GenomeNet

Database: RefSeq
Entry: NC_016775
LinkDB: NC_016775
Original site: NC_016775 
LOCUS       NC_016775            1207451 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Brucella suis VBI22 chromosome II, complete sequence.
ACCESSION   NC_016775
VERSION     NC_016775.1  GI:376277991
DBLINK      Project: 83617
            BioProject: PRJNA83617
KEYWORDS    RefSeq.
SOURCE      Brucella suis VBI22
  ORGANISM  Brucella suis VBI22
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Brucellaceae; Brucella.
REFERENCE   1  (bases 1 to 1207451)
  AUTHORS   Tae,H., Shallom,S., Settlage,R., Hawkins,G.N., Adams,L.G. and
            Garner,H.R.
  TITLE     Complete Genome Sequence of Brucella suis VBI22, Isolated from
            Bovine Milk
  JOURNAL   J. Bacteriol. 194 (4), 910 (2012)
   PUBMED   22275106
REFERENCE   2  (bases 1 to 1207451)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1207451)
  AUTHORS   Tae,H., Shallom,S., Settlage,R., Hawkins,G.N., Adams,L.G. and
            Garner,H.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-NOV-2011) Virginia Bioinformatics Institute, Virginia
            Tech, Washington Street, MC 0477, Blacksburg, VA 24061, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003129.
            DNA material is available from Dr. Gregory Hawkins at Texas Animal
            Health Commission.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1207451
                     /organism="Brucella suis VBI22"
                     /mol_type="genomic DNA"
                     /strain="VBI22"
                     /db_xref="taxon:1112912"
                     /chromosome="II"
     gene            155..1348
                     /gene="repC"
                     /locus_tag="BSVBI22_B0001"
                     /db_xref="GeneID:11685836"
     CDS             155..1348
                     /gene="repC"
                     /locus_tag="BSVBI22_B0001"
                     /note="identified by match to PFAM protein family HMM
                     PF03428"
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepC"
                     /protein_id="YP_005108025.1"
                     /db_xref="GI:376277992"
                     /db_xref="GeneID:11685836"
                     /translation="MEIQLASTPFGSRRMSFALLAAQKKARQIPQGAAADKWQLHRWL
                     CEAKTILGINDRSLAVLSALLSFYPEVTLTGEGNLVVFPSNKQLALRAHGMADATLRR
                     HLAALVEAGLIARQDSPNGKRYARRAKGGELQIAFGFSLAPLLARAPEFEAAAEEIKT
                     AKAQLREMREQLTLLRRDIAKLIEFALIEGLEGPWAHLNQRFRDIVEAIPRRADVQEL
                     AMLVEQMREIRENVDKLLKTNKKAENLSGNESQNERQLNESKPDSHFDETALSHEDQR
                     VFENSQVQKEPSISLDMVLRACPEIETYASGSIRIWQDLIETAGKVRIFLGIDNKLYD
                     MATKTLGIHNAAITIAYILQRYDHIRSAGGYLRILSEKAASGAFSIKPLMMSAMCNRK
                     QPARC"
     misc_feature    155..1345
                     /gene="repC"
                     /locus_tag="BSVBI22_B0001"
                     /note="replication initiation protein RepC; Provisional;
                     Region: PRK13824"
                     /db_xref="CDD:184349"
     misc_feature    191..721
                     /gene="repC"
                     /locus_tag="BSVBI22_B0001"
                     /note="Replication protein C N-terminal domain; Region:
                     RP-C; pfam03428"
                     /db_xref="CDD:251945"
     misc_feature    731..1336
                     /gene="repC"
                     /locus_tag="BSVBI22_B0001"
                     /note="Replication protein C C-terminal region; Region:
                     RP-C_C; pfam11800"
                     /db_xref="CDD:256631"
     gene            complement(1413..1562)
                     /locus_tag="BSVBI22_B0002"
                     /db_xref="GeneID:11685959"
     CDS             complement(1413..1562)
                     /locus_tag="BSVBI22_B0002"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108026.1"
                     /db_xref="GI:376277993"
                     /db_xref="GeneID:11685959"
                     /translation="MPTHGPVCGLIFFSQSSWMLLCSDKWNFHAGARHFKGFPAIYYG
                     FHFVD"
     gene            1551..1814
                     /locus_tag="BSVBI22_B0003"
                     /db_xref="GeneID:11685996"
     CDS             1551..1814
                     /locus_tag="BSVBI22_B0003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108027.1"
                     /db_xref="GI:376277994"
                     /db_xref="GeneID:11685996"
                     /translation="MRRQIACAKSLFHFEPAACMQPALESAAAKTAARLWNVAGLQLK
                     FLCSGRGEQAQEKQDATPDGEHPEYLIGQVVNHVCDPKIDESA"
     gene            1963..2076
                     /locus_tag="BSVBI22_B0004"
                     /db_xref="GeneID:11686017"
     CDS             1963..2076
                     /locus_tag="BSVBI22_B0004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108028.1"
                     /db_xref="GI:376277995"
                     /db_xref="GeneID:11686017"
                     /translation="MRAGLLWQGFLSGFSWVVYENGLAWKFFPFAAMVRQY"
     gene            2092..3033
                     /locus_tag="BSVBI22_B0005"
                     /db_xref="GeneID:11686064"
     CDS             2092..3033
                     /locus_tag="BSVBI22_B0005"
                     /note="similar to GB:M77016, SP:P28289, PID:339948,
                     GB:M77016, SP:P28289, and PID:339948; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase, putative"
                     /protein_id="YP_005108029.1"
                     /db_xref="GI:376277996"
                     /db_xref="GeneID:11686064"
                     /translation="MSHGEAPLKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLG
                     GKGANQAVAVAKLGGAIRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAI
                     IQVEETGQNTIAVCAGANARWSSADIDAYGADIAKARITLLQREVPHEANLAVAKAVR
                     AAGGTVLLDPAPVGDASQMADLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLL
                     ERGPKIVILKLGSRGALLVTADEVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPL
                     HDCVRYGSAAGAIAVTRVGAGAAAPTAREVEELIGRA"
     misc_feature    2116..2997
                     /locus_tag="BSVBI22_B0005"
                     /note="Ribokinase catalyses the phosphorylation of ribose
                     to ribose-5-phosphate using ATP. This reaction is the
                     first step in the ribose metabolism. It traps ribose
                     within the cell after uptake and also prepares the sugar
                     for use in the synthesis of nucleotides...; Region:
                     ribokinase; cd01174"
                     /db_xref="CDD:238579"
     misc_feature    order(2140..2142,2146..2148,2221..2229,2236..2238,
                     2392..2394,2398..2400,2428..2430,2434..2436,2527..2529,
                     2857..2862,2869..2871,2977..2979)
                     /locus_tag="BSVBI22_B0005"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238579"
     misc_feature    order(2149..2151,2155..2157,2170..2190,2227..2229,
                     2389..2391,2395..2403,2419..2442,2605..2607)
                     /locus_tag="BSVBI22_B0005"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238579"
     misc_feature    order(2665..2667,2773..2781,2788..2790,2827..2829,
                     2845..2847,2854..2856,2863..2868,2875..2877,2941..2943,
                     2950..2955,2962..2964)
                     /locus_tag="BSVBI22_B0005"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238579"
     gene            complement(3110..4108)
                     /gene="iunH"
                     /locus_tag="BSVBI22_B0006"
                     /db_xref="GeneID:11686066"
     CDS             complement(3110..4108)
                     /gene="iunH"
                     /locus_tag="BSVBI22_B0006"
                     /note="identified by match to PFAM protein family HMM
                     PF01156"
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-uridine preferring nucleoside hydrolase"
                     /protein_id="YP_005108030.1"
                     /db_xref="GI:376277997"
                     /db_xref="GeneID:11686066"
                     /translation="MLSKHAVSCAIPSQRTHQETTMARKIIIDTDPGQDDAVAILLAL
                     ASPELDILGITAVAGNGPLARTEVNARTVCEVAKKPDTKVFAGSIRPLVRPLVTAENV
                     HGKTGLDGYDLPAPTMPLQAQHGVDFIIETLMKEEPGTVTLCPIGPLTNIASALIREP
                     KIAGRVKEIVLMGGGYFEGGNITPSAEFNIYVDPHAASVVFSSGIKITMLPLDVTHKV
                     LTTEKRIAAIRNIGSHVGEVVAAWLEFFERYDEAKYGTDGAPLHDPNVIAYLIKPELY
                     SGRACNVEIEINSELTIGETVVDWWEVTDRPKNAFFIKDVDADGFFSLLTERLATL"
     misc_feature    complement(3122..4036)
                     /gene="iunH"
                     /locus_tag="BSVBI22_B0006"
                     /note="nuc_hydro_IU_UC_XIUA: inosine-uridine preferring,
                     xanthosine-inosine-uridine-adenosine-preferring and,
                     uridine-cytidine preferring nucleoside hydrolases.
                     Nucleoside hydrolases cleave the N-glycosidic bond in
                     nucleosides generating ribose and the...; Region:
                     nuc_hydro_IU_UC_XIUA; cd02651"
                     /db_xref="CDD:239117"
     misc_feature    complement(order(3320..3322,3542..3544,3548..3550,
                     3566..3568,3671..3673,3803..3805,3929..3931,4001..4006,
                     4016..4018))
                     /gene="iunH"
                     /locus_tag="BSVBI22_B0006"
                     /note="active site"
                     /db_xref="CDD:239117"
     misc_feature    complement(order(3233..3235,3242..3247,3251..3253,
                     3512..3514,3638..3640,3833..3835))
                     /gene="iunH"
                     /locus_tag="BSVBI22_B0006"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239117"
     gene            complement(4131..5042)
                     /locus_tag="BSVBI22_B0007"
                     /db_xref="GeneID:11686068"
     CDS             complement(4131..5042)
                     /locus_tag="BSVBI22_B0007"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00023"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005108031.1"
                     /db_xref="GI:376277998"
                     /db_xref="GeneID:11686068"
                     /translation="MTTVLAQILDPHFIGTILRVATPLLLAALGVMISDRAGVLNIGM
                     EGMMLVAALIAVLASAATGSPAVGLLAALVVGALLGWLMSLSVNRLGTDLIMTGIALN
                     IAAAAATTLGLYLATGDKGMSGALKSGALPSLAVPFIGNIHVLTFAALLAVPAVSLLM
                     MRTRFGLHLRATGVDPKSARAAGIQTGRVQMMALILSGLFGGAAGAYLSLGYVTWFAQ
                     NMTAGRGFIAIAAEVMGQGTAWGTLVASLVLAAAESIAITLQSLGLPFELMQMIPYLV
                     PVIVLTVHAARRQRRARRQITPETQET"
     misc_feature    complement(4200..4982)
                     /locus_tag="BSVBI22_B0007"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(4458..4514)
                     /locus_tag="BSVBI22_B0007"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(5039..6118)
                     /locus_tag="BSVBI22_B0008"
                     /db_xref="GeneID:11686070"
     CDS             complement(5039..6118)
                     /locus_tag="BSVBI22_B0008"
                     /note="similar to GP:13022200, and GP:17134506; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005108032.1"
                     /db_xref="GI:376277999"
                     /db_xref="GeneID:11686070"
                     /translation="MRRFIAYLIPFFLTVLVIGVIMAVLLVPLALMQDNPAAILKTFF
                     LGPFGSIRHMGNVVEAATPIMLTGLAITILFRSGLFNLGAESGFFLGALGAVAGAVLL
                     PSLGWFSLPVAILCGAVAGSFACTIPAALRLRFGASEMVTSLVLNYAFLFLGLFVLNY
                     VIRDPNAGGMMSLRIPADAKLDRLLAGTRLNSGSIIAVLACIAGGIWLYWTRSGLNIR
                     IAGSSPGFANHLGLPLKGIIMRAQIVGGLVAGMAGALEVLGLHARFAWLDLPGYGWTG
                     LVVAILARENPFLLIPSALFLGFVQVGGDLLARNMNIPTEVVGLVTAAIMVGATASVI
                     HNHPTVLRLIRSLRNRDGEQAGVQA"
     misc_feature    complement(5138..5938)
                     /locus_tag="BSVBI22_B0008"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(5390..5446)
                     /locus_tag="BSVBI22_B0008"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(6180..7751)
                     /locus_tag="BSVBI22_B0009"
                     /db_xref="GeneID:11686072"
     CDS             complement(6180..7751)
                     /locus_tag="BSVBI22_B0009"
                     /note="similar to GP:13162075, GB:X52974, SP:P40598, and
                     PID:48736; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_005108033.1"
                     /db_xref="GI:376278000"
                     /db_xref="GeneID:11686072"
                     /translation="MEKQAETSEGGDAIVAFRPIVAFRDVSKIYPNGTVALRDVSFSI
                     RAGSIHAICGENGAGKSTLMKILFGIENATAGEIVVDGKHIASWSPEDAAAQGIGMVH
                     QHFSLVPTLTVTENIILGHEPVKAGLIDRAGARKMVETLMQQYDLHADPDAITGTLSV
                     AAQQKVEILKALARRTRLLILDEPTAVLSPPEIEELMRRLKSLRDDGITILFISHKLN
                     EVRELAESVTVLRAGAVAGTEKLADVPDDAIMQMVMGHAVDIPKRAHQRGPGRTVLEM
                     KDVTTAAPDPADRIRNVSLTIGAGEIIGVAGVDGSGQRGLVSVLSGLAVAASGTISLN
                     GVDMLRADTASWRKKGLAYLPADRFSQGGAPGLSLAENAIAGAGSVTADRQIFRGPFL
                     RWSAIKARVSGMIRQYSVRAGAITERLDSLSGGNAQKLIAARELATNPKFLIADQPTR
                     GIDVSAAAFLHRRIDEVAQGGCAVLLVSADLDELLRLSDHIVVLFNGRIATILDNGPE
                     ITPAVLGPYMLGTRA"
     misc_feature    complement(6192..7700)
                     /locus_tag="BSVBI22_B0009"
                     /note="ABC-type uncharacterized transport systems, ATPase
                     components [General function prediction only]; Region:
                     COG3845"
                     /db_xref="CDD:226364"
     misc_feature    complement(7038..7691)
                     /locus_tag="BSVBI22_B0009"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(7569..7592)
                     /locus_tag="BSVBI22_B0009"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(7107..7109,7203..7208,7443..7445,
                     7566..7574,7578..7583))
                     /locus_tag="BSVBI22_B0009"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(7443..7454)
                     /locus_tag="BSVBI22_B0009"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(7251..7280)
                     /locus_tag="BSVBI22_B0009"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(7203..7220)
                     /locus_tag="BSVBI22_B0009"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(7185..7196)
                     /locus_tag="BSVBI22_B0009"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(7101..7121)
                     /locus_tag="BSVBI22_B0009"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(6255..6944)
                     /locus_tag="BSVBI22_B0009"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            complement(7754..8860)
                     /locus_tag="BSVBI22_B0010"
                     /db_xref="GeneID:11686152"
     CDS             complement(7754..8860)
                     /locus_tag="BSVBI22_B0010"
                     /note="similar to GP:11065692; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="Bmp family lipoprotein"
                     /protein_id="YP_005108034.1"
                     /db_xref="GI:376278001"
                     /db_xref="GeneID:11686152"
                     /translation="MIKSTRRGIIHLAFALAASTAIGTFATSAAEAKDKIMLIVNGTL
                     GDKSFFDSAANGMKMIKDKYGDEVETRILEIGDDPTKWEPVLLDASEQDWDLIIAGTY
                     QMAETVGSVAQQYPDKKYILYDASVPYEEGGYDNVYSIQYKQNEGSYLGGLLAASLLK
                     EGKLGDGAKNLGFLGGMDIPVINDFLVGYIAGAQSVIPDAKIAVSYAGSFMDAAKGKE
                     LGLAQYRSGVSLGFVVASQTGLGQLSAAKETGKYVLGVDSDQEAIFKDSDPAIAKQVV
                     SSVLKNIDVSLLQAYERYKAGNLPFGKAEALGLKEGAVGIVQDGNMATMATPDIKDAI
                     KKASDEISEGKITVPTAFGMSTEDLNAIRNKVRP"
     misc_feature    complement(7913..8758)
                     /locus_tag="BSVBI22_B0010"
                     /note="Periplasmic binding domain of basic membrane
                     lipoprotein, PnrA, in Treponema pallidum and its homologs
                     from other bacteria and Archaea; Region:
                     PBP1_BmpA_PnrA_like; cd06354"
                     /db_xref="CDD:107349"
     misc_feature    complement(order(8018..8020,8090..8092,8153..8155,
                     8231..8233,8315..8317,8489..8491,8711..8713,8738..8740))
                     /locus_tag="BSVBI22_B0010"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107349"
     gene            9104..9712
                     /locus_tag="BSVBI22_B0011"
                     /db_xref="GeneID:11686153"
     CDS             9104..9712
                     /locus_tag="BSVBI22_B0011"
                     /note="similar to GP:15141208, and GP:15141208; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108035.1"
                     /db_xref="GI:376278002"
                     /db_xref="GeneID:11686153"
                     /translation="MRKAAVLSVLGFLAASQVMVENGWAEDGWKAVEIVKPYAIAGTT
                     PPELYESIGARGPKIGERRVIAHTSYVLTWDREFDRSNGACTVVSATPRLRITYTLPN
                     PSQTLAPPVKERWDRFYDGIRRHELVHGDHAKAMTREIVRRTVGLSVPNDPKCRKIRK
                     VLAKEITDMVQVQRAQGRDFDHVEMGNGGNVQQLILTFLNGN"
     misc_feature    9104..9709
                     /locus_tag="BSVBI22_B0011"
                     /note="Predicted secreted Zn-dependent protease
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG5664"
                     /db_xref="CDD:227951"
     gene            complement(9684..10316)
                     /locus_tag="BSVBI22_B0012"
                     /db_xref="GeneID:11686154"
     CDS             complement(9684..10316)
                     /locus_tag="BSVBI22_B0012"
                     /note="similar to GP:15158815, and GP:6018425; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin synthetase subunit D"
                     /protein_id="YP_005108036.1"
                     /db_xref="GI:376278003"
                     /db_xref="GeneID:11686154"
                     /translation="MARYSASKPLIDPSIPAPARAAPRRKAEFVAGQACAREALRLAG
                     GPAVMPGRGDDHAPIWPPGMVGSISHSKGCAIAVAARQSRYLGLGIDIERLQTESSAR
                     KIAPQILGESELRQLPEAGRAFLVSLAFSAKESLFKALYPAVQQFQSFHAAAFSFDGD
                     RQQACLELAVDWSAQWRRGQRFPIRFFCRDGFILTCTAIAAISCRSEMSG"
     misc_feature    complement(9720..>10241)
                     /locus_tag="BSVBI22_B0012"
                     /note="Phosphopantetheinyl transferase component of
                     siderophore synthetase [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: EntD;
                     COG2977"
                     /db_xref="CDD:225524"
     misc_feature    complement(<9894..10058)
                     /locus_tag="BSVBI22_B0012"
                     /note="4'-phosphopantetheinyl transferase superfamily;
                     Region: ACPS; pfam01648"
                     /db_xref="CDD:250768"
     gene            complement(10399..11175)
                     /gene="entA"
                     /locus_tag="BSVBI22_B0013"
                     /db_xref="GeneID:11686155"
     CDS             complement(10399..11175)
                     /gene="entA"
                     /locus_tag="BSVBI22_B0013"
                     /note="catalyzes the formation of 2,3-dihydroxybenzoate
                     from 2,3-dihydro-2,3-dihydroxybenzoate; involved in the
                     biosynthesis of siderophores, enterobactin, bacillibactin
                     or vibriobactin"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-dihydroxybenzoate-2,3-dehydrogenase"
                     /protein_id="YP_005108037.1"
                     /db_xref="GI:376278004"
                     /db_xref="GeneID:11686155"
                     /translation="MVEAKSYPASWRFAGKRVIVTGAAQGIGRRVAERFLAEGATVIG
                     LDRQAGEADAPFRLIRLDITDAAEVRAVSDGLKAEGKPLDILVNVAGVLKLGNSDRLS
                     AEDWKTCMDVNASGPFHLLSQWVPVFRDQRHGAIVNVASNAAHVPRLNMAAYCASKAA
                     LASFSHCVALELAPYGVRCNVVSPGSTRTAMLGAMLNDPSGEAQLVRGLPEQFKLGIP
                     LGKIAMPDDIANVILFLASDQAGHVTMQDIVVDGGATLGA"
     misc_feature    complement(10402..11154)
                     /gene="entA"
                     /locus_tag="BSVBI22_B0013"
                     /note="2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated;
                     Region: PRK08220"
                     /db_xref="CDD:236190"
     misc_feature    complement(10402..11124)
                     /gene="entA"
                     /locus_tag="BSVBI22_B0013"
                     /note="2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases,
                     classical (c) SDRs; Region: DH-DHB-DH_SDR_c; cd05331"
                     /db_xref="CDD:187592"
     misc_feature    complement(order(10606..10611,10615..10626,10702..10704,
                     10714..10716,10753..10761,10840..10842,10903..10911,
                     10987..10995,11032..11040,11095..11106,11110..11112))
                     /gene="entA"
                     /locus_tag="BSVBI22_B0013"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187592"
     misc_feature    complement(order(10702..10704,10714..10716,10753..10755,
                     10837..10839))
                     /gene="entA"
                     /locus_tag="BSVBI22_B0013"
                     /note="active site"
                     /db_xref="CDD:187592"
     gene            complement(11175..12047)
                     /gene="entB"
                     /locus_tag="BSVBI22_B0014"
                     /db_xref="GeneID:11686156"
     CDS             complement(11175..12047)
                     /gene="entB"
                     /locus_tag="BSVBI22_B0014"
                     /note="identified by match to PFAM protein family HMM
                     PF00550"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase"
                     /protein_id="YP_005108038.1"
                     /db_xref="GI:376278005"
                     /db_xref="GeneID:11686156"
                     /translation="MAIPKIADYPMPQKAGFPANKTNWQPDPARAVLLIHDMQRYFLR
                     FYDANGPLMGDLIGNLVRLRNWAHKNGVPVVYTAQPHEQPAGDRALLNDMWGPGLPAA
                     APEQQLIVDKLTPGATDTVLAKWRYSAFQRSDLLQRMKDWNRDQLIIGGIYAHIGCMV
                     TAIDAFMNDIQPFMVGDAVADFSEEEHRLALKYVATRCGAVIDTASLIRKPATETTRD
                     WLQKRVLELIEDETELDPQENLILYGLDSLQVMKLSAELKERGVAVGFDDLARVPTLA
                     AWGDLIETKQKAAA"
     misc_feature    complement(11433..12044)
                     /gene="entB"
                     /locus_tag="BSVBI22_B0014"
                     /note="Isochorismatase, also known as 2,3 dihydro-2,3
                     dihydroxybenzoate synthase, catalyses the conversion of
                     isochorismate, in the presence of water, to
                     2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of
                     a vinyl ether, an uncommon reaction in biological...;
                     Region: isochorismatase; cd01013"
                     /db_xref="CDD:238495"
     misc_feature    complement(order(11502..11504,11580..11582,11589..11591,
                     11667..11669,11763..11765,11922..11924,12039..12041))
                     /gene="entB"
                     /locus_tag="BSVBI22_B0014"
                     /note="hydrophobic substrate binding pocket; other site"
                     /db_xref="CDD:238495"
     misc_feature    complement(order(11577..11579,11589..11591,11676..11678,
                     11784..11786,11811..11813,11937..11939))
                     /gene="entB"
                     /locus_tag="BSVBI22_B0014"
                     /note="active site"
                     /db_xref="CDD:238495"
     misc_feature    complement(11589..11594)
                     /gene="entB"
                     /locus_tag="BSVBI22_B0014"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238495"
     misc_feature    complement(11178..11390)
                     /gene="entB"
                     /locus_tag="BSVBI22_B0014"
                     /note="Aryl carrier domain [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: COG3433"
                     /db_xref="CDD:225967"
     gene            complement(12099..13718)
                     /gene="entE"
                     /locus_tag="BSVBI22_B0015"
                     /db_xref="GeneID:11686157"
     CDS             complement(12099..13718)
                     /gene="entE"
                     /locus_tag="BSVBI22_B0015"
                     /note="bifunctional 2,3-dihydroxybenzoate-AMP
                     ligase/S-dihydroxybenzoyltransferase; activates the
                     carboxylate group of 2,3-dihydroxy-benzoate forming
                     (2,3-dihydroxybenzoyl)adenylate then catalyzes the
                     acylation of holo-entB with 2,3-dihydroxy-benzoate
                     adenylate"
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin synthase subunit E"
                     /protein_id="YP_005108039.1"
                     /db_xref="GI:376278006"
                     /db_xref="GeneID:11686157"
                     /translation="MTIEFTHWPPARERLYREKGYWIDKPLTRALEEQAAMRPDAPTI
                     LCGERRFTYAELDRLSSNLASRLAAAGIGKGDTALVQLPNIAEFYIVFFALMKAGIAP
                     VNALFSHRKLELGAYASQIEPRLLIGSRQHELFMDDAFARDLGKNLSAPLLTLFAGEA
                     DPASSLDHWIATPADKAVPFSPTGAGEVAFFQLSGGSTGTPKLIPRTHNDYDYSVRAS
                     AEICALTPQTRFLCALPTAHNYPMSSPGALGVFHAGGCVVMASNPEPLNCFSIIERHG
                     VNMVALVPPAVALWLQATPDHLAALSSLKLVQVGGASFAEALARQVPQVLGCKLQQVF
                     GMAEGLVNYTRLDDPDEIVFTTQGRPISPDDEIRIVDEDGEPVAEGQPGMLATRGPYT
                     FCGYYRNPEHNAQVFDSEGFYYSGDVVQRTPEGYLRVVGRVKDQINRGGEKVAAEEIE
                     NLILLHPDVTHAALVAMQDELLGEKSCAFIVSRNPDLKPPVLRRHLLALGVAEYKLPD
                     RIRLIETMPLTAVGKIDKKHLRKLSSPSSPG"
     misc_feature    complement(12102..13718)
                     /gene="entE"
                     /locus_tag="BSVBI22_B0015"
                     /note="enterobactin synthase subunit E; Provisional;
                     Region: entE; PRK10946"
                     /db_xref="CDD:236803"
     misc_feature    complement(12132..13673)
                     /gene="entE"
                     /locus_tag="BSVBI22_B0015"
                     /note="2,3-dihydroxybenzoate-AMP ligase; Region:
                     23DHB-AMP_lg; cd05920"
                     /db_xref="CDD:213287"
     misc_feature    complement(order(13113..13118,13122..13139,13146..13148))
                     /gene="entE"
                     /locus_tag="BSVBI22_B0015"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213287"
     misc_feature    complement(order(12150..12152,12423..12425,12432..12434,
                     12468..12470,12474..12476,12696..12698,12708..12722,
                     12780..12788,12987..12989,12999..13007,13131..13139))
                     /gene="entE"
                     /locus_tag="BSVBI22_B0015"
                     /note="active site"
                     /db_xref="CDD:213287"
     misc_feature    complement(order(12150..12152,12423..12425,12432..12434,
                     12468..12470,12474..12476,12711..12722,12783..12788,
                     13131..13139))
                     /gene="entE"
                     /locus_tag="BSVBI22_B0015"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213287"
     misc_feature    complement(order(12150..12152,12696..12698,12708..12716,
                     12720..12722,12786..12788,12987..12989,12999..13007))
                     /gene="entE"
                     /locus_tag="BSVBI22_B0015"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213287"
     gene            complement(13825..15000)
                     /gene="entC"
                     /locus_tag="BSVBI22_B0016"
                     /db_xref="GeneID:11686158"
     CDS             complement(13825..15000)
                     /gene="entC"
                     /locus_tag="BSVBI22_B0016"
                     /note="synthesizes isochorismate acid from chorismate"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase"
                     /protein_id="YP_005108040.1"
                     /db_xref="GI:376278007"
                     /db_xref="GeneID:11686158"
                     /translation="MRTSALKYPTSDADHLIKNNTDFSFASGNLKLAASGMREVIATP
                     AIGGSNPDSTFQRAIAQAFERAARAGQRNPIVVGAIPFDPGEPSCLYVPEEMDWQERE
                     PASGASAAAMPQLAGQRSVPDEAGFKHAVEHAIINFRLSDVRKAVLSVMRELTFADDI
                     DVDAMLANLRAQNHDGYQFRVPLPGGGALVGVSPELLIHKDKGKIVSNPLAGSAKRMA
                     DPEADRKNADRLAKSEKDHYEHRLVIEDIRARLQPICTELDIPERPSLIHTAALWHLS
                     TRIEGRLHDPDMTALQLACLIHPTPAVCGFPTERARRLIRFVEPFERGLFTGMVGWSD
                     AEGNGEWVVTIRCGTVKGNLVRLFAGAGIVEASSPDSEWAEVQTKLGTMLRACGLSA"
     misc_feature    complement(13828..15000)
                     /gene="entC"
                     /locus_tag="BSVBI22_B0016"
                     /note="Isochorismate synthase [Coenzyme metabolism /
                     Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: MenF; COG1169"
                     /db_xref="CDD:224091"
     misc_feature    complement(13840..14781)
                     /gene="entC"
                     /locus_tag="BSVBI22_B0016"
                     /note="isochorismate synthases; Region: isochor_syn;
                     TIGR00543"
                     /db_xref="CDD:233014"
     gene            15072..16481
                     /locus_tag="BSVBI22_B0017"
                     /db_xref="GeneID:11686159"
     CDS             15072..16481
                     /locus_tag="BSVBI22_B0017"
                     /note="similar to GP:13959028, and GP:1778502; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin synthetase, component F, putative"
                     /protein_id="YP_005108041.1"
                     /db_xref="GI:376278008"
                     /db_xref="GeneID:11686159"
                     /translation="MVPICQPGDWPTLNEACRAERNEMARIDFADGWMPLTLPQLDFW
                     EEFSFHPDQPVSTVAHCVEIEGDVDVEKLLRAISQTVREAEVLSIRFSDEKEQGRPVQ
                     LCDPAHMPDVDFVDLSAFPDPRAEAGRRMETDLSAPLDLRRDRMSAHALYRIGARQYI
                     WYIRAHHIIIDGYGLALIEQRCGQLYSHFCGQGESGHPFHPFASFIHEEDAYRASPRW
                     EADRKFWQDYLDGPVRLPILDRGAEDYGEAGYHHDVAFRDDISIGLRAMAKATDIGWP
                     DLLVLLSGLYLSRMLPMQGEDEGLTLWLPFMSRWGSVGAHMPGLLVNILPFHLEFDSG
                     ETLFSALRRNMDMLKKHRLHGRYRIEQISADRGLVSGSRFFFSPLINVLPFSTPQFAG
                     CRVAREVLANGPGDGFNLTYRADVDGAGLTLKIEAASNMMDAQTFARIAAGLPAFLKA
                     SLAPHLIERPVSDLRRRLP"
     misc_feature    15174..16067
                     /locus_tag="BSVBI22_B0017"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     gene            complement(16529..17317)
                     /locus_tag="BSVBI22_B0018"
                     /db_xref="GeneID:11686160"
     CDS             complement(16529..17317)
                     /locus_tag="BSVBI22_B0018"
                     /note="identified by match to PFAM protein family HMM
                     PF00174"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, molybdopterin-binding protein"
                     /protein_id="YP_005108042.1"
                     /db_xref="GI:376278009"
                     /db_xref="GeneID:11686160"
                     /translation="MTGPRLSRRRFLTFTGMAGSAVLLSGCDAFDYLGSDDNAVRQVL
                     EKANDLSYTVQRKLEGPGALAREYGESEIRQGQKPNGETNPSTEEYDRLRENAFADYR
                     LEVHGLVEKPLSFSLNELHNMPARTQITRHDCVEGWSTIAKWTGVPLGHILALAKPKA
                     GAHYVVFHCFDEVDTPQGPDLFYGSIDLIDAQHPQTILAYGLNGSALPVANGAPLRVR
                     VERQLGYKMSKYVKSIELVSSFAAIQGGRGGYWEDQGYDWYGGI"
     misc_feature    complement(16532..17305)
                     /locus_tag="BSVBI22_B0018"
                     /note="Sulfite oxidase and related enzymes [General
                     function prediction only]; Region: COG2041"
                     /db_xref="CDD:224952"
     misc_feature    complement(16538..17083)
                     /locus_tag="BSVBI22_B0018"
                     /note="Sulfite oxidase (SO) family, molybdopterin binding
                     domain. This molybdopterin cofactor (Moco) binding domain
                     is found in a variety of oxidoreductases, main members of
                     this family are nitrate reductase (NR) and sulfite oxidase
                     (SO). SO catalyzes the...; Region: SO_family_Moco;
                     cl00199"
                     /db_xref="CDD:260254"
     misc_feature    complement(order(16628..16633,16637..16639,16646..16648,
                     16670..16672,16685..16687,16772..16774,16916..16918,
                     17039..17041,17045..17047,17051..17053))
                     /locus_tag="BSVBI22_B0018"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:238198"
     misc_feature    complement(16916..16918)
                     /locus_tag="BSVBI22_B0018"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:238198"
     gene            complement(17314..18123)
                     /locus_tag="BSVBI22_B0019"
                     /db_xref="GeneID:11686161"
     CDS             complement(17314..18123)
                     /locus_tag="BSVBI22_B0019"
                     /note="identified by match to PFAM protein family HMM
                     PF01292"
                     /codon_start=1
                     /transl_table=11
                     /product="HupC/HyaC/HydC family protein"
                     /protein_id="YP_005108043.1"
                     /db_xref="GI:376278010"
                     /db_xref="GeneID:11686161"
                     /translation="MGQLIYRQRLLTRLTHWIWAASIFFLLLSGLQIFNAHPTLYLGN
                     ESGFEYENAVLSIYAVPGDNGPQGRLDILGKTFDTTGVLGVSGTMETPRRQAFPPALT
                     IPSYRDLATGRVVHFFFAWVLVATLLLWFTSSLFNGHLKDISPSFTDIRSLPRDFVEH
                     LKFRFQHGKSYNPLQKLSYFLVLFGLFPLIVATGLAMSPGADSILPLSEWLGGRQTAR
                     TLHFVAMLLLVAFFIVHIAMVLAAGPFNELRSMISGWYRIDRTDEKTEKQS"
     misc_feature    complement(17350..18006)
                     /locus_tag="BSVBI22_B0019"
                     /note="Thiosulfate reductase cytochrome B subunit
                     (membrane anchoring protein) [Energy production and
                     conversion]; Region: COG4117"
                     /db_xref="CDD:226602"
     misc_feature    complement(17362..>17802)
                     /locus_tag="BSVBI22_B0019"
                     /note="Cytochrome b(N-terminal)/b6/petB; Region:
                     Cytochrom_B_N; pfam00033"
                     /db_xref="CDD:249526"
     gene            complement(18184..18405)
                     /locus_tag="BSVBI22_B0020"
                     /db_xref="GeneID:11686162"
     CDS             complement(18184..18405)
                     /locus_tag="BSVBI22_B0020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108044.1"
                     /db_xref="GI:376278011"
                     /db_xref="GeneID:11686162"
                     /translation="MTIKHNIIAFSALALIAGFSLTPAAFAEDAMKTDHMKPDAMKSD
                     NMSKDAMHKDSKKMKKHDAMKGDAMKSGQ"
     misc_feature    complement(18196..18378)
                     /locus_tag="BSVBI22_B0020"
                     /note="pentapeptide MXKDX repeat protein; Region:
                     penta_MxKDx; TIGR02953"
                     /db_xref="CDD:131998"
     gene            18590..19114
                     /locus_tag="BSVBI22_B0021"
                     /db_xref="GeneID:11686163"
     CDS             18590..19114
                     /locus_tag="BSVBI22_B0021"
                     /note="similar to GP:15157424; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma factor"
                     /protein_id="YP_005108045.1"
                     /db_xref="GI:376278012"
                     /db_xref="GeneID:11686163"
                     /translation="MKALMLLALDGNSAAYRTLLEELSRLLKAYFVRRLFGGRVSEAE
                     DLVQETLLAIHTRRMTYDREMTFLPWVNAIARHKLVDHLRRQGRHDTDVLDEDIAIPG
                     EAANVEARMDVDRMLGGVSERTAGLIRKVKIEGQSIDEAARAGDMSQSAVKVAIHRGL
                     ATLAQRFGGKKDDR"
     misc_feature    18590..19102
                     /locus_tag="BSVBI22_B0021"
                     /note="RNA polymerase sigma factor; Provisional; Region:
                     PRK12539"
                     /db_xref="CDD:237132"
     misc_feature    18644..18853
                     /locus_tag="BSVBI22_B0021"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    18917..19078
                     /locus_tag="BSVBI22_B0021"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cl17257"
                     /db_xref="CDD:266592"
     gene            19104..19739
                     /locus_tag="BSVBI22_B0022"
                     /db_xref="GeneID:11686164"
     CDS             19104..19739
                     /locus_tag="BSVBI22_B0022"
                     /note="similar to GP:15157423, and GP:15157423; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108046.1"
                     /db_xref="GI:376278013"
                     /db_xref="GeneID:11686164"
                     /translation="MTDDLINRLTGELKPVSRHAMQRLLLGHALLGMVAGVVIMLAFL
                     GARHDLAAAMAPPAFWSKLCYAALLLAVLLPALFALSRPLRQNLPWPALLLIFSCLGA
                     AAIYQWEEASPEVRPVLVWGYTALVCPWLIGLISLPTLASLLLAIRKLAPARPTLAGF
                     AAGLVSGGIGVLVYAFHCPESGLPFIALWYTLGIVGTGVLGALGGRFCLRW"
     misc_feature    19107..19736
                     /locus_tag="BSVBI22_B0022"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4944"
                     /db_xref="CDD:227280"
     gene            complement(19785..20525)
                     /locus_tag="BSVBI22_B0023"
                     /db_xref="GeneID:11686165"
     CDS             complement(19785..20525)
                     /locus_tag="BSVBI22_B0023"
                     /note="similar to GP:14523197; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005108047.1"
                     /db_xref="GI:376278014"
                     /db_xref="GeneID:11686165"
                     /translation="MKEIATRAAGRATGHLPEEIARQIEKRILDGEFSVGSKLPSERE
                     LSVEYGVSRPVVREALSQLKLDGLVEARAGSGVFVIDESNQKAFRIQPLVVEEAQSLE
                     QLMELLVAIEVAATRIAAVNRTPEDLKQIKRALIGLEYAIISDKLGDEEDYAFHDAIV
                     IATHNPHFIALCKHLEYGARHVIRQARTNTRSNLKDMLDAVQDEHKAIYEAIELGDPE
                     QAGIAAERHLRNATQRMKVYLSADNRTN"
     misc_feature    complement(19791..20507)
                     /locus_tag="BSVBI22_B0023"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(20289..20480)
                     /locus_tag="BSVBI22_B0023"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(20295..20306,20310..20315,20343..20345,
                     20352..20357,20361..20375,20397..20402,20406..20408,
                     20475..20477))
                     /locus_tag="BSVBI22_B0023"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(19836..20219)
                     /locus_tag="BSVBI22_B0023"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            20643..22058
                     /locus_tag="BSVBI22_B0024"
                     /db_xref="GeneID:11686166"
     CDS             20643..22058
                     /locus_tag="BSVBI22_B0024"
                     /note="similar to GB:Z11566, GB:J04991, GB:X53305,
                     GB:M31303, GB:D28428, GB:X94912, SP:P16949, PID:1246757,
                     PID:189388, PID:189426, PID:35595, and PID:57870;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="branched chain amino acid ABC transporter,
                     periplasmic amino acid-binding protein, putative"
                     /protein_id="YP_005108048.1"
                     /db_xref="GI:376278015"
                     /db_xref="GeneID:11686166"
                     /translation="MGNTGDKYRILAFNINDISRYQDWSYFSIDWSYQYGVGILSTGR
                     HGKPSKSSGGKMSLKVFLQAGVACAALSLAGAAGASAEPLKIALVETLSGPQASTGLL
                     YRAAVLYQLGKINEAGGFNGEKIQILEYDNQGGPVGAADRVKAAIADGAQIIVQGSSS
                     AVAGQITEDVRKYNLRNKGKEVLYLNLGAEALELTGSKCHFYHFRFSPNAAIRFKTVA
                     QGMKDKGILGERAYSINQNYSWGVDVENTVVANAKEIGYEVVDKTLHEVNKIQDFSPY
                     VAKIQAANVDTVFTGNWSNDLLLLMKAASGAGLKAKFATSFLDQPGNIGNAGAIAEGH
                     IVSTPFNPEANGEASMAFAEDYKKVTGHYPSYVEPAAVFGLQLFGEALKNVKPGEGKI
                     NTTDIALAIENASVKTPMGDYSMRSDDHQAKFPMVVQEVSKKARIKADGTEYGFLPFK
                     TFTGDESIDPVQESCSMKRPG"
     misc_feature    20895..21926
                     /locus_tag="BSVBI22_B0024"
                     /note="Periplasmic solute-binding domain of active
                     transport proteins; Region: PBP1_SBP_like_3; cd06329"
                     /db_xref="CDD:107324"
     misc_feature    order(21114..21122,21204..21212,21360..21362,21519..21521,
                     21591..21593)
                     /locus_tag="BSVBI22_B0024"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107324"
     gene            22100..23089
                     /locus_tag="BSVBI22_B0025"
                     /db_xref="GeneID:11686167"
     CDS             22100..23089
                     /locus_tag="BSVBI22_B0025"
                     /note="similar to GP:15076000; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter,
                     permease protein"
                     /protein_id="YP_005108049.1"
                     /db_xref="GI:376278016"
                     /db_xref="GeneID:11686167"
                     /translation="MDRSPVRAELPITDQTMDQILFAVLNGAIYGLLLFMVSAGLTLI
                     FGMMGVLNFAHASFYMMGAYFAYTLQPLTGFWLAILIAPVIVGIVGVLVERFILRRVH
                     AFGHAHELLVTFGLSVVIAEVIKIFYGNFAVEYRIPAALQFSAFDLGGVSYPFYRLFI
                     GAVALVMFLLIYLLLTRTRIGIVVRSAIYRPRMVEALGHNVPLVFMGVFGVGAFLAGL
                     AGSVAGAFYTTNPNMALELGVMVFVVVVVGGLGSLGGAMFASLLIGILSSVAVGVKVS
                     IASLLDYVGLGDYAREIGGVLTLEVSSIAATLPFFLMLIVLLVRPSGLFGAKE"
     misc_feature    22178..23074
                     /locus_tag="BSVBI22_B0025"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    22673..22729
                     /locus_tag="BSVBI22_B0025"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            23093..24313
                     /locus_tag="BSVBI22_B0026"
                     /db_xref="GeneID:11686168"
     CDS             23093..24313
                     /locus_tag="BSVBI22_B0026"
                     /note="similar to GB:M93015, SP:P29916, and PID:150623;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter,
                     permease protein"
                     /protein_id="YP_005108050.1"
                     /db_xref="GI:376278017"
                     /db_xref="GeneID:11686168"
                     /translation="MTIKQSVVALLVVALLVALPYLVSESMTNAAIQMLIAALFATAF
                     SLLCGQAGMLPFGHAAYFGLGSFAAVHAMNAFGGEGLLPTPLLPLAGAGVGLLSGLVA
                     GWFSTKRTGVYFAMITLALAELLHALAPHLKGTFGGEAGVSSFRMPAWGFDFGSTTEV
                     YYLALAWVVGSILLLFLLTLTPFGRVTVGLRENTHRLRFLGYNVHVLGTLVFAISAMF
                     AGIAGALQAINIEAANYVVFEAGISTAVVLNSFIGGVGTFFGPAIGAAAMTFFGHVTS
                     DVTRSWLLYQGLIFVLVMMFLPRGLVGEAVECFRNPKGTGISLGHALGRLVALLVTAA
                     GTIMIVELVQRFFSGDYKALASAGNWPPVTFLGREWLPFAVSTWLIPLALFAAGIALL
                     TIVNRHRAKAKGEA"
     misc_feature    23192..24001
                     /locus_tag="BSVBI22_B0026"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    23675..23731
                     /locus_tag="BSVBI22_B0026"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            24313..25065
                     /locus_tag="BSVBI22_B0027"
                     /db_xref="GeneID:11686169"
     CDS             24313..25065
                     /locus_tag="BSVBI22_B0027"
                     /note="similar to GP:15159144; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter,
                     ATP-binding protein"
                     /protein_id="YP_005108051.1"
                     /db_xref="GI:376278018"
                     /db_xref="GeneID:11686169"
                     /translation="MTKDILVLDQLNKSFGPAHIIRGVNLAVRDGERHAVIGPNGAGK
                     STLFHLISGNFTPSSGSIRFQGEEIGGLTPAAVNRKGLARSFQITNIFPGLTVFENIR
                     LAVMRRYKVQFTFWRPVSSMRKVTAEVESLLEQVRLTARAYTLASQLSYSEQRSLEIG
                     MTLASDPRLIILDEPMAGMSQEETDYTVGLIREITQNRTLMIVEHDMDVVFTLADRIS
                     VLVYGEIIATGTPKEIRENARVREAYLGEEAH"
     misc_feature    24316..25053
                     /locus_tag="BSVBI22_B0027"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    24328..25032
                     /locus_tag="BSVBI22_B0027"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    24424..24447
                     /locus_tag="BSVBI22_B0027"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    order(24433..24438,24442..24450,24571..24573,24829..24834,
                     24925..24927)
                     /locus_tag="BSVBI22_B0027"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    24562..24573
                     /locus_tag="BSVBI22_B0027"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    24757..24786
                     /locus_tag="BSVBI22_B0027"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    24817..24834
                     /locus_tag="BSVBI22_B0027"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    24841..24852
                     /locus_tag="BSVBI22_B0027"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    24913..24933
                     /locus_tag="BSVBI22_B0027"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            25065..25781
                     /locus_tag="BSVBI22_B0028"
                     /db_xref="GeneID:11686170"
     CDS             25065..25781
                     /locus_tag="BSVBI22_B0028"
                     /note="similar to GB:M93015, SP:P29916, and PID:150623;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter,
                     ATP-binding protein"
                     /protein_id="YP_005108052.1"
                     /db_xref="GI:376278019"
                     /db_xref="GeneID:11686170"
                     /translation="MAAENILDVRELHAHYGKSHILQGVTFDLKKGEAISLLGRNGSG
                     RSTTMKAIMGLVPPTSGEVLLNGKNLAGERSFKICRAGIGFVPEERETFLNLTVDENL
                     QMGIQRGAEGATRWTVEQMFDYFPRLKERRNTRAGSFSGGEQQMLTMCRTLLGNPLVM
                     LIDEPTEGLAPKIVAVVGEMIKDINRQGVSVVLVEQKLTIALKVSSRVCVMGHGRIVF
                     EGTPDELTADEKLMEEWLAV"
     misc_feature    25074..25778
                     /locus_tag="BSVBI22_B0028"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    25083..25748
                     /locus_tag="BSVBI22_B0028"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    25179..25202
                     /locus_tag="BSVBI22_B0028"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(25188..25193,25197..25205,25326..25328,25551..25556,
                     25650..25652)
                     /locus_tag="BSVBI22_B0028"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    25317..25328
                     /locus_tag="BSVBI22_B0028"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    25479..25508
                     /locus_tag="BSVBI22_B0028"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    25539..25556
                     /locus_tag="BSVBI22_B0028"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    25563..25574
                     /locus_tag="BSVBI22_B0028"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    25638..25658
                     /locus_tag="BSVBI22_B0028"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            25833..26315
                     /locus_tag="BSVBI22_B0029"
                     /db_xref="GeneID:11686171"
     CDS             25833..26315
                     /locus_tag="BSVBI22_B0029"
                     /note="identified by match to PFAM protein family HMM
                     PF00903"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase family protein"
                     /protein_id="YP_005108053.1"
                     /db_xref="GI:376278020"
                     /db_xref="GeneID:11686171"
                     /translation="MTQMTAPLEVGLAVRDLKRMRAFYEGALGLSFVSEIHVGGEKAK
                     VAAMSPDGYTVVRLQTAKGERIKLLQPDRLPQAGQAETGLILERAGASYLTFIVDDLK
                     ALVERLIEHGAQPLTGRDPIEVRPGTWLAFLHDPEGHIVEIVQYDDIAAYRPDLAEEK
                     "
     misc_feature    25860..26261
                     /locus_tag="BSVBI22_B0029"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    order(25869..25871,25965..25967,25998..26000,26037..26039,
                     26109..26111,26226..26228,26250..26252,26256..26258)
                     /locus_tag="BSVBI22_B0029"
                     /note="active site"
                     /db_xref="CDD:211348"
     gene            26319..27056
                     /locus_tag="BSVBI22_B0030"
                     /db_xref="GeneID:11686172"
     CDS             26319..27056
                     /locus_tag="BSVBI22_B0030"
                     /note="similar to GB:L13289, SP:P47721, PID:551904,
                     GB:M11147, GB:M10119, GB:M12938, GB:X03742, GB:X03743,
                     SP:P02792, PID:1340145, PID:1340146, PID:182514,
                     PID:182516, PID:182518, PID:2230869, and PID:28519;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-(acyl-carrier-protein) reductase,
                     putative"
                     /protein_id="YP_005108054.1"
                     /db_xref="GI:376278021"
                     /db_xref="GeneID:11686172"
                     /translation="MKFEFENRTLVLTGANGGIGRAIAELFHASGANLVLTDLDREGL
                     DAFAASLGSPERIATIKADASSADDAEKTVALAMERFGGIDFLVPSAGIYQAKPFAEM
                     SDADWYRTISINLDGVFYLCKRALPALKEDSSIVTLASLAAYRGAYVNAHYGATKGAM
                     VSMTRALSRELAPKTRVNGVAPGIIETPMTSELLKTRMDETMTQTPLKRLGKPSEIAS
                     VIAFLCSPAASFVTGETIQVNGGIYMA"
     misc_feature    26331..27050
                     /locus_tag="BSVBI22_B0030"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    26349..27035
                     /locus_tag="BSVBI22_B0030"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(26358..26360,26364..26375,26430..26438,26502..26510,
                     26586..26594,26655..26657,26730..26738,26775..26777,
                     26787..26789,26862..26873,26877..26882)
                     /locus_tag="BSVBI22_B0030"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(26658..26660,26736..26738,26775..26777,26787..26789)
                     /locus_tag="BSVBI22_B0030"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            27074..27826
                     /locus_tag="BSVBI22_B0031"
                     /db_xref="GeneID:11686173"
     CDS             27074..27826
                     /locus_tag="BSVBI22_B0031"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01500"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /protein_id="YP_005108055.1"
                     /db_xref="GI:376278022"
                     /db_xref="GeneID:11686173"
                     /translation="MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAK
                     AQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQP
                     EAVEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKG
                     AIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGET
                     SEVVDPVVFLASPMASYITGTILPVDGGFLAA"
     misc_feature    27080..27811
                     /locus_tag="BSVBI22_B0031"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    27098..27805
                     /locus_tag="BSVBI22_B0031"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(27110..27112,27116..27127,27182..27190,27257..27265,
                     27341..27349,27413..27415,27491..27499,27536..27538,
                     27548..27550,27626..27637,27641..27646)
                     /locus_tag="BSVBI22_B0031"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(27416..27418,27497..27499,27536..27538,27548..27550)
                     /locus_tag="BSVBI22_B0031"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            27936..30125
                     /locus_tag="BSVBI22_B0032"
                     /db_xref="GeneID:11686174"
     CDS             27936..30125
                     /locus_tag="BSVBI22_B0032"
                     /note="similar to SP:P27746, GB:X52592, and PID:46994;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin dehydrogenase, alpha/beta subunit,
                     putative"
                     /protein_id="YP_005108056.1"
                     /db_xref="GI:376278023"
                     /db_xref="GeneID:11686174"
                     /translation="MPKYKDLVPHSFWREIVPTTEDRAAFDLALGGTMLSQMHLIRAF
                     EEKVLELAGQGLVHGPAHSAIGQEGGAVGSAVSMRPSDQINGSHRAHHQFLAKALGYV
                     AQKGIDPKAAFDQDIRTLAQRTLAEILGLSQGFCRGRGGSMHLRWAESGNLGTNAIVG
                     GGVPMAAGAAWAHRRAGKGDVVYTYFGDGATNIGSVLETMNLAAAWKLPICFFIENNR
                     YAVSTHVEEVTAEPRLSSRGLAFGIPSFKVDGMDPIAVWLASEEANAIMRAGNGPTII
                     EADVYRYFHQNGPLPGSAFGYRSKDEEAEWRGRDPLDALAKTLLERQALGEDAIKALR
                     ERCVSLMDEVAGQLIEMHDGKRRIIPSLWPEESFRDFGLRGDLSEFDGVRFEEQESFS
                     GKLVEDARFIDTVADVMARRMETDERVVVLGEDVHRLKGGTNGATRGLSADYPDRVLG
                     TPISENAFTGIAGGMAADGRVLPVIEFMYPDFMWVAADQVFNQIGKARHMFGGDSDMP
                     VVLRTKVAMGTGYGSQHSMDPAGIFATAPGWRIVAPSTPFDYVGLMNSALLCRDPVLV
                     LEHVDLYASKGAAPAEDFDYFIPLGEAKVVRPGSRVTVLTYLAMVAKTQAVVEALGVD
                     AEIIDLRSLDRAGVDWETIEASVRKTGNVLIVEQGASGTSYGGWLADELQRRCFDWLD
                     QPIARVHGAEASPSISKVLEAAAAARPQDIEAGLRAVMAAQGLPIEN"
     misc_feature    28035..28964
                     /locus_tag="BSVBI22_B0032"
                     /note="Thiamine pyrophosphate (TPP) family, E1 of
                     PDC_ADC_BCADC subfamily, TPP-binding module; composed of
                     proteins similar to the E1 components of the human
                     pyruvate dehydrogenase complex (PDC), the acetoin
                     dehydrogenase complex (ADC) and the branched chain...;
                     Region: TPP_E1_PDC_ADC_BCADC; cd02000"
                     /db_xref="CDD:238958"
     misc_feature    order(28107..28109,28323..28325,28404..28409,28500..28502,
                     28506..28517,28524..28526,28536..28538,28548..28550,
                     28593..28604,28644..28646,28659..28661,28809..28811,
                     28821..28823)
                     /locus_tag="BSVBI22_B0032"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238958"
     misc_feature    order(28197..28202,28404..28406,28410..28412,28494..28505,
                     28584..28586,28590..28592,28791..28793)
                     /locus_tag="BSVBI22_B0032"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238958"
     misc_feature    order(28389..28391,28395..28397,28401..28403,28416..28418,
                     28425..28430,28437..28442,28446..28451,28458..28460,
                     28515..28520,28536..28541,28548..28550)
                     /locus_tag="BSVBI22_B0032"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238958"
     misc_feature    order(28776..28796,28806..28838,28860..28868)
                     /locus_tag="BSVBI22_B0032"
                     /note="phosphorylation loop region [posttranslational
                     modification]"
                     /db_xref="CDD:238958"
     misc_feature    29136..30101
                     /locus_tag="BSVBI22_B0032"
                     /note="Pyruvate/2-oxoglutarate dehydrogenase complex,
                     dehydrogenase (E1) component, eukaryotic type, beta
                     subunit [Energy production and conversion]; Region: AcoB;
                     COG0022"
                     /db_xref="CDD:223101"
     misc_feature    29142..29645
                     /locus_tag="BSVBI22_B0032"
                     /note="Pyrimidine (PYR) binding domain of the beta
                     subunits of the E1 components of human pyruvate
                     dehydrogenase complex (E1- PDHc) and related proteins;
                     Region: TPP_PYR_E1-PDHc-beta_like; cd07036"
                     /db_xref="CDD:132919"
     misc_feature    order(29184..29186,29190..29192,29208..29210,29274..29276,
                     29283..29285,29289..29306,29313..29318,29322..29330,
                     29388..29390,29397..29402,29427..29432,29496..29498,
                     29505..29507,29550..29555,29616..29621)
                     /locus_tag="BSVBI22_B0032"
                     /note="alpha subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132919"
     misc_feature    order(29205..29207,29292..29294,29298..29300,29379..29381,
                     29388..29390)
                     /locus_tag="BSVBI22_B0032"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132919"
     misc_feature    order(29208..29210,29283..29285,29289..29300,29385..29390,
                     29394..29396,29409..29411,29421..29423,29430..29432,
                     29496..29498,29502..29507,29529..29531,29535..29540,
                     29544..29546)
                     /locus_tag="BSVBI22_B0032"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132919"
     misc_feature    29706..30053
                     /locus_tag="BSVBI22_B0032"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            30144..31409
                     /locus_tag="BSVBI22_B0033"
                     /db_xref="GeneID:11686175"
     CDS             30144..31409
                     /locus_tag="BSVBI22_B0033"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01348"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain alpha-keto acid dehydrogenase
                     subunit E2"
                     /protein_id="YP_005108057.1"
                     /db_xref="GI:376278024"
                     /db_xref="GeneID:11686175"
                     /translation="MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKA
                     TMELEAEVDGRIGQLLVKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAE
                     TPVAASPVPAAPAVSAPASGEVRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDV
                     ERAAASKPVPVAAAAAPVAAPAEASSKAIPVGIGEYEAVPHTSMRRTIARRLLEAKIT
                     VPHFYLNVDCEIDALLALRSQINEKREGSARISVNDFVIKASAAALRRVPDANVIWTD
                     EALLKLKDVDIAVAVATEGGLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEF
                     QGGGFSISNLGMYGVKSFSAIINPPQSAILAVGAGERRPIERNGELAFATMMSVTLSV
                     DHRAVDGALGAQLLAAFKAGIEDPMSLLV"
     misc_feature    30144..31406
                     /locus_tag="BSVBI22_B0033"
                     /note="branched-chain alpha-keto acid dehydrogenase
                     subunit E2; Reviewed; Region: PRK11856"
                     /db_xref="CDD:237001"
     misc_feature    30150..30371
                     /locus_tag="BSVBI22_B0033"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    order(30240..30242,30261..30278,30288..30290)
                     /locus_tag="BSVBI22_B0033"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    30270..30272
                     /locus_tag="BSVBI22_B0033"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    30522..30629
                     /locus_tag="BSVBI22_B0033"
                     /note="e3 binding domain; Region: E3_binding; pfam02817"
                     /db_xref="CDD:251550"
     misc_feature    30777..31406
                     /locus_tag="BSVBI22_B0033"
                     /note="2-oxoacid dehydrogenases acyltransferase (catalytic
                     domain); Region: 2-oxoacid_dh; pfam00198"
                     /db_xref="CDD:249671"
     gene            31510..32295
                     /locus_tag="BSVBI22_B0034"
                     /db_xref="GeneID:11686176"
     CDS             31510..32295
                     /locus_tag="BSVBI22_B0034"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00507"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase family protein"
                     /protein_id="YP_005108058.1"
                     /db_xref="GI:376278025"
                     /db_xref="GeneID:11686176"
                     /translation="MTVTGHTRVFAIIADPVHHVRTPQALNALFAARGYDGIVVPAAV
                     PASGLKYAAAALRAFGNWGGFIVTVPHKTEMPAFCDRLTPRAQAAGAVNVIRREADGS
                     LTGELLDGVGFVRGLANAGHDVKGRSVYLAGAGGAASAIAFALAEAGVVRLTVVNRSS
                     EKAGQLVARLKEHFPAGMFVSQGTPAGHDIIVNGTSLGLKEGDALPVDPQYLRPEMLV
                     AEVIMSPEVTPLLQIAKDSGCSIHPGKAMLDGQLAEMFDFFTR"
     misc_feature    31516..32289
                     /locus_tag="BSVBI22_B0034"
                     /note="Shikimate 5-dehydrogenase [Amino acid transport and
                     metabolism]; Region: AroE; COG0169"
                     /db_xref="CDD:223247"
     misc_feature    31543..31794
                     /locus_tag="BSVBI22_B0034"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    31834..32289
                     /locus_tag="BSVBI22_B0034"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    order(31834..31836,32176..32178,32251..32253,32260..32262)
                     /locus_tag="BSVBI22_B0034"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    order(31909..31911,31918..31920,31978..31983,32089..32097,
                     32170..32172,32239..32241,32248..32253)
                     /locus_tag="BSVBI22_B0034"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            32575..32868
                     /locus_tag="BSVBI22_B0035"
                     /db_xref="GeneID:11686177"
     CDS             32575..32868
                     /locus_tag="BSVBI22_B0035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108059.1"
                     /db_xref="GI:376278026"
                     /db_xref="GeneID:11686177"
                     /translation="MKFTAIALLGARVLARRHPKYSQMSARPASCVPGAEHGTIRPRP
                     VAIWKADPSTGRIECHWTTDPNEVSAWLARSCFEQAGLIMAAVQQGRFGMPAH"
     gene            complement(32822..33103)
                     /locus_tag="BSVBI22_B0036"
                     /db_xref="GeneID:11686178"
     CDS             complement(32822..33103)
                     /locus_tag="BSVBI22_B0036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108060.1"
                     /db_xref="GI:376278027"
                     /db_xref="GeneID:11686178"
                     /translation="MLKGSPLMPRCWETLADHLERLRVGHPFSAHFRCLHPSSGLWGG
                     VRGRIWQLRRERAMLAQISSVTAPPMMRTCAKNHISAQACQSGPAARQP"
     gene            33221..35938
                     /locus_tag="BSVBI22_B0037"
                     /db_xref="GeneID:11686179"
     CDS             33221..35938
                     /locus_tag="BSVBI22_B0037"
                     /note="similar to GP:397973; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium ion-transporting ATPase E1-E2 family
                     protein"
                     /protein_id="YP_005108061.1"
                     /db_xref="GI:376278028"
                     /db_xref="GeneID:11686179"
                     /translation="MNVAVRTANNKNFKKDERRLSMRAVREASNEIELTLANVGSRRD
                     GLTEGDAITRLYRDGPNEVARERRIPALVQFALAFKNPFIMVLVVLGAISAFTDIWLP
                     LETGEEADPTKVIIIAVMVLASALMRFIQEYRSGRAAEALKAMVRTTATVWRRVSAGT
                     SSAPREIPMRELVVGDIVQLSAGDMIPADLRLIESRDLFISQAVLTGEALPVEKYDTL
                     GAISEKSAMATASQDADMLDLPSICFMGTNVVSGTATAVVVATGQRTYFGSLAKAIVG
                     SRAQTSFDRGINSVSWLLIRFMLIMVPVVFLINGFTKGNWVEAMLFGLAVAVGLTPEM
                     LPMIVSSNLAKGAVAMARRKVVVKRLNAIQNFGAMDVLCTDKTGTLTQDKIILEHHID
                     VSGKADDKVLRLAWLNSYHQSGVKNLMDQAVVSFANRVPEEVMRTARLYRKVDELPFD
                     FIRRRLSVVVEGVGGEHLLVCKGAVEEMLAICTTVRDGETVRALDAVTREKLIATARA
                     YNADGFRVLVVATREIPGAETSAQYRIADEAGLTVQGFLTFLDPPKETAGPAIAALAE
                     HGVCVKVLTGDNEIVTRKICREVGLEAGIPILGSEIEKLDDEALRVVAEERTVFAKLT
                     PLQKSRVLQALQANGHTVGFLGDGINDAPALRDADVGISVDSGADIAKESADIILLEK
                     SLIVLEEGVVTGRETFGNILKYLNMCASSNFGNVFSVLVASAFIPFLPMLAIHLLIQN
                     LMYDISQLALPWDKMDKEFLAKPRKWDARNIGRFMIWIGPTSSIFDITTFALMWYVFS
                     ANSPQMQSLFQSGWFIEGLLSQTLVVHMLRTQKIPFFQSTAALPVMLMSALIIALGIY
                     IPFSPIGEMVGLVPLPWAYFPWLAATLVSYCLVAQGMKVIYVRRFGQWF"
     misc_feature    33221..35935
                     /locus_tag="BSVBI22_B0037"
                     /note="magnesium-transporting ATPase; Provisional; Region:
                     PRK15122"
                     /db_xref="CDD:237914"
     misc_feature    <33341..33511
                     /locus_tag="BSVBI22_B0037"
                     /note="Cation transporter/ATPase, N-terminus; Region:
                     Cation_ATPase_N; smart00831"
                     /db_xref="CDD:214842"
     misc_feature    33566..34312
                     /locus_tag="BSVBI22_B0037"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    <34469..34675
                     /locus_tag="BSVBI22_B0037"
                     /note="Putative hydrolase of sodium-potassium ATPase alpha
                     subunit; Region: Hydrolase_like2; pfam13246"
                     /db_xref="CDD:257602"
     misc_feature    <34865..35188
                     /locus_tag="BSVBI22_B0037"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     pfam12710"
                     /db_xref="CDD:257240"
     misc_feature    35402..35908
                     /locus_tag="BSVBI22_B0037"
                     /note="Cation transporting ATPase, C-terminus; Region:
                     Cation_ATPase_C; pfam00689"
                     /db_xref="CDD:250058"
     gene            36023..36373
                     /locus_tag="BSVBI22_B0038"
                     /db_xref="GeneID:11686180"
     CDS             36023..36373
                     /locus_tag="BSVBI22_B0038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108062.1"
                     /db_xref="GI:376278029"
                     /db_xref="GeneID:11686180"
                     /translation="MQPIDAEGGKMSDTVFVFVDTTQGANPPGGRRPGSPRRRGEPPL
                     PGGSPQGLWQWMKGRMDRWICWAYTVLGANLASITYWLSRQGLIGRRATFRLLRWTSA
                     LRARSVRRLRKASW"
     gene            36504..36707
                     /locus_tag="BSVBI22_B0039"
                     /db_xref="GeneID:11686181"
     CDS             36504..36707
                     /locus_tag="BSVBI22_B0039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108063.1"
                     /db_xref="GI:376278030"
                     /db_xref="GeneID:11686181"
                     /translation="MYHFRFSGGYKALPTAVPHRGTLVGSIAVATYLILFALVVLFVV
                     PASQANGPLDGDTQWQGAQAGGK"
     gene            36709..37425
                     /locus_tag="BSVBI22_B0040"
                     /db_xref="GeneID:11686182"
     CDS             36709..37425
                     /locus_tag="BSVBI22_B0040"
                     /note="similar to GB:L33799, and PID:642908; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="MgtC family protein"
                     /protein_id="YP_005108064.1"
                     /db_xref="GI:376278031"
                     /db_xref="GeneID:11686182"
                     /translation="MVWKPLAHTAACLAGAFLLGGLIGFERQFRHRLAGLRTNTLVAV
                     GAATFVVFSSLVSGDSSPTRVAAQIVSGIGFLGAGIIFKEGFNVRGLNTAATLWCSAA
                     VGVLCGAGLISHAAVATVFIIAVNALLRPLVQVLEFQAMRRGAFQPTYAIDIICHGDA
                     EAQVRALLLRDIGDHLHIHELESSNIEGTNRVEVSATVRADQRQDRLLEQIVGHLSLE
                     PRITSARWRIEDDSGGLSGL"
     misc_feature    36709..37392
                     /locus_tag="BSVBI22_B0040"
                     /note="Uncharacterized membrane protein [Function
                     unknown]; Region: SapB; COG1285"
                     /db_xref="CDD:224204"
     misc_feature    36754..37134
                     /locus_tag="BSVBI22_B0040"
                     /note="MgtC family; Region: MgtC; pfam02308"
                     /db_xref="CDD:111223"
     gene            37500..38570
                     /locus_tag="BSVBI22_B0041"
                     /db_xref="GeneID:11686183"
     CDS             37500..38570
                     /locus_tag="BSVBI22_B0041"
                     /note="similar to GB:M57423, SP:P09329, SP:P11908,
                     SP:P21108, PID:190522, and PID:2160401; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_005108065.1"
                     /db_xref="GI:376278032"
                     /db_xref="GeneID:11686183"
                     /translation="MLKTIIRRNVTGSTPKILLLACLTAAIFIVDTVTDYAIAAAVFY
                     TVVILLSARLLTGKAVTGLASTCIALSVISFAFTSKGAFYEGLINTGISIIAIIATTY
                     LGLKLVSAEIDVRESRERLLRLARMTTLGQLTSSIAHEVSQPLVAIEISASAGRRWLA
                     QSPPNNERAAAAIERISADSHRAIEILDRVRRLSRGEKPHVAPFDINEVVRDIVELAH
                     NEITRHDIALDLDLTPGLPMALADRVQIQQVIGNLVLNAIEAIQEKDPPVRSLKINTA
                     LTEGARLQVAVRDSGGGIAPADQERLFDAFWTTKKGGFGLGLTISRTIVESSGGTIAL
                     GSTTPHGTTILFEVPTTQETEI"
     misc_feature    37539..38546
                     /locus_tag="BSVBI22_B0041"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    37878..38084
                     /locus_tag="BSVBI22_B0041"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(37896..37898,37908..37910,37920..37922,37929..37931,
                     37941..37943,37950..37952,38013..38015,38025..38027,
                     38034..38036,38046..38048,38055..38057,38067..38069)
                     /locus_tag="BSVBI22_B0041"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    37914..37916
                     /locus_tag="BSVBI22_B0041"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    38235..38543
                     /locus_tag="BSVBI22_B0041"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(38253..38255,38265..38267,38274..38276,38358..38360,
                     38364..38366,38370..38372,38376..38381,38442..38453,
                     38499..38501,38505..38507,38520..38525,38529..38531)
                     /locus_tag="BSVBI22_B0041"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    38265..38267
                     /locus_tag="BSVBI22_B0041"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(38370..38372,38376..38378,38442..38444,38448..38450)
                     /locus_tag="BSVBI22_B0041"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            38567..39205
                     /locus_tag="BSVBI22_B0042"
                     /db_xref="GeneID:11686184"
     CDS             38567..39205
                     /locus_tag="BSVBI22_B0042"
                     /note="similar to GB:L22075, SP:Q14344, and PID:404722;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family DNA-binding response regulator"
                     /protein_id="YP_005108066.1"
                     /db_xref="GI:376278033"
                     /db_xref="GeneID:11686184"
                     /translation="MNCAYERDPVVFIVDDDHSVRLGLVDLFASIGLKALCFASVNEF
                     LKHAREEVPACLILDVRMPGESGTEFHARMKGLDIRLPVIFITGHGDIAMGVKAIKDG
                     AIDFLAKPFRNQDLLDAVQQAIRTDRKRLREEHNQHRIIARYQTLNQGERAVFKLVVQ
                     GLMNKQIAAELDVAEVTVKVRRSHLMHKMRAKSLADLVRMATELNAQPVKEL"
     misc_feature    38579..39184
                     /locus_tag="BSVBI22_B0042"
                     /note="Response regulator [Signal transduction
                     mechanisms]; Region: TtrR; COG4566"
                     /db_xref="CDD:226932"
     misc_feature    38600..38938
                     /locus_tag="BSVBI22_B0042"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(38609..38614,38741..38743,38765..38767,38825..38827,
                     38882..38884,38891..38896)
                     /locus_tag="BSVBI22_B0042"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    38741..38743
                     /locus_tag="BSVBI22_B0042"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(38750..38755,38759..38767)
                     /locus_tag="BSVBI22_B0042"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    38891..38899
                     /locus_tag="BSVBI22_B0042"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    39017..39169
                     /locus_tag="BSVBI22_B0042"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(39041..39043,39047..39049,39053..39055,39146..39154,
                     39161..39163)
                     /locus_tag="BSVBI22_B0042"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     misc_feature    order(39053..39061,39083..39088,39092..39097,39101..39115,
                     39146..39148)
                     /locus_tag="BSVBI22_B0042"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     gene            complement(39403..39477)
                     /gene="tRNA-Val-3"
                     /locus_tag="BSVBI22_Bt01"
                     /db_xref="GeneID:11686185"
     tRNA            complement(39403..39477)
                     /gene="tRNA-Val-3"
                     /locus_tag="BSVBI22_Bt01"
                     /product="tRNA-Val"
                     /codon_recognized="GUC"
                     /db_xref="GeneID:11686185"
     gene            complement(39591..39953)
                     /locus_tag="BSVBI22_B0043"
                     /db_xref="GeneID:11686186"
     CDS             complement(39591..39953)
                     /locus_tag="BSVBI22_B0043"
                     /note="identified by match to PFAM protein family HMM
                     PF00072"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_005108067.1"
                     /db_xref="GI:376278034"
                     /db_xref="GeneID:11686186"
                     /translation="MKRILLAEDDNDMRRFLVKALEKAGYHVTHFDNGASAYERLQEE
                     PFSLLLTDIVMPEMDGIELARRATEIDPDLKIMFITGFAAVALNPDSDAPRDAKVLSK
                     PFHLRDLVNEIEKMLIAA"
     misc_feature    complement(39603..39941)
                     /locus_tag="BSVBI22_B0043"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(39645..39650,39714..39716,39774..39776,
                     39798..39800,39927..39932))
                     /locus_tag="BSVBI22_B0043"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(39798..39800)
                     /locus_tag="BSVBI22_B0043"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(39774..39782,39786..39791))
                     /locus_tag="BSVBI22_B0043"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(39642..39650)
                     /locus_tag="BSVBI22_B0043"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            40272..41162
                     /locus_tag="BSVBI22_B0044"
                     /db_xref="GeneID:11686187"
     CDS             40272..41162
                     /locus_tag="BSVBI22_B0044"
                     /codon_start=1
                     /transl_table=11
                     /product="formiminoglutamase, putative"
                     /protein_id="YP_005108068.1"
                     /db_xref="GI:376278035"
                     /db_xref="GeneID:11686187"
                     /translation="MSLERDFGSVPPFEVSAPAQQRIPFVFNSPHSGRHYPLSFVQAS
                     RLDAISIRNSEDCYVDELFASVMRLGAPLLKANFPRAFLDVNREPYELDPRMFAEPLP
                     PFANSHSARVAGGLGTVPRLVAEGQLIYPGRIPLAEALYRIEDLYKPYHAALDALLEA
                     TRQQFGYAVLIDCHSMPGGTSAGEIGSRPDFIVGDRFGRSCSERLTQAAIELLQDLGY
                     TVAHNKPYAGGFITEHYGRPAMACHALQIEVNRSLYVNEQNLHKLEGFEALCVALHHF
                     VSDLTSLPDDLFIAPPLAAE"
     misc_feature    40296..41150
                     /locus_tag="BSVBI22_B0044"
                     /note="N-formylglutamate amidohydrolase [Amino acid
                     transport and metabolism]; Region: HutG; COG3741"
                     /db_xref="CDD:226264"
     gene            41324..42100
                     /locus_tag="BSVBI22_B0045"
                     /db_xref="GeneID:11686188"
     CDS             41324..42100
                     /locus_tag="BSVBI22_B0045"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01330"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase family protein"
                     /protein_id="YP_005108069.1"
                     /db_xref="GI:376278036"
                     /db_xref="GeneID:11686188"
                     /translation="MLIDKAFFSEVAAAAAAQTLPRFRQLTEVDNKYSVGFDPVTEAD
                     RAAERAIRAVIGRTFPDHGILGEEYGAENTDRSHVWIIDPVDGTRAFISGLPVWGTLV
                     GLTVDGDARAGMMSQPFTGELFYSDGDGAYLQRGDGAPRRLCVRKNAVLEDATLFTTT
                     PALFKGDDRKAFDRLESAVRLSRYGVDCYAFAMLAGGFVDIVVEAGLQTYDIAALIPI
                     IEQAGGVVTRRDGGPAEQGGDIVAAATPALHQAALDLLHI"
     misc_feature    41378..42082
                     /locus_tag="BSVBI22_B0045"
                     /note="Predominantly bacterial family of Mg++ dependend
                     phosphatases, related to inositol monophosphatases. These
                     enzymes may dephosphorylate fructose-1,6-bisphosphate,
                     inositol monophospate, 3'-phosphoadenosine-5'-phosphate,
                     or similar substrates; Region: Bacterial_IMPase_like_1;
                     cd01641"
                     /db_xref="CDD:238819"
     misc_feature    order(41453..41455,41522..41527,41570..41581,41585..41587,
                     41951..41956)
                     /locus_tag="BSVBI22_B0045"
                     /note="active site"
                     /db_xref="CDD:238819"
     gene            complement(42151..43146)
                     /locus_tag="BSVBI22_B0046"
                     /db_xref="GeneID:11686189"
     CDS             complement(42151..43146)
                     /locus_tag="BSVBI22_B0046"
                     /note="similar to GB:X15949, SP:P14316, and PID:33967;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase L2, putative"
                     /protein_id="YP_005108070.1"
                     /db_xref="GI:376278037"
                     /db_xref="GeneID:11686189"
                     /translation="MSELLFETDANPIPSRIRGGLFHAPDGKALRYALLKAESRPCRG
                     TVIVLQGRNEFIENYYETMSDLAGRGFTVATFDWRGQGGSHRLLRDRLRGYVRSFNDY
                     ADDLDHFLTGIVLPDCPPPFFILAHSAGALVALSSLERLSSRITRMVLCAPLMGLGGQ
                     KISDDNVRRITAALRWIGLGRIYAAGGRTLSAARAFADNPLTSDPLRFMRNVEITRTY
                     TDLALGGPTVRWVWSALETAWRINQPDFYKSPIAPVLIIAAGADRVVSTAVIERFVAR
                     TRNISLAVIDGARHEMLQEADFYREQVLAAFDAFIPGSSPVESMPQSLEPDLSQI"
     misc_feature    complement(42193..43119)
                     /locus_tag="BSVBI22_B0046"
                     /note="Lysophospholipase [Lipid metabolism]; Region: PldB;
                     COG2267"
                     /db_xref="CDD:225176"
     misc_feature    complement(42817..43068)
                     /locus_tag="BSVBI22_B0046"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     pfam12146"
                     /db_xref="CDD:256874"
     gene            complement(43186..43401)
                     /locus_tag="BSVBI22_B0047"
                     /db_xref="GeneID:11686190"
     CDS             complement(43186..43401)
                     /locus_tag="BSVBI22_B0047"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108071.1"
                     /db_xref="GI:376278038"
                     /db_xref="GeneID:11686190"
                     /translation="MSTGTQINCSLQPGITKNATVVLTGLPKHSQRKRTSWRNGPCSG
                     CFLNRKFAHELPVTFYHDFAHYGGASK"
     gene            complement(43496..43894)
                     /locus_tag="BSVBI22_B0048"
                     /db_xref="GeneID:11686191"
     CDS             complement(43496..43894)
                     /locus_tag="BSVBI22_B0048"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108072.1"
                     /db_xref="GI:376278039"
                     /db_xref="GeneID:11686191"
                     /translation="MKKAALALAALATAATGIATPTLAADNGLRVQIQYYDDDGYRVP
                     RQGFDGPGRHDRRPNWGDGYIRREVMNPRRVARSLERRGYDVGDMRLERDTYFVRATR
                     PSGRRVVVMVDAYNGNIIGERRAGPRPSGY"
     misc_feature    complement(43526..>43693)
                     /locus_tag="BSVBI22_B0048"
                     /note="Peptidase propeptide and YPEB domain; Region:
                     PepSY_2; pfam13670"
                     /db_xref="CDD:257976"
     gene            43946..44155
                     /locus_tag="BSVBI22_B0049"
                     /db_xref="GeneID:11686192"
     CDS             43946..44155
                     /locus_tag="BSVBI22_B0049"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108073.1"
                     /db_xref="GI:376278040"
                     /db_xref="GeneID:11686192"
                     /translation="MVPVKMATLDQSRYLFRSIYLTQNRCALLLEMLWPRAFERSPKM
                     MFILGYRAVRKAKYSSLWIRSCYAK"
     gene            44128..44379
                     /locus_tag="BSVBI22_B0050"
                     /db_xref="GeneID:11686193"
     CDS             44128..44379
                     /locus_tag="BSVBI22_B0050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108074.1"
                     /db_xref="GI:376278041"
                     /db_xref="GeneID:11686193"
                     /translation="MDQELLRKVTWCVRARSKSRHAGLQMALLIQAPGPGIEYRVLSI
                     SAGLEMKSRHSQMSSAVATEGPPAQEIRHQGSFAAHVRS"
     gene            44458..44928
                     /gene="ibpA"
                     /locus_tag="BSVBI22_B0051"
                     /db_xref="GeneID:11686194"
     CDS             44458..44928
                     /gene="ibpA"
                     /locus_tag="BSVBI22_B0051"
                     /note="similar to GB:X01703, GB:K00557, SP:P04687,
                     SP:P05215, PID:340019, PID:340021, and PID:37492;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="16 kDa heat shock protein A"
                     /protein_id="YP_005108075.1"
                     /db_xref="GI:376278042"
                     /db_xref="GeneID:11686194"
                     /translation="MRHVDFSPLYRSTVGFDRLFTMLDSLASPEGNQSYPPYNIERTG
                     ENAYRITMAVAGFSENELEIEAHRNQLTVKDQKADETASDVGEVLYRGIASRAFERRF
                     QLADFVEVSGASLKNGLLHIDLKREIPEQMKPRKIEVTKAGSGTAQPIEAKTAH"
     misc_feature    44458..44874
                     /gene="ibpA"
                     /locus_tag="BSVBI22_B0051"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    44563..44835
                     /gene="ibpA"
                     /locus_tag="BSVBI22_B0051"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    order(44569..44583,44608..44610,44614..44616,44620..44625,
                     44755..44757,44809..44814)
                     /gene="ibpA"
                     /locus_tag="BSVBI22_B0051"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            complement(45066..46115)
                     /locus_tag="BSVBI22_B0052"
                     /db_xref="GeneID:11686195"
     CDS             complement(45066..46115)
                     /locus_tag="BSVBI22_B0052"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine aldolase, low-specificity, putative"
                     /protein_id="YP_005108076.1"
                     /db_xref="GI:376278043"
                     /db_xref="GeneID:11686195"
                     /translation="MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFN
                     ELFEREVAVFFVGTGTAANSLALASVNRPGGVSLVHREAHVIEDECGAPEYFTGGARL
                     HPIDGALGRIDPELLKRELKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQI
                     CRDAGLPLHMDGARFANALVSLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDP
                     ARAKDLPFIRKRAAQLFSKTRFVAAQFDAYLRDDLWRDLARHSNALAARLANHIHASS
                     QMRLAWKPEANEVFAIMKQSVYDRLRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTGF
                     ANTEEEVDRFGDMIA"
     misc_feature    complement(45069..46115)
                     /locus_tag="BSVBI22_B0052"
                     /note="Threonine aldolase [Amino acid transport and
                     metabolism]; Region: GLY1; COG2008"
                     /db_xref="CDD:224919"
     misc_feature    complement(45228..46004)
                     /locus_tag="BSVBI22_B0052"
                     /note="Beta-eliminating lyase; Region: Beta_elim_lyase;
                     pfam01212"
                     /db_xref="CDD:250447"
     misc_feature    complement(order(45504..45506,45513..45515,45594..45596,
                     45603..45605,45696..45698,45927..45929,45936..45941))
                     /locus_tag="BSVBI22_B0052"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(45504..45506)
                     /locus_tag="BSVBI22_B0052"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(46384..46668)
                     /locus_tag="BSVBI22_B0053"
                     /db_xref="GeneID:11686196"
     CDS             complement(46384..46668)
                     /locus_tag="BSVBI22_B0053"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108077.1"
                     /db_xref="GI:376278044"
                     /db_xref="GeneID:11686196"
                     /translation="MKSLIDKALDEVPQGRKAAGERCLAPILIRLLTDSTLRTATGAR
                     NSPCHSRSACHRQASGLPVRRLSLKLYEQRLIAFGSHQRLIGQHCCPNYV"
     gene            46758..51509
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /db_xref="GeneID:11686197"
     CDS             46758..51509
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="similar to SP:P04993, GB:X04581, GB:X04582,
                     PID:42683, PID:42691, PID:882711, GB:U00096, and
                     PID:1789182; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase, large subunit"
                     /protein_id="YP_005108078.1"
                     /db_xref="GI:376278045"
                     /db_xref="GeneID:11686197"
                     /translation="MTHLTPSVSNVVSHNVQNEAVKAATTASTRTTRKTKAAGVPPAQ
                     GLYDPRNEHDACGVGFIAHMKGRKSHVVVENGLKMLENLTHRGAVGADPLMGDGAGIL
                     VQIPDRFFREEMARQGIDLPQPGHYGVGYIFMPRDPDLRAHAEEIVREVIAAEGQTFI
                     GFREVPVDNSSLSKAPHIAATEPFHMQVFIGRSPMLETDDDFERRLFVLRKVISNRIY
                     QENDGDDKGFYVVSMSARTVVYKGMFLAYQVGAYYLDLKDPRFESAVALVHQRFSTNT
                     FPSWRLAHPYRMVAHNGEINTLRGNVNWMAARQASVDSELFGNDISKLWPISYEGQSD
                     TACFDNALEFLHQGGYSLAHAMMMLIPEAWSGNKLMSDERRAFYEYHAALMEPWDGPA
                     AVAFTDGRQIGAMLDRNGLRPARYIVTEDDFVILASEAGVLPVDEKKIVRKWRLQPGR
                     MLLIDMEEGRIISDEEIKSQIAQKHPYKQWLANTQLILEDLNPVEPRALHKDVSLLDR
                     QQAFGYTQEDTKFLMAPMATTGQEAIGSMGTDTPISAMSDKSKLLYTYFKQNFAQVTN
                     PPIDPIREELVMSLVSFIGPRPNIFDLVGTSRRKRLEVRQPILTNGDLEKIRSIGHTE
                     DRFDTKTLDITYNTGEGATGMHGAIERLCDRAEAAVHGGYNIVILSDRQVGPDRIPIP
                     ALLATAAVHHHLIRKGLRTSVGLVVESGEPREVHHFACLAGYGAEAINPYLAFDTLLD
                     MHRRREFPPEVDEHEVVKRYIKSIGKGILKVMSKMGISTYQSYCGAQIFDAVGVRTDF
                     VDKFFFGTATTIEGVGLDEIAEETVRRHTDAFGNDPVLLNALEVGGEYAYRMRGEAHM
                     WSPDAVAKLQHAVRTSNPDTFTEYTRMLDAKSSQAKTIRGLFNIRFAEERGLKPVSID
                     EVEPATDIVKRFSTGAMSFGSISREAHTTLARAMNAIGGKSNTGEGGEEPDRFYPLPD
                     GTANPERSAIKQVASGRFGVTTEYLVNSDLIQIKVAQGAKPGEGGQLPGHKVDATIAK
                     TRHSTPGVGLISPPPHHDIYSIEDLAQLIYDLKNVNPAADISVKLVSEVGVGTVAAGV
                     AKARADHITVSGYDGGTGASPLTSLKHAGSPWEIGLAETHQTLVLNGLRSRVALQVDG
                     GLRTGRDVVIGALLGADEFGFSTAPLIAAGCIMMRKCHLNTCPVGVATQDPVLRKRFK
                     GTPEHVINFFFYLAEEVRALLAQMGFTRLEQIIGETELLEKQAMIDHWKAKGLDFSRI
                     FYKPEAEKHEIYWTERQHHPIDDILDRKLIELAAPALEERQPVKIDVEIKNVDRSAGA
                     MLSGEVAKRFRHKGLPEDTISVTLRGTAGQSFGAFLARGISFELIGDGNDYIGKGLSG
                     GRIVVRPPEDTRIVAEDSIIVGNTVLYGALEGECYFRGVAGERFAVRNSGAVTVVEGV
                     GDHGCEYMTGGVVVVIGQTGRNFAAGMSGGVAYVLDEEGDFAQRCNMAMVELEPVPEE
                     DDILEKLHHHGGDLMHKGRVDVSANMTHHDEERLVQLIANHLHYTGSTRAKDILDNWE
                     SYRPKFVKVMPVEYRRALEEMERMQIGVAAE"
     misc_feature    46881..51446
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="glutamate synthase subunit alpha; Provisional;
                     Region: gltB; PRK11750"
                     /db_xref="CDD:236968"
     misc_feature    46923..48182
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="Glutamine amidotransferases class-II (Gn-AT),
                     glutamate synthase (GltS)-type. GltS is a homodimer that
                     synthesizes L-glutamate from 2-oxoglutarate and
                     L-glutamine, an important step in ammonia assimilation in
                     bacteria, cyanobacteria and plants. The...; Region: GltS;
                     cd00713"
                     /db_xref="CDD:238365"
     misc_feature    order(46923..46925,47013..47015,47568..47570,47631..47639,
                     47757..47759)
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="active site"
                     /db_xref="CDD:238365"
     misc_feature    order(47181..47183,47190..47192,47202..47204,47241..47243,
                     47247..47249,47262..47264,47301..47303,47313..47315,
                     47586..47588)
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238365"
     misc_feature    48270..49139
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="Glutamate synthase central domain; Region:
                     Glu_syn_central; pfam04898"
                     /db_xref="CDD:252865"
     misc_feature    49329..50465
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="Glutamate synthase (GltS) FMN-binding domain.  GltS
                     is a complex iron-sulfur flavoprotein that catalyzes the
                     reductive synthesis of L-glutamate from 2-oxoglutarate and
                     L-glutamine via intramolecular channelling of ammonia, a
                     reaction in the plant, yeast...; Region: GltS_FMN;
                     cd02808"
                     /db_xref="CDD:239202"
     misc_feature    order(49542..49553,49632..49634,49707..49709,49773..49775,
                     49791..49793,49851..49853,49977..49979,50067..50075,
                     50190..50192,50196..50198,50259..50264,50286..50288,
                     50304..50306,50319..50321)
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="active site"
                     /db_xref="CDD:239202"
     misc_feature    order(49542..49553,49632..49634,49707..49709,49773..49775,
                     49977..49979,50067..50072,50190..50192,50196..50198,
                     50259..50264)
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239202"
     misc_feature    order(49791..49793,49851..49853,50070..50075)
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    order(50286..50288,50304..50306,50319..50321)
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="3Fe-4S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    50616..51446
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="gltb_C. This domain is found at the C-terminus of
                     the large subunit (gltB) of glutamate synthase (GltS).
                     GltS encodes a complex iron-sulfur flavoprotein that
                     catalyzes the synthesis of L-glutamate from L-glutamine
                     and 2-oxoglutarate. It requires the...; Region: gltB_C;
                     cd00982"
                     /db_xref="CDD:238482"
     misc_feature    order(50715..50720,50727..50729,50736..50741,50796..50798,
                     50805..50810,50820..50822,50856..50864,50877..50879,
                     50886..50888,50943..50954,50961..50963,50970..50972,
                     50979..50981,51006..51020,51027..51032,51036..51038,
                     51063..51074,51081..51086,51090..51092,51129..51131,
                     51138..51140,51147..51149,51192..51203)
                     /gene="gltB"
                     /locus_tag="BSVBI22_B0054"
                     /note="domain interface; other site"
                     /db_xref="CDD:238482"
     gene            51591..53045
                     /gene="gltD"
                     /locus_tag="BSVBI22_B0055"
                     /db_xref="GeneID:11686198"
     CDS             51591..53045
                     /gene="gltD"
                     /locus_tag="BSVBI22_B0055"
                     /note="glutamate synthase is composed of subunits alpha
                     and beta; beta subunit is a flavin adenine
                     dinucleotide-NADPH dependent oxidoreductase; provides
                     electrons to the alpha subunit, which binds L-glutamine
                     and 2-oxoglutarate and forms L-glutamate"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase subunit beta"
                     /protein_id="YP_005108079.1"
                     /db_xref="GI:376278046"
                     /db_xref="GeneID:11686198"
                     /translation="MGKVTGFLEIDRQVAKYQPASDRIRHFREFTIPMTDGEVQKQAA
                     RCMDCGIPYCHGPTGCPVHNQIPDWNDLVYNNNWDQAIRNLHLTNNFPEFTGRICPAP
                     CEEACTLNLEDMPVAIKTVEQALGDKAYELGYIVPQPAASKTGKLVAIIGSGPAGLAA
                     AQQLARAGHMVDVYERESRPGGLLRYGIPDFKMEKHLIDRRVAQMEGEGVRFHCGVNI
                     GVDKPLRGLLDTYDAVLYCGGSETPRPAGIPGADLDGVHDAMPYLVQQNRRVGRENIE
                     SVAWASVPILAGGKHVVVVGGGDTASDCVGTAFRQGAVNVTQLDIRPQPPEKEDKLSV
                     WPYWATKMRTSSSQAEGASREFQVATLEFIGEDGRLTHVKCCQVDEKRRPIAGTEFFI
                     KADLAFIAIGFAGPVEDSVVKEMDGKLEIATDRRGSKSVKANDRDYRTNVDKLYAAGD
                     IRRGQSLVVWAIREGRQAAHAIDADLMGSSVLPR"
     misc_feature    51591..53039
                     /gene="gltD"
                     /locus_tag="BSVBI22_B0055"
                     /note="glutamate synthase subunit beta; Reviewed; Region:
                     gltD; PRK12810"
                     /db_xref="CDD:237213"
     misc_feature    51657..51992
                     /gene="gltD"
                     /locus_tag="BSVBI22_B0055"
                     /note="Dihydroprymidine dehydrogenase domain II, 4Fe-4S
                     cluster; Region: Fer4_20; pfam14691"
                     /db_xref="CDD:258829"
     gene            complement(53090..54493)
                     /locus_tag="BSVBI22_B0056"
                     /db_xref="GeneID:11686199"
     CDS             complement(53090..54493)
                     /locus_tag="BSVBI22_B0056"
                     /note="similar to SP:O06005, GB:M86808, SP:P29803, and
                     PID:190790; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease family protein"
                     /protein_id="YP_005108080.1"
                     /db_xref="GI:376278047"
                     /db_xref="GeneID:11686199"
                     /translation="MNTISKPSVDLHREEEPHLARNLSNRHLQLIAIGGTIGTGLFMG
                     SGKAVSLAGPSILLIYAITGFMLFFVMRALGEILLSNLQYRSFADFAGDYLGPCAQFF
                     TGWTYWLCWIVTAVAEVVAVSGYVSFWFPHLAPWIPALGLITILLILNLPTVRNFGEI
                     EFWFALIKIITIIGLIITGIYMLMTGFVLPNGTQASIAHLWNHGGFFPNGSLGFIAGF
                     QISVFAFVGIELVGTAAAEAENPMRNLPKAINNIPIRIVLFYIGALFVIITVTPWNQV
                     DPNSSPFVAMFSLAGIGIAAHFINFVVLTSASSSSNSGIYSTSRMVYGLATVGLAPKA
                     FSKLSNRKVPVHALIFSCIFLLSSVVLLYAGQSMIQVFTLVTTISALLFIFIWSIILV
                     SYLQYRRKHPERHEKSTFKMPGRRASVVMVFIFFAFVLWALTQEPDTLAAMKVTPLWF
                     VLLGIAYRVMKLKQKQS"
     misc_feature    complement(53102..54481)
                     /locus_tag="BSVBI22_B0056"
                     /note="D-alanine/D-serine/glycine permease; Provisional;
                     Region: PRK11049"
                     /db_xref="CDD:236830"
     misc_feature    complement(53282..>53890)
                     /locus_tag="BSVBI22_B0056"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     gene            complement(54715..55866)
                     /locus_tag="BSVBI22_B0057"
                     /db_xref="GeneID:11686200"
     CDS             complement(54715..55866)
                     /locus_tag="BSVBI22_B0057"
                     /note="similar to GP:15075833; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108081.1"
                     /db_xref="GI:376278048"
                     /db_xref="GeneID:11686200"
                     /translation="MREALTSGKFLKLAGMMLAAAALLLTSLAAATAQERPRTLFDLL
                     FGSRQAQPQRQYERPAPQRVKPKPKRPRASSPAARAAAPSAAAPAVEIATKKPDAKKI
                     LVVGDFIGNGLAEGLDAAFATDPDLTVATRVNGSSGFVRDDYFNWPDNIGKILDEEKP
                     AAVVVMIGANDRQAITANGNSLQPRSPEWNAEYQKRVAAFTKVISDRHYPLVWVGQPP
                     FRPKGMSQDMLALNEIYRNAAEKAGGKFADVWDGFVDEEGNFTQTGFDINGQTARLRA
                     NDGINITSTGKRKLAFYAEKPLHAYLGVSREEGNSLPATHSLDPSKPVDRVAPVSLRD
                     INKDDSGILLGGTPAMQAKPLKTEQKKANPSPGRADDFSWPRNGKAPRK"
     misc_feature    complement(54967..55566)
                     /locus_tag="BSVBI22_B0057"
                     /note="SGNH_peri2; putative periplasmic member of the
                     SGNH-family of hydrolases, a diverse family of lipases and
                     esterases. The tertiary fold of the enzyme is
                     substantially different from that of the alpha/beta
                     hydrolase family and unique among all known...; Region:
                     SGNH_hydrolase_peri2; cd01829"
                     /db_xref="CDD:238867"
     misc_feature    complement(order(55024..55026,55033..55035,55357..55359,
                     55459..55461,55543..55545))
                     /locus_tag="BSVBI22_B0057"
                     /note="active site"
                     /db_xref="CDD:238867"
     misc_feature    complement(order(55024..55026,55033..55035,55543..55545))
                     /locus_tag="BSVBI22_B0057"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238867"
     misc_feature    complement(order(55357..55359,55459..55461,55543..55545))
                     /locus_tag="BSVBI22_B0057"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238867"
     gene            complement(56117..56635)
                     /locus_tag="BSVBI22_B0058"
                     /db_xref="GeneID:11686201"
     CDS             complement(56117..56635)
                     /locus_tag="BSVBI22_B0058"
                     /note="identified by match to PFAM protein family HMM
                     PF00691"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_005108082.1"
                     /db_xref="GI:376278049"
                     /db_xref="GeneID:11686201"
                     /translation="MRTLVMVACAVSLAACSSPPKPPTVSGRHRIPINSPAAQEELRL
                     QVFPQEPTAQATMWPARPPKQTVSVYFPQDVTVFRPTSAQINQLHTLLWPVPKHINVR
                     GLTDNNCPPPGDTQVARVRALAIYNWLINQGVSASRITISYAPVKDYASNAPLSPGRV
                     LNRRVDIEILRK"
     misc_feature    complement(56120..56635)
                     /locus_tag="BSVBI22_B0058"
                     /note="Outer membrane protein and related
                     peptidoglycan-associated (lipo)proteins [Cell envelope
                     biogenesis, outer membrane]; Region: OmpA; COG2885"
                     /db_xref="CDD:225439"
     misc_feature    complement(<56534..56617)
                     /locus_tag="BSVBI22_B0058"
                     /note="Cag pathogenicity island protein Cag12; Region:
                     Cag12; pfam13117"
                     /db_xref="CDD:257508"
     misc_feature    complement(56129..56440)
                     /locus_tag="BSVBI22_B0058"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cl02931"
                     /db_xref="CDD:261518"
     misc_feature    complement(order(56147..56149,56159..56161,56285..56287,
                     56294..56299,56309..56311,56318..56323,56414..56419))
                     /locus_tag="BSVBI22_B0058"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(56784..57869)
                     /locus_tag="BSVBI22_B0059"
                     /db_xref="GeneID:11686202"
     CDS             complement(56784..57869)
                     /locus_tag="BSVBI22_B0059"
                     /note="similar to GP:5929876, and GP:8163894; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB11"
                     /protein_id="YP_005108083.1"
                     /db_xref="GI:376278050"
                     /db_xref="GeneID:11686202"
                     /translation="MMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVN
                     RPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERI
                     QIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKE
                     AGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPD
                     HPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGEAYDFINVAASG
                     HGGSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHD
                     GTGRHISEVWYDPNTKRALSLQHSEKT"
     misc_feature    complement(56928..57485)
                     /locus_tag="BSVBI22_B0059"
                     /note="Type IV secretory pathway component VirB11, and
                     related ATPases. The homohexamer, VirB11 is one of eleven
                     Vir proteins, which are required for T-pilus biogenesis
                     and virulence in the transfer of T-DNA from the Ti
                     (tumor-inducing) plasmid of bacterial to...; Region:
                     VirB11-like_ATPase; cd01130"
                     /db_xref="CDD:238550"
     misc_feature    complement(order(57300..57317,57474..57476))
                     /locus_tag="BSVBI22_B0059"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238550"
     misc_feature    complement(order(57303..57311,57321..57326))
                     /locus_tag="BSVBI22_B0059"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238550"
     misc_feature    complement(order(56988..56990,56997..56999,57009..57017,
                     57045..57050,57057..57059,57069..57071,57108..57110,
                     57114..57122,57192..57197,57201..57212,57234..57236,
                     57258..57260,57315..57320))
                     /locus_tag="BSVBI22_B0059"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238550"
     misc_feature    complement(57090..57107)
                     /locus_tag="BSVBI22_B0059"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238550"
     gene            complement(57850..59025)
                     /locus_tag="BSVBI22_B0060"
                     /db_xref="GeneID:11686203"
     CDS             complement(57850..59025)
                     /locus_tag="BSVBI22_B0060"
                     /note="similar to GP:5929875, and GP:5929875; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB10"
                     /protein_id="YP_005108084.1"
                     /db_xref="GI:376278051"
                     /db_xref="GeneID:11686203"
                     /translation="MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIV
                     VLLLLLVFHMRGNAENNHHSDKTMVQTSTVPMRTFKLPPPPPPPPPAPPEPPAPPPAP
                     AMPIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTT
                     NARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTR
                     LDSTVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTP
                     NGVVIDLDSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSN
                     QINLNTGGGESTSNLASTALKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK"
     misc_feature    complement(57853..>58668)
                     /locus_tag="BSVBI22_B0060"
                     /note="Type IV secretory pathway, VirB10 components
                     [Intracellular trafficking and secretion]; Region: VirB10;
                     COG2948"
                     /db_xref="CDD:225499"
     misc_feature    complement(57880..58419)
                     /locus_tag="BSVBI22_B0060"
                     /note="Bacterial conjugation TrbI-like protein; Region:
                     TrbI; pfam03743"
                     /db_xref="CDD:252141"
     gene            complement(59022..59891)
                     /locus_tag="BSVBI22_B0061"
                     /db_xref="GeneID:11686204"
     CDS             complement(59022..59891)
                     /locus_tag="BSVBI22_B0061"
                     /note="similar to GP:5929874, and GP:5929874; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB9"
                     /protein_id="YP_005108085.1"
                     /db_xref="GI:376278052"
                     /db_xref="GeneID:11686204"
                     /translation="MKRFLLACILITLASPSWATKIPSGSKYDSRIQYVDYNSGDVVL
                     VRALPGVGARIVFAPGENIEDVASGFTQGWEFKASHNILYLKARSMTLSHSNQSIDMA
                     PEPGKWDTNLMVTTDQRMYDFDLRLMPGRNNQRVAYRVQFRYPAAAAAAAVAAAQKRV
                     VQARMNARPSPVNWNYTMQVGTNSASIAPTLAYDDGRFTYLRFPNNRDFPAAFLVAED
                     KSESIVNSHIDPSAPDILVLHRVAKQMVLRLGNKVIGIYNESFNPDGVPARDGTTVPG
                     VKRVIKSPGENLQ"
     misc_feature    complement(<59280..59837)
                     /locus_tag="BSVBI22_B0061"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cl11423"
                     /db_xref="CDD:264360"
     misc_feature    complement(59112..59387)
                     /locus_tag="BSVBI22_B0061"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cd06911"
                     /db_xref="CDD:132874"
     misc_feature    complement(order(59121..59141,59154..59156,59313..59330,
                     59352..59372))
                     /locus_tag="BSVBI22_B0061"
                     /note="VirB7 interaction site; other site"
                     /db_xref="CDD:132874"
     gene            complement(59888..60607)
                     /locus_tag="BSVBI22_B0062"
                     /db_xref="GeneID:11686205"
     CDS             complement(59888..60607)
                     /locus_tag="BSVBI22_B0062"
                     /note="similar to GP:5929873, and GP:5929873; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB8"
                     /protein_id="YP_005108086.1"
                     /db_xref="GI:376278053"
                     /db_xref="GeneID:11686205"
                     /translation="MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRA
                     WKIAGAFGTITVLLGIGIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVM
                     DKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVR
                     TSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARL
                     TNPLGFNVTSYRVDPEMGVVQ"
     misc_feature    complement(59891..60607)
                     /locus_tag="BSVBI22_B0062"
                     /note="Type IV secretory pathway, component VirB8
                     [Intracellular trafficking and secretion]; Region: VirB8;
                     COG3736"
                     /db_xref="CDD:226259"
     gene            complement(60610..60783)
                     /locus_tag="BSVBI22_B0063"
                     /db_xref="GeneID:11686206"
     CDS             complement(60610..60783)
                     /locus_tag="BSVBI22_B0063"
                     /note="similar to GP:5929872; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB7"
                     /protein_id="YP_005108087.1"
                     /db_xref="GI:376278054"
                     /db_xref="GeneID:11686206"
                     /translation="MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKP
                     PLAQPNPVDTYED"
     misc_feature    complement(<60631..60783)
                     /locus_tag="BSVBI22_B0063"
                     /note="META domain; Region: META; cl01245"
                     /db_xref="CDD:260851"
     misc_feature    complement(60727..60783)
                     /locus_tag="BSVBI22_B0063"
                     /note="Prokaryotic membrane lipoprotein lipid attachment
                     site; Region: LPAM_1; pfam08139"
                     /db_xref="CDD:149279"
     gene            complement(60947..61990)
                     /locus_tag="BSVBI22_B0064"
                     /db_xref="GeneID:11686207"
     CDS             complement(60947..61990)
                     /locus_tag="BSVBI22_B0064"
                     /note="similar to GP:8163889, and GP:8163889; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB6"
                     /protein_id="YP_005108088.1"
                     /db_xref="GI:376278055"
                     /db_xref="GeneID:11686207"
                     /translation="MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLY
                     YTAMGILMSVGRIEGPFSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADA
                     FAGNHGTPSSTIYQTLDNSLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGS
                     TLILAGPTGAMIVATNAVIAILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVAL
                     LSAVLSISSAIFSRMVAAINLASATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGS
                     SISAATISLGSLAVNTATSGGGAMTSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSP
                     AYRQHVLGQFNRD"
     misc_feature    complement(60950..61990)
                     /locus_tag="BSVBI22_B0064"
                     /note="Type IV secretory pathway, VirB6 components
                     [Intracellular trafficking and secretion]; Region: VirB6;
                     COG3704"
                     /db_xref="CDD:226227"
     gene            complement(62174..62890)
                     /locus_tag="BSVBI22_B0065"
                     /db_xref="GeneID:11686208"
     CDS             complement(62174..62890)
                     /locus_tag="BSVBI22_B0065"
                     /note="similar to GP:5929870, and GP:5929870; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB5"
                     /protein_id="YP_005108089.1"
                     /db_xref="GI:376278056"
                     /db_xref="GeneID:11686208"
                     /translation="MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKF
                     AQQIEQLKQQFEEQKMQFDALTGYRGLGDILRDPTLRSYLPHNWRDLYEAVMSGGYLA
                     AAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEI
                     ESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLHLYQQMAEAQDKLLDERQHEL
                     DAKDNARRGYPQPKALEAAY"
     misc_feature    complement(62240..62890)
                     /locus_tag="BSVBI22_B0065"
                     /note="P-type DNA transfer protein VirB5; Region: VirB5;
                     TIGR02791"
                     /db_xref="CDD:234016"
     gene            complement(62895..65390)
                     /locus_tag="BSVBI22_B0066"
                     /db_xref="GeneID:11686209"
     CDS             complement(62895..65390)
                     /locus_tag="BSVBI22_B0066"
                     /note="similar to GP:8163887, and GP:8163887; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB4"
                     /protein_id="YP_005108090.1"
                     /db_xref="GI:376278057"
                     /db_xref="GeneID:11686209"
                     /translation="MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWR
                     IAGLAFETQDKEELLIRKDQLNTLFRAIASNNVALWSHNVRRRTWDHLKSFFSNPFCD
                     ALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLFNVAVHRSHAEILQEQQLAIRK
                     LDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALCSQQLEFYNFLLSGEWQKVRVP
                     SCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDYASHTEPGILNGLMYSDYEY
                     VITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDIAIDQLGRGDFVMGEYHY
                     SLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYAQLPCNWRYRPRVAGL
                     TSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHYSKGDEDNFDKKLL
                     GNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAKGTILAIGGKYL
                     AIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRISHAIRTVMRM
                     RPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVLDCPQDQID
                     FNTHSNYGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKWVDDEAFS
                     EFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADYHEYTD
                     GFKVTNEEFDIIRSMSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNNELLD
                     QVIAEVGDDPSVWLPVFQERRKARIASSKSTGR"
     misc_feature    complement(62919..65390)
                     /locus_tag="BSVBI22_B0066"
                     /note="Type IV secretory pathway, VirB4 components
                     [Intracellular trafficking and secretion]; Region: VirB4;
                     COG3451"
                     /db_xref="CDD:225982"
     misc_feature    complement(64227..64841)
                     /locus_tag="BSVBI22_B0066"
                     /note="CagE, TrbE, VirB family, component of type IV
                     transporter system; Region: CagE_TrbE_VirB; pfam03135"
                     /db_xref="CDD:251751"
     gene            complement(65390..65740)
                     /locus_tag="BSVBI22_B0067"
                     /db_xref="GeneID:11686210"
     CDS             complement(65390..65740)
                     /locus_tag="BSVBI22_B0067"
                     /note="similar to GP:5929868, and GP:5929868; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB3"
                     /protein_id="YP_005108091.1"
                     /db_xref="GI:376278058"
                     /db_xref="GeneID:11686210"
                     /translation="MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGS
                     IVLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRAS
                     AYSPIAFTKRKRES"
     misc_feature    complement(65393..65710)
                     /locus_tag="BSVBI22_B0067"
                     /note="Type IV secretory pathway, VirB3 components
                     [Intracellular trafficking and secretion]; Region: VirB3;
                     COG3702"
                     /db_xref="CDD:226225"
     gene            complement(65754..66071)
                     /locus_tag="BSVBI22_B0068"
                     /db_xref="GeneID:11686211"
     CDS             complement(65754..66071)
                     /locus_tag="BSVBI22_B0068"
                     /note="similar to GP:5929867, and GP:5929867; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB2"
                     /protein_id="YP_005108092.1"
                     /db_xref="GI:376278059"
                     /db_xref="GeneID:11686211"
                     /translation="MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVN
                     TSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAAAEIASY
                     LLR"
     misc_feature    complement(65763..66050)
                     /locus_tag="BSVBI22_B0068"
                     /note="TrbC/VIRB2 family; Region: TrbC; pfam04956"
                     /db_xref="CDD:252903"
     gene            complement(66507..67223)
                     /locus_tag="BSVBI22_B0069"
                     /db_xref="GeneID:11686212"
     CDS             complement(66507..67223)
                     /locus_tag="BSVBI22_B0069"
                     /note="similar to GP:5929866, and GP:5929866; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB1"
                     /protein_id="YP_005108093.1"
                     /db_xref="GI:376278060"
                     /db_xref="GeneID:11686212"
                     /translation="MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVR
                     QPVSLDEAITTAQSLEAKGWNFSLGIAQVNRYNLPKYGSTYAQAFDPCKNLKMGSKIL
                     EDCYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTKPGSPSYVQKVVASADVTTKP
                     IAVVPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGAANAPVRLKTE
                     QPATTDAPPGKDNTDGVVVF"
     misc_feature    complement(66759..67175)
                     /locus_tag="BSVBI22_B0069"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(<66918..>67160)
                     /locus_tag="BSVBI22_B0069"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    complement(order(66840..66842,66921..66923,67002..67004,
                     67143..67145))
                     /locus_tag="BSVBI22_B0069"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(67143..67145)
                     /locus_tag="BSVBI22_B0069"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(67727..68953)
                     /locus_tag="BSVBI22_B0070"
                     /db_xref="GeneID:11686213"
     CDS             complement(67727..68953)
                     /locus_tag="BSVBI22_B0070"
                     /note="identified by match to PFAM protein family HMM
                     PF01471"
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase, putative"
                     /protein_id="YP_005108094.1"
                     /db_xref="GI:376278061"
                     /db_xref="GeneID:11686213"
                     /translation="MLRFPFTPEKKLRIKIAATVALAIIGASLSAGTALADAGFRQWI
                     ANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSV
                     AVSQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATL
                     AYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYTVDMD
                     GNGKRDIWNSVPDALGTAANLLHRNGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQI
                     GLVRANGRAFPDPHEKATLKVPDGHQGPAFLMTKNFFVLKRYNNADKYALAVGLLADR
                     IGGYQGLRQDWNRPFTPISMNERLELQTHLKALGYYDGKIGATSRAAIEAFQQRNGLE
                     PDGHPSKEVLSVLRRR"
     misc_feature    complement(67943..68839)
                     /locus_tag="BSVBI22_B0070"
                     /note="lytic murein transglycosylase; Region: MltB_2;
                     TIGR02283"
                     /db_xref="CDD:233810"
     misc_feature    complement(67955..68839)
                     /locus_tag="BSVBI22_B0070"
                     /note="Transglycosylase SLT domain; Region: SLT_2;
                     pfam13406"
                     /db_xref="CDD:257731"
     misc_feature    complement(67739..67897)
                     /locus_tag="BSVBI22_B0070"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_1; pfam01471"
                     /db_xref="CDD:250643"
     gene            69365..70258
                     /gene="galU"
                     /locus_tag="BSVBI22_B0071"
                     /db_xref="GeneID:11686214"
     CDS             69365..70258
                     /gene="galU"
                     /locus_tag="BSVBI22_B0071"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01208"
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="YP_005108095.1"
                     /db_xref="GI:376278062"
                     /db_xref="GeneID:11686214"
                     /translation="MSSIRKIRKAVFPVAGLGTRFLPATKSIPKEMLTVVDKPVIQYV
                     VDEAREAGIEHLIFVTGRNKAVIEDYFDAQVELYSTLAERGKTEELNRLQDLQPQPGT
                     TSFTRQQVPLGLGHAVWCARELVGNEPFALLLPDMVMQSKKGCLAEMVELYEQTGGNI
                     IAVQECDPEEAHKYGIVGKGGAVGNGFEITRMVEKPAKGTAPSNLYINGRYILQPEIF
                     GLLSKQEKGAGNEIQLTDAMLKLADQQKFYGFDYRGLTFDCGSKAGFIEANVAFALWR
                     EDIRPSVEGSIGHLLKTIQPA"
     misc_feature    69386..70186
                     /gene="galU"
                     /locus_tag="BSVBI22_B0071"
                     /note="Prokaryotic UGPase catalyses the synthesis of
                     UDP-glucose; Region: UGPase_prokaryotic; cd02541"
                     /db_xref="CDD:133021"
     misc_feature    order(69401..69412,69452..69457,69686..69688,69695..69706,
                     69764..69766,69770..69775,69884..69889,69944..69949,
                     69983..69985,70067..70069)
                     /gene="galU"
                     /locus_tag="BSVBI22_B0071"
                     /note="active site"
                     /db_xref="CDD:133021"
     misc_feature    order(69413..69415,69422..69436,69440..69448,69458..69466,
                     69470..69478,69488..69490,69560..69562,69566..69574,
                     69578..69580,69590..69595,69680..69685,69689..69691,
                     69695..69697,69881..69883,70055..70057,70127..70129,
                     70145..70153,70157..70165,70169..70177,70184..70186)
                     /gene="galU"
                     /locus_tag="BSVBI22_B0071"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133021"
     gene            complement(70311..71849)
                     /locus_tag="BSVBI22_B0072"
                     /db_xref="GeneID:11686215"
     CDS             complement(70311..71849)
                     /locus_tag="BSVBI22_B0072"
                     /note="similar to GP:14023404; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108096.1"
                     /db_xref="GI:376278063"
                     /db_xref="GeneID:11686215"
                     /translation="MFIACAPIGGLAPLARRLRCLLLAGVALALPHFAYAQDADLRGS
                     ISDDIAAAATDADDAGAGADGFYSPEQDNASSGKGDLSQETPAADPVSEDSTFLLDNI
                     RVGAVLPDDDTVRAQRENLRARPGQGRSFTPEADPYAPIGIRAGSFILKPSLEQGIKA
                     TSNGDNSSNGSRAILNETTLRLNALSDWLQHQASLDASGTFSKSISGQDVSEPQANIL
                     GRLRLDLANQTTVNAETSYRLRRESASSPNGVVDALKRPLVHTFAGRLGVERDTGLLF
                     GRVTGGLEHDMYGNAELASGGTVTQKDRNNTYASVAIRGGFSLSPALKPFAEVELGKR
                     MFDERIDSNGYERSGRQYALRGGLIFDRGEKFNGEIAAGYMQADSDDPRLANISGPSI
                     NAMVNWSPLRGTDMRFFARTMVDTSTTPGVAGSLQHFASLDVTRRVRANLSFNGKLDA
                     NIRQNKDGTGTDYTLGAEIGATYWLNRMVAIDARLRHEFQTSQVADREYKSNSIYVGM
                     KFQK"
     misc_feature    complement(70314..71594)
                     /locus_tag="BSVBI22_B0072"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5338"
                     /db_xref="CDD:227643"
     gene            71990..72991
                     /locus_tag="BSVBI22_B0073"
                     /db_xref="GeneID:11686216"
     CDS             71990..72991
                     /locus_tag="BSVBI22_B0073"
                     /note="similar to GP:15159530; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar isomerase, KpsF/GutQ"
                     /protein_id="YP_005108097.1"
                     /db_xref="GI:376278064"
                     /db_xref="GeneID:11686216"
                     /translation="MEKLDITQKLADAEAAITSALRTIKTENAGLVALEEALNNGLSG
                     PFVEAVERIVASRGRLVVTGVGKSGHIGSKLAATFASTGTSAFFVHSGEANHGDLGMI
                     GLEDVILAISWSGETVELKGIVNYSQRFRIPLIAITSRQDSALGRAADVVLLLPKATE
                     ACPHGLAPTTSTMMQLAIGDALAIALLEARGFTPSDFKTFHPGGSLGASLIHIRDIMH
                     RGNRLPLVKTGTPMPDAMKVLAQKSFGCVVVTDDAGELAGIVTDGDISRNLSRNLSAL
                     AVDDIMTRSPRTIDQNMLASAALKTINENHIGALIVVEANRPIGLVHFHDLLRIGAA"
     misc_feature    72053..72982
                     /locus_tag="BSVBI22_B0073"
                     /note="D-arabinose 5-phosphate isomerase; Provisional;
                     Region: PRK10892"
                     /db_xref="CDD:182814"
     misc_feature    72161..72544
                     /locus_tag="BSVBI22_B0073"
                     /note="KpsF-like protein. KpsF is an arabinose-5-phosphate
                     isomerase which contains SIS (Sugar ISomerase) domains.
                     SIS domains are found in many phosphosugar isomerases and
                     phosphosugar binding proteins. KpsF catalyzes the
                     reversible reaction of ribulose...; Region: SIS_Kpsf;
                     cd05014"
                     /db_xref="CDD:240145"
     misc_feature    order(72191..72193,72323..72325)
                     /locus_tag="BSVBI22_B0073"
                     /note="putative active site [active]"
                     /db_xref="CDD:240145"
     misc_feature    72647..72976
                     /locus_tag="BSVBI22_B0073"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with KpsF/GutQ domains in the API [A5P (D-arabinose
                     5-phosphate) isomerase] protein.  These APIs catalyze the
                     conversion of the pentose pathway...; Region:
                     CBS_pair_KpsF_GutQ_assoc; cd04604"
                     /db_xref="CDD:239977"
     gene            complement(73122..73589)
                     /locus_tag="BSVBI22_B0074"
                     /db_xref="GeneID:11686217"
     CDS             complement(73122..73589)
                     /locus_tag="BSVBI22_B0074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108098.1"
                     /db_xref="GI:376278065"
                     /db_xref="GeneID:11686217"
                     /translation="MIPEFLFQLGIWNWLVFGLILLILEILAPGFFFIWFGLAALVTG
                     ALAFLLSSTAGFGWQLQTVIFLVLAIVFTLAGRRFFGSKSNDTGEPLLNRRGEQLVGQ
                     RATLTEPIVNGHGRIHINDTTWRVKGPDLPAGTEIRIVAFDPVSLEIEVGLGE"
     misc_feature    complement(73140..73571)
                     /locus_tag="BSVBI22_B0074"
                     /note="Membrane protein implicated in regulation of
                     membrane protease activity [Posttranslational
                     modification, protein turnover, chaperones / Intracellular
                     trafficking and secretion]; Region: COG1585"
                     /db_xref="CDD:224501"
     gene            complement(73610..74596)
                     /locus_tag="BSVBI22_B0075"
                     /db_xref="GeneID:11686218"
     CDS             complement(73610..74596)
                     /locus_tag="BSVBI22_B0075"
                     /note="similar to GP:15159532; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="SPFH domain-containing protein/band 7 family
                     protein"
                     /protein_id="YP_005108099.1"
                     /db_xref="GI:376278066"
                     /db_xref="GeneID:11686218"
                     /translation="MTGFDITLLILVALVLAALIASIKTVPQGYNYTIERFGRYTRTL
                     NPGLNLIVPFFDRVGARLNMMEQVLDVPTQEVITRDNAIVGVDAVAFYQVLNAAQAAY
                     QVAKLQYAILNLTMTNIRTVMGSMDLDELLSNRDAINDRLLRVVDEAAHPWGIKITRV
                     EIKDINPPADIVTSMARQMKAERDKRAQVLEAEGNRNAQILRAEGQKQSQILEAEGKL
                     EAAKREAEARERLAEAEAKATTMVSQAVANGNVQALNYFVAQKYTEALSNIASAKNQK
                     IVLMPLEASSLIGSLGGIGAIAREVFGDGSQPAGPAPQPPARARSVPPTGRD"
     misc_feature    complement(73709..74533)
                     /locus_tag="BSVBI22_B0075"
                     /note="Membrane protease subunits, stomatin/prohibitin
                     homologs [Posttranslational modification, protein
                     turnover, chaperones]; Region: HflC; COG0330"
                     /db_xref="CDD:223407"
     misc_feature    complement(74090..74416)
                     /locus_tag="BSVBI22_B0075"
                     /note="Paraslipin or slipin-2 (SLP-2, a subgroup of the
                     stomatin-like proteins (slipins) family; belonging to the
                     SPFH (stomatin, prohibitin, flotillin, and HflK/C)
                     superfamily; Region: SPFH_paraslipin; cd08829"
                     /db_xref="CDD:259811"
     misc_feature    complement(73916..>74251)
                     /locus_tag="BSVBI22_B0075"
                     /note="core domain of the SPFH (stomatin, prohibitin,
                     flotillin, and HflK/C) superfamily; Region: SPFH_like;
                     cl19107"
                     /db_xref="CDD:267460"
     gene            complement(74729..75787)
                     /gene="hemH"
                     /locus_tag="BSVBI22_B0076"
                     /db_xref="GeneID:11686219"
     CDS             complement(74729..75787)
                     /gene="hemH"
                     /locus_tag="BSVBI22_B0076"
                     /note="protoheme ferro-lyase; catalyzes the insertion of a
                     ferrous ion into protoporphyrin IX to form protoheme;
                     involved in protoheme biosynthesis; in some organisms this
                     protein is membrane-associated while in others it is
                     cytosolic"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="YP_005108100.1"
                     /db_xref="GI:376278067"
                     /db_xref="GeneID:11686219"
                     /translation="MSGTDKVRVNVSQTAQTPLHTSAKLPKVGVLLVNLGTPDGTSYG
                     PMRRYLAEFLSDRRVIEWSRLIWYPILYGIVLNTRPRRSGRLYDRIWNHENNESPLRT
                     YTRAQGEKLAKALSDQPNVVVDWAMRYGQPSIESITDRLLQQGCERIVIFPLYPQYSA
                     TTTATVNDKFFEALMKKRFMPAIRTVPSYEAEPVYIDALARSVEKHLATLSFKPEVIL
                     TSYHGIPKSYSDKGDPYRQQCLETTRLLRERLGLGEDEMRATFQSRFGPEEWLQPYTD
                     ETVKELAKNGVKSVAVLNPGFVADCLETVDEIGNEAAEEFLENGGENFSHIPCLNDSE
                     EGMKVIETLVRRELLGWV"
     misc_feature    complement(74732..75712)
                     /gene="hemH"
                     /locus_tag="BSVBI22_B0076"
                     /note="ferrochelatase; Reviewed; Region: hemH; PRK00035"
                     /db_xref="CDD:234585"
     misc_feature    complement(75221..75706)
                     /gene="hemH"
                     /locus_tag="BSVBI22_B0076"
                     /note="Ferrochelatase, N-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_N;
                     cd03411"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(75224..75226,75308..75319,75326..75328,
                     75467..75469,75479..75481,75518..75520,75530..75532,
                     75686..75688))
                     /gene="hemH"
                     /locus_tag="BSVBI22_B0076"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(75302..75307,75623..75631,75641..75643,
                     75683..75685))
                     /gene="hemH"
                     /locus_tag="BSVBI22_B0076"
                     /note="active site"
                     /db_xref="CDD:239504"
     misc_feature    complement(74795..75199)
                     /gene="hemH"
                     /locus_tag="BSVBI22_B0076"
                     /note="Ferrochelatase, C-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_C;
                     cd00419"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(74879..74881,74978..74980,75107..75109,
                     75122..75124))
                     /gene="hemH"
                     /locus_tag="BSVBI22_B0076"
                     /note="active site"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(74795..74797,74870..74872,74882..74884,
                     74888..74896,74900..74902,75062..75064,75074..75076,
                     75083..75091))
                     /gene="hemH"
                     /locus_tag="BSVBI22_B0076"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238240"
     gene            complement(75925..76305)
                     /gene="omp10"
                     /locus_tag="BSVBI22_B0077"
                     /db_xref="GeneID:11686220"
     CDS             complement(75925..76305)
                     /gene="omp10"
                     /locus_tag="BSVBI22_B0077"
                     /note="similar to GP:13877130, and GP:13877130; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein Omp10"
                     /protein_id="YP_005108101.1"
                     /db_xref="GI:376278068"
                     /db_xref="GeneID:11686220"
                     /translation="MKRFRIVAPLALMSLALAACETTGPGSGNAPIIAHTPAGIEGSW
                     VDPNGIASSFNGGIFETRTTDTNEKLAEGNYLYLSPQLVEINMRSIVRGTTSKVNCAL
                     VSPTQLNCTSSAGSRFSLTRRNAG"
     gene            complement(76447..77892)
                     /locus_tag="BSVBI22_B0078"
                     /db_xref="GeneID:11686221"
     CDS             complement(76447..77892)
                     /locus_tag="BSVBI22_B0078"
                     /note="similar to GP:2276407; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="homospermidine synthase"
                     /protein_id="YP_005108102.1"
                     /db_xref="GI:376278069"
                     /db_xref="GeneID:11686221"
                     /translation="MAREKWQVYGEITGPIIMIGFGSIGRGTLPLIERHFKFDQSQMV
                     VIDPSEKNRKILDEKNIRFIKQAITRDNYKDVLGPLLKGVKGQPFVVNLSVDTSSLDL
                     MRFVRECGALYIDTVVEPWLGFYFDAQADNAAWTNYALRETVRSEKRKNPGGPTAVSC
                     CGANPGMVSWFVKKALVDLAAELKLDFTEPAPQDRHGWAKLMKKAGVKGIHIAERDTQ
                     RARKPKPFNTFWNTWSVEGFIAEGLQPAELGWGSHEKWKPKNARKQKKGNKAAIFLEQ
                     PGGNTRIRTWCPTLGAQYGLLVTHNEAISIADFFTLRDKKGKLDFRLTCHYAYHPCND
                     AIVSLDEMFGAGGKAQPVQHVLEENEILDGADELGVLLYGHARNAYWYGSQLTVQEAR
                     KLAPYQNATGLQVSSAVLAGMVWALENPQSGIVETDEMDYRRCLEVQMQYLGPVKGYY
                     TDWTPLEGRDGLFEEDVDRKDPWQFRNVLVR"
     misc_feature    complement(76450..77892)
                     /locus_tag="BSVBI22_B0078"
                     /note="Homospermidine synthase [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: COG5310"
                     /db_xref="CDD:227626"
     misc_feature    complement(76537..77847)
                     /locus_tag="BSVBI22_B0078"
                     /note="Saccharopine dehydrogenase; Region: Saccharop_dh;
                     pfam03435"
                     /db_xref="CDD:251951"
     gene            complement(78004..78684)
                     /locus_tag="BSVBI22_B0079"
                     /db_xref="GeneID:11686222"
     CDS             complement(78004..78684)
                     /locus_tag="BSVBI22_B0079"
                     /note="similar to GP:14023390, and GP:14023390; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108103.1"
                     /db_xref="GI:376278070"
                     /db_xref="GeneID:11686222"
                     /translation="MSSESTVRDGSKAVTSEPDYQLIETMRWEPLAGVLRFDLHMARL
                     ENSARELNFACNMDVIRQKIAESGTGDQALKLRLTLAPDGVATVAALPYEALPQQTVW
                     RITIARTRLDHTDPLLRYKTTRRQAYIAAREEYSPAEVDEVILLNERGEVCEGTITSI
                     FLDIGGTACTTPALSCGLLDGVMRRELLDKGVASEEVVSVDMLKSARNILVGNSLRGM
                     IRAKLIES"
     misc_feature    complement(78013..78636)
                     /locus_tag="BSVBI22_B0079"
                     /note="hypothetical protein; Provisional; Region:
                     PRK07546"
                     /db_xref="CDD:169002"
     misc_feature    complement(order(78043..78045,78136..78141,78223..78225,
                     78322..78324,78556..78558))
                     /locus_tag="BSVBI22_B0079"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238254"
     misc_feature    complement(order(78223..78225,78322..78324,78556..78558))
                     /locus_tag="BSVBI22_B0079"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238254"
     misc_feature    complement(order(78244..78246,78286..78288,78298..78300,
                     78304..78306,78316..78318,78418..78420,78454..78456,
                     78460..78462,78535..78537))
                     /locus_tag="BSVBI22_B0079"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238254"
     misc_feature    complement(78322..78324)
                     /locus_tag="BSVBI22_B0079"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238254"
     gene            complement(78618..79787)
                     /locus_tag="BSVBI22_B0080"
                     /db_xref="GeneID:11686223"
     CDS             complement(78618..79787)
                     /locus_tag="BSVBI22_B0080"
                     /note="catalyzes the formation of
                     4-amino-4-deoxychorismate from chorismate and glutamine"
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate synthase"
                     /protein_id="YP_005108104.1"
                     /db_xref="GI:376278071"
                     /db_xref="GeneID:11686223"
                     /translation="MTRPGNKPLILFRDDKAGRDVLFAAPSRIIRADTPDEFEPAWEA
                     MQRAHEAGEWLAGYLSYEAGYLLEPKLRPLLPEGRKTPLLCFGVFDGPSDEQLHVRDS
                     ENATYLRNPVAQWSFEDYAPRFERLHRHLREGNCYQGNLTFPVTAQWGGDPLILFNML
                     AKRQPVRYATYCDLGGPVVLSRSPELFFKVDGDGWIETHPMKGTMPRGATPEEDERNR
                     QFLLNDPKNQAENRMIVDLLRNDISLVSEVGSLDVPELFRVESYLTVHQMISRVRARP
                     KSGLHLRAVFAALFPCGSITGAPKISAMKILRRLETGPRDIYCGSLGWIEPGGRMRFN
                     VAIRTISLLGGNRAIFNVGGGVVFDSTAQAEYEECLLKARFATGQKPLPANRIIS"
     misc_feature    complement(78636..79766)
                     /locus_tag="BSVBI22_B0080"
                     /note="aminodeoxychorismate synthase; Provisional; Region:
                     PRK07508"
                     /db_xref="CDD:236035"
     misc_feature    complement(78660..79625)
                     /locus_tag="BSVBI22_B0080"
                     /note="chorismate binding enzyme; Region: Chorismate_bind;
                     cl10555"
                     /db_xref="CDD:263998"
     gene            complement(79797..81659)
                     /gene="pepF"
                     /locus_tag="BSVBI22_B0081"
                     /db_xref="GeneID:11686224"
     CDS             complement(79797..81659)
                     /gene="pepF"
                     /locus_tag="BSVBI22_B0081"
                     /note="identified by match to PFAM protein family HMM
                     PF01432"
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="YP_005108105.1"
                     /db_xref="GI:376278072"
                     /db_xref="GeneID:11686224"
                     /translation="MKFMVYRFSSDAILRAPAADAIAAKKHDLGNLPEWNLADLYPAP
                     DSPQLASDLEKAMQDSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGS
                     YAGLYYYGDTTDPKRMKLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAI
                     GHYRPWLTDLRMDKPYQLDDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLA
                     IEPTLNMLQDADGAVRKQASEALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIA
                     DSQHLSNRVEREVVDALAKAVEDAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETP
                     QALIPWDEARETVLSAYGNFAPEMADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSA
                     HPYVLLNYMGKPHNVMTLAHELGHGVHQVLAGSQGALMASTPLTLAETASVFGEMLTF
                     RLLLERTRDKRERKAMLAQKAEDMINTVVRQIAFYQFERRVHTERRAGELTSERIGEI
                     WMDVQRESLGDAVRLNPGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQNSEK
                     GFQQKYFEMLKAGGTKHHKELLAPFGLDASDPGFWNKGLSVIEGIIDELEAMED"
     misc_feature    complement(79806..81560)
                     /gene="pepF"
                     /locus_tag="BSVBI22_B0081"
                     /note="oligoendopeptidase, pepF/M3 family; Region:
                     M3_fam_3; TIGR02290"
                     /db_xref="CDD:233812"
     misc_feature    complement(79833..81257)
                     /gene="pepF"
                     /locus_tag="BSVBI22_B0081"
                     /note="Peptidase family M3B Oligopeptidase F (PepF);
                     Region: M3B_PepF_5; cd09610"
                     /db_xref="CDD:189017"
     misc_feature    complement(order(80019..80021,80031..80033,80052..80054,
                     80343..80345,80412..80414,80421..80426))
                     /gene="pepF"
                     /locus_tag="BSVBI22_B0081"
                     /note="active site"
                     /db_xref="CDD:189017"
     misc_feature    complement(order(80343..80345,80412..80414,80424..80426))
                     /gene="pepF"
                     /locus_tag="BSVBI22_B0081"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:189017"
     gene            82007..83497
                     /locus_tag="BSVBI22_B0082"
                     /db_xref="GeneID:11686225"
     CDS             82007..83497
                     /locus_tag="BSVBI22_B0082"
                     /note="similar to GP:15159542; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54 dependent DNA-binding response
                     regulator"
                     /protein_id="YP_005108106.1"
                     /db_xref="GI:376278073"
                     /db_xref="GeneID:11686225"
                     /translation="MATRILIADDDPIQRRNLEAIVMRMGYRTILADGGVSALGFISQ
                     RKDIVLVLLDLTMPDMDGLTVLSRMRAAGVAVPVIVLVHSDDMHRVAQAIRLGAADFM
                     IKPVIFERVQVSVANVLKLDALTHEIQRARSSPRVHLSLSEMVAKSPEMERVMVLARR
                     AAALDAPLLVEGETGSGRQTLARAICGGGSRWRGPFVSLDCRGLTMENADDILFGTAK
                     FCPDDPIVSAGKLAEADGGVLFLDEVGALPHHTQLRLFTAMQSGQYESNGSRVTSNAR
                     IMTSSSQPLVDFVHMGRFHAGLYHLLGSFSIAMPPLRERVEDISILVHQFAVRFASEE
                     RLSHITGIAPHLLERLKAYQWPGNVRELKNAVYRAVLLCDKSELTVEDFAQLNLGAAG
                     FAGAQAMWQKPAAPLSVGRAGTAFSGIDADGEVRTLAAAEEEMIRFAIAHYDGQISEV
                     ARRLGIGRTTLYRKLKEYGIDVASISGKGKESDLENESCSWGRAAI"
     misc_feature    82007..83440
                     /locus_tag="BSVBI22_B0082"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    82022..82363
                     /locus_tag="BSVBI22_B0082"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(82031..82036,82166..82168,82190..82192,82250..82252,
                     82307..82309,82316..82321)
                     /locus_tag="BSVBI22_B0082"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    82166..82168
                     /locus_tag="BSVBI22_B0082"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(82175..82180,82184..82192)
                     /locus_tag="BSVBI22_B0082"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    82316..82324
                     /locus_tag="BSVBI22_B0082"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    82505..82870
                     /locus_tag="BSVBI22_B0082"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    82520..82543
                     /locus_tag="BSVBI22_B0082"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(82523..82546,82730..82732,82847..82849)
                     /locus_tag="BSVBI22_B0082"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    82718..82735
                     /locus_tag="BSVBI22_B0082"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    83285..83410
                     /locus_tag="BSVBI22_B0082"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            83838..85751
                     /locus_tag="BSVBI22_B0083"
                     /db_xref="GeneID:11686226"
     CDS             83838..85751
                     /locus_tag="BSVBI22_B0083"
                     /note="similar to GP:14023385; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108107.1"
                     /db_xref="GI:376278074"
                     /db_xref="GeneID:11686226"
                     /translation="MRARASISAGLAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAE
                     IAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQVYQSTGSREYITVVSA
                     YRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIGMRYQIGGVGYYPR
                     SGSPFVHMDVGNVRHWPRMSRRELLALFPDGKTVHIPTDGKPLPGYEQALAMIEKRKA
                     GGGTIMMASNSSSRKRKSLFAALFGGGGADEEEDNGDTAAPATARPARATAPTRQAPA
                     AVPAAPVEQPRETMVAALPARDAPVPMQAPRPETGLDAQAAAAETPVAAFNVPVPAHK
                     PQMAPQDAVALAAAEDPAAAARAAVDANTAQVADAGMSAALTNGFVPVPSARPHLETD
                     NVQLAAAVIPTARPERPGEHPARGQDAIAALVNSQSDEPAQMAGEMADATGNAVAPQP
                     GKTAAFPLPTQAPRADTKLAMVSRRDEIGELIAPPEDDYDYDAKPVAAAAPKQAPAPV
                     QMASAAPTKPAAVASAAMRKKAAIIGKTADTGVRTTTKGARHMAKAPSRPRPVIRPAV
                     MPSSEIAMSTEPVSSTVPVTSPVLRNDALRSAPTMVYTAGFQRGDLPSARANQFSGNA
                     VTFLTVAKFTETN"
     misc_feature    83838..84374
                     /locus_tag="BSVBI22_B0083"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3108"
                     /db_xref="CDD:225650"
     misc_feature    83907..84365
                     /locus_tag="BSVBI22_B0083"
                     /note="Bacterial protein of unknown function (DUF882);
                     Region: Peptidase_M15_2; pfam05951"
                     /db_xref="CDD:253473"
     gene            complement(85817..86453)
                     /gene="eda"
                     /locus_tag="BSVBI22_B0084"
                     /note="This region contains an authentic frame shift and
                     is not the result of a sequencing artifact;
                     2-dehydro-3-deoxyphosphogluconate
                     aldolase/4-hydroxy-2-oxoglutarate aldolase, authentic
                     frameshift; similar to GP:15075909, GB:D13626, and
                     PID:285995; identified by sequence similarity; putative"
                     /db_xref="GeneID:11686227"
     gene            complement(86648..87223)
                     /locus_tag="BSVBI22_B0085"
                     /note="This region contains an authentic point mutation,
                     causing a premature stop, and is not the result of a
                     sequencing artifact; conserved hypothetical protein,
                     authentic point mutation; similar to GP:4063783, and
                     GP:4063783; identified by sequence similarity; putative"
                     /db_xref="GeneID:11686228"
     gene            87345..88271
                     /locus_tag="BSVBI22_B0086"
                     /db_xref="GeneID:11686229"
     CDS             87345..88271
                     /locus_tag="BSVBI22_B0086"
                     /note="identified by match to PFAM protein family HMM
                     PF00581"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese family protein"
                     /protein_id="YP_005108108.1"
                     /db_xref="GI:376278075"
                     /db_xref="GeneID:11686229"
                     /translation="MDPMSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLL
                     LAAEGINGTVAGSAGAIEKLIAHITAIPGLGEPELKYSHASEMPFHRMKVRLKREIVT
                     MGVEGIDPLKSVGTYIAPKDWNALIADENTVVVDTRNDYEYAIGTFEGAIDPQTRTFR
                     EFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVP
                     REQSVWNGECFVFDERVAVGHGLAESDVELCRACRRPLTPQDKLSQFFEEGVSCAGCY
                     AERTPEDRARYAERQKQVKLAEKRGANKHIGS"
     misc_feature    87366..88268
                     /locus_tag="BSVBI22_B0086"
                     /note="Predicted sulfurtransferase [General function
                     prediction only]; Region: COG1054"
                     /db_xref="CDD:223982"
     misc_feature    87687..87989
                     /locus_tag="BSVBI22_B0086"
                     /note="Member of the Rhodanese Homology Domain
                     superfamily. This CD includes Escherichia coli YceA,
                     Bacillus subtilis YbfQ, and similar uncharacterized
                     proteins; Region: RHOD_YceA; cd01518"
                     /db_xref="CDD:238776"
     misc_feature    87888..87890
                     /locus_tag="BSVBI22_B0086"
                     /note="active site residue [active]"
                     /db_xref="CDD:238776"
     gene            88306..88512
                     /locus_tag="BSVBI22_B0087"
                     /db_xref="GeneID:11686230"
     CDS             88306..88512
                     /locus_tag="BSVBI22_B0087"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108109.1"
                     /db_xref="GI:376278076"
                     /db_xref="GeneID:11686230"
                     /translation="MNHTMVAPILERYEFVTEFSGRLLHGRPCIKGLTASGSRLPPSH
                     PSSQVEASDRVRCLSVNSAGFSGG"
     gene            88552..89307
                     /gene="modA"
                     /locus_tag="BSVBI22_B0088"
                     /db_xref="GeneID:11686231"
     CDS             88552..89307
                     /gene="modA"
                     /locus_tag="BSVBI22_B0088"
                     /note="similar to GP:15157753; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter, periplasmic
                     molybdenum-binding protein"
                     /protein_id="YP_005108110.1"
                     /db_xref="GI:376278077"
                     /db_xref="GeneID:11686231"
                     /translation="MKKLIAAFLITIAAGAASVAQAAEKVTVFAAASMKDVIEEAARQ
                     IKARDGTEVVASFASSSALARQIEQGAPAQIFISADLDWMDYVEKAGLIDKASRKIIA
                     GNALVIAAQKDTPKGDARELLSADRFAMGDPSNVPAGKYGKAALEKLDIWKEVEKNAV
                     FTENVRVALRYVSLAEVKTAIVYASDRVAAPELVEAYRFPADSHAPILYPAALLKKNE
                     SDAARTFLAFLESDAGQAIIKDKGFVGAAEAAE"
     misc_feature    88561..89280
                     /gene="modA"
                     /locus_tag="BSVBI22_B0088"
                     /note="ABC-type molybdate transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: ModA; COG0725"
                     /db_xref="CDD:223797"
     gene            89318..90004
                     /gene="modB"
                     /locus_tag="BSVBI22_B0089"
                     /gene_synonym="chlJ"
                     /db_xref="GeneID:11686232"
     CDS             89318..90004
                     /gene="modB"
                     /locus_tag="BSVBI22_B0089"
                     /gene_synonym="chlJ"
                     /note="part of ModCBA molybdate transporter; member of ABC
                     superfamily; inner membrane component; regulated by
                     repressor protein ModE"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter permease protein"
                     /protein_id="YP_005108111.1"
                     /db_xref="GI:376278078"
                     /db_xref="GeneID:11686232"
                     /translation="MIMESNIWQIVLLSLRVAGIAIIIALPLAFLVGWLLARFHFPGK
                     SLVQAIVTMPLVLPPVVTGYLLLILFGARGPLGAPLQEWLGLSFAFRWTGAALAAGVM
                     AFPLLVRPIRLSIEGLDRGLEEAARTLGASRFTAFFTVILPPLLPGILAGAVLGFAKA
                     LGEFGATITFVSNIPGETQTLSLAIYTLLQTPSGDAEAFRLIAVSATISIAAVVLSEW
                     LQRRLAGGVK"
     misc_feature    89321..89992
                     /gene="modB"
                     /locus_tag="BSVBI22_B0089"
                     /gene_synonym="chlJ"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    89351..89887
                     /gene="modB"
                     /locus_tag="BSVBI22_B0089"
                     /gene_synonym="chlJ"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(89396..89401,89408..89413,89426..89428,89456..89467,
                     89471..89500,89507..89512,89516..89518,89618..89623,
                     89627..89629,89633..89635,89642..89647,89651..89653,
                     89663..89668,89675..89677,89726..89728,89768..89773,
                     89780..89782,89801..89812,89819..89824,89861..89866)
                     /gene="modB"
                     /locus_tag="BSVBI22_B0089"
                     /gene_synonym="chlJ"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(89474..89518,89801..89818)
                     /gene="modB"
                     /locus_tag="BSVBI22_B0089"
                     /gene_synonym="chlJ"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(89516..89518,89603..89605,89819..89821,89855..89857,
                     89864..89866)
                     /gene="modB"
                     /locus_tag="BSVBI22_B0089"
                     /gene_synonym="chlJ"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(89678..89716,89732..89737,89747..89749)
                     /gene="modB"
                     /locus_tag="BSVBI22_B0089"
                     /gene_synonym="chlJ"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            90001..91080
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /db_xref="GeneID:11686233"
     CDS             90001..91080
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="similar to SP:P09833; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter, ATP-binding protein"
                     /protein_id="YP_005108112.1"
                     /db_xref="GI:376278079"
                     /db_xref="GeneID:11686233"
                     /translation="MSGLTVSIRGRNGAFAIEAGFAAEGGVTALFGHSGAGKTTLLKM
                     IAGTLRPENGRIAVGDFTLFDAQKGINLPPEKRCIGYVFQDARLFAYMSVKRNLTYAR
                     WAGHRQATRSFDEVVALLGIGHLLDRRPSTLSGGERQRVAIGRALLSDPALLLLDEPL
                     SSLDHARRQEILPFIERLRDESHVPIVYVSHEIDEVARLADQIVLLSAGRVTASGAAA
                     DIFPLIDAESEGGGVLLEGIVSAYDERYKLAEIDLGGASFQLSDAGLKQTMHVRLRVR
                     ARDVSIARKIPEAISIRNLLPVTVTGIERGEGPNAHVFLDFRGRRLGARLTRRSVDDL
                     GLSVGDQVVALVKAVSVDRAAIREK"
     misc_feature    90007..91059
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="ABC-type molybdate transport system, ATPase
                     component [Inorganic ion transport and metabolism];
                     Region: ModC; COG4148"
                     /db_xref="CDD:226628"
     misc_feature    90010..90645
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    90094..90117
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(90103..90108,90112..90120,90250..90252,90469..90474,
                     90571..90573)
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    90241..90252
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    90397..90426
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    90457..90474
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    90481..90492
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    90559..90579
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    90868..91053
                     /gene="modC"
                     /locus_tag="BSVBI22_B0090"
                     /note="TOBE domain; Region: TOBE; cl01440"
                     /db_xref="CDD:260939"
     gene            91150..91827
                     /locus_tag="BSVBI22_B0091"
                     /db_xref="GeneID:11686234"
     CDS             91150..91827
                     /locus_tag="BSVBI22_B0091"
                     /note="identified by match to PFAM protein family HMM
                     PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_005108113.1"
                     /db_xref="GI:376278080"
                     /db_xref="GeneID:11686234"
                     /translation="MTDLQNWTSRPKPERKIFEGRYVRLEPLNAQKHGDELFAASSVE
                     DAEQRFTWLFETPPATRAEFEPWLDKASKSDDPLFFAVIDKASGKVAGRQALMRIDPA
                     NGVIEIGSIYWGPLISRRPAATEAQFLFMQYVFDVLGYRRYEWKCHNENGPSRRAAER
                     FGFRFEGIFRQHMVVKGRNRDTAWFSVLDSEWPALKQAYQAWLAPENFDSAGQQKKTL
                     QEFRDLG"
     misc_feature    91210..91737
                     /locus_tag="BSVBI22_B0091"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    91309..91704
                     /locus_tag="BSVBI22_B0091"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            91814..92023
                     /locus_tag="BSVBI22_B0092"
                     /db_xref="GeneID:11686235"
     CDS             91814..92023
                     /locus_tag="BSVBI22_B0092"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108114.1"
                     /db_xref="GI:376278081"
                     /db_xref="GeneID:11686235"
                     /translation="MILAERKESNPAIAAAIILIGFGVLAYFVPSIMLVLGKHSQIAA
                     IIFPIVFVLGFFAIFWLRSKGQNKN"
     gene            complement(92075..92428)
                     /locus_tag="BSVBI22_B0093"
                     /db_xref="GeneID:11686236"
     CDS             complement(92075..92428)
                     /locus_tag="BSVBI22_B0093"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108115.1"
                     /db_xref="GI:376278082"
                     /db_xref="GeneID:11686236"
                     /translation="MQMYIKFHIVFIIFTHLLYVLSIIVGLRGWPFWTSLTVAISMIG
                     FSFIFSYSDYGSVPSNVSKTTSAIVATSFAVACGLTVVAIAPPLAFTRRIIFMIIGVL
                     FIIILGQINRYRINF"
     gene            complement(92485..92826)
                     /locus_tag="BSVBI22_B0094"
                     /db_xref="GeneID:11686237"
     CDS             complement(92485..92826)
                     /locus_tag="BSVBI22_B0094"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01598"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108116.1"
                     /db_xref="GI:376278083"
                     /db_xref="GeneID:11686237"
                     /translation="MIHAFKHSIWTWLGILGGALTLLSNLQGILDLAEWADWIISKWQ
                     KLIMPAVSSLIKFVGIRVSNDAASMIVMAIFVSFIAIGARTENEFKGKNREIRAIKWS
                     NIFNINIYILG"
     gene            complement(92968..94071)
                     /locus_tag="BSVBI22_B0095"
                     /db_xref="GeneID:11686238"
     CDS             complement(92968..94071)
                     /locus_tag="BSVBI22_B0095"
                     /note="identified by match to PFAM protein family HMM
                     PF03741"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108117.1"
                     /db_xref="GI:376278084"
                     /db_xref="GeneID:11686238"
                     /translation="MRRTAGFMIALCLTMIVAQAYAQSSLGIGANEVAMKPTGPFAHI
                     ILWMNEQQRSFYLAMTTALKAMREDPLQAAWGLVGLSFIYGIFHAVGPGHGKAVISSY
                     MIANETALRRGIFLSFISSLLQAIMAVAVVGLAWLVLRGTGISMNQTAHYMEIASFAL
                     VLFFGLWLLVRKLPQLFRKRDHAGAGPASPLFAAAPQPAIVSGPAWQGSISQATRTAA
                     TSSTVKLNYKPATAATDHIFIGEGDVCAACGNAHIVDPSTLGDDFNWKTAWSAIFSVG
                     LRPCSGALIVLTFALLNGLMVGGLLSVFAMALGTFITVAVLATLAVTAKNTALRFAGS
                     KAMSGRLKAAIEVCAALFITLTGALLLSAALVK"
     misc_feature    complement(92971..94014)
                     /locus_tag="BSVBI22_B0095"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG2215"
                     /db_xref="CDD:225125"
     gene            complement(94071..94775)
                     /locus_tag="BSVBI22_B0096"
                     /db_xref="GeneID:11686239"
     CDS             complement(94071..94775)
                     /locus_tag="BSVBI22_B0096"
                     /note="similar to GP:15158721; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108118.1"
                     /db_xref="GI:376278085"
                     /db_xref="GeneID:11686239"
                     /translation="MKFSMLVSLWPRRSFVRSAAIALLAGCLPTLAHAHPHVFAEARL
                     ELTIAPDGTVQQLAHVWRFDDVFSSTVLMEFDKKGDLQLDHKELVDLAHVINSSIAEF
                     KYFQSVLADGKDVKMARPTDLAAAFTDNRLLIVFTSKPEKPLKLAPGHKVSFGVYDPT
                     FYTAIDYVKDSDLVVKGLPAGCTSKVIRPDPDEAIAQNQATLTDAFFNDPTGTDMSKI
                     FATRLEIDCAAKGKTG"
     misc_feature    complement(94095..94736)
                     /locus_tag="BSVBI22_B0096"
                     /note="ABC-type uncharacterized transport system,
                     periplasmic component [General function prediction only];
                     Region: COG3683"
                     /db_xref="CDD:226208"
     gene            complement(94815..95708)
                     /locus_tag="BSVBI22_B0097"
                     /db_xref="GeneID:11686240"
     CDS             complement(94815..95708)
                     /locus_tag="BSVBI22_B0097"
                     /note="identified by match to PFAM protein family HMM
                     PF02492"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005108119.1"
                     /db_xref="GI:376278086"
                     /db_xref="GeneID:11686240"
                     /translation="MDTLTRMRAFIDVVEAEGFSAAARKIGRSKALLSKYVRELEDEL
                     GARLLNRTTRQFSLTEAGHTYYHRALEIIREIDALQDAVSETSSDARGRIKLSAPRTF
                     TDAVIGQSLIDFCLAHPEIVLDVRLDDRFVDLVEEGFDLAIRITRLQDSSLIAKRLSP
                     FHSVLCGAPELIARVGKPQRPEDLTDRPCIVDTNARARNNWHFRNMDGSMMTVPVSGP
                     IEINSPVATKNAALAGLGFCMLPAFIAEDEIEQGKLITCLDEFIVRDGGIYAVYPHRR
                     YLPAKIRALVDFMTQWFKERE"
     misc_feature    complement(95520..95699)
                     /locus_tag="BSVBI22_B0097"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(94836..95681)
                     /locus_tag="BSVBI22_B0097"
                     /note="LysR family transcriptional regulator; Provisional;
                     Region: PRK14997"
                     /db_xref="CDD:184959"
     misc_feature    complement(94842..95435)
                     /locus_tag="BSVBI22_B0097"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(94905..94907,94986..94988,95037..95039,
                     95226..95228,95232..95234,95274..95276,95391..95393,
                     95403..95405))
                     /locus_tag="BSVBI22_B0097"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(95010..95012,95019..95024,95043..95057,
                     95145..95147,95328..95348,95352..95354,95364..95366,
                     95373..95378,95382..95387,95397..95402))
                     /locus_tag="BSVBI22_B0097"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            complement(95712..96917)
                     /locus_tag="BSVBI22_B0098"
                     /db_xref="GeneID:11686241"
     CDS             complement(95712..96917)
                     /locus_tag="BSVBI22_B0098"
                     /note="catalyzes the hydrolysis of a monocarboxylic acid
                     amid to form a monocarboxylate and ammonia"
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="YP_005108120.1"
                     /db_xref="GI:376278087"
                     /db_xref="GeneID:11686241"
                     /translation="MANLDPFNALIAKPEKPLAHAASGPLAGERLAVKDIYDIAGMVT
                     GCGNPQILAESPVARKSAPVVEKLLAAGAEFIGKAQMDEVAFSMMGQNSHYPYPINPA
                     APDRVTGGSSSGSAAAVAGKLADIALGSDTGGSIRTPASFCGLIGLRSTHGRIPLEGI
                     MPLAPSLDTIGWFARDIALYEKVGAVLLGDDAQEFKLTQLLYMPVLEQLLLGQAETDA
                     YRAMFAKVRPHFATLKAASQPTLSIDELYLAFRQIQGAEAWENHGAWISSGNRQLGPG
                     IADRFAYGAEMTADMVKNQRARRARFAEEFEAIIGESAVLALPTVPGAAPLTGEPFEA
                     LQAYREQALRLLCLSGLSGLPQITLPLGSLRPGGTMHDAPFGISFIGPRGSDRTLIAL
                     AQTIISERS"
     misc_feature    complement(95715..96917)
                     /locus_tag="BSVBI22_B0098"
                     /note="amidase; Provisional; Region: PRK08310"
                     /db_xref="CDD:181375"
     gene            97502..98635
                     /locus_tag="BSVBI22_B0099"
                     /db_xref="GeneID:11686242"
     CDS             97502..98635
                     /locus_tag="BSVBI22_B0099"
                     /note="similar to SP:O50657; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine/DAP/arginine decarboxylase family
                     decarboxylase 2"
                     /protein_id="YP_005108121.1"
                     /db_xref="GI:376278088"
                     /db_xref="GeneID:11686242"
                     /translation="MATQRIIDFLNTRRPEGPCLVVDTDVVRENYQGFEKALPYSRIF
                     YAVKANPAPEILRLLASLGSSFDTASVAEIEMALEAGATPDRISYGNTIKKERDIARA
                     FDLGIRLYAVDCVEEVEKIARVAPGSRVFCRVLTDGEGAEWPLSRKFGCVPAMAKDVL
                     RRAKALGLDAYGVSFHVGSQQTDLTAWDRALADAAAVFRTLADEGIILRMVNMGGGFP
                     TRYLKDVPTAQAYGMAIFDALSRHFGNRIPETIIEPGRGMVGNAGVIKTEVVLVSRKA
                     DNDNVRWVYLDIGKFGGLAETMDEAIRYQIVTPHDGSETEPCVLAGPTCDSADVLYEK
                     TPYPLPVSLTIGDEILIEGTGAYTTTYSAVAFNGFEPLRSYVI"
     misc_feature    97535..98632
                     /locus_tag="BSVBI22_B0099"
                     /note="Diaminopimelate decarboxylase [Amino acid transport
                     and metabolism]; Region: LysA; COG0019"
                     /db_xref="CDD:223098"
     misc_feature    97547..98632
                     /locus_tag="BSVBI22_B0099"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Ornithine Decarboxylase; Region: PLPDE_III_ODC;
                     cd00622"
                     /db_xref="CDD:143482"
     misc_feature    order(97550..97552,97643..97645,97706..97711,97715..97720,
                     97784..97786,97799..97801,97838..97840,97847..97849,
                     97859..97861,97940..97948,98309..98311,98315..98320,
                     98348..98350,98354..98356,98360..98362,98369..98374,
                     98396..98398,98402..98404,98465..98467,98471..98473,
                     98477..98479,98486..98488,98582..98584,98588..98590,
                     98597..98605,98609..98611)
                     /locus_tag="BSVBI22_B0099"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143482"
     misc_feature    order(97637..97639,97643..97645,97700..97702,97898..97900,
                     98027..98029,98036..98038,98144..98149,98258..98269,
                     98399..98401,98474..98476,98570..98572)
                     /locus_tag="BSVBI22_B0099"
                     /note="active site"
                     /db_xref="CDD:143482"
     misc_feature    order(97637..97639,97643..97645,97700..97702,97898..97900,
                     98027..98029,98036..98038,98144..98149,98258..98269,
                     98474..98476,98570..98572)
                     /locus_tag="BSVBI22_B0099"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143482"
     misc_feature    order(97643..97645,98474..98476)
                     /locus_tag="BSVBI22_B0099"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143482"
     misc_feature    order(98396..98401,98474..98479,98570..98572,98597..98599)
                     /locus_tag="BSVBI22_B0099"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143482"
     gene            complement(98711..100429)
                     /locus_tag="BSVBI22_B0100"
                     /db_xref="GeneID:11686243"
     CDS             complement(98711..100429)
                     /locus_tag="BSVBI22_B0100"
                     /note="similar to GP:15141223; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide accessory transport protein,
                     putative"
                     /protein_id="YP_005108122.1"
                     /db_xref="GI:376278089"
                     /db_xref="GeneID:11686243"
                     /translation="MDGEDKRKSGSEGKPLLAFSDAPVSDSKKSRSTEDQASPTPPWT
                     PPASPRERAQYYRSHQSASSALTDEEIAELREIGRDAASSEDKASPSDKEQPASDADE
                     NWPRRSNAAQDAEWKPLIDPRIAIDVIRGSRRLLLATTIFGGIVATLYALSLPQTYIA
                     STDILVDPRNIKVVGTELTPGQLPTDASLAVAESQARMIDSSSVLLKVINKAHLIQDP
                     EFNGTLVPTGIVGFFAQLKDLIGKKEQSDSQTMETRVLDNLRKSLTIHRDAKTFIYSI
                     SVTTREANKSASLANEISSVFQDELASLQSDAARRTSEELFQRLADLRASVEGAEKAV
                     ADFRATHDLIDVDGRLISNNELGRLNEQLTNQRAETVRLQARINVLKDATPDSVVAGT
                     LPEDLRSNTLTALRAQYAQARQAANGMATRLGPRHPQLIQLNSQANAVLNDISAELQR
                     VRSSLQVEVQRSQQQETALSARLAQLKARQANDAKDLVKLRELEREAAARRSIYEAFL
                     LRSRETSEQEGLNTVNIRVLSAARPPLEPAGSTRKLIVIAGLIAGFLAGLAITIIRNF
                     GRLLRL"
     misc_feature    complement(98726..100105)
                     /locus_tag="BSVBI22_B0100"
                     /note="Uncharacterized protein involved in
                     exopolysaccharide biosynthesis [Cell envelope biogenesis,
                     outer membrane]; Region: GumC; COG3206"
                     /db_xref="CDD:225747"
     misc_feature    complement(99542..100054)
                     /locus_tag="BSVBI22_B0100"
                     /note="Chain length determinant protein; Region: Wzz;
                     pfam02706"
                     /db_xref="CDD:251487"
     misc_feature    complement(98732..98956)
                     /locus_tag="BSVBI22_B0100"
                     /note="G-rich domain on putative tyrosine kinase; Region:
                     GNVR; pfam13807"
                     /db_xref="CDD:258087"
     gene            complement(100446..100583)
                     /locus_tag="BSVBI22_B0101"
                     /db_xref="GeneID:11686244"
     CDS             complement(100446..100583)
                     /locus_tag="BSVBI22_B0101"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108123.1"
                     /db_xref="GI:376278090"
                     /db_xref="GeneID:11686244"
                     /translation="MISGASSIFEAEAHWNIWQVSLYSTAYFNHLFSIKKYSHASSWY
                     S"
     gene            complement(100555..101457)
                     /locus_tag="BSVBI22_B0102"
                     /db_xref="GeneID:11686245"
     CDS             complement(100555..101457)
                     /locus_tag="BSVBI22_B0102"
                     /note="similar to GP:14026189; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108124.1"
                     /db_xref="GI:376278091"
                     /db_xref="GeneID:11686245"
                     /translation="MARRQNMAEGRSPVKTAIVTASWDQDFERCKLLCETVDKYTTGF
                     TKHYILVESKDVALFRQLESSRRIIIDERDLLPSWLHAFWDPTHLWRRRIWLSLKTKP
                     LRGWHVQQLRRIALAGAMEEDGFLYMDSDMAFLRPFDCSTLWHGEKLRLFVRPNALAN
                     PKWPEHPVWAANAAKLLGIQNGKSGLNDYIGQLVSWRRDSVISMCERIEAHTGQHWVA
                     ALGKIRGFSECILYGRYVDDILKGVGHFHDTGDLCRVYWFSPPPTEDEFRAFIAGLEP
                     HQVAIGMQSFIGLSVDDIRRVINI"
     gene            complement(101415..102176)
                     /locus_tag="BSVBI22_B0103"
                     /db_xref="GeneID:11686246"
     CDS             complement(101415..102176)
                     /locus_tag="BSVBI22_B0103"
                     /note="identified by match to PFAM protein family HMM
                     PF03808"
                     /codon_start=1
                     /transl_table=11
                     /product="WecB/TagA/CpsF family glycosyl transferase"
                     /protein_id="YP_005108125.1"
                     /db_xref="GI:376278092"
                     /db_xref="GeneID:11686246"
                     /translation="MDMSDDKVSYRNILGTRVACFTWDSAFAFFEKRIESRSFMKQSW
                     LNAHNANIAYENPVFRKALEDFLILPDGIGVDIASKVFYGERFPANLNGTDFVPGLLQ
                     HMKRPLKIGLLGGLPGVAANAAQLFKKQVSRHDYRVISDGYFKPANLDAILARLKDFH
                     PDILLVAMGVPRQEFFIDAHITGEHCTIASGVGALFDLHTGRVQRAPQWMRKLRMEWV
                     YRLLQEPQRLAKRYLLGNPAFLWRVAKTWLKGDHR"
     misc_feature    complement(101481..101978)
                     /locus_tag="BSVBI22_B0103"
                     /note="The glycosyltransferase WecG/TagA superfamily
                     contains Escherichia coli WecG, Bacillus subtilis TagA and
                     related proteins. E. coli WecG is believed to be a
                     UDP-N-acetyl-D-mannosaminuronic acid transferase, and is
                     involved in enterobacterial common...; Region:
                     Glyco_transf_WecG_TagA; cd06533"
                     /db_xref="CDD:119439"
     gene            complement(102177..103331)
                     /locus_tag="BSVBI22_B0104"
                     /db_xref="GeneID:11686247"
     CDS             complement(102177..103331)
                     /locus_tag="BSVBI22_B0104"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108126.1"
                     /db_xref="GI:376278093"
                     /db_xref="GeneID:11686247"
                     /translation="MPHAIAATGYEVANAAVIDGLRRAGADVTVLGFTWPGHRAAEDP
                     DTIVLGEVEVRTENAGLKRKVCWVLKSFLTGLTVSSAKLRVIPEQKLRETIRQLGEFD
                     AYVLNGVTLAGAFVDVFKDKPCLFVAHNVEHRSAEENAQNAGGIQKFLFQREAGILKG
                     LETRLCQQASFVFTFAQDDGPALGLDQDHFATLPLVTPGGMQIAQDRPVEYDLALIGT
                     WTWHPNRIGLEWFLHEVKPLLPQDISIAIAGSTPADLIEAWPGVNFVGKVPDATAFVE
                     AGALIPLISRAGTGVQLKTIETFELGMPSVATSHSVRGISQVPANCTIANNPSDFAAA
                     VIKQLEKIRTGDRQKLDGKIFTRSQIKGMDQAIARGLAALRRRLGNTDCI"
     misc_feature    complement(102321..102698)
                     /locus_tag="BSVBI22_B0104"
                     /note="Glycosyl transferases group 1; Region:
                     Glyco_trans_1_4; pfam13692"
                     /db_xref="CDD:257994"
     gene            103325..103453
                     /locus_tag="BSVBI22_B0105"
                     /db_xref="GeneID:11686248"
     CDS             103325..103453
                     /locus_tag="BSVBI22_B0105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108127.1"
                     /db_xref="GI:376278094"
                     /db_xref="GeneID:11686248"
                     /translation="MAQEMLQKGDETIAIQPLKGLIGYKAGVFYSHEMNVSLNVYQ"
     gene            103503..104495
                     /locus_tag="BSVBI22_B0106"
                     /db_xref="GeneID:11686249"
     CDS             103503..104495
                     /locus_tag="BSVBI22_B0106"
                     /note="identified by match to PFAM protein family HMM
                     PF00535"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="YP_005108128.1"
                     /db_xref="GI:376278095"
                     /db_xref="GeneID:11686249"
                     /translation="MSALPDHIEVISKTSDLRFEDIDIVVTLPTFRRPDHLIRTLDTL
                     KAQKTEKRFAVIVIENEAEKREGAEVAAPLFADGTYRGMLIVESHRGNCNAYNAGWLT
                     AMTCFPNFKYILVIDDDELADPMWIENMVSAAGRFDASLVGGPQYPVFEKPNSQQWAK
                     HPVFMPPYTKTGAVPIIYSSGNLLIARPVLEAIGYPFLDLMFNFTGGGDSDFVGRSKA
                     KGFRIAWCAEGIVRETIPARRLEGDWIRARGLRNGVLSTLTEQRRRKDEPCGQIRVFL
                     KSLALLAYSPIKALRRGLAAGFAPAGMYFIYVGLGRVLAHFGYLNEQYRNPDKN"
     misc_feature    103563..104258
                     /locus_tag="BSVBI22_B0106"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    103569..104084
                     /locus_tag="BSVBI22_B0106"
                     /note="Glycosyl transferase family 2; Region:
                     Glycos_transf_2; pfam00535"
                     /db_xref="CDD:249939"
     misc_feature    order(103587..103589,103593..103595,103674..103676,
                     103851..103853,103857..103859)
                     /locus_tag="BSVBI22_B0106"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            104464..105789
                     /locus_tag="BSVBI22_B0107"
                     /db_xref="GeneID:11686250"
     CDS             104464..105789
                     /locus_tag="BSVBI22_B0107"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide production protein, putative"
                     /protein_id="YP_005108129.1"
                     /db_xref="GI:376278096"
                     /db_xref="GeneID:11686250"
                     /translation="MSNIVTRTRTDARMPDATGPQARIRRIALVIASVIFGVLLISFR
                     PFTPAGGAETETGGDIINQLGFSCVGAVALASMAMFANLRKLAGIIRPGWLVMLVFLF
                     ASIFASSDPATAVRGVLLTTVGIVAIIAVLVLPQDGDGYSALLVSVASVVIVISYAGV
                     VLLPSLGTHGADAIEPQNSFLWRGVFSHKNIAGPVMAVFAFAGLYLWRRGWKTSGLLI
                     GLSALGFVSQTGSKTTMALVPFAMLLVVLPGLMGLRKLTAGLIFAIQLAFATFTFGVV
                     LFEPIRRLVENMDVDATFTGRVSIWKFALEALSKRPWTGYGYESFWSSAYARHAARPY
                     YLDWDVRGIVHGHNSYLDVAMTMGIPALLCAIAVIIVMPLVHYARCRPVRENMLLADF
                     FLMIVLFGTLNAMMESFFFRRMDPVWLTLILAIFGLGMTAKVVIPKRSV"
     misc_feature    104641..105750
                     /locus_tag="BSVBI22_B0107"
                     /note="Lipid A core - O-antigen ligase and related enzymes
                     [Cell envelope biogenesis, outer membrane]; Region: RfaL;
                     COG3307"
                     /db_xref="CDD:225844"
     misc_feature    105148..105561
                     /locus_tag="BSVBI22_B0107"
                     /note="O-Antigen ligase; Region: Wzy_C; pfam04932"
                     /db_xref="CDD:252887"
     gene            105803..106939
                     /locus_tag="BSVBI22_B0108"
                     /db_xref="GeneID:11686251"
     CDS             105803..106939
                     /locus_tag="BSVBI22_B0108"
                     /note="similar to GP:15076091; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="YP_005108130.1"
                     /db_xref="GI:376278097"
                     /db_xref="GeneID:11686251"
                     /translation="MNIAIIGTGFVADYYMTTLRNYPELSLRGVYDRSPERLKAFVAH
                     YNVPAYESYEALLADPDVQIVVNLTTPESHFAVSHAALCAGKHVYSEKPLAMDFDDAK
                     ALLELARQSGLTLAAAPANGLSDAHKLVSSLIKTIGTPRLVYAEMEDGPVFRDKWSTW
                     RSQSGAPWPGLHEFEIGCTLEHAGYALSWLVSLFGPVESVSAFSAITFPDKGPGTEHL
                     HMAPDFSVGCLVFKSGLVARLTSGLAMPKDRSLTVVADKGSIVVDDLWDNRSAVRLER
                     VEEKRRFFARLFANLERRLGKFLSWKPGVGRKIAYPKTGKYALPSFPSQIDFMRGVAD
                     QARSISSGEKAFFSGDVALHITEIALALNNAGQGAAVYRMKSSF"
     misc_feature    105803..106885
                     /locus_tag="BSVBI22_B0108"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    105803..106147
                     /locus_tag="BSVBI22_B0108"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     gene            complement(106936..107985)
                     /locus_tag="BSVBI22_B0109"
                     /db_xref="GeneID:11686252"
     CDS             complement(106936..107985)
                     /locus_tag="BSVBI22_B0109"
                     /note="similar to GP:6469270; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="YP_005108131.1"
                     /db_xref="GI:376278098"
                     /db_xref="GeneID:11686252"
                     /translation="MTQNERIGGDFRWGIWGTDMIASSFAADIAASAGMRVVAVCSHT
                     MQTAQAFCRHIGINKAFGNPHAFLADPEIDAVYIASPNMLHVEQALDAIMAGKACLIE
                     KPLSLDPEGARQIETASKARNIFAMEAMWTRFLPAVQAVKHAIDASRIGTVTHIEADL
                     SYSRAYDPESRFFSPALGGGAAFDLGVYPLSLALYFLGLPEKVDGHCQRAASGVDLRS
                     EFNLGWPSATAWISCGFDRDGENRMLIEGTDGAILIHPPFLKAQRLTFFSRSALHSPF
                     GPKNSKGRIGNIINRLPLPGRTIETHAFAGNGLQFQAQAVRDAIRRGEISTPIMPLAQ
                     SAAVADIISRVLVSG"
     misc_feature    complement(106942..107955)
                     /locus_tag="BSVBI22_B0109"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    complement(107605..107955)
                     /locus_tag="BSVBI22_B0109"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    complement(107245..107562)
                     /locus_tag="BSVBI22_B0109"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            108302..109711
                     /gene="gnd"
                     /locus_tag="BSVBI22_B0110"
                     /db_xref="GeneID:11686253"
     CDS             108302..109711
                     /gene="gnd"
                     /locus_tag="BSVBI22_B0110"
                     /note="catalyzes the formation of D-ribulose 5-phosphate
                     from 6-phospho-D-gluconate"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="YP_005108132.1"
                     /db_xref="GI:376278099"
                     /db_xref="GeneID:11686253"
                     /translation="MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIE
                     KAGRLRDKIIPCPTFEELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDA
                     GNSDYRDTVRRLKALGPNDPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLA
                     VAAKYQGEPCCALVGPDGAGHFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGD
                     VFEKWNEGPLNSYLIEITAKVLKSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILG
                     VPATGIEAAVAARSLSSMKGEREEAAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIA
                     AYAQGFAVMEAASREHGWNIPLATTARIWRAGCIIRSQLLDDIAQAFEGNESRNLLMA
                     PAFVPRMETSVKSLRQIVAQAALASLPLPALGSALSYFDSYTQALGTANLIQGQRDFF
                     GSHGFKRIDKEGDFHGPWG"
     misc_feature    108302..109708
                     /gene="gnd"
                     /locus_tag="BSVBI22_B0110"
                     /note="6-phosphogluconate dehydrogenase [Carbohydrate
                     transport and metabolism]; Region: Gnd; COG0362"
                     /db_xref="CDD:223439"
     misc_feature    108311..108793
                     /gene="gnd"
                     /locus_tag="BSVBI22_B0110"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    108839..109705
                     /gene="gnd"
                     /locus_tag="BSVBI22_B0110"
                     /note="6-phosphogluconate dehydrogenase, C-terminal
                     domain; Region: 6PGD; pfam00393"
                     /db_xref="CDD:249826"
     gene            complement(109807..110868)
                     /locus_tag="BSVBI22_B0111"
                     /db_xref="GeneID:11686254"
     CDS             complement(109807..110868)
                     /locus_tag="BSVBI22_B0111"
                     /note="similar to GP:15157291; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter,
                     ATP-binding protein"
                     /protein_id="YP_005108133.1"
                     /db_xref="GI:376278100"
                     /db_xref="GeneID:11686254"
                     /translation="MAFLNIKNLKKSFGTNTVVHDFNLAVEKGEFVSFLGPSGCGKTT
                     VLRMIAGFETPDNGSIEIDGKDVVNLRPNQRNIGMVFQAYALFPNMTVAQNVSFGLRV
                     SGKSRSEIDATVKEMLSLIRLDHLADRYPYQMSGGQQQRVALARALATKPQVLLLDEP
                     LSALDAKIRISLREEIRAIQQKLGITTVFVTHDQEEALSISDRIVVMHEGRADQIGSP
                     FDIYNRPASRFVASFVGTLNMLEASVSEPAQNSIDLDGRQITVQETLAHHPKGKPLTL
                     ALRPEAVSLEARKSHDTSLEATIDDVHFLGSVIRTRVILGKNRLSFDTFNDPTHPPPQ
                     RGYKVTVHFASHDLLVLAD"
     misc_feature    complement(109810..110868)
                     /locus_tag="BSVBI22_B0111"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    complement(110164..110859)
                     /locus_tag="BSVBI22_B0111"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(110740..110763)
                     /locus_tag="BSVBI22_B0111"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(110293..110295,110392..110397,
                     110623..110625,110737..110745,110749..110754))
                     /locus_tag="BSVBI22_B0111"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110623..110634)
                     /locus_tag="BSVBI22_B0111"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110440..110469)
                     /locus_tag="BSVBI22_B0111"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110392..110409)
                     /locus_tag="BSVBI22_B0111"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110374..110385)
                     /locus_tag="BSVBI22_B0111"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110287..110307)
                     /locus_tag="BSVBI22_B0111"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(109816..110043)
                     /locus_tag="BSVBI22_B0111"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            complement(110874..111692)
                     /locus_tag="BSVBI22_B0112"
                     /db_xref="GeneID:11686255"
     CDS             complement(110874..111692)
                     /locus_tag="BSVBI22_B0112"
                     /note="similar to GP:15075242, and GP:17740614; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter, permease
                     protein, putative"
                     /protein_id="YP_005108134.1"
                     /db_xref="GI:376278101"
                     /db_xref="GeneID:11686255"
                     /translation="MKSKGSNLRKISAQKIGAWIAFFVGAIYFLVPLIGTFEFSLRMR
                     RGEYSFDAYRVVFADANFQATFTYSIVLGLLTIIFGVLLVVPTAYWVRLRLPQLRPVM
                     EFITLMPLVIPAIVIVFGYLRIYNSSSWLPFTASTRATDVLLMFGYMTLSLPYMYRAV
                     DTAMRTIDVNTLTEAAQSLGAGWGRIMFKVIFPNVISGVMSGAFITFAIVIGEFTLAS
                     LLNRPAFGPYLQLVGANRAYEPSALAIISFGITWLSIIMLQLVSRLNKFKTTAG"
     misc_feature    complement(110877..111647)
                     /locus_tag="BSVBI22_B0112"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    complement(110922..111497)
                     /locus_tag="BSVBI22_B0112"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110928..110933,110940..110945,
                     110949..110954,110961..110966,110994..110999,
                     111036..111041,111048..111059,111078..111080,
                     111087..111092,111132..111134,111186..111188,
                     111195..111200,111210..111212,111216..111221,
                     111228..111230,111234..111236,111240..111245,
                     111327..111329,111333..111338,111345..111374,
                     111378..111389,111417..111419,111432..111437,
                     111444..111449))
                     /locus_tag="BSVBI22_B0112"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111042..111059,111327..111371))
                     /locus_tag="BSVBI22_B0112"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110964..110966,110994..110996,
                     111003..111005,111039..111041,111267..111269,
                     111327..111329))
                     /locus_tag="BSVBI22_B0112"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111111..111113,111123..111128,
                     111144..111179,111183..111185))
                     /locus_tag="BSVBI22_B0112"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(111698..112582)
                     /locus_tag="BSVBI22_B0113"
                     /db_xref="GeneID:11686256"
     CDS             complement(111698..112582)
                     /locus_tag="BSVBI22_B0113"
                     /note="similar to GP:15075241, and GP:17740613; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter, permease
                     protein, putative"
                     /protein_id="YP_005108135.1"
                     /db_xref="GI:376278102"
                     /db_xref="GeneID:11686256"
                     /translation="MSSVAETTAPTSGVRKRQLPLSWLGVAPFFLFAILFLIWPTMYL
                     IIGAFQDPAGNFTLQNIHDLFQPQIMSAYWISIKVSFASAVGGAIIGFFLAWAVVLGN
                     LPSWLRPTVLTFSGVASNFAGVPLAFAFLATLGRTGFVTILLREWFGFNLYSTGFNLL
                     SFFGLTLTYLFFQIPLMVLILTPALDGLKKEWREASSILGATHMQYWRMVAFPILWPS
                     LLGTTLLLFANAFGAIATAYALTGSSLNIVPILLYAQIRGDVLHNQNLGYALALGMIV
                     ITGVSNLLYIWLRIRAER"
     misc_feature    complement(111701..112540)
                     /locus_tag="BSVBI22_B0113"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    complement(111749..112366)
                     /locus_tag="BSVBI22_B0113"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111749..111751,111758..111763,
                     111770..111775,111779..111784,111791..111796,
                     111824..111829,111866..111871,111878..111889,
                     111908..111910,111917..111922,111962..111964,
                     112013..112015,112022..112027,112037..112039,
                     112043..112048,112055..112057,112061..112063,
                     112070..112075,112190..112192,112196..112201,
                     112208..112237,112241..112252,112280..112282,
                     112301..112306,112313..112318))
                     /locus_tag="BSVBI22_B0113"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111872..111889,112190..112234))
                     /locus_tag="BSVBI22_B0113"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111794..111796,111824..111826,
                     111833..111835,111869..111871,112088..112090,
                     112190..112192))
                     /locus_tag="BSVBI22_B0113"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111941..111943,111953..111958,
                     111974..112012))
                     /locus_tag="BSVBI22_B0113"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(112791..113894)
                     /locus_tag="BSVBI22_B0114"
                     /db_xref="GeneID:11686257"
     CDS             complement(112791..113894)
                     /locus_tag="BSVBI22_B0114"
                     /note="similar to GP:15075240; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, periplasmic substrate-binding
                     protein"
                     /protein_id="YP_005108136.1"
                     /db_xref="GI:376278103"
                     /db_xref="GeneID:11686257"
                     /translation="MLSYTARLLSLSTAIAVAGVSIATAEPSAELIAAAKAEGELTTI
                     ALPHDWCGYGDIIKSFKDKYGIKVNELNPDAGSGDEVEAIKANKNNKGPQAPDVIDVG
                     FAFGTSAKKDGLTQAYKVSTWDEIPDSAKDPEGHWYGDYYGVLAFEVNKDIVKDAPQD
                     WEDLLKSDYANAVALAGDPRVSAQAILGVHAAGIARGAEPGEAAGKKGLEFYKELNAN
                     GNFVPVIGKAASLAQGSTPIVIRWDYNSLADRDTLNGNPEVETIIPKSGVIAGVYVQA
                     ISAYAPHPNAAKLWMEHIYSDEGQLGYLKGYCHPIRFNAMAKAGKIPQELLDKLPPAA
                     AYEKAIFPTIEQIEATQATITKDWDSVVGANVQ"
     misc_feature    complement(112800..113729)
                     /locus_tag="BSVBI22_B0114"
                     /note="ABC-type Fe3+ transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: AfuA; COG1840"
                     /db_xref="CDD:224753"
     gene            complement(114303..115892)
                     /locus_tag="BSVBI22_B0115"
                     /db_xref="GeneID:11686258"
     CDS             complement(114303..115892)
                     /locus_tag="BSVBI22_B0115"
                     /note="identified by match to PFAM protein family HMM
                     PF04039"
                     /codon_start=1
                     /transl_table=11
                     /product="Bcr/CflA subfamily drug resistance transporter"
                     /protein_id="YP_005108137.1"
                     /db_xref="GI:376278104"
                     /db_xref="GeneID:11686258"
                     /translation="MAADTTIGTVGGKNPADDRIDPKKTIGFMAMVFGMFMAILDIQI
                     VSASLSEIQAGLGASTDEISWVQTSYLIAEVIMIPLSGFLGRLLSTRVLFTISAAGFT
                     LASMLCATATNIEQMIVYRAIQGFIGGGMIPSVFAAAFTIFPPSKRSIVSPMIGLVAT
                     LAPTIGPTIGGYLSHAFSWHWLFLVNVGPGILVTIAAWNLIDFDEGDLSLLDKFDWWG
                     LFGMAAFLGSLEYVLEEGPRNDWLQDHTIFIMSIIPTVGAIVFFYRVFTAEQPIVDFR
                     AFRNMNFAFGSLFSFVMGVGLYGLTYLYPLYLSMIRGYDALMIGEALFVSGLAMFFTA
                     PVAGFLSNRMDPRLMMMIGFVGFAIGTWLVTGLTADWDFNELLMPQILRGCSLMLCMV
                     PINNLALGTLPPSLMKNASGLFNLTRNLGGAVGLAVINTILTRRGDMHYARLAEHVRN
                     GNAEAENMIANLTAKYNAAGMDGASIAIAKLSGMVRQQATLLSFIDVFFILTMMFCSL
                     AICAMLLRKPSPAAGGGGGGH"
     misc_feature    complement(114348..115811)
                     /locus_tag="BSVBI22_B0115"
                     /note="drug resistance transporter, EmrB/QacA subfamily;
                     Region: efflux_EmrB; TIGR00711"
                     /db_xref="CDD:129794"
     misc_feature    complement(114582..115811)
                     /locus_tag="BSVBI22_B0115"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(114627..114629,114636..114641,
                     114648..114653,114660..114665,114696..114698,
                     114705..114710,114720..114722,114729..114734,
                     114741..114743,114891..114893,114903..114905,
                     114912..114914,114924..114926,114936..114938,
                     114978..114980,114987..114992,114999..115004,
                     115011..115013,115404..115406,115422..115427,
                     115434..115439,115473..115475,115482..115487,
                     115494..115499,115506..115511,115647..115652,
                     115656..115661,115671..115673,115680..115685,
                     115692..115694,115743..115748,115752..115760,
                     115767..115769))
                     /locus_tag="BSVBI22_B0115"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(115985..117202)
                     /locus_tag="BSVBI22_B0116"
                     /note="This region contains an authentic point mutation,
                     causing a premature stop, and is not the result of a
                     sequencing artifact; HlyD family secretion protein,
                     authentic point mutation"
                     /db_xref="GeneID:11686259"
     gene            117327..118070
                     /locus_tag="BSVBI22_B0117"
                     /db_xref="GeneID:11686260"
     CDS             117327..118070
                     /locus_tag="BSVBI22_B0117"
                     /note="identified by match to PFAM protein family HMM
                     PF00440"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005108138.1"
                     /db_xref="GI:376278105"
                     /db_xref="GeneID:11686260"
                     /translation="MKPARNTSRIGDISDDKKGELRSAPDKAELSASCLPETECGRTR
                     LAAGQDPAKRSQILEGAQSVFLRMGFDAASMNDITREAGVSKGTIYVYFNSKEDLFVA
                     LCEHYRQTLFSSFIGQLEKGFSNRQELIDFGVALTTLITSSIAIRAQRIVVGVSERKP
                     ELAARFYERGPKRSHAIMAQSLQAMIDAGVLEQHDVTRTAYQLSDLFFAGLYRPRLFG
                     ALAEAPSEQAIRDNVESAVDFFFRAYGKK"
     misc_feature    117480..118055
                     /locus_tag="BSVBI22_B0117"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    117495..117635
                     /locus_tag="BSVBI22_B0117"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    117891..118058
                     /locus_tag="BSVBI22_B0117"
                     /note="AefR-like transcriptional repressor, C-terminal
                     region; Region: TetR_C_7; pfam14246"
                     /db_xref="CDD:258436"
     gene            118344..119123
                     /locus_tag="BSVBI22_B0118"
                     /db_xref="GeneID:11686261"
     CDS             118344..119123
                     /locus_tag="BSVBI22_B0118"
                     /note="similar to GP:9622950; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_005108139.1"
                     /db_xref="GI:376278106"
                     /db_xref="GeneID:11686261"
                     /translation="MSLDLVHFPNYKKTFFGSSFQSDTLALLTRIRDEIGCRYVTHTY
                     RGRVGDCTKVNSADLTVLMTLPATWVARYSSKNYFAIDPVFQEDAPYYRNDTSAIARD
                     LKEDADICPAVAELLHDAEKHGLGNLFIAVSARNPKGVAGCTVFTFEVEDEDRTQFLA
                     RMRPRLLSLAGIIHGTVCGCKDANSVASLLTPREVDCLRWAANGKTDGEIAEILSIAR
                     WTVVTYLQNAKIKLNCSNRTSAVATALSLGIIDMPEVQHLV"
     misc_feature    118407..118874
                     /locus_tag="BSVBI22_B0118"
                     /note="Autoinducer binding domain; Region: Autoind_bind;
                     pfam03472"
                     /db_xref="CDD:251983"
     misc_feature    118911..119081
                     /locus_tag="BSVBI22_B0118"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(118914..118922,118959..118967,118989..118994,
                     118998..119003,119007..119021,119052..119054)
                     /locus_tag="BSVBI22_B0118"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(118947..118949,118953..118955,118959..118961,
                     119052..119060,119067..119069,119076..119081)
                     /locus_tag="BSVBI22_B0118"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(119192..119611)
                     /locus_tag="BSVBI22_B0119"
                     /db_xref="GeneID:11686262"
     CDS             complement(119192..119611)
                     /locus_tag="BSVBI22_B0119"
                     /note="similar to GP:15073579, and GP:15073579; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108140.1"
                     /db_xref="GI:376278107"
                     /db_xref="GeneID:11686262"
                     /translation="MQFSKERETIIAENIREVVSDLRLVDPADYIAFIRCELFANIAD
                     LVSSAAELYFYPGTLGLGHGGEFHCDWQSPPSITLDMEFRHQGVYAYFRITLTDRTAG
                     VELNHIAFEDADGDPSANTVRLAKAFEDARLPLRKRA"
     gene            complement(119731..120801)
                     /gene="flhB"
                     /locus_tag="BSVBI22_B0120"
                     /db_xref="GeneID:11686263"
     CDS             complement(119731..120801)
                     /gene="flhB"
                     /locus_tag="BSVBI22_B0120"
                     /note="membrane protein responsible for substrate
                     specificity switching from rod/hook-type export to
                     filament-type export"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="YP_005108141.1"
                     /db_xref="GI:376278108"
                     /db_xref="GeneID:11686263"
                     /translation="MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFL
                     VIAVFVAAPAATRLAVFLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIII
                     PLAGIAASAFQNAPRFVGERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASV
                     IVFLVFFKGNSLFTDAVATDPGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHW
                     RQELRMTRQEVKDELKQSEGDPLVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFS
                     VALRYKPNEDAAPVVVAKGQDLIALKIREIAASHSIPVFEDVQLARALYKQVNVDHMI
                     APEFYKAVAELIRIINTRRAIS"
     misc_feature    complement(119740..120798)
                     /gene="flhB"
                     /locus_tag="BSVBI22_B0120"
                     /note="Flagellar biosynthesis pathway, component FlhB
                     [Cell motility and secretion / Intracellular trafficking
                     and secretion]; Region: FlhB; COG1377"
                     /db_xref="CDD:224295"
     gene            complement(120818..121873)
                     /gene="fliG"
                     /locus_tag="BSVBI22_B0121"
                     /note="This region contains an authentic point mutation,
                     causing a premature stop, and is not the result of a
                     sequencing artifact; flagellar motor switch protein FliG,
                     authentic point mutation; similar to SP:O54244; identified
                     by sequence similarity; putative"
                     /db_xref="GeneID:11686264"
     gene            complement(121890..122210)
                     /locus_tag="BSVBI22_B0122"
                     /db_xref="GeneID:11686265"
     CDS             complement(121890..122210)
                     /locus_tag="BSVBI22_B0122"
                     /note="identified by match to PFAM protein family HMM
                     PF01052"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliN, putative"
                     /protein_id="YP_005108142.1"
                     /db_xref="GI:376278109"
                     /db_xref="GeneID:11686265"
                     /translation="MQQELNEAIEELREEKPRSAQKSASKPNLDLIMGIPVDVQVVLG
                     GTTMPVSSLMKLGCGAVITLDKQIGDPVDIVVNGRVIARGEVIVLEDDSSRFGVSLTE
                     IIGK"
     misc_feature    complement(121893..122129)
                     /locus_tag="BSVBI22_B0122"
                     /note="flagellar motor switch protein FliN; Region: fliN;
                     TIGR02480"
                     /db_xref="CDD:131533"
     gene            complement(122234..122695)
                     /locus_tag="BSVBI22_B0123"
                     /db_xref="GeneID:11686266"
     CDS             complement(122234..122695)
                     /locus_tag="BSVBI22_B0123"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108143.1"
                     /db_xref="GI:376278110"
                     /db_xref="GeneID:11686266"
                     /translation="MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAA
                     ASNGLERAVKAIRNERTDLTDASAKLDARLAETQRVRREMDEAIEELNRLRKALSRDM
                     RQARILAETPPPRQEKTPSAAEQPLPADKNALPVFVRRAVKKATVELAGQA"
     gene            complement(122676..123626)
                     /locus_tag="BSVBI22_B0124"
                     /db_xref="GeneID:11686267"
     CDS             complement(122676..123626)
                     /locus_tag="BSVBI22_B0124"
                     /note="similar to SP:O54246; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM, putative"
                     /protein_id="YP_005108144.1"
                     /db_xref="GI:376278111"
                     /db_xref="GeneID:11686267"
                     /translation="MDDATTLEHNRKNDALAENLLRAAGLSGDDLKSLAHVFKDASSH
                     FCARLKQGSAAAFDAETGSVESTDKTAFNDIFDKAAIITPLKAERWGCSLYLALDAVL
                     VFSVIEAMFGAQGNLGPVDADRPFGMVEQKIANLLAGHLAGALDRVFNTSSSQPLFAP
                     GDCIDTADFDRENFELSRLFTCRIAVTAAGKTGQMHLLLPRSTHKPMQDAVAAFLRRP
                     MDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDALSRLEIGQVLKLPVDAMEQVRL
                     RAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELVAG"
     misc_feature    complement(122679..123626)
                     /locus_tag="BSVBI22_B0124"
                     /note="Flagellar motor switch protein [Cell motility and
                     secretion]; Region: FliM; COG1868"
                     /db_xref="CDD:224781"
     misc_feature    complement(122718..122933)
                     /locus_tag="BSVBI22_B0124"
                     /note="Surface presentation of antigens (SPOA); Region:
                     SpoA; pfam01052"
                     /db_xref="CDD:250325"
     gene            complement(123628..124500)
                     /gene="motA"
                     /locus_tag="BSVBI22_B0125"
                     /db_xref="GeneID:11686268"
     CDS             complement(123628..124500)
                     /gene="motA"
                     /locus_tag="BSVBI22_B0125"
                     /note="With MotB forms the ion channels that couple
                     flagellar rotation to proton/sodium motive force across
                     the membrane and forms the stator elements of the rotary
                     flagellar machine"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="YP_005108145.1"
                     /db_xref="GI:376278112"
                     /db_xref="GeneID:11686268"
                     /translation="MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGT
                     FFVANPFSLVKDTGRACMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHID
                     NPKESPIFLAYPSVLKKEDLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLK
                     PYQAMITISEALPALGIVAAVLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYG
                     VIGPIANKIKSTREKNNRLYIVVKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVV
                     EQETMASVPTQQAA"
     misc_feature    complement(123652..124500)
                     /gene="motA"
                     /locus_tag="BSVBI22_B0125"
                     /note="flagellar motor protein MotA; Validated; Region:
                     PRK09110"
                     /db_xref="CDD:181655"
     gene            124658..125434
                     /locus_tag="BSVBI22_B0126"
                     /db_xref="GeneID:11686269"
     CDS             124658..125434
                     /locus_tag="BSVBI22_B0126"
                     /note="similar to GP:15155497, and GP:15073585; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108146.1"
                     /db_xref="GI:376278113"
                     /db_xref="GeneID:11686269"
                     /translation="MTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDF
                     MADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDF
                     AGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILG
                     DKALLTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPDYVLKFISRFTAMHEM
                     NNPTASSPASIASFLLGGTSSIGISMNILATLQNFKPGGR"
     misc_feature    <124670..>124843
                     /locus_tag="BSVBI22_B0126"
                     /note="Protein of unknown function (DUF1217); Region:
                     DUF1217; pfam06748"
                     /db_xref="CDD:148384"
     misc_feature    124826..125272
                     /locus_tag="BSVBI22_B0126"
                     /note="Protein of unknown function (DUF1217); Region:
                     DUF1217; pfam06748"
                     /db_xref="CDD:148384"
     gene            125434..126165
                     /gene="flgF"
                     /locus_tag="BSVBI22_B0127"
                     /db_xref="GeneID:11686270"
     CDS             125434..126165
                     /gene="flgF"
                     /locus_tag="BSVBI22_B0127"
                     /note="FlgF, with FlgB and C, makes up the proximal
                     portion of the flagellar basal body rod; Bradyrhizobium
                     have one thick flagellum and several thin flagella; the
                     protein in this cluster is associated with the thin
                     flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgF"
                     /protein_id="YP_005108147.1"
                     /db_xref="GI:376278114"
                     /db_xref="GeneID:11686270"
                     /translation="MQNNSIYVGLSSLITLERRMDAIAHNVANASTVGFRGEGTKFDT
                     IVSDKASDDVSFATAGKSYIRTEAGPLIKTDNPLDVAVKGDAWMSFSTPQGQVYSRDG
                     RMKMLSTGDLVSVTGNAILDVGGAPIVLNPGGGAPRISSDGAIYQNGVQVGAIGLYTI
                     PADADLAYAGTSGVIPSKPAQPVVDDNSVGVVQGMIEGSNVDAMTEMTRLISISRAFE
                     QVNNLLSQQEATVSEAIKTLGSKNG"
     misc_feature    125437..126159
                     /gene="flgF"
                     /locus_tag="BSVBI22_B0127"
                     /note="flagellar basal body rod protein FlgF; Reviewed;
                     Region: flgF; PRK12642"
                     /db_xref="CDD:237153"
     misc_feature    125449..125541
                     /gene="flgF"
                     /locus_tag="BSVBI22_B0127"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    125815..126087
                     /gene="flgF"
                     /locus_tag="BSVBI22_B0127"
                     /note="flagellar basal-body rod protein FlgF; Region:
                     flgF; TIGR02490"
                     /db_xref="CDD:233892"
     gene            126162..127430
                     /gene="fliI"
                     /locus_tag="BSVBI22_B0128"
                     /db_xref="GeneID:11686271"
     CDS             126162..127430
                     /gene="fliI"
                     /locus_tag="BSVBI22_B0128"
                     /note="involved in type III protein export during
                     flagellum assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellum-specific ATP synthase"
                     /protein_id="YP_005108148.1"
                     /db_xref="GI:376278115"
                     /db_xref="GeneID:11686271"
                     /translation="MTPDLPLTRLAAFVRQQTIAPEPLTGIGGTVSDVSRSSIAVRGL
                     SRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMPSLGAAVFEEGPLRIR
                     PAPEWRGRVINALGNAIDGKGALKLGTRPMAAESLAPAALRRARVDRGLRTGVNVIDI
                     FTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGREVREMLEETMAG
                     HLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTRFAHAAREVA
                     IAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSIAGIYSVLVDGDDHNDPASVS
                     RLAKHNWTPEQRKLVMQLRSMVARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEA
                     LQQSPETGLSDDPYNDLAAALRGDRQAQNA"
     misc_feature    126162..127427
                     /gene="fliI"
                     /locus_tag="BSVBI22_B0128"
                     /note="flagellum-specific ATP synthase; Validated; Region:
                     fliI; PRK06002"
                     /db_xref="CDD:235666"
     misc_feature    126453..127346
                     /gene="fliI"
                     /locus_tag="BSVBI22_B0128"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(126681..126686,126696..126704)
                     /gene="fliI"
                     /locus_tag="BSVBI22_B0128"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(126684..126686,126696..126704,126753..126755,
                     126759..126764,126948..126953)
                     /gene="fliI"
                     /locus_tag="BSVBI22_B0128"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    126936..126950
                     /gene="fliI"
                     /locus_tag="BSVBI22_B0128"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            127514..128032
                     /locus_tag="BSVBI22_B0129"
                     /db_xref="GeneID:11686272"
     CDS             127514..128032
                     /locus_tag="BSVBI22_B0129"
                     /note="similar to GP:2916792, and GP:2459710; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108149.1"
                     /db_xref="GI:376278116"
                     /db_xref="GeneID:11686272"
                     /translation="MKKPLSKGDRYLMIAVIALAAASALLPIVTYLQRVDFNPANKAE
                     RKIIDPLDRSEQKTVRRFPSFRPSEQVAPASEVDKTMTGSVMSNGKGLPGAGKGEGEI
                     GDGRGQPFPKPVFALRDVVGGMAMIEDASGYWFVEKGSLLPDGSRLVSIGRGAGTWQL
                     TTSSGDIIDMRR"
     gene            complement(128057..129034)
                     /locus_tag="BSVBI22_B0130"
                     /db_xref="GeneID:11686273"
     CDS             complement(128057..129034)
                     /locus_tag="BSVBI22_B0130"
                     /note="identified by match to PFAM protein family HMM
                     PF01569"
                     /codon_start=1
                     /transl_table=11
                     /product="PAP2 family protein"
                     /protein_id="YP_005108150.1"
                     /db_xref="GI:376278117"
                     /db_xref="GeneID:11686273"
                     /translation="MKQAHGPDDNRSMWMLMGIGIVCVFGFFIQILVLSRYLDRPLAL
                     FMASQKGTALVDIAAHITKFGKAYWFLVPAAALFVFYRFINRSPQKSFNCFFIIASIA
                     VSGIVIKILKIIFGRARPGVLIDDGFYGFTFFRLDREFNSFPSAHTGVAIAAGVALAL
                     IMQKHRWVPIILGIVIASSRIIINAHYLSDVVASSLISTVTVLLLYDILGYFGYRAGE
                     PDRHSPDMQGSLKLMSNVIGAPVAEHENGQRPQDGLTTRIIGVMNIAAILILIGLIFD
                     FVLIEWFEWQYQPAELIPGWWLPAAITLCALGVGASLYVGRAGRGCARR"
     misc_feature    complement(128417..128998)
                     /locus_tag="BSVBI22_B0130"
                     /note="Membrane-associated phospholipid phosphatase [Lipid
                     metabolism]; Region: PgpB; COG0671"
                     /db_xref="CDD:223743"
     misc_feature    complement(128408..128929)
                     /locus_tag="BSVBI22_B0130"
                     /note="PAP2_like proteins, Lipid A 1-phosphatase
                     subfamily. Lipid A 1-phosphatase, or LpxE from Francisella
                     novicida selectively dephosphorylates lipid A at the
                     1-position. Lipid A is the membrane-anchor component of
                     lipopolysaccharides (LPS), the major...; Region:
                     PAP2_lipid_A_1_phosphatase; cd03389"
                     /db_xref="CDD:239483"
     misc_feature    complement(order(128465..128467,128477..128479,
                     128495..128497,128594..128602,128678..128680,
                     128699..128701))
                     /locus_tag="BSVBI22_B0130"
                     /note="active site"
                     /db_xref="CDD:239483"
     gene            129022..129177
                     /locus_tag="BSVBI22_B0131"
                     /db_xref="GeneID:11686274"
     CDS             129022..129177
                     /locus_tag="BSVBI22_B0131"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108151.1"
                     /db_xref="GI:376278118"
                     /db_xref="GeneID:11686274"
                     /translation="MLVSFAILFHTLVVIEKWEPRPDNQIKVLFGASHGEYRASAMLV
                     PEFSGRF"
     gene            complement(129332..129550)
                     /locus_tag="BSVBI22_B0132"
                     /db_xref="GeneID:11686275"
     CDS             complement(129332..129550)
                     /locus_tag="BSVBI22_B0132"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108152.1"
                     /db_xref="GI:376278119"
                     /db_xref="GeneID:11686275"
                     /translation="MSYLDFQPQLVQRRSSEPERRTTPIFAVKADEYRGPHPEFIGII
                     PIFTSLFLQIMRFFCIIKMCDIRKISVY"
     gene            129578..129973
                     /locus_tag="BSVBI22_B0133"
                     /db_xref="GeneID:11686276"
     CDS             129578..129973
                     /locus_tag="BSVBI22_B0133"
                     /note="identified by match to PFAM protein family HMM
                     PF03751"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108153.1"
                     /db_xref="GI:376278120"
                     /db_xref="GeneID:11686276"
                     /translation="MAPRAMFKRFPIFVGGSAIGAVIDYVVTLSASNYINLYPPVALA
                     LAMLISGSVVFFFHIRITFQYSTHKIFRQYALFMGWTCAIYFLRAAMLQICLYAGLPL
                     AVALILAIGLASVINFVISSVIIFAKSPS"
     misc_feature    129629..129955
                     /locus_tag="BSVBI22_B0133"
                     /note="GtrA-like protein; Region: GtrA; pfam04138"
                     /db_xref="CDD:252403"
     gene            129970..130950
                     /locus_tag="BSVBI22_B0134"
                     /db_xref="GeneID:11686277"
     CDS             129970..130950
                     /locus_tag="BSVBI22_B0134"
                     /note="similar to GB:Z17227, SP:Q08334, PID:393379, and
                     PID:571296; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="YP_005108154.1"
                     /db_xref="GI:376278121"
                     /db_xref="GeneID:11686277"
                     /translation="MNAKTLCIIVPVYNEAEGLSDLLDRLHSAADSIASQFTLNIEFI
                     FIDDGSSDGSFALLKAHDFGSRPVRLLRFSRNFGKEAALSAGIDAAEGADAAILMDAD
                     LQHPPEMIADFVRIWQEEDADSVYAYKASRLASEGPVKAALSRAFFWVINRDQRYKIP
                     PGAGDFRLVNRRFMAALRSLPESDRFMKGLYGWVGFNQVGLPLQPPPRMRGTSYYNPL
                     QLLLMSLGAMTSFSTTPLRLMALAGIVVAGLSAAYGLYVLSEYFFFPGVPVGLTSILA
                     LTAFFGGIQLMFLGLLGEYIGKSVLEAKKRPIYILAEDIRRKESDDADRG"
     misc_feature    129979..130941
                     /locus_tag="BSVBI22_B0134"
                     /note="undecaprenyl phosphate
                     4-deoxy-4-formamido-L-arabinose transferase; Provisional;
                     Region: PRK10714"
                     /db_xref="CDD:182669"
     misc_feature    129991..130557
                     /locus_tag="BSVBI22_B0134"
                     /note="Bacterial DPM1_like enzymes are related to
                     eukaryotic DPM1; Region: DPM1_like_bac; cd04187"
                     /db_xref="CDD:133030"
     misc_feature    order(130000..130002,130006..130008,130273..130275)
                     /locus_tag="BSVBI22_B0134"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133030"
     misc_feature    order(130111..130113,130270..130275)
                     /locus_tag="BSVBI22_B0134"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133030"
     misc_feature    130267..130275
                     /locus_tag="BSVBI22_B0134"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133030"
     misc_feature    130675..>130896
                     /locus_tag="BSVBI22_B0134"
                     /note="Peptidase family M48; Region: Peptidase_M48;
                     cl12018"
                     /db_xref="CDD:264511"
     gene            130934..131683
                     /locus_tag="BSVBI22_B0135"
                     /db_xref="GeneID:11686278"
     CDS             130934..131683
                     /locus_tag="BSVBI22_B0135"
                     /note="identified by match to PFAM protein family HMM
                     PF03633"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108155.1"
                     /db_xref="GI:376278122"
                     /db_xref="GeneID:11686278"
                     /translation="MRIADDFGLGRGHDRVILSLLETGRLDGTSVMMNDAMNPEDIAR
                     LRKLRAGGAKVGLHLNLTQALPGGGPIWPLGELIRPLLGAPFLGAITASLVRQVDAFV
                     TQFGSLPDYYDGHQHCHCFPAIAPLVARLPYGPATWVRVPLPATWEGRWLNIRAGGAK
                     VLLILALAARARAIFVRAGLKTNHDFSGFLRLGDPASVRRWLPELLARATPDCLIMLH
                     PGDGADPVQCAGHAAGSRAIEARILFESPIK"
     misc_feature    130934..131662
                     /locus_tag="BSVBI22_B0135"
                     /note="uncharacterized YdjC-like family proteins from
                     bacteria; Region: YdjC_like_3; cd10807"
                     /db_xref="CDD:212118"
     misc_feature    order(130946..130957,131099..131107,131261..131278,
                     131585..131587,131639..131641)
                     /locus_tag="BSVBI22_B0135"
                     /note="YdjC motif; other site"
                     /db_xref="CDD:212118"
     misc_feature    order(130946..130951,130955..130957,131099..131101,
                     131105..131107,131264..131266,131270..131272,
                     131276..131278,131585..131587,131639..131641)
                     /locus_tag="BSVBI22_B0135"
                     /note="putative active site [active]"
                     /db_xref="CDD:212118"
     misc_feature    order(130946..130951,131105..131107,131276..131278)
                     /locus_tag="BSVBI22_B0135"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212118"
     misc_feature    order(130964..130966,131030..131032,131039..131053,
                     131174..131176,131180..131182,131207..131209,
                     131231..131233,131240..131242)
                     /locus_tag="BSVBI22_B0135"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212118"
     gene            131680..133116
                     /locus_tag="BSVBI22_B0136"
                     /db_xref="GeneID:11686279"
     CDS             131680..133116
                     /locus_tag="BSVBI22_B0136"
                     /note="similar to GP:4433524; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase family protein"
                     /protein_id="YP_005108156.1"
                     /db_xref="GI:376278123"
                     /db_xref="GeneID:11686279"
                     /translation="MMKNRAIVWGLFLLLFVRLLAMIWVPLTDPTEARYAEIARKMVE
                     TGNWITPQFDYGVPFWAKPPLHTWLSAAGIAIFGTTAFTARLGILLASLATLTILWQW
                     ACTLTDRRTATIAVLVAASSGLFYVSAAFVQTDMVLTLGVTASMAGFYNGLAGSRRWG
                     WLFFLGLAIGLLAKGPVAVVLSATPIAVWMLWRGNWRDLKHLPWAGGLTLCAVLVIPW
                     YAAAEIATPGFLKYFLIGEHIQRFLQPGWSGDLYGAGREHARGSIWLFWIVATLPWSP
                     LLPVLIWRLRKNGMPDGKGLHLYLLLFALTPLVFFTPAANILLAYVLPGVPAAALLAV
                     ILWTRTGPAGAGWLKLGVVEVLLIFLVITIGSFFGLGRSFLPTQAPLIASYSGPGRLA
                     ILGGRSFSAEFYTQDKIVRFQTLNELAAWLKPGDGVLVPKSAYDAFAARFGNAVKPIS
                     EDRKYLLFIPIPAASVAKGTGAAAGAVI"
     misc_feature    131680..133074
                     /locus_tag="BSVBI22_B0136"
                     /note="4-amino-4-deoxy-L-arabinose transferase and related
                     glycosyltransferases of PMT family [Cell envelope
                     biogenesis, outer membrane]; Region: ArnT; COG1807"
                     /db_xref="CDD:224720"
     misc_feature    131767..>132765
                     /locus_tag="BSVBI22_B0136"
                     /note="Dolichyl-phosphate-mannose-protein
                     mannosyltransferase; Region: PMT_2; cl19158"
                     /db_xref="CDD:267511"
     gene            complement(133238..133360)
                     /locus_tag="BSVBI22_B0137"
                     /db_xref="GeneID:11686280"
     CDS             complement(133238..133360)
                     /locus_tag="BSVBI22_B0137"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108157.1"
                     /db_xref="GI:376278124"
                     /db_xref="GeneID:11686280"
                     /translation="MAARTKSLRKRLSTISVEKKRYLSSCVRLDVNSARFTGGI"
     gene            133359..134315
                     /locus_tag="BSVBI22_B0138"
                     /db_xref="GeneID:11686281"
     CDS             133359..134315
                     /locus_tag="BSVBI22_B0138"
                     /note="similar to GP:15159134; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005108158.1"
                     /db_xref="GI:376278125"
                     /db_xref="GeneID:11686281"
                     /translation="MKPMYEIIMDPNDRSYELSGSAKLYASGLITIGTTTFNTQSYAR
                     TPKIIAQGGLDFYVLQLLTGGHLLGDFDGTDVAAKPGDIVIIDMAKTLVSRAFKGSRT
                     TVFIPRAELEEVVGGRNLHGLVLSGTRPITRLLFSYIQELNAVVPDLSMDEAIAAQKV
                     MLTFLRTGITGLEEDLVGFLPVNLPVKKRILSFIDQNLSDPLLGPRTIIQNFHVSRSH
                     LYRAFENDGGVAKTIRDKRLDRAFRILAEERNRTVYSKEVAYRCGFNDPAQFASAFKN
                     RFGMSPRDVQASGATLLSLDVDGFSFPKYISQEIEKVVPPSS"
     misc_feature    133407..133829
                     /locus_tag="BSVBI22_B0138"
                     /note="AraC-binding-like domain; Region: AraC_binding_2;
                     pfam14525"
                     /db_xref="CDD:258665"
     misc_feature    133992..134222
                     /locus_tag="BSVBI22_B0138"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     misc_feature    134097..134210
                     /locus_tag="BSVBI22_B0138"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            134577..134681
                     /locus_tag="BSVBI22_B0139"
                     /db_xref="GeneID:11686282"
     CDS             134577..134681
                     /locus_tag="BSVBI22_B0139"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108159.1"
                     /db_xref="GI:376278126"
                     /db_xref="GeneID:11686282"
                     /translation="MPKMGSQSQAEYRMMICAQWGIIRTIDGAFIDGH"
     gene            134671..135108
                     /locus_tag="BSVBI22_B0140"
                     /db_xref="GeneID:11686283"
     CDS             134671..135108
                     /locus_tag="BSVBI22_B0140"
                     /note="identified by match to PFAM protein family HMM
                     PF01527"
                     /codon_start=1
                     /transl_table=11
                     /product="SyrB family protein, putative"
                     /protein_id="YP_005108160.1"
                     /db_xref="GI:376278127"
                     /db_xref="GeneID:11686283"
                     /translation="MATEFEHGPDMYTPEDVIKNFKDHSSQSRSRGTKTLENEKHTAN
                     GRMVKRYTPEERRKVFSEIATSVKSGQSSLKDALATAGISEQTYYNWKKIFTGNGPAS
                     STTLGKDLQELIELEAENQRLRQELADKLRMENAELRRRLGKV"
     misc_feature    134815..135057
                     /locus_tag="BSVBI22_B0140"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            135130..135240
                     /locus_tag="BSVBI22_B0141"
                     /db_xref="GeneID:11686284"
     CDS             135130..135240
                     /locus_tag="BSVBI22_B0141"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108161.1"
                     /db_xref="GI:376278128"
                     /db_xref="GeneID:11686284"
                     /translation="MNQIGALTICFDAHLFRKPFHTFRDALYIVRPVVTG"
     gene            complement(135302..136603)
                     /locus_tag="BSVBI22_B0142"
                     /db_xref="GeneID:11686285"
     CDS             complement(135302..136603)
                     /locus_tag="BSVBI22_B0142"
                     /note="similar to GP:5281442, GB:U12431, SP:P26378,
                     PID:521144, and PID:905387; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="phthalate transporter, putative"
                     /protein_id="YP_005108162.1"
                     /db_xref="GI:376278129"
                     /db_xref="GeneID:11686285"
                     /translation="MKNSNTAITSPEVVENMTYRKVAFRIIPLLMICYIIAYLDRVNV
                     GFAKLQMSEELGFSEAIYGLGAGLFFIGYFFFEIPSNILLHKLGARLWIARIMITWGL
                     LSALFAFVQTEWQFYILRFLLGAAEAGFYPGVILYLTYWFPSHRRGKMFALFQAGSPA
                     AGIFGNPLSGWIMDQFHDTAGWQGWQWMFVLEAIPAVVLGVVILLYLDNSVKAAKWLT
                     EEEKAIISRDIEADSKGKAASHSLMSLVKNPMLWVMTLIYFCFVMGQYGLTLWMPTLI
                     RASGVTSNVTIGLLGAIPFICAIIAMVIFSRSADHYRERRWHLVVPALLGAVGFVVAA
                     SATNTTVSIIFLSMAAAGVLACAPLFWSLPTAILSGAAAAAGIALINSVANLAGFISP
                     YMVGIIRDATHSSELGMYVLAGFLILGAAIVLCIPASKVNR"
     misc_feature    complement(135350..136546)
                     /locus_tag="BSVBI22_B0142"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     misc_feature    complement(135323..136525)
                     /locus_tag="BSVBI22_B0142"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(135440..135442,135449..135454,
                     135461..135466,135473..135478,135509..135511,
                     135518..135523,135533..135535,135542..135547,
                     135554..135556,135698..135700,135710..135712,
                     135719..135721,135731..135733,135743..135745,
                     135785..135787,135794..135799,135806..135811,
                     135818..135820,136118..136120,136136..136141,
                     136148..136153,136187..136189,136196..136201,
                     136208..136213,136220..136225,136361..136366,
                     136370..136375,136385..136387,136394..136399,
                     136406..136408,136457..136462,136466..136474,
                     136481..136483))
                     /locus_tag="BSVBI22_B0142"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(136629..137261)
                     /locus_tag="BSVBI22_B0143"
                     /db_xref="GeneID:11686286"
     CDS             complement(136629..137261)
                     /locus_tag="BSVBI22_B0143"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00760"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aldolase"
                     /protein_id="YP_005108163.1"
                     /db_xref="GI:376278130"
                     /db_xref="GeneID:11686286"
                     /translation="MTEQEIRELIVELGASLFARGYCVGSAGNISVRLADGYLMTPTN
                     SCLGRLRADRLSKLDKGWNHIGGDRPSKEVFMHRAVLGARPQAGAVVHLHSTYATAIS
                     CLSSPADTMPITPLTPYFVMRIGKHLPTIPYYRPGDPAMEREIHDAAQNASAMLLANH
                     GPVVSGNSLVDAVYAAEELEESARLSIMLQGLPARKLTDEQIEDLLHTFK"
     misc_feature    complement(136632..137261)
                     /locus_tag="BSVBI22_B0143"
                     /note="putative aldolase; Validated; Region: PRK08130"
                     /db_xref="CDD:181241"
     misc_feature    complement(order(136644..136646,136719..136721,
                     136731..136733,136752..136754,136785..136787,
                     136863..136865,136911..136916,136920..136922,
                     136950..136958,136971..136976,136980..136982,
                     137115..137120,137124..137126,137190..137192))
                     /locus_tag="BSVBI22_B0143"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(136782..136784,136980..136982,
                     136986..136988,137043..137051,137130..137135,
                     137175..137177))
                     /locus_tag="BSVBI22_B0143"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(136782..136784,136980..136982,
                     136986..136988))
                     /locus_tag="BSVBI22_B0143"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            complement(137287..138252)
                     /locus_tag="BSVBI22_B0144"
                     /db_xref="GeneID:11686287"
     CDS             complement(137287..138252)
                     /locus_tag="BSVBI22_B0144"
                     /note="similar to GB:M31651, GB:M27542, GB:X16351,
                     GB:X05403, GB:X05792, GB:X16349, GB:X16350, SP:P04278,
                     SP:P14689, PID:1335305, PID:36452, PID:825718, GB:M31651,
                     GB:M27542, GB:X16351, GB:X05403, GB:X05792, GB:X16349,
                     GB:X16350, SP:P04278, SP:P14689, PID:1335305, PID:36452,
                     and PID:825718; identified by sequence similarity;
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108164.1"
                     /db_xref="GI:376278131"
                     /db_xref="GeneID:11686287"
                     /translation="MAKIVVTGGAGFLGSRLIRGLLASRGQNGVPSFDSIVSVDLVAC
                     SIDDPRITSVTGDIADPAFARSVITKGTVGVYHMAAALSGQSEAEFDVGMRVNIDGTR
                     ALLEAARATQEAPKFIFTSSLAVFGGEMPDVVPENLALLPQSSYGAEKAIGEFLVGDY
                     SRRGFIDGRICRLPTIVVRPGKPNSAASSFASGIIREPLAGIASNNPVPPATRMWLSS
                     PDIAARNLVHAITVEGSALGINRVLNLPGICVTVADMLDSLERIAGKDVRALVSAEPE
                     QRVIDIVCSWPGEFDIARPLALGFTRDADFDAVVRQYRDEFAHSS"
     misc_feature    complement(137296..138246)
                     /locus_tag="BSVBI22_B0144"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    complement(137323..138246)
                     /locus_tag="BSVBI22_B0144"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(137725..137736,137803..137805,
                     137815..137817,137887..137895,138013..138021,
                     138133..138141,138214..138216,138220..138225,
                     138229..138231))
                     /locus_tag="BSVBI22_B0144"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(137803..137805,137815..137817,
                     137887..137889,137962..137964))
                     /locus_tag="BSVBI22_B0144"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(138252..139043)
                     /locus_tag="BSVBI22_B0145"
                     /db_xref="GeneID:11686288"
     CDS             complement(138252..139043)
                     /locus_tag="BSVBI22_B0145"
                     /note="similar to GB:J00222, GB:S55273, SP:P01854,
                     PID:184760, PID:2300106, and PID:386807; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="YP_005108165.1"
                     /db_xref="GI:376278132"
                     /db_xref="GeneID:11686288"
                     /translation="MIPAERQALIVSRLSARGILSIAELAEMLGVSPMTVRRDIHSLE
                     EQGRALSVAGGVQLPERIFSEPSHIVKAALYHNEKAAIGQLAAQMIRPGTVIYLDAGT
                     TTLEIAYRLTDRQDLTVFTNDFVIAAFLSQESNCKLFHTGGEVERENQSCVGSAAGEA
                     IRRFNFDLAFISTSSFGARGVSTPSENKIAVKRAVVESAVRRVLVTDSSKYGLIGTFN
                     AIPLDVLSAVVTDAGLPENARETITQRGVELHLVEAGTGKVEGKI"
     misc_feature    complement(138285..139043)
                     /locus_tag="BSVBI22_B0145"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    complement(138870..139028)
                     /locus_tag="BSVBI22_B0145"
                     /note="DeoR-like helix-turn-helix domain; Region:
                     HTH_DeoR; cl17531"
                     /db_xref="CDD:248085"
     misc_feature    complement(138345..138827)
                     /locus_tag="BSVBI22_B0145"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            complement(139040..139825)
                     /locus_tag="BSVBI22_B0146"
                     /db_xref="GeneID:11686289"
     CDS             complement(139040..139825)
                     /locus_tag="BSVBI22_B0146"
                     /note="similar to GP:10197687, GB:J03799, GB:X15005,
                     GB:S37431, GB:M14199, GB:X61156, GB:U36484, SP:P08865,
                     PID:1125065, PID:34272, and PID:386857; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate isomerase, putative"
                     /protein_id="YP_005108166.1"
                     /db_xref="GI:376278133"
                     /db_xref="GeneID:11686289"
                     /translation="MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDADV
                     IARELKQHNLTQVLFNMPPGDWAAGERGMAAIPGREQEFRDNVDIALHYALALDCRTL
                     HAMSGITEGLDRKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEA
                     VGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDEGEL
                     NYPYLFSVLESVGYRGWVGCEYNPRGKTESGLAWFAPYRDQSA"
     misc_feature    complement(139049..139825)
                     /locus_tag="BSVBI22_B0146"
                     /note="Hydroxypyruvate isomerase [Carbohydrate transport
                     and metabolism]; Region: Hfi; COG3622"
                     /db_xref="CDD:226149"
     misc_feature    complement(139067..139822)
                     /locus_tag="BSVBI22_B0146"
                     /note="Fructose/tagarose-bisphosphate aldolase class II.
                     This family includes fructose-1,6-bisphosphate (FBP) and
                     tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is
                     homodimeric and used in gluconeogenesis and glycolysis;
                     the enzyme controls the...; Region: FTBP_aldolase_II;
                     cl17181"
                     /db_xref="CDD:266533"
     gene            complement(139825..141099)
                     /locus_tag="BSVBI22_B0147"
                     /db_xref="GeneID:11686290"
     CDS             complement(139825..141099)
                     /locus_tag="BSVBI22_B0147"
                     /note="similar to GB:J00222, GB:S55273, SP:P01854,
                     PID:184760, PID:2300106, and PID:386807; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108167.1"
                     /db_xref="GI:376278134"
                     /db_xref="GeneID:11686290"
                     /translation="MRLGVIADDFTGATDIAGFLVGNGLRTIQLNGVPADDLAVDADA
                     VVISLKTRSCPTGQAIAESLAALKWLQKNNCQQFFFKYCSTFDSTPKGNIGPVTDALL
                     EALGEEFTVICPALPVNGRTIYNGYLFVNGVLLSETGMRNHPVTPMTDSNIMRVMESQ
                     SRGRAGNISSTIVDQGSDAVRDALRKLQSEGIRYAVLDALNDQHIETLGRAVSQMKLV
                     TGGSGLADGMARAWTQLRGKNVAAAEAAGAPVKGRTVILSGSCSQMTNAQVAAYKAKA
                     PALAMDVEKAINDAAYIDVLAEWVLAQSGDALAPLVYATMPPEALKAVQERFGGERAS
                     AAIEDLFGQLAKRLEAEGFTRFIVAGGETSGAVTQALAIDGFTIRPQIAPGVPWVRGI
                     GKPLSLALKSGNFGTEAFFFEAQKIANQEGDK"
     misc_feature    complement(139852..141099)
                     /locus_tag="BSVBI22_B0147"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3395"
                     /db_xref="CDD:225930"
     gene            142158..142295
                     /locus_tag="BSVBI22_B0148"
                     /db_xref="GeneID:11686291"
     CDS             142158..142295
                     /locus_tag="BSVBI22_B0148"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108168.1"
                     /db_xref="GI:376278135"
                     /db_xref="GeneID:11686291"
                     /translation="MQEIQTIKGSFRQLQIAACYERRLWNRAEVSLQSLCAETSIPVQ
                     A"
     gene            142372..142752
                     /gene="flgB"
                     /locus_tag="BSVBI22_B0149"
                     /db_xref="GeneID:11686292"
     CDS             142372..142752
                     /gene="flgB"
                     /locus_tag="BSVBI22_B0149"
                     /note="with FlgF and C makes up the proximal portion of
                     the flagellar basal body rod; Bradyrhizobium have one
                     thick flagellum and several thin flagella; the proteins in
                     this cluster are associated with the thin flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgB"
                     /protein_id="YP_005108169.1"
                     /db_xref="GI:376278136"
                     /db_xref="GeneID:11686292"
                     /translation="MSSIHLFDLAARQAQWLSVRQATVAGNVANANTPDFRARDVQPF
                     ADVLDKTQLTMTATSPLHLEAEADGIAATRLRPDDVTEQTHSGNTVDVEQEMMKAGEI
                     AREYSLNTSIVKAFHRMMLSVAKG"
     misc_feature    142372..142749
                     /gene="flgB"
                     /locus_tag="BSVBI22_B0149"
                     /note="flagellar basal body rod protein FlgB; Reviewed;
                     Region: flgB; PRK06003"
                     /db_xref="CDD:168340"
     misc_feature    142414..142704
                     /gene="flgB"
                     /locus_tag="BSVBI22_B0149"
                     /note="flagellar basal body rod protein FlgB; Provisional;
                     Region: flgB; cl19173"
                     /db_xref="CDD:267526"
     gene            142755..143177
                     /gene="flgC"
                     /locus_tag="BSVBI22_B0150"
                     /db_xref="GeneID:11686293"
     CDS             142755..143177
                     /gene="flgC"
                     /locus_tag="BSVBI22_B0150"
                     /note="with FlgF and B makes up the proximal portion of
                     the flagellar basal body rod"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="YP_005108170.1"
                     /db_xref="GI:376278137"
                     /db_xref="GeneID:11686293"
                     /translation="MSSDALQSTLKIAASGLSAQSTRLCIVSENIANAQSTAKTADTD
                     PYRRKTVSFRTELEQGTGAAEVRVAEVGKDTSPFIEQYDPSHPAADARGYVKYPNVNM
                     VVEMADMREANRSYEANLQVVRQARELISMTIDLLRST"
     misc_feature    142758..143171
                     /gene="flgC"
                     /locus_tag="BSVBI22_B0150"
                     /note="flagellar basal body rod protein FlgC; Reviewed;
                     Region: flgC; PRK12782"
                     /db_xref="CDD:139220"
     misc_feature    142782..>142856
                     /gene="flgC"
                     /locus_tag="BSVBI22_B0150"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    <143025..143162
                     /gene="flgC"
                     /locus_tag="BSVBI22_B0150"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            143177..143512
                     /gene="fliE"
                     /locus_tag="BSVBI22_B0151"
                     /db_xref="GeneID:11686294"
     CDS             143177..143512
                     /gene="fliE"
                     /locus_tag="BSVBI22_B0151"
                     /note="forms a junction between the M-ring and FlgB during
                     flagella biosynthesis; Bradyrhizobium has one thick
                     flagellum and several thin flagella; the protein in this
                     cluster is associated with the thin flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body protein FliE"
                     /protein_id="YP_005108171.1"
                     /db_xref="GI:376278138"
                     /db_xref="GeneID:11686294"
                     /translation="MYDSIMSVSARNALSRLSETVAEKGVGSASAPQAVPAAPGASFG
                     EVLSQMTGSVSQKLQAAEATSIQGIKGDAPVRDVVSSVMEAEQSLQTAIAIRDKIVQA
                     YLEISRMPI"
     misc_feature    143177..143509
                     /gene="fliE"
                     /locus_tag="BSVBI22_B0151"
                     /note="flagellar hook-basal body protein FliE; Reviewed;
                     Region: fliE; PRK00790"
                     /db_xref="CDD:179126"
     gene            143598..144386
                     /gene="flgG"
                     /locus_tag="BSVBI22_B0152"
                     /db_xref="GeneID:11686295"
     CDS             143598..144386
                     /gene="flgG"
                     /locus_tag="BSVBI22_B0152"
                     /note="makes up the distal portion of the flagellar basal
                     body rod; Bradyrhizobium has one thick flagellum and
                     several thin flagella; the Bradyrhizobium protein in this
                     cluster is associated with the thick flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgG"
                     /protein_id="YP_005108172.1"
                     /db_xref="GI:376278139"
                     /db_xref="GeneID:11686295"
                     /translation="MKALTIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFTDLL
                     YQSERTAGVPNQANQAIVPEGALVGLGVQTAAVRNLHIQGSFNQTGNPYDVALTGRGW
                     FQIQSPTGETLYTRAGAFNKNADGQLVTLDGNPVEPAITIPPDAIEVTITDTGQVFAK
                     LQDQINQVDLGQLTLANFTNEAGLEPLGGNLYRETEASGGPLVGVPGDPGYGSIKQGY
                     LEASNVDPVKEITDLITAQRAYEMNSKVIQAADEMAATVSKNLR"
     misc_feature    143598..144383
                     /gene="flgG"
                     /locus_tag="BSVBI22_B0152"
                     /note="flagellar basal body rod protein FlgG; Reviewed;
                     Region: flgG; PRK12691"
                     /db_xref="CDD:183686"
     misc_feature    143607..143699
                     /gene="flgG"
                     /locus_tag="BSVBI22_B0152"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    144141..144374
                     /gene="flgG"
                     /locus_tag="BSVBI22_B0152"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            144398..144880
                     /gene="flgA"
                     /locus_tag="BSVBI22_B0153"
                     /db_xref="GeneID:11686296"
     CDS             144398..144880
                     /gene="flgA"
                     /locus_tag="BSVBI22_B0153"
                     /note="required for the assembly of the flagellar basal
                     body P-ring; Bradyrhizobium japonicum has two types of
                     flagella, a single thick flagella and a few thin flagella;
                     the protein in this cluster is associated with the thin
                     flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring biosynthesis protein
                     FlgA"
                     /protein_id="YP_005108173.1"
                     /db_xref="GI:376278140"
                     /db_xref="GeneID:11686296"
                     /translation="MDRVKAIFQTARLALAGGFLLAAMAGAGAADRIAFVVPSATVYP
                     GQIVSDTALLEKQFFINAPAATQYVLSLDQAVGKVARKTLLPGKPILVSALGEPSLVT
                     RGIPAPLVFTAGTLTITAMGTPLESGVAGDFIKVRNVDSGIIVSGTVLANGRIQVGMQ
                     "
     misc_feature    144503..144682
                     /gene="flgA"
                     /locus_tag="BSVBI22_B0153"
                     /note="SAF domains of the flagella basal body P-ring
                     formation protein FlgA and the flp pilus assembly CpaB;
                     Region: SAF_CpaB_FlgA_like; cd11614"
                     /db_xref="CDD:212159"
     misc_feature    <144602..144871
                     /gene="flgA"
                     /locus_tag="BSVBI22_B0153"
                     /note="Domains similar to fish antifreeze type III
                     protein; Region: SAF; cl00555"
                     /db_xref="CDD:260496"
     gene            145177..146250
                     /gene="flgI"
                     /locus_tag="BSVBI22_B0154"
                     /db_xref="GeneID:11686297"
     CDS             145177..146250
                     /gene="flgI"
                     /locus_tag="BSVBI22_B0154"
                     /note="part of the basal body which consists of four rings
                     L, P, S, and M mounted on a central rod; Vibrio
                     parahaemolyticus, Yersinia, Bradyrhizobium and other
                     bacteria have two copies of this and other flagellar
                     genes; the V. parahaemolyticus protein is associated with
                     the polar flagella and the Bradyrhizobium protein is
                     associated with the thick flagellum"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring protein"
                     /protein_id="YP_005108174.1"
                     /db_xref="GI:376278141"
                     /db_xref="GeneID:11686297"
                     /translation="MTYAELGRGSAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDS
                     LRNSPFTEQSMRAMLDNLGISAPRNSTRSKNTAAVIVTANLPAFAGAGSRIDVTVSSL
                     GDATSLQGGTLVMTQLMGADNQIYAVAQGNMIVSGFSAEGEAASVTQGVPTSGRIPNG
                     ALVEREVAGSFGKDREMIVELRDPDFTTAVRAADTINVFAKRRYGRGVAIARDAKTIR
                     LSRPKNVPAARFLAELEGLPITTDEVARVVVDERTGTVVIGEKVRISKVAISHGSLTV
                     RVTETPMVVQPEPFSDGETAVEPNTDIAVNQQNAKIGILSGANLENLVKGLNQIGVKP
                     TGIIAILQAIKTSGALHAELVVQ"
     misc_feature    145204..146247
                     /gene="flgI"
                     /locus_tag="BSVBI22_B0154"
                     /note="flagellar basal body P-ring protein; Provisional;
                     Region: flgI; PRK05303"
                     /db_xref="CDD:235399"
     gene            146247..146819
                     /locus_tag="BSVBI22_B0155"
                     /db_xref="GeneID:11686298"
     CDS             146247..146819
                     /locus_tag="BSVBI22_B0155"
                     /note="similar to GP:12057224; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108175.1"
                     /db_xref="GI:376278142"
                     /db_xref="GeneID:11686298"
                     /translation="MIMAHKMIRYGSAVALFLAASVPAFADPPALGNLDEIRKFCGNI
                     DDQAADARYALQAKQLTELKADVEERMRALEEKRREYELWLKRRDEFVSKAQDALVDI
                     ISKMKPDAAAAQMALIGDEAAAALILKLNPRVSSIILNEMPPEKAAKLARVIVGSQRT
                     SSAAQPVKDQSGRDQRAAAQTGNTVQRKTA"
     misc_feature    146250..146741
                     /locus_tag="BSVBI22_B0155"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3334"
                     /db_xref="CDD:225871"
     gene            146816..147532
                     /gene="flgH"
                     /locus_tag="BSVBI22_B0156"
                     /db_xref="GeneID:11686299"
     CDS             146816..147532
                     /gene="flgH"
                     /locus_tag="BSVBI22_B0156"
                     /note="part of the flagellar basal body which consists of
                     four rings L,P, S and M mounted on a central rod"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body L-ring protein"
                     /protein_id="YP_005108176.1"
                     /db_xref="GI:376278143"
                     /db_xref="GeneID:11686299"
                     /translation="MNKAILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQ
                     FNGYPARPGKASYSLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVS
                     KGIYGGGGSFATSSITGAAAGGDMDASINTHSDSKSKGKGTIERSEDIRLQIAAIVTD
                     TLPNGNLIIRGSQEVRVNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGR
                     LSEIQQPPYGQQILDQFSPF"
     misc_feature    146837..147529
                     /gene="flgH"
                     /locus_tag="BSVBI22_B0156"
                     /note="flagellar basal body L-ring protein; Reviewed;
                     Region: flgH; PRK00249"
                     /db_xref="CDD:234700"
     gene            147545..148036
                     /locus_tag="BSVBI22_B0157"
                     /db_xref="GeneID:11686300"
     CDS             147545..148036
                     /locus_tag="BSVBI22_B0157"
                     /note="similar to GP:15073597, GB:X56253, GB:X56254,
                     GB:X56255, GB:X56256, GB:X56257, GB:M16985, SP:P20645,
                     PID:307147, and PID:825692; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FliL, putative"
                     /protein_id="YP_005108177.1"
                     /db_xref="GI:376278144"
                     /db_xref="GeneID:11686300"
                     /translation="MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMISAG
                     QQASAKPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHE
                     IPPAMAANVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISAL
                     VVE"
     misc_feature    147545..>147787
                     /locus_tag="BSVBI22_B0157"
                     /note="Flagellar basal body-associated protein FliL;
                     Region: FliL; cl00681"
                     /db_xref="CDD:260568"
     misc_feature    147749..148030
                     /locus_tag="BSVBI22_B0157"
                     /note="Flagellar basal body-associated protein FliL;
                     Region: FliL; pfam03748"
                     /db_xref="CDD:252145"
     gene            148033..148773
                     /gene="fliP"
                     /locus_tag="BSVBI22_B0158"
                     /db_xref="GeneID:11686301"
     CDS             148033..148773
                     /gene="fliP"
                     /locus_tag="BSVBI22_B0158"
                     /note="FliP, with proteins FliQ and FliR, forms the core
                     of the central channel in the flagella export apparatus"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliP"
                     /protein_id="YP_005108178.1"
                     /db_xref="GI:376278145"
                     /db_xref="GeneID:11686301"
                     /translation="MKHSLGLGVILTLALTVSAQAQQALPLDKLLPAGSGAASGQIVQ
                     LFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALFMTFYVM
                     APAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLADPSFR
                     TSDDGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTV
                     ISLPFKILFFVLIDGWNILVGSLIRSFS"
     misc_feature    148042..148770
                     /gene="fliP"
                     /locus_tag="BSVBI22_B0158"
                     /note="FliP family; Region: FliP; cl00593"
                     /db_xref="CDD:260517"
     gene            148868..149362
                     /locus_tag="BSVBI22_B0159"
                     /db_xref="GeneID:11686302"
     CDS             148868..149362
                     /locus_tag="BSVBI22_B0159"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108179.1"
                     /db_xref="GI:376278146"
                     /db_xref="GeneID:11686302"
                     /translation="MVPAVLLKQESLYLLQVSFDNSSADITAKQYTKRHYMDFPAWTW
                     WAVAIGLFLLIEALMAIWYIRRLSRQRVETTAALKEVQHTGEPGSALVLEATDTGKRL
                     GAYSFLVVRLRLRVTRANGEEFETAIDAHISPVRIADFAEGKHIKVSIDPHARTVVLN
                     QPVQ"
     misc_feature    148985..>149152
                     /locus_tag="BSVBI22_B0159"
                     /note="Domain of unknown function (DUF4381); Region:
                     DUF4381; pfam14316"
                     /db_xref="CDD:258491"
     gene            149375..149791
                     /locus_tag="BSVBI22_B0160"
                     /db_xref="GeneID:11686303"
     CDS             149375..149791
                     /locus_tag="BSVBI22_B0160"
                     /note="similar to GP:15130936; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108180.1"
                     /db_xref="GI:376278147"
                     /db_xref="GeneID:11686303"
                     /translation="MLAACGKPMNIMALISILHLSSGGVALAADTGRIIIRNDLAACV
                     DMRVEKPPFEYPNGSNIVAINANFKLRKPIGACGCMSALARYASSVNERESRLFLQQG
                     LFNLKKSDTKTLPLATEPALVKDGNIEITVGCARPR"
     misc_feature    149414..149788
                     /locus_tag="BSVBI22_B0160"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4893"
                     /db_xref="CDD:227230"
     gene            complement(149987..150871)
                     /locus_tag="BSVBI22_B0161"
                     /db_xref="GeneID:11686304"
     CDS             complement(149987..150871)
                     /locus_tag="BSVBI22_B0161"
                     /note="similar to GP:3419687; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005108181.1"
                     /db_xref="GI:376278148"
                     /db_xref="GeneID:11686304"
                     /translation="MRFDVTDLRLFVSIAETGSITHGAAMVNMALGAASARVRGMEEL
                     AGVALLNRERLGVSITPAGRALLQHGRIVLQQLGRMHSELDEFAHGLKGHVRLFSNTN
                     ALAEFLPVALSSFLMDNPGVNIDLQEHLSDEIVRSVVEGIADIGIVAGTVDVASLETF
                     PFREDYLVVVVPQGHPFARRRRIAFKDTLDYDFIGLSQGAALQNFLSAHAMRMGQRLR
                     LRVQLRSFDSICQMVESRAGIAIVPASAAKRLRRIMAIRIIALDDAWALRRLTICVRS
                     LQDLPAHAARLVEHLRQT"
     misc_feature    complement(149993..150865)
                     /locus_tag="BSVBI22_B0161"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(150680..150853)
                     /locus_tag="BSVBI22_B0161"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(149999..150592)
                     /locus_tag="BSVBI22_B0161"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator,
                     contains the type 2 periplasmic binding fold; Region:
                     PBP2_LTTR_like_1; cd08421"
                     /db_xref="CDD:176113"
     misc_feature    complement(order(150167..150172,150176..150181,
                     150197..150214,150488..150508,150512..150514,
                     150524..150526,150533..150538,150542..150547))
                     /locus_tag="BSVBI22_B0161"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176113"
     gene            151051..152268
                     /locus_tag="BSVBI22_B0162"
                     /db_xref="GeneID:11686305"
     CDS             151051..152268
                     /locus_tag="BSVBI22_B0162"
                     /note="identified by match to PFAM protein family HMM
                     PF02515"
                     /codon_start=1
                     /transl_table=11
                     /product="CAIB/BAIF family protein"
                     /protein_id="YP_005108182.1"
                     /db_xref="GI:376278149"
                     /db_xref="GeneID:11686305"
                     /translation="MTAPFSVQPPESALRPLDGITVVSLEHAIAAPFATRQLADLGAR
                     VIKVERPGVGDFARAYDDRVNGMASHFVWCNRSKESLAIDLKHPDARGILHDLVSKAD
                     VLVQNLAPGAAARLGLSAEALRADCPHLIVCDISGYGSDGPYRDRKAYDLLIQSEAGF
                     LSVTGTPDEQAKAGISIADIAAGMYAYSGILSALLMRERTGQGSHIEVSMLEALGEWM
                     GFPLYYTYGGKEPPPRTGASHATIFPYGPFPTGDGKTVMLGLQNEREWAIFCEKVLHQ
                     PALAQDERFVSNVLRVRNRDALTEIIVASFAASNAEAITMQLDEAGIANARVRTMAEV
                     WDHPQLQARGRWTEITTPAGQVPALLPPAFPNGMEPRMDPVPALGAHNISILTELGLD
                     EAQIAALREAGAI"
     misc_feature    151078..152265
                     /locus_tag="BSVBI22_B0162"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            152336..153172
                     /locus_tag="BSVBI22_B0163"
                     /db_xref="GeneID:11686306"
     CDS             152336..153172
                     /locus_tag="BSVBI22_B0163"
                     /note="identified by match to PFAM protein family HMM
                     PF01524"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108183.1"
                     /db_xref="GI:376278150"
                     /db_xref="GeneID:11686306"
                     /translation="MELNIEQLRSWIGREETRHELVTPSLVERFNATFDHEGDTANDA
                     VAPLLIHLCLTQPAALTSRLGPDGHPARGGFLPPVPLPRRMWAGGAFTFRDDIRVGDI
                     VTRTSRIQDVVVKEGRTGTLCFVTVGHEFHSNGRHAVTERQDIVYRGADMSNPAAKTQ
                     PAVPHGPHCRFITPSAPLLFRYSALTFNGHRIHYDAPYVRNVENYPGLIVHGPMQATM
                     LVRFATEIRGKPPVRFDFRSLSPLFDDADFTLNAIDDGEGLKLWTSYANGPVAMEARA
                     LW"
     misc_feature    152342..153169
                     /locus_tag="BSVBI22_B0163"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3777"
                     /db_xref="CDD:226300"
     misc_feature    152363..152755
                     /locus_tag="BSVBI22_B0163"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    152849..153163
                     /locus_tag="BSVBI22_B0163"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    order(152966..152971,153047..153058)
                     /locus_tag="BSVBI22_B0163"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(152984..152986,152993..152998,153005..153007,
                     153029..153031)
                     /locus_tag="BSVBI22_B0163"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            153166..153990
                     /locus_tag="BSVBI22_B0164"
                     /db_xref="GeneID:11686307"
     CDS             153166..153990
                     /locus_tag="BSVBI22_B0164"
                     /note="identified by match to PFAM protein family HMM
                     PF03328"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase, beta subunit, putative"
                     /protein_id="YP_005108184.1"
                     /db_xref="GI:376278151"
                     /db_xref="GeneID:11686307"
                     /translation="MVSIASIRAPLFVPADRPDRFSKAAASGTDCVILDLEDAVAPKA
                     KDAARAALDTSFTDLPVMVRINPHGTPWHEADMAAVARLDVAGVILPKAETAERIEAA
                     ARMLDLPLIALVETARGLANARSIAAASGVVRLAFGSIDFCADLACAHMREILLPARV
                     ELVMASRLAGIAAPIDGVTPGFNDPVMCHQDAAHARALGMMGKLCIHPRQISEVLRAF
                     AWSDQEIDWARRVLASGEGAISIDGMMVDEPVRIRARTILEQADIGAAPVLTKPTG"
     misc_feature    153190..153969
                     /locus_tag="BSVBI22_B0164"
                     /note="Citrate lyase beta subunit [Carbohydrate transport
                     and metabolism]; Region: CitE; COG2301"
                     /db_xref="CDD:225184"
     gene            complement(154185..154370)
                     /locus_tag="BSVBI22_B0165"
                     /db_xref="GeneID:11686308"
     CDS             complement(154185..154370)
                     /locus_tag="BSVBI22_B0165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108185.1"
                     /db_xref="GI:376278152"
                     /db_xref="GeneID:11686308"
                     /translation="MTRIFSKNRFTLFGMRSKGASLIGTSEMTLFRINYPLKIKVSGF
                     LNFNEVERCIFLVPHLR"
     gene            154440..155018
                     /locus_tag="BSVBI22_B0166"
                     /db_xref="GeneID:11686309"
     CDS             154440..155018
                     /locus_tag="BSVBI22_B0166"
                     /note="similar to GB:L25675, PID:409767, and SP:P53641;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b561, putative"
                     /protein_id="YP_005108186.1"
                     /db_xref="GI:376278153"
                     /db_xref="GeneID:11686309"
                     /translation="MTQSRAIFDSPIGYGVVSRVLHWAMALMFAWQFTSAILHYFAKG
                     SAIFKFFWAAHFQLGFALLLLVLLRGVWGLINCNRRPRAESSGGRIVALGHGLIYILM
                     IAVPTVAMLRSYNSGRGFSFLGMEIFAKTAVQNPAGGAPAAAVNAGLSLHGLLGWILL
                     AVVIAHILLALAHHFIMQDNTLRYMTGRRAVS"
     misc_feature    154458..155009
                     /locus_tag="BSVBI22_B0166"
                     /note="Cytochrome B561 [Energy production and conversion];
                     Region: CybB; COG3038"
                     /db_xref="CDD:225580"
     gene            155517..155861
                     /locus_tag="BSVBI22_B0167"
                     /db_xref="GeneID:11686310"
     CDS             155517..155861
                     /locus_tag="BSVBI22_B0167"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108187.1"
                     /db_xref="GI:376278154"
                     /db_xref="GeneID:11686310"
                     /translation="MLICSYLILINKSVDGGGNIGTKLGRGVESRRTLGSHINSASQL
                     YSGCLCCANRVTLWHRCILSLVPKIHRSISLGALLVYGAPSSGTRWWDNFISRVGRVR
                     ELRRLVLRKKAY"
     gene            155809..156216
                     /locus_tag="BSVBI22_B0168"
                     /db_xref="GeneID:11686311"
     CDS             155809..156216
                     /locus_tag="BSVBI22_B0168"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108188.1"
                     /db_xref="GI:376278155"
                     /db_xref="GeneID:11686311"
                     /translation="MDGFASCGVWFSERKHIDMRSVRTIIRPGAAFIAMLYATVSVHA
                     GGQGGYGGLNMNPYGYPGGNGNSATGMGGDGGQGYNNPDPTGAGGTVGNLITSPTTII
                     SNITGGLVDAPLTRTDLEAMPVVVVRVLQQLRT"
     gene            156261..159602
                     /locus_tag="BSVBI22_B0169"
                     /db_xref="GeneID:11686312"
     CDS             156261..159602
                     /locus_tag="BSVBI22_B0169"
                     /note="similar to GP:15162141, and GP:15162141; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane autotransporter"
                     /protein_id="YP_005108189.1"
                     /db_xref="GI:376278156"
                     /db_xref="GeneID:11686312"
                     /translation="MGAWSGAGAGGGGGAGVATSANFTNNSTVIGGAGGDGANTSRGQ
                     NSGGGGGGAGVYVVGNSTLVTITNNGTITGGAGGLNSAWPVYYGATGGAGEGGAAGSI
                     RTGGSQGTSSQGGAGIIGANIAVINNGTITGGIGGTGGLNAGVQNDAVTFQSGTNSLT
                     LTTKSVISGVVSANGNDDTLTLQNTLSKIDGGQSDGANISATQYKGFEHLVVNGGRWT
                     VGGSAIVSGETTLNGGALVVTGPAALGVQAITAQGGAIEASGDQVLNQSFVLKNNPYG
                     ASTSGLVVQGADNLVLSGVLSDVGRLTKNGSGTLTLTADNTYTGGTVFAGGVVSVDKE
                     VRLGGGDLTFNGGTLQVMGTSWTSTNRAVSLQAGGGTFDIEDAANNFAVTQGVAGAGG
                     LTKSGSGTLTLSGANSYTGATTVSAGTLVVANDNTGGGTTTVDVGAGLQIGTGGVSGS
                     LAGDIVNNGTLVVDRSNAFDLANVISGTGSLTKNGAGTLTLSGVNSYTGGTTVSAGIL
                     TLTGDNTGGGTTTVDAGAVLQIGTGGTSGNLAGDIANNGALVVNRSDALNLANAISGA
                     GSLMKSGAGTLTLSGANSYTGATTVSAGTLTQGAAGGFSTASSRYDVDTDGTLDLGGF
                     DTMLAALYNAGTINMNVGAAGSTLMVNGDYVGHDGTIVFNTVLGDDNSKTDKLMVGGD
                     TAGNTNVQVVNRDGLGAQTVKGIEIITVGGQSNGVFSLVSDYRTKDGRKAVVGGAYAY
                     TLHQGPARGANDGNWYLISQLEDIKPDNPATRRVSDTPDAPDTPAPRYSANVPVYEGY
                     VQTMQALNKPSTLQERVGKRYMTGENGDGRTSGGMVDAHGIWARIQGAHDRLEPTTLT
                     GMKQEINTFILQAGVDGQFYEDENGKLIAGITGQYGTARSNIVARDGDGRISTNAWSL
                     GATATWIGNDGFYVDTQGQVTWFESDLNSDTADVGLASGRKATGYALSVETGKRIALN
                     GNWALTPQAQLIWSSINADDFEDVWQANISVARGNSFAARFGLAASYDSSWQGSDGRV
                     VNTSVYGITNLYQEFLGGTRVNISGVDFSTDNDRTWAGIGAGGTYAWAGGKYLIFGQG
                     TINTSLDHFADSYAIKGDVGFKVKW"
     misc_feature    157164..157256
                     /locus_tag="BSVBI22_B0169"
                     /note="Autotransporter-associated beta strand repeat;
                     Region: Autotrns_rpt; pfam12951"
                     /db_xref="CDD:257425"
     misc_feature    157434..157529
                     /locus_tag="BSVBI22_B0169"
                     /note="Autotransporter-associated beta strand repeat;
                     Region: Autotrns_rpt; pfam12951"
                     /db_xref="CDD:257425"
     misc_feature    157698..157784
                     /locus_tag="BSVBI22_B0169"
                     /note="Autotransporter-associated beta strand repeat;
                     Region: Autotrns_rpt; pfam12951"
                     /db_xref="CDD:257425"
     misc_feature    157956..159599
                     /locus_tag="BSVBI22_B0169"
                     /note="Type V secretory pathway, adhesin AidA [Cell
                     envelope biogenesis, outer membrane / Intracellular
                     trafficking and secretion]; Region: AidA; COG3468"
                     /db_xref="CDD:225999"
     misc_feature    157980..158549
                     /locus_tag="BSVBI22_B0169"
                     /note="Pertactin-like passenger domains (virulence
                     factors), C-terminal, subgroup 2, of autotransporter
                     proteins of the type V secretion system of Gram-negative
                     bacteria. This subgroup includes the passenger domains of
                     the nonprotease autotransporters, Ag43; Region:
                     PL2_Passenger_AT; cd01344"
                     /db_xref="CDD:238654"
     misc_feature    158859..159518
                     /locus_tag="BSVBI22_B0169"
                     /note="Autotransporter beta-domain; Region:
                     Autotransporter; smart00869"
                     /db_xref="CDD:214872"
     gene            159838..160233
                     /gene="cycA"
                     /locus_tag="BSVBI22_B0170"
                     /db_xref="GeneID:11686313"
     CDS             159838..160233
                     /gene="cycA"
                     /locus_tag="BSVBI22_B0170"
                     /note="similar to GB:L11566, SP:Q07020, PID:337493,
                     GB:L11566, SP:Q07020, and PID:337493; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c2"
                     /protein_id="YP_005108190.1"
                     /db_xref="GI:376278157"
                     /db_xref="GeneID:11686313"
                     /translation="MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGE
                     GAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKM
                     VYAGLKDEGKIDDLIAFLKQYDLGGKIKE"
     misc_feature    159844..160221
                     /gene="cycA"
                     /locus_tag="BSVBI22_B0170"
                     /note="Cytochrome c2 [Energy production and conversion];
                     Region: COG3474"
                     /db_xref="CDD:226005"
     gene            complement(160457..160696)
                     /locus_tag="BSVBI22_B0171"
                     /db_xref="GeneID:11686314"
     CDS             complement(160457..160696)
                     /locus_tag="BSVBI22_B0171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108191.1"
                     /db_xref="GI:376278158"
                     /db_xref="GeneID:11686314"
                     /translation="MSNTPHTLGEEFPGQLEAIHALKAKDAHFARILEEYDSVNDLIH
                     RAETNIQPVSQEEETNLRKQRLALKDKIASALAAA"
     misc_feature    complement(160460..160675)
                     /locus_tag="BSVBI22_B0171"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2841"
                     /db_xref="CDD:225397"
     gene            161127..161264
                     /locus_tag="BSVBI22_B0172"
                     /db_xref="GeneID:11686315"
     CDS             161127..161264
                     /locus_tag="BSVBI22_B0172"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108192.1"
                     /db_xref="GI:376278159"
                     /db_xref="GeneID:11686315"
                     /translation="MTAKNATLLTVLMVSAIVFMAVGIFTVDAGNQTAPTDGYGISSA
                     H"
     gene            complement(161342..162154)
                     /locus_tag="BSVBI22_B0173"
                     /db_xref="GeneID:11686316"
     CDS             complement(161342..162154)
                     /locus_tag="BSVBI22_B0173"
                     /note="similar to GP:15073704; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005108193.1"
                     /db_xref="GI:376278160"
                     /db_xref="GeneID:11686316"
                     /translation="MADTVFSRIQASRTADDVVHQIESLILEGVLRGGDRLPGERELA
                     RQFDISRPILRDALKRLETAGLLTSRHGGGTFVADVIGQVFSAPVVKLFADHHKATAD
                     YLEYRREIESVAAEYAALRATPADRALLTEIMNAMEKAHGADDFATEARLDVELHNAI
                     GEAAHNIVLLHTLRSCYQLLKDGVFYNRSVIYNHPGVADVFLSQHRAIYDAVMAGNPQ
                     AAREAVQKHIRFVEQATHDRALNDERERVARLRYRQRAGSKELKEIREDESE"
     misc_feature    complement(161387..162139)
                     /locus_tag="BSVBI22_B0173"
                     /note="transcriptional regulator PdhR; Reviewed; Region:
                     pdhR; PRK09464"
                     /db_xref="CDD:181879"
     misc_feature    complement(161921..162112)
                     /locus_tag="BSVBI22_B0173"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(161930..161941,161945..161950,
                     161978..161980,161987..161992,161996..162010,
                     162032..162037,162041..162043,162110..162112))
                     /locus_tag="BSVBI22_B0173"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(161468..161851)
                     /locus_tag="BSVBI22_B0173"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            complement(162276..163196)
                     /locus_tag="BSVBI22_B0174"
                     /db_xref="GeneID:11686317"
     CDS             complement(162276..163196)
                     /locus_tag="BSVBI22_B0174"
                     /note="similar to GP:15073706; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005108194.1"
                     /db_xref="GI:376278161"
                     /db_xref="GeneID:11686317"
                     /translation="MMSSLADMEIFARVVATGSMSAAARDLGLSPAVVSKRLGRLEER
                     LGTRLLQRTTRQIALTEAGQGYHERVLAILANIEEAEAFVARRSADARGTLKISAPTT
                     FGRMHIAPYLVPFMRANADLTVNMQLSDEMVDIVGDGYDLAIRIGELSDSTLVARRLA
                     PVRRIFVAAPRYLKERGTPQTIEDLQDHICLAPHNNDPWRLEGPKGPIVIRPTGPLQT
                     NSSEIVREAVLAGLGIAQRSTWDVGPELAAGKLVQVLPDYAASRNVAIHAVYPSKQFL
                     PAKVRLFIDYLADLYGPVPYWESGTFPEEN"
     misc_feature    complement(163005..163184)
                     /locus_tag="BSVBI22_B0174"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(162333..163178)
                     /locus_tag="BSVBI22_B0174"
                     /note="transcriptional activator TtdR; Provisional;
                     Region: PRK09801"
                     /db_xref="CDD:182085"
     misc_feature    complement(162336..162920)
                     /locus_tag="BSVBI22_B0174"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(162399..162401,162483..162485,
                     162534..162536,162711..162713,162717..162719,
                     162759..162761,162876..162878,162888..162890))
                     /locus_tag="BSVBI22_B0174"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(162507..162509,162516..162521,
                     162540..162554,162630..162632,162813..162833,
                     162837..162839,162849..162851,162858..162863,
                     162867..162872,162882..162887))
                     /locus_tag="BSVBI22_B0174"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            complement(163356..163475)
                     /locus_tag="BSVBI22_B0175"
                     /db_xref="GeneID:11686318"
     CDS             complement(163356..163475)
                     /locus_tag="BSVBI22_B0175"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108195.1"
                     /db_xref="GI:376278162"
                     /db_xref="GeneID:11686318"
                     /translation="MPSSHIRPEFLFSRNSGETRVPVFLEFFQSAPCALFVKW"
     gene            163547..165043
                     /gene="glcD"
                     /locus_tag="BSVBI22_B0176"
                     /db_xref="GeneID:11686319"
     CDS             163547..165043
                     /gene="glcD"
                     /locus_tag="BSVBI22_B0176"
                     /note="similar to SP:P32718, PID:396419, GB:U00096, and
                     PID:1790522; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycolate oxidase, subunit GlcD"
                     /protein_id="YP_005108196.1"
                     /db_xref="GI:376278163"
                     /db_xref="GeneID:11686319"
                     /translation="MSGLIMPEPDAGVLQRREQIVADLRVIVPGEGVVDTVNAMRVFE
                     TDGLTVHRQLPLVVVLPETVEQVAQVLRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVL
                     LVMSRFNRILEIDYPNRVAVVQPGVTNLGITKAVEHEGFYYAPDPSSQIACSIGGNVA
                     ENAGGVHCLKYGLTANNVLGIEMVLITGEVMRLGGKHLDSEAYDLLGLMTGSEGLLGV
                     VTEITVRILQKPETARAIMVGFPSSEQAGQCVADIIGAGIIPGGMEMMDRPAIKAAED
                     FVRVGYPLDVEALLIVELDGPPVEVDYLLGRVEKIALQNGSTTCTLSQSEEQRLAFWA
                     GRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSGMRALSEKYGLRVANVFHAGDGNLH
                     PLILYDANNPGELEAAEDFGADILRLCVKVGGVLTGEHGVGIEKRDLMPEMFNETDLD
                     QQMRVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVSRGALAFPDLPRF"
     misc_feature    163595..165040
                     /gene="glcD"
                     /locus_tag="BSVBI22_B0176"
                     /note="glycolate oxidase subunit GlcD; Provisional;
                     Region: PRK11230"
                     /db_xref="CDD:183043"
     misc_feature    163709..164128
                     /gene="glcD"
                     /locus_tag="BSVBI22_B0176"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    164231..164956
                     /gene="glcD"
                     /locus_tag="BSVBI22_B0176"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            165059..166291
                     /gene="glcE"
                     /locus_tag="BSVBI22_B0177"
                     /db_xref="GeneID:11686320"
     CDS             165059..166291
                     /gene="glcE"
                     /locus_tag="BSVBI22_B0177"
                     /note="similar to GP:14026515, and SP:P52073; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycolate oxidase, subunit GlcE"
                     /protein_id="YP_005108197.1"
                     /db_xref="GI:376278164"
                     /db_xref="GeneID:11686320"
                     /translation="MSDANILKPQDEAGVLEMVQAALASSTPLEIIGHGSKRGIGRPV
                     EAGHVLDVSGLSGVTLYEPDELVLSARAGTPMAEIQKLLADHNQCFHFEPMDYGPLLG
                     AEPGRGTIGGTLAANLAGPRRLKAGAARDHVLGVRVVSGRGEVFKSGGRVVKNVTGYD
                     LSKGMANSWGTLGVATEVTFKVLPAPETVATLAVRGLDDEQAARVMALAMGSREEVSS
                     AAHLPPTVAWRFLDGKLGGDAATILRLEGFAPSVAHRSRQLQDLLGRTGTIDVLDDSQ
                     SRQLWREVRDVLPYAQAGDGRAVWRVSMAPMQGWRMVDEFRRHAGVDAYYDWQGGLIW
                     MRMEAEPEADVLRKLIARHGGGHATLIRAPERVRGSVDVFQPQPAALAALSARLKQQF
                     DPENILNPGRMYPHQAGA"
     misc_feature    165074..165505
                     /gene="glcE"
                     /locus_tag="BSVBI22_B0177"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    165089..166273
                     /gene="glcE"
                     /locus_tag="BSVBI22_B0177"
                     /note="glycolate oxidase FAD binding subunit; Provisional;
                     Region: glcE; PRK11282"
                     /db_xref="CDD:236893"
     misc_feature    165614..166267
                     /gene="glcE"
                     /locus_tag="BSVBI22_B0177"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            166296..167597
                     /gene="glcF"
                     /locus_tag="BSVBI22_B0178"
                     /db_xref="GeneID:11686321"
     CDS             166296..167597
                     /gene="glcF"
                     /locus_tag="BSVBI22_B0178"
                     /note="similar to SP:P52074; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycolate oxidase, iron-sulfur subunit"
                     /protein_id="YP_005108198.1"
                     /db_xref="GI:376278165"
                     /db_xref="GeneID:11686321"
                     /translation="MQTHFSPEQLRDPGVLEAEKILRKCVHCGFCTATCPTYVTLGNE
                     LDSPRGRIYLIKDMLENGRPADEEIVRHVDRCLSCLACMTTCPSGVNYMHLVDHARAH
                     IEKTYKRPFMNRLLRSVLAQVLPYPARFRLALKLAKLGKPFASLFRKSPVLRPVAAML
                     DLAPQSLPAMPAATNAVRGEKRGRVAILNGCAQPVLNPGINAATLRLLNRFDIEVATP
                     KGEGCCGSLVHHMGREEQALEQARHNVDVWTREIETGGLDAIIVTASGCGTTIKDYGY
                     MLRLDPAYKDKAARVSALAKDITEYLATLELPEPDAPKTLTVAYHSACSMQHGQKIVR
                     EPKDLLVKAGFTVKEPLEGHLCCGSAGTYNIMQPEIATKLRDRKVKNIEATGAALIAT
                     GNIGCMTQIATGSDLPIVHTVELIDWAYGGPTPQALEKAGA"
     misc_feature    166296..167546
                     /gene="glcF"
                     /locus_tag="BSVBI22_B0178"
                     /note="glycolate oxidase iron-sulfur subunit; Provisional;
                     Region: glcF; PRK11274"
                     /db_xref="CDD:236890"
     misc_feature    166359..166565
                     /gene="glcF"
                     /locus_tag="BSVBI22_B0178"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    166848..167111
                     /gene="glcF"
                     /locus_tag="BSVBI22_B0178"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     misc_feature    167247..167498
                     /gene="glcF"
                     /locus_tag="BSVBI22_B0178"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            complement(167821..168648)
                     /locus_tag="BSVBI22_B0179"
                     /db_xref="GeneID:11686322"
     CDS             complement(167821..168648)
                     /locus_tag="BSVBI22_B0179"
                     /note="similar to GP:4007669; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase family oxidoreductase"
                     /protein_id="YP_005108199.1"
                     /db_xref="GI:376278166"
                     /db_xref="GeneID:11686322"
                     /translation="MTVPTVKLNDGNHIPQLGYGVWQISNDEAVSAVSEALKAGYRHI
                     DTATIYGNEKGVGKAINGSGIARADIFLTTKLWNSDQGYESTLKAFDTSLKKLGTDYV
                     DLYLIHWPMPSKDLFMETWRAFIKLKEEGRVKSIGVSNFRTADLERLIKESGVTPVLN
                     QIELHPQFQQDELRLFHGKHDIATEAWSPLGQGKLLEDPTLKSIAEKHAKSVAQIILR
                     WHIETGNIVIPKSITPARIKENFDIFDFTLNGTDHDAITKLDMADGRIGPNPSVFSA"
     misc_feature    complement(167872..168636)
                     /locus_tag="BSVBI22_B0179"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(167929..167934,167941..167943,
                     167956..167967,168010..168012,168073..168090,
                     168166..168168,168229..168234,168322..168327,
                     168424..168426,168499..168501,168514..168516,
                     168583..168591))
                     /locus_tag="BSVBI22_B0179"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(168325..168327,168424..168426,
                     168499..168501,168514..168516))
                     /locus_tag="BSVBI22_B0179"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(168924..169658)
                     /locus_tag="BSVBI22_B0180"
                     /db_xref="GeneID:11686323"
     CDS             complement(168924..169658)
                     /locus_tag="BSVBI22_B0180"
                     /note="similar to GP:15155625, and GP:15073711; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108200.1"
                     /db_xref="GI:376278167"
                     /db_xref="GeneID:11686323"
                     /translation="MKPRHLLLIGSLTAIAVSIVSTGMAFADDRYSDLPPVRVSQAIS
                     APWVAQLQDAPARPRIARQETRKTKTHYNKVSYQRPATNPATTARKKQFDPIYLPQIV
                     SYSGKEKPGTIVIDTASRFLYLVQADGKARRYGVGVGKQGFSWKGTQRISRKAEWPTW
                     TPPSEMIARERKKGRFLPARMDGGINNPLGARALYLGSTLYRIHGTNQPWTIGKAMSS
                     GCIRMRNEDVTDLYERTPVGTRVVVR"
     misc_feature    complement(168930..169658)
                     /locus_tag="BSVBI22_B0180"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: ErfK; COG1376"
                     /db_xref="CDD:224294"
     misc_feature    complement(168930..169331)
                     /locus_tag="BSVBI22_B0180"
                     /note="L,D-transpeptidase catalytic domain; Region: YkuD;
                     pfam03734"
                     /db_xref="CDD:252135"
     gene            169898..170554
                     /gene="tag"
                     /locus_tag="BSVBI22_B0181"
                     /db_xref="GeneID:11686324"
     CDS             169898..170554
                     /gene="tag"
                     /locus_tag="BSVBI22_B0181"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00624"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosidase I"
                     /protein_id="YP_005108201.1"
                     /db_xref="GI:376278168"
                     /db_xref="GeneID:11686324"
                     /translation="MSDMAEARAGLVVGADGRTRCFWPGELPDYLAYHDNEWGVPVAD
                     DFRLFEKICLEGFQSGLSWLTILRKRENFRAAFDGFNFHRIATYDESDVERLLADKGI
                     VRHRGKIVSVINNAGRAIELIEEKGSLAAYFWSFEPGAENRPAVVDYPTLVANPITAT
                     STRISKDLKKRGWSFVGPTTVYAFMQAMGLVNDHIEGCHCRATIEKLRQNFKRPGKKL
                     "
     misc_feature    169949..170515
                     /gene="tag"
                     /locus_tag="BSVBI22_B0181"
                     /note="3-methyladenine DNA glycosylase [DNA replication,
                     recombination, and repair]; Region: Tag; COG2818"
                     /db_xref="CDD:225374"
     gene            170673..171290
                     /locus_tag="BSVBI22_B0182"
                     /db_xref="GeneID:11686325"
     CDS             170673..171290
                     /locus_tag="BSVBI22_B0182"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00948"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter LysE"
                     /protein_id="YP_005108202.1"
                     /db_xref="GI:376278169"
                     /db_xref="GeneID:11686325"
                     /translation="MDLMSLVAFAGILVVAAGTPGPNVGALVARVISRGHKGVFPFMF
                     GLWLGDAVWLSLAVWGLSALAHTFQTAFLVLKYAGVAYLIYLSWKMWFAPVDEEADEN
                     TIPRQGEGKRLFLSALGVTLGNPKIMVFYLAILPTVVDITHVSLTGWVELLLVMFMVL
                     AAVDTAWVVLAAQARKFLRSPRMMRLANRTSAGMMAGAAVAIAAR"
     misc_feature    170673..171245
                     /locus_tag="BSVBI22_B0182"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            171401..172909
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /db_xref="GeneID:11686326"
     CDS             171401..172909
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="catalyzes a two-step reaction, first charging a
                     histidine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; class II aminoacyl-tRNA
                     synthetase; forms homodimers; some organisms have a
                     paralogous gene, hisZ, that is similar to hisS and
                     produces a protein that performs the first step in
                     histidine biosynthesis along with HisG"
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="YP_005108203.1"
                     /db_xref="GI:376278170"
                     /db_xref="GeneID:11686326"
                     /translation="MADKADKMKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFE
                     PVETPLVEYTDALGKFLPDQDRPNEGVFSFQDDDEQWLSLRYDLTAPLARYVAENFET
                     LPKPYRSYRNGWVFRNEKPGPGRFRQFMQFDADTVGAPNVSADAEMCMMMADTLERLG
                     IQRGDYAIRVNNRKVLDGVLDAIGLEGEGNAAKRLNVLRAIDKLDKFGPEGVRLLLGK
                     GRLDESGDFTKGAQLPEAAIEKVLAFTAAGGADGAQTIANLQAVVAGNAEGEEGVQEL
                     ADMQALFFAGGYEGRVKIDPSVVRGLEYYTGPVFEAELLFDVTNEDGQKVVFGSVGGG
                     GRYDGLVSRFRGEPVPATGFSIGVSRLMTALKNLGKLDVSDTVGPVVVLVMDKDTQNL
                     GRYQKMVSDLRKAGIRAEMYVGGSGMKAQMKYADRRAAPCVVIQGSQEREAGEVQIKD
                     LVEGKRLSAEIEDNVTWRESRPAQITVREDGLVDAVREILDAQARDRAEQSK"
     misc_feature    171419..172840
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="Histidyl-tRNA synthetase [Translation, ribosomal
                     structure and biogenesis]; Region: HisS; COG0124"
                     /db_xref="CDD:223202"
     misc_feature    171467..172498
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
                     catalytic core domain. HisRS is a homodimer. It is
                     responsible for the attachment of histidine to the 3' OH
                     group of ribose of the appropriate tRNA. This domain is
                     primarily responsible for...; Region: HisRS-like_core;
                     cd00773"
                     /db_xref="CDD:238396"
     misc_feature    order(171482..171484,171518..171520,171533..171553,
                     171620..171625,171659..171661,171665..171667,
                     171680..171685,171692..171697,171779..171784,
                     171803..171805,171827..171829,171839..171841,
                     171848..171850,172367..172369,172457..172462)
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238396"
     misc_feature    171527..171553
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="motif 1; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(171659..171661,171665..171667,171749..171751,
                     171755..171757,171776..171778,171785..171787,
                     171791..171793,171803..171805,172298..172300,
                     172304..172306,172310..172315,172367..172369,
                     172460..172462,172469..172471,172478..172480)
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="active site"
                     /db_xref="CDD:238396"
     misc_feature    171746..171760
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="motif 2; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(172457..172471,172478..172480)
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="motif 3; other site"
                     /db_xref="CDD:238396"
     misc_feature    172535..172861
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="HisRS Histidyl-anticodon binding domain. HisRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     HisRS_anticodon; cd00859"
                     /db_xref="CDD:238436"
     misc_feature    order(172553..172558,172667..172669,172685..172687,
                     172709..172711,172739..172741,172745..172747)
                     /gene="hisS"
                     /locus_tag="BSVBI22_B0183"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238436"
     gene            172918..174048
                     /gene="hisZ"
                     /locus_tag="BSVBI22_B0184"
                     /db_xref="GeneID:11686327"
     CDS             172918..174048
                     /gene="hisZ"
                     /locus_tag="BSVBI22_B0184"
                     /note="May allow the feedback regulation of ATP
                     phosphoribosyltransferase activity by histidine"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase regulatory
                     subunit"
                     /protein_id="YP_005108204.1"
                     /db_xref="GI:376278171"
                     /db_xref="GeneID:11686327"
                     /translation="MVGSRTSPIFNALRVELNAREAELVEIPLIQPADPFLDMAGEDL
                     RRRIFLTENENGDSLCLRPEFTIPVCRNHIALNAATPKRYAYLGEVFRQRRDGAAEFL
                     QAGIEDLGAADEAASDARSLADALSCVKAIAPDAPLEIVLGDQSVFAGMLKALGLPQG
                     WRKKLLRSFGDAHSMDLALAELTGTQRRDPLPESLAVLVAEGDEIGLARMLEAEMLEA
                     GISPGAGRTPVEIARRLIEKEDLAATHFPAAALDLLRQFLAIRVSLDTAAVTLRAFAA
                     DNALDLGAVLQKFEARADAIAQAGIEMKDIIYDASFGRPLDYYTGLVYEIRDASNRQD
                     GVLAGGGRYDRLLTMLGACEAIPGVGFSIWLDRLQALAGEKQ"
     misc_feature    172918..174045
                     /gene="hisZ"
                     /locus_tag="BSVBI22_B0184"
                     /note="ATP phosphoribosyltransferase involved in histidine
                     biosynthesis [Amino acid transport and metabolism];
                     Region: HisZ; COG3705"
                     /db_xref="CDD:226228"
     misc_feature    172918..174039
                     /gene="hisZ"
                     /locus_tag="BSVBI22_B0184"
                     /note="ATP phosphoribosyltransferase regulatory subunit;
                     Provisional; Region: hisZ; PRK12295"
                     /db_xref="CDD:183413"
     misc_feature    172981..172995
                     /gene="hisZ"
                     /locus_tag="BSVBI22_B0184"
                     /note="motif 1; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(172984..172989,172993..172995,173128..173133,
                     173188..173190,173194..173196,173293..173295)
                     /gene="hisZ"
                     /locus_tag="BSVBI22_B0184"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(173107..173109,173113..173115,173191..173193,
                     173218..173220,173224..173226,173230..173238,
                     173923..173928,173938..173940,173995..174000,
                     174004..174009,174016..174018)
                     /gene="hisZ"
                     /locus_tag="BSVBI22_B0184"
                     /note="active site"
                     /db_xref="CDD:238391"
     misc_feature    173188..173196
                     /gene="hisZ"
                     /locus_tag="BSVBI22_B0184"
                     /note="motif 2; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(174007..174009,174016..174018)
                     /gene="hisZ"
                     /locus_tag="BSVBI22_B0184"
                     /note="motif 3; other site"
                     /db_xref="CDD:238391"
     gene            174045..174740
                     /gene="hisG"
                     /locus_tag="BSVBI22_B0185"
                     /db_xref="GeneID:11686328"
     CDS             174045..174740
                     /gene="hisG"
                     /locus_tag="BSVBI22_B0185"
                     /note="short form of enzyme; requires HisZ for function;
                     catalyzes the formation of N'-5'-phosphoribosyl-ATP from
                     phosphoribosyl pyrophosphate; crucial role in histidine
                     biosynthesis; forms heteromultimer of HisG and HisZ"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase catalytic subunit"
                     /protein_id="YP_005108205.1"
                     /db_xref="GI:376278172"
                     /db_xref="GeneID:11686328"
                     /translation="MSVTLALPSKGRLKEKTLAVLEKAGYKVVLPDDDRNYRARVEGE
                     DDLDILFLSASEIARELGYGSVDLGVTGEDLARETLAHADERVAIEAQLGFGHADVVV
                     AVPEVWRDVTTMADLDDVAADFRQRHGRRLRIATKYWRLTQQFFSQKHGIQVYRIVES
                     LGATEGAPAAGSADMIVDITSTGSTLRANRLKVLEDGIILRSQACLVSARRSHTSRRV
                     EEIAARIRAGLEI"
     misc_feature    174045..>174734
                     /gene="hisG"
                     /locus_tag="BSVBI22_B0185"
                     /note="ATP phosphoribosyltransferase [Amino acid transport
                     and metabolism]; Region: HisG; COG0040"
                     /db_xref="CDD:223118"
     misc_feature    174045..174722
                     /gene="hisG"
                     /locus_tag="BSVBI22_B0185"
                     /note="ATP phosphoribosyltransferase catalytic subunit;
                     Provisional; Region: hisG; PRK13583"
                     /db_xref="CDD:237438"
     gene            complement(174813..176051)
                     /gene="gluP"
                     /locus_tag="BSVBI22_B0186"
                     /note="This region contains an authentic point mutation,
                     causing a premature stop, and is not the result of a
                     sequencing artifact; glucose/galactose transporter,
                     authentic point mutation; similar to SP:Q44623, GB:S68805,
                     SP:P50440, and PID:791049; identified by sequence
                     similarity; putative"
                     /db_xref="GeneID:11686329"
     gene            complement(176337..176738)
                     /locus_tag="BSVBI22_B0187"
                     /db_xref="GeneID:11686330"
     CDS             complement(176337..176738)
                     /locus_tag="BSVBI22_B0187"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108206.1"
                     /db_xref="GI:376278173"
                     /db_xref="GeneID:11686330"
                     /translation="MSSITPKANGAATLIIRVFLSVLFIIAGYNKLTALDGTADYFAS
                     IGLPMPIVTAVVVGLIEFVGGLAILFGFKTRIAAVIVGLFTLGATLVAHMDFAEGMNL
                     LIAQKNLAIAGGLFLLFLHGAGSLSIDARRG"
     misc_feature    complement(176340..176708)
                     /locus_tag="BSVBI22_B0187"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            complement(176841..178232)
                     /gene="fumC"
                     /locus_tag="BSVBI22_B0188"
                     /db_xref="GeneID:11686331"
     CDS             complement(176841..178232)
                     /gene="fumC"
                     /locus_tag="BSVBI22_B0188"
                     /note="class II family (does not require metal);
                     tetrameric enzyme; fumarase C; reversibly converts
                     (S)-malate to fumarate and water; functions in the TCA
                     cycle"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="YP_005108207.1"
                     /db_xref="GI:376278174"
                     /db_xref="GeneID:11686331"
                     /translation="MAATRTETDTFGPIDVPADRYWGAQTQRSLQNFRIGGERMPLPL
                     VHALGVVKRAAAETNIALGKLDPVLGQVIAVAASEVIEGKLDDHFPLVVWQTGSGTQS
                     NMNANEVISNRAIELLGGEMGSKKPIHPNDHVNMSQSSNDSFPTAIHIATAVETVNRL
                     YPALEHLTKALKVKEEAFKDIIKIGRTHTQDATPVTLGQEFSGYRAALEYARHRLEQS
                     LADVFLLAQGGTAVGTGLNAPVGFDKGFAEAVSEITGLSFKTAPNKFEALASHGAVLN
                     FHGSLNALAADLFKIANDIRFLGSGPRSGLGELSLPENEPGSSIMPGKVNPTQAEAMT
                     MVATQVFGNQTAVTVAASQGHFELNVFKPVIAYNVLQSIRLLSDTMVSFADHCVEGIE
                     PNTARIKELLERSLMLVTALAPAIGYDNAARIAKTAHKNGTTLREEALASGLVSEEDY
                     DRLVRAERMIAPQ"
     misc_feature    complement(176844..178232)
                     /gene="fumC"
                     /locus_tag="BSVBI22_B0188"
                     /note="fumarate hydratase; Reviewed; Region: fumC;
                     PRK00485"
                     /db_xref="CDD:234779"
     misc_feature    complement(176856..178220)
                     /gene="fumC"
                     /locus_tag="BSVBI22_B0188"
                     /note="Class II fumarases; Region: Fumarase_classII;
                     cd01362"
                     /db_xref="CDD:176465"
     misc_feature    complement(order(177240..177242,177255..177257,
                     177261..177263,177669..177671,177810..177818,
                     177837..177848,177855..177857,177933..177935,
                     177939..177941))
                     /gene="fumC"
                     /locus_tag="BSVBI22_B0188"
                     /note="active site"
                     /db_xref="CDD:176465"
     misc_feature    complement(order(177003..177005,177162..177170,
                     177177..177179,177201..177203,177351..177356,
                     177363..177368,177372..177377,177384..177389,
                     177396..177398,177405..177410,177417..177419,
                     177423..177428,177435..177437,177444..177449,
                     177537..177539,177591..177593,177603..177605,
                     177615..177617,177633..177638,177654..177656,
                     177666..177677))
                     /gene="fumC"
                     /locus_tag="BSVBI22_B0188"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176465"
     gene            complement(178382..178669)
                     /locus_tag="BSVBI22_B0189"
                     /db_xref="GeneID:11686332"
     CDS             complement(178382..178669)
                     /locus_tag="BSVBI22_B0189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108208.1"
                     /db_xref="GI:376278175"
                     /db_xref="GeneID:11686332"
                     /translation="MKPEETGTENHMRKELPIETAPKDGRKITVIWIDDDDQRNESIA
                     QYRTLEQLRAGGGQWDEADTGWWTFTDSKTQRKIEPTAWIRETDDDESQED"
     gene            complement(178966..179187)
                     /locus_tag="BSVBI22_B0190"
                     /db_xref="GeneID:11686333"
     CDS             complement(178966..179187)
                     /locus_tag="BSVBI22_B0190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108209.1"
                     /db_xref="GI:376278176"
                     /db_xref="GeneID:11686333"
                     /translation="MLLPIMSSNPVSILALPRYVLLMQAFLPPVESLPNPGEPPLPGL
                     TFLTVPDARNGHTNSVKLSPFFPAPHNHF"
     gene            complement(179389..181029)
                     /gene="groEL"
                     /locus_tag="BSVBI22_B0191"
                     /db_xref="GeneID:11686334"
     CDS             complement(179389..181029)
                     /gene="groEL"
                     /locus_tag="BSVBI22_B0191"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="YP_005108210.1"
                     /db_xref="GI:376278177"
                     /db_xref="GeneID:11686334"
                     /translation="MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSF
                     GAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQE
                     GAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGK
                     MIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDA
                     YILLHEKKLSNLQALLPVLEAVVQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAV
                     KAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVD
                     GAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEK
                     KDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKGVNADQEAGINIVRRAIQAPA
                     RQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAA
                     SVAGLLITTEAMIAELPKKDAAPAGMPGGMGGMGGMDF"
     misc_feature    complement(179446..181029)
                     /gene="groEL"
                     /locus_tag="BSVBI22_B0191"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    complement(179461..181020)
                     /gene="groEL"
                     /locus_tag="BSVBI22_B0191"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(179464..179484,179491..179493,
                     179656..179658,179872..179874,179878..179880,
                     180259..180261,180343..180345,180439..180441,
                     180802..180804,180811..180813,180823..180825,
                     180847..180849,180853..180855,180883..180885,
                     180889..180894,180907..180909,180913..180924,
                     180955..180957,181006..181008,181018..181020))
                     /gene="groEL"
                     /locus_tag="BSVBI22_B0191"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(179545..179547,179551..179553,
                     179671..179673,179785..179787,179836..179838,
                     180580..180582,180757..180759,180769..180771,
                     180931..180939))
                     /gene="groEL"
                     /locus_tag="BSVBI22_B0191"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(179632..179634,179641..179646,
                     179650..179652,179677..179679,179731..179733,
                     180703..180705))
                     /gene="groEL"
                     /locus_tag="BSVBI22_B0191"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(179800..179805,179905..179907,
                     180451..180453,180472..180474,180607..180609))
                     /gene="groEL"
                     /locus_tag="BSVBI22_B0191"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            complement(181120..181416)
                     /gene="groES"
                     /locus_tag="BSVBI22_B0192"
                     /db_xref="GeneID:11686335"
     CDS             complement(181120..181416)
                     /gene="groES"
                     /locus_tag="BSVBI22_B0192"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin GroES"
                     /protein_id="YP_005108211.1"
                     /db_xref="GI:376278178"
                     /db_xref="GeneID:11686335"
                     /translation="MADIKFRPLHDRVVVRRVESEAKTAGGIIIPDTAKEKPQEGEVV
                     AAGAGARDEAGKLVPLDVKAGDRVLFGKWSGTEVKIGGEDLLIMKESDILGIVG"
     misc_feature    complement(181126..181404)
                     /gene="groES"
                     /locus_tag="BSVBI22_B0192"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(181129..181137,181183..181185,
                     181189..181191,181204..181206,181234..181236,
                     181297..181302,181381..181383,181390..181392,
                     181396..181398,181402..181404))
                     /gene="groES"
                     /locus_tag="BSVBI22_B0192"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(181315..181356)
                     /gene="groES"
                     /locus_tag="BSVBI22_B0192"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(181240..181242,181273..181275))
                     /gene="groES"
                     /locus_tag="BSVBI22_B0192"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            181536..181676
                     /locus_tag="BSVBI22_B0193"
                     /db_xref="GeneID:11686336"
     CDS             181536..181676
                     /locus_tag="BSVBI22_B0193"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108212.1"
                     /db_xref="GI:376278179"
                     /db_xref="GeneID:11686336"
                     /translation="MSRRIAVQAGVFCAEQPDFRPVSACGEMHILPYLGACSMLFKPC
                     GR"
     gene            complement(181729..181833)
                     /locus_tag="BSVBI22_B0194"
                     /db_xref="GeneID:11686337"
     CDS             complement(181729..181833)
                     /locus_tag="BSVBI22_B0194"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108213.1"
                     /db_xref="GI:376278180"
                     /db_xref="GeneID:11686337"
                     /translation="METGVGKAPLGFLYPKRPILSPRFNKTNCRIMIS"
     gene            181894..182745
                     /locus_tag="BSVBI22_B0195"
                     /db_xref="GeneID:11686338"
     CDS             181894..182745
                     /locus_tag="BSVBI22_B0195"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01668"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD superfamily hydrolase"
                     /protein_id="YP_005108214.1"
                     /db_xref="GI:376278181"
                     /db_xref="GeneID:11686338"
                     /translation="MMILPERLDDLTDRYDAIFCDVWGVVHNGETSFAPAIAALQRAR
                     AKGVTIILVTNSPRPHPGVVAQMSLLGVPENAYDRVVTSGDVTRDLIAEGPRRIFHIG
                     CERELAIYDGLDVELVEEFEAAGVVCTGLYDDEVETPEDYRELLQRLRSRNLPFICAN
                     PDIMVERGPRLIWCAGALAREYGQLGGRTLIAGKPHRPIYEAALRAVESIRGGSVDKS
                     RILGIGDGVLTDVKGAADFGLDVLYISGGVHAADYAVNGDLDMAKMEAFLEKHGHRPI
                     ASLHALV"
     misc_feature    181915..182742
                     /locus_tag="BSVBI22_B0195"
                     /note="Predicted sugar phosphatases of the HAD superfamily
                     [Carbohydrate transport and metabolism]; Region: NagD;
                     COG0647"
                     /db_xref="CDD:223720"
     misc_feature    181942..>182175
                     /locus_tag="BSVBI22_B0195"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(181954..181962,182053..182058)
                     /locus_tag="BSVBI22_B0195"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    181954..181971
                     /locus_tag="BSVBI22_B0195"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    182053..182055
                     /locus_tag="BSVBI22_B0195"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <182320..182613
                     /locus_tag="BSVBI22_B0195"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     gene            182781..182894
                     /locus_tag="BSVBI22_B0196"
                     /db_xref="GeneID:11686339"
     CDS             182781..182894
                     /locus_tag="BSVBI22_B0196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108215.1"
                     /db_xref="GI:376278182"
                     /db_xref="GeneID:11686339"
                     /translation="MPLLFQALTLLRRLFSNNEEIKLSAPHRNRGFAASPA"
     gene            182875..183822
                     /gene="ribF"
                     /locus_tag="BSVBI22_B0197"
                     /gene_synonym="ribC"
                     /db_xref="GeneID:11686340"
     CDS             182875..183822
                     /gene="ribF"
                     /locus_tag="BSVBI22_B0197"
                     /gene_synonym="ribC"
                     /note="catalyzes the formation of FMN from riboflavin and
                     the formation of FAD from FMN; in Bacillus the ribC gene
                     has both flavokinase and FAD synthetase activities"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FMN
                     adenylyltransferase"
                     /protein_id="YP_005108216.1"
                     /db_xref="GI:376278183"
                     /db_xref="GeneID:11686340"
                     /translation="MPPALHDCVVAIGNFDGVHRGHQAVLERALELAERESRPAVVLT
                     FEPHPRSFFKQDQPVDRLTDAAEKAEILRLMGFDAVMEQPFTAEFSQRSAEDFVQHIL
                     VEKLRASRVVTGYDFHFGKGRRGTPEFLCEAGKKAGFSVTLVDAFTDEGGMLVSSTRI
                     RNLLSEGEVAEAAGLLGYRYRICGEVIHGKKLGRTLGFPTANMALAPQTSLKHGIYAV
                     RFRLDDAMLYDGVASFGRRPTVDDEGAPLLETFLFDFSGDLYGKTAAVSFFGFLRGEV
                     KFDGLDPLIDQMKQDEAQARALLADVRPISGLDRMLSFN"
     misc_feature    182878..183774
                     /gene="ribF"
                     /locus_tag="BSVBI22_B0197"
                     /gene_synonym="ribC"
                     /note="bifunctional riboflavin kinase/FMN
                     adenylyltransferase; Reviewed; Region: PRK05627"
                     /db_xref="CDD:235536"
     misc_feature    182896..183441
                     /gene="ribF"
                     /locus_tag="BSVBI22_B0197"
                     /gene_synonym="ribC"
                     /note="FAD synthetase, N-terminal domain of the
                     bifunctional enzyme; Region: FAD_synthetase_N; cd02064"
                     /db_xref="CDD:185679"
     misc_feature    order(182911..182922,182929..182931,182938..182940,
                     183220..183222,183310..183312,183337..183345)
                     /gene="ribF"
                     /locus_tag="BSVBI22_B0197"
                     /gene_synonym="ribC"
                     /note="active site"
                     /db_xref="CDD:185679"
     misc_feature    183397..183774
                     /gene="ribF"
                     /locus_tag="BSVBI22_B0197"
                     /gene_synonym="ribC"
                     /note="Riboflavin kinase; Region: Flavokinase; smart00904"
                     /db_xref="CDD:214901"
     gene            184166..187084
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /db_xref="GeneID:11686341"
     CDS             184166..187084
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="IleRS; catalyzes the formation of
                     isoleucyl-tRNA(Ile) from isoleucine and tRNA(Ile); since
                     isoleucine and other amino acids such as valine are
                     similar, there are additional editing function in this
                     enzyme; one is involved in hydrolysis of activated
                     valine-AMP and the other is involved in deacylation of
                     mischarged Val-tRNA(Ile); there are two active sites, one
                     for aminoacylation and one for editing; class-I
                     aminoacyl-tRNA synthetase family; some organisms carry two
                     different copies of this enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucyl-tRNA synthetase"
                     /protein_id="YP_005108217.1"
                     /db_xref="GI:376278184"
                     /db_xref="GeneID:11686341"
                     /translation="MTDTTKIDYSKTLYLPQTEFPIRAGLPQREPLFVQRWEEMNLYK
                     KLREQAKDRPLYVLHDGPPYANGNIHIGHALNKILKDVITRSFQMRGYNSNYVPGWDC
                     HGLPIEWKIEEKYRAAGKNKDEVPINEFRKECRELASNWIKVQTEEFKRLAILGDFEN
                     PYTTMNFHAEARIAGELLKFAASGQLYRGSKPVMWSVVERTALAEAEVEYHDIESDMI
                     WVKFPVAGEVATENDLSGSAVVIWTTTPWTIPGNRAVSYSSRIEYGLFEITEAENDFG
                     PRPGERLVFADKLVEECCAKAKLQFKRLRSVSAEELGKIVLDHPLKGFGGGYEFVVPM
                     LDGDHVTDDAGTGFVHTAPSHGREDFEAWMDNARQLEARGIDPNIPFPVGDDGFYTKD
                     APGFGPDREGGPARVIDDNGKKGDANKVVIEQLIAADKLFARGRLKHSYPHSWRSKKP
                     VIFRNTPQWFVYMDKNLGDGTTLRSRALKAIDETRFVPAAGQTRLRSMIEGRPDWVLS
                     RQRAWGVPICVFVDEEGNILQDDAVNKRIMDAFEKEGADAWFADGARERFLGARAGEG
                     WTQVRDILDVWFDSGSTHTFTLEDRPDLKWPADVYLEGSDQHRGWFHSSLLESCGTRG
                     RAPYNAVVTHGFTMDEHGKKMSKSLGNTVTPQDVIKESGADILRLWVMTTDYWEDQRL
                     GKSIIQTNIDAYRKLRNTIRWMLGTLAHDEGENVAYADLPELERLMLHRLTELDELVR
                     SGYDTFDFKRIARALVDFMNVELSAFYFDIRKDALYCDAPSSIRRKAALQTVREIFVR
                     LTTWLAPMLPFTMEEAWLDRYPQSVSIHAEQFRPTPAEWRDDVLAEKWRKVRAVRRVV
                     TGALELERADKRIGSSLEAAPVVYIADKSLSDSLEGLDFAEICITSGISVSDAAAPEG
                     AFTLGDVKGVAVVPERAKGEKCARSWRYTTDVGADPEFPEVSARDAAALRELQALGKL
                     "
     misc_feature    184166..187078
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="isoleucyl-tRNA synthetase; Provisional; Region:
                     ileS; PRK13804"
                     /db_xref="CDD:237514"
     misc_feature    184325..>184765
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:260139"
     misc_feature    184373..184384
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    184373..184384
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    order(184373..184375,184382..184384)
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    <185453..186211
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="catalytic core domain of isoleucyl-tRNA
                     synthetases; Region: IleRS_core; cd00818"
                     /db_xref="CDD:173909"
     misc_feature    order(185645..185647,185894..185896,185903..185905,
                     185972..185986,185990..185992,185996..185998,
                     186065..186079,186089..186106,186200..186202)
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="active site"
                     /db_xref="CDD:173909"
     misc_feature    186095..186109
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173909"
     misc_feature    186209..186703
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="Anticodon-binding domain of bacterial and
                     eukaryotic mitochondrial isoleucyl tRNA synthetases;
                     Region: Anticodon_Ia_Ile_BEm; cd07960"
                     /db_xref="CDD:153414"
     misc_feature    order(186218..186220,186230..186232,186239..186241,
                     186251..186253,186260..186262,186269..186274,
                     186410..186412,186419..186424,186431..186436,
                     186443..186445,186458..186460,186470..186472,
                     186479..186481)
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153414"
     misc_feature    order(186260..186262,186269..186271)
                     /gene="ileS"
                     /locus_tag="BSVBI22_B0198"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153414"
     gene            187276..187947
                     /locus_tag="BSVBI22_B0199"
                     /db_xref="GeneID:11686342"
     CDS             187276..187947
                     /locus_tag="BSVBI22_B0199"
                     /note="similar to GP:15073729; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108218.1"
                     /db_xref="GI:376278185"
                     /db_xref="GeneID:11686342"
                     /translation="MKIEGRVLVLMTALAGLSLSGCVSSPTYGTDKSAGAQLLDDVSN
                     MASFGQGKKKERIDYKPRPDLVRPAPGDKGYLPAPQQSLASSSDPNWPESPEQRRKRV
                     RDEITAHRDDPNYVSPVLQDAPVADNIRTALPRGNSRREDYASRTPTSDPAKVAALKA
                     ARAQQNQGSATTRRYLSEPPLAYRQPASTAAVGELGPDEAQKERERKKAASGSRGWRD
                     YLPWN"
     gene            188292..188852
                     /locus_tag="BSVBI22_B0200"
                     /db_xref="GeneID:11686343"
     CDS             188292..188852
                     /locus_tag="BSVBI22_B0200"
                     /note="similar to SP:P08732; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b561, putative"
                     /protein_id="YP_005108219.1"
                     /db_xref="GI:376278186"
                     /db_xref="GeneID:11686343"
                     /translation="MSSKTYIWDDRSGYGLVSRGFHWLMALLFLWQFASAILRVFAKD
                     TPIYSFFWSAHFQLGFALLVLALLRGVWGLMNIHRRPHKDGAIGKLAVLGHLAIYVLM
                     ITIPSLALLRAYGSGRGFSFLGMPIFAKTDIQNAMLTAPANALHGPLGWVLLAAIVGH
                     VAMALVHHFALRDDTLRYMTGHGTPN"
     misc_feature    188310..188840
                     /locus_tag="BSVBI22_B0200"
                     /note="Cytochrome B561 [Energy production and conversion];
                     Region: CybB; COG3038"
                     /db_xref="CDD:225580"
     gene            complement(188906..189379)
                     /locus_tag="BSVBI22_B0201"
                     /db_xref="GeneID:11686344"
     CDS             complement(188906..189379)
                     /locus_tag="BSVBI22_B0201"
                     /note="similar to GP:15155649; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine and deoxycytidylate deaminase family
                     protein"
                     /protein_id="YP_005108220.1"
                     /db_xref="GI:376278187"
                     /db_xref="GeneID:11686344"
                     /translation="MRKAASITKANSATPMDIALEEAHAAGERGEVPIGAVIVRDGEI
                     IARAGNRTREFNDVTAHAEILIIRQAGEMLGSERLIDCDLYVTLEPCAMCAAAISFAR
                     IRRLYYGASDPKGGGIEHGGRFYTQPTCHHAPEIYPGFCEADARKILKDFFREKR"
     misc_feature    complement(189026..189334)
                     /locus_tag="BSVBI22_B0201"
                     /note="Nucleoside deaminases include adenosine, guanine
                     and cytosine deaminases. These enzymes are Zn dependent
                     and catalyze the deamination of nucleosides. The zinc ion
                     in the active site plays a central role in the proposed
                     catalytic mechanism, activating a...; Region:
                     nucleoside_deaminase; cd01285"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(189098..189100,189107..189109,
                     189191..189199,189230..189232,189278..189280))
                     /locus_tag="BSVBI22_B0201"
                     /note="nucleoside/Zn binding site; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(189077..189082,189089..189094,
                     189101..189106,189176..189178,189188..189190,
                     189203..189205))
                     /locus_tag="BSVBI22_B0201"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(189098..189100,189107..189112,
                     189191..189199))
                     /locus_tag="BSVBI22_B0201"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238612"
     gene            189469..191265
                     /locus_tag="BSVBI22_B0202"
                     /db_xref="GeneID:11686345"
     CDS             189469..191265
                     /locus_tag="BSVBI22_B0202"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pseudouridylate synthase family protein"
                     /protein_id="YP_005108221.1"
                     /db_xref="GI:376278188"
                     /db_xref="GeneID:11686345"
                     /translation="MRTELYGVPVANNLWRAMMAQGDAVTLLKGLYQMTTEDDNKGGK
                     PPHGRKGHSDRPGRPDRDSRPRREGGDRDKPRKFGSRGAPVEEETSERIAKRLARAGI
                     ASRREAETMIAAGRIAVNGKVLESPAVNVKRTDIITVDGKPLRQTERTRLWLYHKPAG
                     LVTTNRDPEGRPTVFEALPPEMPRVLSVGRLDINTEGLLLLTNDGGLSRVLELPSTGW
                     LRRYRVRAHGKVTQQQLDELKNGIAVDGVFYGSVEAELERVQGANVWISIGLREGKNR
                     EVKNILGALGLTVGRLIRVSFGPFQLGDLEEGAVREIKGRTLRDQLGDKLIEESGADF
                     DAPVLNEFSNAAVQGRTRREMEEGELPQEGERRRAPREREWISSTGERRRGREEKTEK
                     VEPRRRGNANVWMAPGARPKGEKEAAKPARVEHQQPHRSAKFSGDLQMRPRRFSEEER
                     GGEESGERRYKRPEGRFEREGGRPDNREKYEKHEGAGKERRPGKRERAELRNAEGQTT
                     ERGKGGFEGRKPGKPGGPRSEGRFGGADRDTRSGPRGSGPRGAGDGPRRGHDGKPGGK
                     PGGKPTGRPGGKPGTKPGGGGRSGGGGADRRR"
     misc_feature    189733..190458
                     /locus_tag="BSVBI22_B0202"
                     /note="16S rRNA uridine-516 pseudouridylate synthase and
                     related pseudouridylate synthases [Translation, ribosomal
                     structure and biogenesis]; Region: RsuA; COG1187"
                     /db_xref="CDD:224108"
     misc_feature    189739..189912
                     /locus_tag="BSVBI22_B0202"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(189742..189744,189778..189780,189784..189789,
                     189793..189798,189805..189810,189814..189816,
                     189835..189858,189862..189864)
                     /locus_tag="BSVBI22_B0202"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    189919..190410
                     /locus_tag="BSVBI22_B0202"
                     /note="Pseudouridine synthases catalyze the isomerization
                     of specific uridines in an RNA molecule to pseudouridines
                     (5-ribosyluracil, psi); Region: PseudoU_synth; cl00130"
                     /db_xref="CDD:260207"
     misc_feature    order(190033..190044,190303..190305)
                     /locus_tag="BSVBI22_B0202"
                     /note="active site"
                     /db_xref="CDD:211324"
     misc_feature    190996..>191142
                     /locus_tag="BSVBI22_B0202"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            191246..191809
                     /locus_tag="BSVBI22_B0203"
                     /db_xref="GeneID:11686346"
     CDS             191246..191809
                     /locus_tag="BSVBI22_B0203"
                     /note="identified by match to PFAM protein family HMM
                     PF03602"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108222.1"
                     /db_xref="GI:376278189"
                     /db_xref="GeneID:11686346"
                     /translation="MRIVGGKFRGRALVTPSTNAIRPTTDRTRESLFNILAHSFPDKV
                     EGVRVLDLFAGTGALGLEALSRGARYATFVEESAEGRGILRQNIEALGLQGHTKILRR
                     DACQLGIVGTMEPFDLVFADPPYGRRMGEKAFLSALQGGWLNPDALLVLEEDAQAALE
                     LDDRFAVREERNYGGTVIRLIELKAAS"
     misc_feature    191387..191701
                     /locus_tag="BSVBI22_B0203"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(191399..191419,191468..191473,191549..191557,
                     191609..191611)
                     /locus_tag="BSVBI22_B0203"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            191988..194773
                     /locus_tag="BSVBI22_B0204"
                     /note="This region contains a gene with one or more
                     premature stops or frameshifts, and is not the result of a
                     sequencing artifact; peptidase, M16 family, degenerate"
                     /db_xref="GeneID:11686347"
     gene            194783..195664
                     /locus_tag="BSVBI22_B0205"
                     /db_xref="GeneID:11686348"
     CDS             194783..195664
                     /locus_tag="BSVBI22_B0205"
                     /note="identified by match to PFAM protein family HMM
                     PF01734"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108223.1"
                     /db_xref="GI:376278190"
                     /db_xref="GeneID:11686348"
                     /translation="MDKALSSSPRFAVAFGGGGARGIAHIHVVDVLNELGIQPVAIAG
                     SSIGSIIGSSMANGMSGKDIYDYMASIFTNRSEVVRRMWQTRPAHWAELFKGGLRVSQ
                     FNIEKVLDVFLPDSFPSNVEDLKIPMTITAVDFHGAREIHISDGDLRSAIAASCAIPP
                     VFAPVRRNGRILVDGGLFNPVPFDFLFDKADIVIGIDVVGGPVGPDDHMPTTFEAVIG
                     TSQLTMCSIIENKFRYRPPHIFVRPNVERIGLLDFLKFEQVISQSAAVRDELKRAIEQ
                     ALDGKVAPILPEKLPDL"
     misc_feature    194786..195658
                     /locus_tag="BSVBI22_B0205"
                     /note="Predicted esterase of the alpha-beta hydrolase
                     superfamily [General function prediction only]; Region:
                     RssA; COG1752"
                     /db_xref="CDD:224666"
     misc_feature    194816..195376
                     /locus_tag="BSVBI22_B0205"
                     /note="Patatins and Phospholipases; Region:
                     Patatin_and_cPLA2; cl11396"
                     /db_xref="CDD:264349"
     misc_feature    order(194834..194839,194843..194845,194918..194920,
                     195302..195304)
                     /locus_tag="BSVBI22_B0205"
                     /note="active site"
                     /db_xref="CDD:132836"
     misc_feature    194912..194926
                     /locus_tag="BSVBI22_B0205"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132836"
     gene            complement(195677..197584)
                     /locus_tag="BSVBI22_B0206"
                     /db_xref="GeneID:11686349"
     CDS             complement(195677..197584)
                     /locus_tag="BSVBI22_B0206"
                     /note="similar to GP:15073737; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-regulated potassium-efflux system
                     protein, putative"
                     /protein_id="YP_005108224.1"
                     /db_xref="GI:376278191"
                     /db_xref="GeneID:11686349"
                     /translation="MPKSGVFKATSSTIFKYQEHSMVANGGSLYLQSLMILGGAIIAA
                     PLFKRLGLGTVLGYLAAGITIGPVARLIADGEEFLHFSELGVVFLLFIIGLELNPSRL
                     WSLRHSIFGLGTAQVLLCGAALAALGVYLAGLDTEAAIIIGFGLALSSTAFAMQVLED
                     RAETNQKHGQRAFAILLFQDLAIVPILAIIPALSPNEPSQASAGFHLATAIASIAALV
                     IAGRYLINPMFRIIANTGAREVMIAAALFVVLGSASLLQYAGLSMAMGAFIAGVLLAE
                     SSYRHELEADIEPFRGIFLGLFFVAVGLSLNLSVILEYWAVILAAVPIFMATKIVIIY
                     LLCRIFRSSHNDAVRIAFLLPQGGEFAFVLFSAASAAAIISSALGSELVAAVTVSMAL
                     TPLSVAIGSRLLIKDKADDIIEENFDGAGSDVLMIGFSRYGQIAAQILLAGGIDVTVI
                     DSSSNRVRAAGKFGFRIYFGDGTRKDVLEAAGIRKAKIVAICTHKKSTTNHIVNLIQS
                     EYPDVRLFVRSYDREHTLQLRAQGVEYELRETFESGLLFGQRTLEGLGLSEANAYAIR
                     EDVRQRDEDRLHVQASEGIMAGRHLLFNKPVTPEPLVKPTREGQRIDKSDDGQRAPSP
                     QETAAAPVAAE"
     misc_feature    complement(195866..197509)
                     /locus_tag="BSVBI22_B0206"
                     /note="glutathione-regulated potassium-efflux system
                     protein KefB; Provisional; Region: PRK03659"
                     /db_xref="CDD:179625"
     misc_feature    complement(196373..197506)
                     /locus_tag="BSVBI22_B0206"
                     /note="Kef-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: KefB;
                     COG0475"
                     /db_xref="CDD:223551"
     misc_feature    complement(195980..196315)
                     /locus_tag="BSVBI22_B0206"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     gene            197723..199066
                     /gene="pmbA"
                     /locus_tag="BSVBI22_B0207"
                     /db_xref="GeneID:11686350"
     CDS             197723..199066
                     /gene="pmbA"
                     /locus_tag="BSVBI22_B0207"
                     /note="similar to GB:V00566, GB:J00299, GB:M29386,
                     GB:D00411, SP:P01236, GB:U75583, PID:1620399, PID:1658518,
                     PID:190354, PID:190356, PID:220018, PID:34211, PID:531101,
                     and PID:531103; identified by sequence similarity;
                     putative"
                     /codon_start=1
                     /transl_table=11
                     /product="pmbA protein"
                     /protein_id="YP_005108225.1"
                     /db_xref="GI:376278192"
                     /db_xref="GeneID:11686350"
                     /translation="MISDNSADKLVERAAELVAAAKRAGADEVDAVVMRARSVSVSVR
                     LGKVEGTESSESDDFALRVFVGRRIASVSANAGADPHRLAERAVAMARVAPEDPYERL
                     ADPSLLVKSPRDLDLFDATEIDTARLTEDALAMEAAALAVSGVTNSGGAGASRSLGGM
                     VLVTSTGFSGHYAATRFGRSVSAIAGEGTGMERDYDFSSRLHFADLDAPEAIGRSAGE
                     RAVRRLGARQAKTGPVTVVYDPRLARGIAGHLASAINGASVAHKTSFLRNSLGKPVLK
                     QGINVTDNPLRVRGPSSRPFDGEGIEGQPLTMVEDGVLQHWLLSGSSARELGLQGNGR
                     GVRSGSGVTPASTNFAIEPGTQSPEELIRAVGTGFYVTEVFGQGVDMISGQYSRGASG
                     FWIENGELAYPVSEVTIASNLKDMFLNMTPASDIDRNFGMAAPTLVIEGMTLAGN"
     misc_feature    197756..199063
                     /gene="pmbA"
                     /locus_tag="BSVBI22_B0207"
                     /note="Predicted Zn-dependent proteases and their
                     inactivated homologs [General function prediction only];
                     Region: TldD; COG0312"
                     /db_xref="CDD:223389"
     gene            199098..199862
                     /locus_tag="BSVBI22_B0208"
                     /db_xref="GeneID:11686351"
     CDS             199098..199862
                     /locus_tag="BSVBI22_B0208"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01330"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase family protein"
                     /protein_id="YP_005108226.1"
                     /db_xref="GI:376278193"
                     /db_xref="GeneID:11686351"
                     /translation="MLREAAREAGRIAMHYFGRSPEVWLKDGVSPVSEADLAVDRFLK
                     ETLLAARLDYGWISEETVDERAAAERSRAFVVDPIDGTRAYIGGQDQWCVSIAIIENG
                     SPVAGVLECPVREELLEAGKGLGARQNGCRIHTKVPLAGEEITIAFARNQINALPEQW
                     RGPVRVHPYVPSLAYRIAMVARGDIAGTFIRPNSHDWDLAAADLILSESGGAILTSKA
                     LPLVYGGPTRSHGALVAASGNLLREMLSVVADQPLS"
     misc_feature    199101..199802
                     /locus_tag="BSVBI22_B0208"
                     /note="CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate
                     (PAPS) 3'-phosphatase, is a bacterial member of the
                     inositol monophosphatase family. It has been proposed that
                     CysQ helps control intracellular levels of PAPS, which is
                     an intermediate in...; Region: CysQ; cd01638"
                     /db_xref="CDD:238816"
     misc_feature    order(199203..199205,199272..199277,199326..199343,
                     199347..199349,199542..199544,199551..199553,
                     199623..199625,199659..199661,199686..199691)
                     /locus_tag="BSVBI22_B0208"
                     /note="active site"
                     /db_xref="CDD:238816"
     gene            199901..200152
                     /locus_tag="BSVBI22_B0209"
                     /db_xref="GeneID:11686352"
     CDS             199901..200152
                     /locus_tag="BSVBI22_B0209"
                     /note="similar to GP:15155658, and GP:15073740; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108227.1"
                     /db_xref="GI:376278194"
                     /db_xref="GeneID:11686352"
                     /translation="MSDAGDNKQLLHLVFGGELKKLDSLEFRDLQNLDIVGIYPDYES
                     AKTAWKSKAQQTVDNAHMRYFIVHLHRLLDPNNMTLKAE"
     misc_feature    199922..200128
                     /locus_tag="BSVBI22_B0209"
                     /note="Domain of unknown function (DUF4170); Region:
                     DUF4170; pfam13773"
                     /db_xref="CDD:205946"
     gene            200216..200959
                     /locus_tag="BSVBI22_B0210"
                     /db_xref="GeneID:11686353"
     CDS             200216..200959
                     /locus_tag="BSVBI22_B0210"
                     /note="similar to GP:14027592; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108228.1"
                     /db_xref="GI:376278195"
                     /db_xref="GeneID:11686353"
                     /translation="MQKKKGGLAKRLWRRIRGPLARSAAVKSILVWLIASYLKLVHAT
                     NPRLKDSASSEDIVHDFAPFIVTFWHGQHLMGPFLRPKGLELVAMFSRSADAELNARV
                     AEKLGLLTVRGSGGRGTRANPEKGGARALLTLKNALRKGQSTSMIADIAHGKAREAGE
                     GIILLAKLSGRPIIPLAYAFSRNHVLEKTWDKTTIPLPFGRSTIVRGDPVWVDADADD
                     VQLEEKRVELTRQLNRATDRAYAALEKAK"
     misc_feature    200327..200917
                     /locus_tag="BSVBI22_B0210"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: DUF374; Region:
                     LPLAT_DUF374-like; cd07983"
                     /db_xref="CDD:153245"
     misc_feature    order(200423..200425,200432..200434,200438..200440,
                     200483..200494,200663..200671)
                     /locus_tag="BSVBI22_B0210"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153245"
     gene            200956..202296
                     /gene="kdtA"
                     /locus_tag="BSVBI22_B0211"
                     /db_xref="GeneID:11686354"
     CDS             200956..202296
                     /gene="kdtA"
                     /locus_tag="BSVBI22_B0211"
                     /note="catalyzes the transfer of
                     2-keto-3-deoxy-D-manno-octulosonic acid to lipid A"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic-acid transferase"
                     /protein_id="YP_005108229.1"
                     /db_xref="GI:376278196"
                     /db_xref="GeneID:11686354"
                     /translation="MSERWARSILSAYRFLGSAAYPFVGSYIAYRASRGKEDRARRGE
                     RYGKSAIARPQGPVIWAHAASVGETIALVPLVERIVATGIHVVMTTGTVTSAKVVADQ
                     LGSRVIHQYAPLDLQPAVDHFLDHWKPDLVIGCESEVWPATVLSLGSRHIPHVLVNGR
                     MSDRSFAAWQKRPALAEALFENFAHVVAQSELDGERFRALGARPVSVSGNLKVDTPPP
                     PSDPQALSLMQRQVAGRRTWAAISTHDGEEEIAAEVHQMLKMRYPRLITIIVPRHPDR
                     APAIEAMLAAKGLKVARRSTGQPIEADTDVLLGDTIGEMGLYLQLTEIAFIGNSLTKE
                     GGHNPLEPAMMGTAVLTGRNVQNFRESFQRLIKNGGARIVKDRNMLAGAINFLFNNPQ
                     HLRAMINAGVTTVRDMRGALDRTLAALEPFIQPLVLQAQLPGNRNEPAFSLDEH"
     misc_feature    200980..202224
                     /gene="kdtA"
                     /locus_tag="BSVBI22_B0211"
                     /note="3-deoxy-D-manno-octulosonic-acid transferase [Cell
                     envelope biogenesis, outer membrane]; Region: KdtA;
                     COG1519"
                     /db_xref="CDD:224436"
     misc_feature    201067..201606
                     /gene="kdtA"
                     /locus_tag="BSVBI22_B0211"
                     /note="3-Deoxy-D-manno-octulosonic-acid transferase
                     (kdotransferase); Region: Glycos_transf_N; pfam04413"
                     /db_xref="CDD:252580"
     misc_feature    <201853..202158
                     /gene="kdtA"
                     /locus_tag="BSVBI22_B0211"
                     /note="Glycosyl transferases group 1; Region:
                     Glycos_transf_1; cl19138"
                     /db_xref="CDD:267491"
     gene            202299..203324
                     /gene="lpxK"
                     /locus_tag="BSVBI22_B0212"
                     /db_xref="GeneID:11686355"
     CDS             202299..203324
                     /gene="lpxK"
                     /locus_tag="BSVBI22_B0212"
                     /note="transfers the gamma-phosphate of ATP to the 4'
                     position of a tetraacyldisaccharide 1-phosphate
                     intermediate to form tetraacyldisaccharide
                     1,4'-bis-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="YP_005108230.1"
                     /db_xref="GI:376278197"
                     /db_xref="GeneID:11686355"
                     /translation="MASEAPPFWWDEPDWRALALAPAAWIYGRVSGRRLIRAVPPRVS
                     LPVLCVGNFTVGGAGKTPTAIAFARGAIARGMKPGIVSRGYGGNYSGLHLVDPGHDGA
                     RHVGDEPLLLARHAAVALSPDRVKAAEYLKSLGCDFIIMDDGFQSARLHADFSLLVVD
                     ASRGIGNGRVIPAGPLRAPLTDQMRKTDALLCIGKGNGADFVIRQAARAGRPIYHAQL
                     RPSSSATVAGRRWLAFAGIGNPDKFYESVRQAGGEVVETHSFADHYSFEPDDIRGLVD
                     MARRQGLGLITTAKDHVRLATMPGVPPEFLSKLAVLDVDLEFDRTDALDHILDTVVER
                     FKSRLHG"
     misc_feature    202299..203315
                     /gene="lpxK"
                     /locus_tag="BSVBI22_B0212"
                     /note="Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope
                     biogenesis, outer membrane]; Region: LpxK; COG1663"
                     /db_xref="CDD:224577"
     gene            complement(203338..203574)
                     /locus_tag="BSVBI22_B0213"
                     /db_xref="GeneID:11686356"
     CDS             complement(203338..203574)
                     /locus_tag="BSVBI22_B0213"
                     /note="similar to GP:15073746; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108231.1"
                     /db_xref="GI:376278198"
                     /db_xref="GeneID:11686356"
                     /translation="MNRFESPRSSEAVLRYLDGDYEIVKHGSFVSCAVTGAPIPLDEL
                     KYWSVARQEPYASGPISFERELEMNPELRSRKKA"
     misc_feature    complement(203347..203574)
                     /locus_tag="BSVBI22_B0213"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3908"
                     /db_xref="CDD:226423"
     gene            complement(203672..205543)
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /db_xref="GeneID:11686357"
     CDS             complement(203672..205543)
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /note="This protein is involved in the repair of
                     mismatches in DNA. It is required for dam-dependent
                     methyl-directed DNA mismatch repair. Promotes the
                     formation of a stable complex between two or more
                     DNA-binding proteins in an ATP-dependent manner without
                     itself being part of a final effector complex"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein"
                     /protein_id="YP_005108232.1"
                     /db_xref="GI:376278199"
                     /db_xref="GeneID:11686357"
                     /translation="MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEV
                     VTAGGGKTLLRVTDNGSGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGS
                     VSKLTLKSRPQDADSGFEVCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKT
                     DRAEATAITDVVKRIGIAFPHIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREF
                     GENALAIDAERDGVRLAGFVGIPSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDV
                     IARDRHPVAVLFLTLDPALVDVNVHPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRP
                     ATSGAEAMLQAFRAEGFGAQQSAPRPANSYSPASWRTAPPAPRSEWSPQTAHPAHRPL
                     DLQAAPALRENGQAVLGDVAVPAADARASVAEAPVELMQKPLGAARAQIHENYIVAQT
                     EDSLVIVDQHAAHERLVYEALKNALHARPIAGQMLLIPEIVDLPEEDAQRLAGHAETL
                     ARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIRDLADEIAEHDTADGLKAMLHHVAA
                     TMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCNHGRPTYIELKLTDIERLFGRR"
     misc_feature    complement(203675..205543)
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /note="DNA mismatch repair protein; Reviewed; Region:
                     mutL; PRK00095"
                     /db_xref="CDD:234630"
     misc_feature    complement(205172..205477)
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(205181..205183,205187..205192,
                     205214..205216,205220..205222,205253..205264,
                     205355..205360,205364..205366,205370..205372,
                     205376..205378,205436..205438,205445..205447,
                     205457..205459))
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(205445..205447)
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(205256..205258,205262..205264,
                     205358..205360,205364..205366))
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(204563..204928)
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /note="MutL_Trans: transducer domain, having a ribosomal
                     S5 domain 2-like fold, conserved in the C-terminal domain
                     of DNA mismatch repair (MutL/MLH1/PMS2) family. This
                     transducer domain is homologous to the second domain of
                     the DNA gyrase B subunit, which is...; Region: MutL_Trans;
                     cd00782"
                     /db_xref="CDD:238405"
     misc_feature    complement(204632..204634)
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238405"
     misc_feature    complement(203804..204247)
                     /gene="mutL"
                     /locus_tag="BSVBI22_B0214"
                     /note="MutL C terminal dimerization domain; Region:
                     MutL_C; pfam08676"
                     /db_xref="CDD:254967"
     gene            complement(205727..207010)
                     /gene="mucK"
                     /locus_tag="BSVBI22_B0215"
                     /db_xref="GeneID:11686358"
     CDS             complement(205727..207010)
                     /gene="mucK"
                     /locus_tag="BSVBI22_B0215"
                     /note="similar to GB:Z25795, SP:P39118, PID:397488,
                     PID:2293136, GB:AL009126, GB:Z25795, SP:P39118,
                     PID:397488, PID:2293136, and GB:AL009126; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="cis,cis-muconate transport protein MucK"
                     /protein_id="YP_005108233.1"
                     /db_xref="GI:376278200"
                     /db_xref="GeneID:11686358"
                     /translation="MRTINENTATKTSRAAVRPEHNRIWILVFIFSFLGLMIDGADLM
                     LLSYSLTSIKAEFGLTSVEAGSLGSITLAGMAIGGIYGGWACDRFGRVKTVSWTIVLF
                     SIGTAVLGLTHSYFQFAVARFVSSLGLGALYVACNTLMAEYVPTKYRTTALGTLQAGW
                     SVGYIVATVLAGAILPVYGWRYLFFVAIVPVIIALLMHKGVPEPESWVRAKAERESGG
                     SKFTTAKRESAFKAIFGNPRVRTLFIFWALTAGFLQFGYYGVNNWLPSYLETEMGMNF
                     KSMTAYMIGSYTAMILGKVLAGVAADWLGRRAVFALGALGTAAFLPIIVLYHSPNTIL
                     WMLVVFGFLYGVPYGVNATYMAESFEAKYRGTAVGGAYNIGRAGAALAPVAIGFFASQ
                     ISIGFGFLVMGGAYFICGVIPALFIREKQFDPEKQ"
     misc_feature    complement(205847..206947)
                     /gene="mucK"
                     /locus_tag="BSVBI22_B0215"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    complement(205760..206926)
                     /gene="mucK"
                     /locus_tag="BSVBI22_B0215"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(205874..205876,205883..205888,
                     205895..205900,205907..205912,205943..205945,
                     205952..205957,205967..205969,205976..205981,
                     205988..205990,206129..206131,206141..206143,
                     206150..206152,206162..206164,206174..206176,
                     206216..206218,206225..206230,206237..206242,
                     206249..206251,206519..206521,206537..206542,
                     206549..206554,206588..206590,206597..206602,
                     206609..206614,206621..206626,206762..206767,
                     206771..206776,206786..206788,206795..206800,
                     206807..206809,206858..206863,206867..206875,
                     206882..206884))
                     /gene="mucK"
                     /locus_tag="BSVBI22_B0215"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(207108..208262)
                     /locus_tag="BSVBI22_B0216"
                     /db_xref="GeneID:11686359"
     CDS             complement(207108..208262)
                     /locus_tag="BSVBI22_B0216"
                     /note="similar to SP:P45857; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_005108234.1"
                     /db_xref="GI:376278201"
                     /db_xref="GeneID:11686359"
                     /translation="MIRDPEILEILRDTVSQFVSETLIPRENEVAETNAIPADIIAQM
                     KELGFFGLTIPEEFGGLGLTMEEEVNVAFELGRASPAFRSYIGTNNGIGSIGILIDGT
                     DEQKRNYLPRLASGELLSSFCLTEPDAGSDAASLKTTAVRDGDFYILNGTKRFITNAP
                     IADIFTVMARTAADVKGADGISAFIVERNSPGLSLGKPDQKMGQKGALTSDVIFENVR
                     VPASQLIGGVEGKGFKTAMKVLDKGRLHIAALSTGAAERMLADTLAYALDRKQFGKPI
                     ADFQLIQAMLADSKAEIYAAKCMVLDAARKRDSGQNVSTEASCAKMFATEMCGRVADR
                     CVQIHGGAGYVSEYAIERFYRDVRLFRIYEGTTQIQQIVIARNMIREARR"
     misc_feature    complement(207114..208250)
                     /locus_tag="BSVBI22_B0216"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(207123..208247)
                     /locus_tag="BSVBI22_B0216"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(207159..207161,207165..207167,
                     207171..207179,207792..207794,207798..207800,
                     207891..207893,207897..207899,207987..207989))
                     /locus_tag="BSVBI22_B0216"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(208319..209173)
                     /locus_tag="BSVBI22_B0217"
                     /db_xref="GeneID:11686360"
     CDS             complement(208319..209173)
                     /locus_tag="BSVBI22_B0217"
                     /note="identified by match to PFAM protein family HMM
                     PF01614"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_005108235.1"
                     /db_xref="GI:376278202"
                     /db_xref="GeneID:11686360"
                     /translation="MRSRTGSDASRRQERSAEMRKPTMLTPLEAGVEEEDRQFVTALA
                     RGLEVLRCFTPTENTLGNQEIAHKTGLPKPTVSRLTHTLVRLGYLRQDALSGLYQLDI
                     GILRLGYAMLSNLMIRTVASPLMQVLADYAKAAVAMAARDRLSMVYLDVVQGEGNMTM
                     RRQIGSTLPLAGSSVGRACLAAMPEDERTFILKHIREREPENWPSIRKGLDRALRDFE
                     DYGYCLSIGEWHRDVNSVAVPLVHKQYGVLVFNCGGPSFQLPREKLEDDIGPRLIEMV
                     HNISSAVP"
     misc_feature    complement(208784..209056)
                     /locus_tag="BSVBI22_B0217"
                     /note="helix_turn_helix isocitrate lyase regulation;
                     Region: HTH_ICLR; smart00346"
                     /db_xref="CDD:214629"
     misc_feature    complement(208325..209053)
                     /locus_tag="BSVBI22_B0217"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(208352..208702)
                     /locus_tag="BSVBI22_B0217"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            209433..210194
                     /locus_tag="BSVBI22_B0218"
                     /db_xref="GeneID:11686361"
     CDS             209433..210194
                     /locus_tag="BSVBI22_B0218"
                     /note="Catalyzes the reversible hydration of unsaturated
                     fatty acyl-CoA to beta-hydroxyacyl-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_005108236.1"
                     /db_xref="GI:376278203"
                     /db_xref="GeneID:11686361"
                     /translation="MSVERHADGVATVRINRPEARNALNLTTRQQLAEHFRALSGDES
                     VRAIVLTGGETCFVAGADVREFASAGPIEMYLRHTEYLWDAIASCAKPVIAAVNGYAL
                     GGGCELAMHCDIIVAGEGAVFGQPEVKLGLMPGAGGTQRLIRAVGKFQAMRIALTGCM
                     VPAAEALSIGMISEMTANERTLPRAHELAVEIARLPALAVAQIKEVMLVGADLPLDGA
                     LALERKAFQLLFDSKDQKEGAAAFLEKRKPAYNGR"
     misc_feature    209433..210191
                     /locus_tag="BSVBI22_B0218"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK08138"
                     /db_xref="CDD:236162"
     misc_feature    209436..210008
                     /locus_tag="BSVBI22_B0218"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(209493..209495,209499..209501,209595..209597,
                     209607..209621,209730..209732,209736..209744,
                     209808..209813,209820..209822)
                     /locus_tag="BSVBI22_B0218"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(209613..209615,209742..209744)
                     /locus_tag="BSVBI22_B0218"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(209682..209684,209706..209708,209769..209780,
                     209814..209825,209841..209843,209847..209855,
                     209859..209864,209877..209882,209886..209891,
                     209895..209900,209907..209909,209940..209942,
                     209949..209951,209994..209996,210003..210008)
                     /locus_tag="BSVBI22_B0218"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            210199..211728
                     /locus_tag="BSVBI22_B0219"
                     /db_xref="GeneID:11686362"
     CDS             210199..211728
                     /locus_tag="BSVBI22_B0219"
                     /note="converts 3-hydroxyadipyl-CoA to beta-ketoadipyl-CoA
                     in phenylacetate degradation"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxy-acyl-CoA dehydrogenase"
                     /protein_id="YP_005108237.1"
                     /db_xref="GI:376278204"
                     /db_xref="GeneID:11686362"
                     /translation="MERSINHIAIVGAGVMGTGIAQIAAQAGLVTQIFDAREGAAAAS
                     RDRLASTLAKLAEKGKISAEDAQTAVSRIEICSSIQELADCDLVVEAIVEKLDAKQAL
                     FLELEAVVSGNCILATNTSSLSVTSIARVCRHPERVAGFHFFNPVPLMKVVEVIDGLT
                     TDPAVGDALLVLAKRMGHHGIRAKDMPGFIINHAGRAYGTEALKIFGECVAPRGDIDR
                     ILRESAGFRMGPLELFDLTGLDVSHPVMESIYNQFYQEPRYRPSALTRQMLEGGYVGR
                     KVGQGFYRYEDGKMVASPVPQPVPAVDIMPSVWISADCDEDKEQLYALLRSLGATVET
                     GALPSAEALCLLAPYGYDATTACELAGSDPARTVCIDMLPGLDRHRTLMMTPATSPAF
                     RDAAHALLARDGVNVTVIRDSVGFVAQRTLAAIVNLACDIAQQGIATADDIDQAVRLG
                     LGYPQGPLAWGDALGASRILKILSRMLELTGDPRYRPSPWLRRRAALGLSLRSAEPDI
                     D"
     misc_feature    210199..211716
                     /locus_tag="BSVBI22_B0219"
                     /note="3-hydroxy-acyl-CoA dehydrogenase; Validated;
                     Region: PRK08268"
                     /db_xref="CDD:236211"
     misc_feature    210217..210753
                     /locus_tag="BSVBI22_B0219"
                     /note="3-hydroxyacyl-CoA dehydrogenase, NAD binding
                     domain; Region: 3HCDH_N; pfam02737"
                     /db_xref="CDD:251505"
     misc_feature    210760..211053
                     /locus_tag="BSVBI22_B0219"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     misc_feature    211441..211692
                     /locus_tag="BSVBI22_B0219"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     gene            211951..213192
                     /locus_tag="BSVBI22_B0220"
                     /db_xref="GeneID:11686363"
     CDS             211951..213192
                     /locus_tag="BSVBI22_B0220"
                     /note="similar to GP:14587414; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="CAIB/BAIF family protein"
                     /protein_id="YP_005108238.1"
                     /db_xref="GI:376278205"
                     /db_xref="GeneID:11686363"
                     /translation="MGALTGYRVLDMSRVLAGPWCGQILADLGAEVIKIERPRTGDDT
                     RDWGPPWMKDEQGNPTREASYYQSANRGKFSVALNIASPEGQDLLRKMVAECDVLIEN
                     YKAGSLAKYGLDYETLSAINPGLVYCSVTGFGQTGPRAPEPGYDFIIQGIGGLMSITG
                     ERDDKPGGGPQKVGVAVADLMTGLYSAIAIEAALLSRAKTGKGQHIDMALLDVQVAAL
                     CNQSQNYLASGRPPGRYGNAHANIVPYQVFRASDRDFIIACGNDAQFVSLCDAIGLPD
                     LPKDPRFTRNSDRVIHRDEIIGILAAHFLTGTADEWIGRIHPRGVPVGAINDIARALD
                     EPQVKARNMLVQIPHPLNKDFVTVGSPIKLSGTPVEYKRAAPMLGEHTDTLLQQLAKL
                     DDDRLNDLKSRGIIEQFNSGE"
     misc_feature    211951..213168
                     /locus_tag="BSVBI22_B0220"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            complement(213176..214344)
                     /locus_tag="BSVBI22_B0221"
                     /note="This region contains an authentic frame shift and
                     is not the result of a sequencing artifact;
                     oxidoreductase, FMN-binding, authentic frameshift"
                     /db_xref="GeneID:11686364"
     gene            214430..214894
                     /locus_tag="BSVBI22_B0222"
                     /db_xref="GeneID:11686365"
     CDS             214430..214894
                     /locus_tag="BSVBI22_B0222"
                     /note="identified by match to PFAM protein family HMM
                     PF00376"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_005108239.1"
                     /db_xref="GI:376278206"
                     /db_xref="GeneID:11686365"
                     /translation="MKIGELAKRSGLAASRIRFYESIGLLKTVDRRSNGYRTYPEEAV
                     LVLHLIATAQKAGFSLDEIRTLLPPDLDNWEHDALIEVLRRKVADIEALEARLARSKL
                     QLLGLISDIEAKPDDMACADNARRVLSRLMAEEMEAPASLQDEGRPHRRTTI"
     misc_feature    214430..214822
                     /locus_tag="BSVBI22_B0222"
                     /note="Helix-Turn-Helix DNA binding domain of putative
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-like_sg7; cd04786"
                     /db_xref="CDD:133413"
     misc_feature    214430..214771
                     /locus_tag="BSVBI22_B0222"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    order(214433..214441,214481..214483,214532..214540)
                     /locus_tag="BSVBI22_B0222"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133413"
     misc_feature    order(214574..214576,214583..214585,214595..214600,
                     214625..214627,214676..214678,214688..214690,
                     214706..214708,214718..214720,214727..214732)
                     /locus_tag="BSVBI22_B0222"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133413"
     gene            complement(214940..215647)
                     /locus_tag="BSVBI22_B0223"
                     /db_xref="GeneID:11686366"
     CDS             complement(214940..215647)
                     /locus_tag="BSVBI22_B0223"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01382"
                     /codon_start=1
                     /transl_table=11
                     /product="ThiJ/PfpI family protein"
                     /protein_id="YP_005108240.1"
                     /db_xref="GI:376278207"
                     /db_xref="GeneID:11686366"
                     /translation="MGKRVLHVVTNVAHYADPSQPTGLWLSELSHAHDVFAAKGYDQH
                     IVSPKGGVSPLEPRALKWPLLDTSAKAWLADPARMALLTTTARPDQIDPADYDAIYFT
                     GGHAVMWDFPDSQGLQNITRAIWEQGGIVSSVCHGYCGLLNTRLSDGSLLAAGKRLTG
                     FSWMEEILAGVSSRMPYNAEQEMKRRGAHYQKAFLPFISYVVADGRLVTGQNPASAKA
                     TAEKVVALMEMRSNPLF"
     misc_feature    complement(214967..215635)
                     /locus_tag="BSVBI22_B0223"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in proteins similar to Escherichia coli Hsp31
                     protein; Region: GATase1_Hsp31_like; cd03141"
                     /db_xref="CDD:153235"
     misc_feature    complement(214949..215587)
                     /locus_tag="BSVBI22_B0223"
                     /note="Putative intracellular protease/amidase [General
                     function prediction only]; Region: ThiJ; COG0693"
                     /db_xref="CDD:223765"
     misc_feature    complement(order(215150..215152,215240..215245))
                     /locus_tag="BSVBI22_B0223"
                     /note="potential catalytic triad [active]"
                     /db_xref="CDD:153235"
     misc_feature    complement(215243..215245)
                     /locus_tag="BSVBI22_B0223"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153235"
     gene            complement(215878..217218)
                     /locus_tag="BSVBI22_B0224"
                     /db_xref="GeneID:11686367"
     CDS             complement(215878..217218)
                     /locus_tag="BSVBI22_B0224"
                     /note="similar to GP:15159266; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_005108241.1"
                     /db_xref="GI:376278208"
                     /db_xref="GeneID:11686367"
                     /translation="MRPRSLQWRISLWLGLGISMLWAIAALVTASQLSREMNVVFDSA
                     LEETAQRILPLAVLDITERESDDEMNQRMATLRKHDEYFTYVVRNTAGEVLLQSHSAD
                     LSIFPPFTTMGFQTTPTHRIYFDAALQGAVNIAVAEPLGARRGVAMQVLWRLALPLGL
                     VIPLSLIGVWAIVRVSMAPLWAFRSDIEARGSGDLSPVTVNDLPSEVSPIAQAVNRLM
                     DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRL
                     SRLSEKLMQLAKAEGGRLHAAEPIDMGVILRMVVRELSQPHGNENRIRLSIPDMAVKI
                     DIDADAFAILARNLIENALKHGPHDEPVEVLLTASGKLVVSNGGPAVPPDILERLSHR
                     FERGATKAEGTGLGLAIAKAIAAGTGGTIDLFSPREGRKDGFEVRFTPGGRVLH"
     misc_feature    complement(215908..217218)
                     /locus_tag="BSVBI22_B0224"
                     /note="sensor protein QseC; Provisional; Region: PRK10337"
                     /db_xref="CDD:182388"
     misc_feature    complement(216550..216759)
                     /locus_tag="BSVBI22_B0224"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(216355..216546)
                     /locus_tag="BSVBI22_B0224"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(216370..216372,216382..216384,
                     216391..216393,216403..216405,216412..216414,
                     216424..216426,216472..216474,216481..216483,
                     216493..216495,216502..216504,216514..216516,
                     216526..216528))
                     /locus_tag="BSVBI22_B0224"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(216508..216510)
                     /locus_tag="BSVBI22_B0224"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(215899..216183)
                     /locus_tag="BSVBI22_B0224"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(215911..215913,215917..215922,
                     215944..215946,215950..215952,215998..216009,
                     216076..216081,216085..216087,216091..216093,
                     216097..216099,216157..216159,216166..216168,
                     216178..216180))
                     /locus_tag="BSVBI22_B0224"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(216166..216168)
                     /locus_tag="BSVBI22_B0224"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(216001..216003,216007..216009,
                     216079..216081,216085..216087))
                     /locus_tag="BSVBI22_B0224"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(217218..217886)
                     /locus_tag="BSVBI22_B0225"
                     /note="This region contains an authentic point mutation,
                     causing a premature stop, and is not the result of a
                     sequencing artifact; DNA-binding response regulator,
                     authentic point mutation; similar to GP:15159265,
                     GB:J00230, SP:P01857, SP:P01859, SP:P01860, SP:P01861,
                     PID:1335110, PID:1335112, PID:1335113, PID:184758,
                     PID:567112, and PID:577056; identified by sequence
                     similarity; putative"
                     /db_xref="GeneID:11686368"
     gene            complement(218014..218178)
                     /locus_tag="BSVBI22_B0226"
                     /db_xref="GeneID:11686369"
     CDS             complement(218014..218178)
                     /locus_tag="BSVBI22_B0226"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108242.1"
                     /db_xref="GI:376278209"
                     /db_xref="GeneID:11686369"
                     /translation="MTFQPSEAAICCTASRDYHLSIGTLQSLSAKAACGAAIAAISAV
                     IRMIFFISLS"
     gene            218150..218422
                     /locus_tag="BSVBI22_B0227"
                     /db_xref="GeneID:11686370"
     CDS             218150..218422
                     /locus_tag="BSVBI22_B0227"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108243.1"
                     /db_xref="GI:376278210"
                     /db_xref="GeneID:11686370"
                     /translation="MAASLGWNVKRIKIDDGCYEIKGLNEAGKPFKAKINPQSLAIMK
                     LKVKGMDDDRDHRRNRQQHGDAPGPLDGVPANKLIQKGSTPKVQVQ"
     misc_feature    <218150..218407
                     /locus_tag="BSVBI22_B0227"
                     /note="Peptidase propeptide and YPEB domain; Region:
                     PepSY_2; cl17877"
                     /db_xref="CDD:266904"
     gene            218590..219060
                     /locus_tag="BSVBI22_B0228"
                     /db_xref="GeneID:11686371"
     CDS             218590..219060
                     /locus_tag="BSVBI22_B0228"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108244.1"
                     /db_xref="GI:376278211"
                     /db_xref="GeneID:11686371"
                     /translation="MKSLLSALAITTALTFPGLALAQPVTLSTTLNNYGGDGAYIALY
                     VTDAQGAYAGSLWMAGGKSKYYQHLSGWYRATGGDTAEIDGITGASVGAGRKLEITLD
                     LADALFDAGYTLHVDAAVEDMQDSPDEIALPLTSKGSGVPVRGRRYIANFTYTK"
     misc_feature    218659..219045
                     /locus_tag="BSVBI22_B0228"
                     /note="Predicted periplasmic protein (DUF2271); Region:
                     DUF2271; pfam10029"
                     /db_xref="CDD:255708"
     gene            219071..221275
                     /locus_tag="BSVBI22_B0229"
                     /db_xref="GeneID:11686372"
     CDS             219071..221275
                     /locus_tag="BSVBI22_B0229"
                     /note="identified by match to PFAM protein family HMM
                     PF03929"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, FAD-binding, putative"
                     /protein_id="YP_005108245.1"
                     /db_xref="GI:376278212"
                     /db_xref="GeneID:11686372"
                     /translation="MIRWLHRWSGIIAAVLLMVLALSGAALSVFPAMERLSAPQAETG
                     LSVADLMARIQANYPAVEQVRRTPSGKITAYWFDDGAPQAAVIDPATGKSVAPANPNR
                     LEQWLKGLHRSLFLGDSGRIVMAIGALIMLGLSISGAFLIARRTGGWKNWFKPLRGAA
                     SGRLHTEVARIAVLGLLLSSTTAVWMSASTFDLLPKSPVVAEPTGVSGETGMKPALIA
                     KLEETPVSSFKELSFPYPGDATDMFVLKTDRGTGYLDQGTGAVLDWHDYTVWQRISQT
                     VKMLHTGKGAALLGIILGLASLTVPFLGITGIVLWFAGLRGRPRIRDNAAAGKAETIV
                     LVGSEGGSTWGFAATLHAALREAGQSVHVGPMSSFNPARYGKAQRILIFAATYGNGDA
                     PASAKGFLDRLAALPKSPAAPLAVLGFGDRSFPDYCAFAKAIADGARAKGWKELIPFE
                     TVDRQSTQDFARWGRDLGAAIGIKLELVHQPVIPAVAALTLVSRRDYGADVQAPTAIL
                     RFALPKPTFWQQLSGAGFSRFEAGDLLGIVPEGSAVPRFYSLASGSRDGFVEIVVKKH
                     PAGLCSGQLFELQPGDTMRAFLRRNANFHAGKGRTPLILVGAGTGIGPLAGIVRANRQ
                     HRPVHLFFGMRHPESDFFYHEDLQEWQGEGRLQNLTTACSRVHNPSYVQDALRKDAAE
                     IARLVNKGARVMVCGGRDMAAGVSEALADILAPAGLTPAVLKAEGRYVEDVY"
     misc_feature    219074..219154
                     /locus_tag="BSVBI22_B0229"
                     /note="PepSY-associated TM helix; Region: PepSY_TM_1;
                     pfam13172"
                     /db_xref="CDD:257540"
     misc_feature    219146..221272
                     /locus_tag="BSVBI22_B0229"
                     /note="Sulfite reductase, alpha subunit (flavoprotein)
                     [Inorganic ion transport and metabolism]; Region: CysJ;
                     COG0369"
                     /db_xref="CDD:223446"
     misc_feature    219386..219637
                     /locus_tag="BSVBI22_B0229"
                     /note="PepSY-associated TM helix; Region: PepSY_TM_2;
                     pfam13703"
                     /db_xref="CDD:258001"
     misc_feature    220070..220447
                     /locus_tag="BSVBI22_B0229"
                     /note="Flavodoxin; Region: Flavodoxin_1; pfam00258"
                     /db_xref="CDD:249722"
     misc_feature    220394..221272
                     /locus_tag="BSVBI22_B0229"
                     /note="Cytochrome p450- like alpha subunits of E. coli
                     sulfite reductase (SiR) multimerize with beta subunits to
                     catalyze the NADPH dependent reduction of sulfite to
                     sulfide.  Beta subunits have an Fe4S4 cluster and a
                     siroheme, while the alpha subunits (cysJ...; Region:
                     SiR_like2; cd06201"
                     /db_xref="CDD:99798"
     misc_feature    order(220670..220672,220706..220717,220754..220756,
                     220760..220762,220775..220786)
                     /locus_tag="BSVBI22_B0229"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99798"
     misc_feature    order(220706..220708,220712..220717)
                     /locus_tag="BSVBI22_B0229"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99798"
     misc_feature    order(220715..220717,221156..221158,221264..221266,
                     221270..221272)
                     /locus_tag="BSVBI22_B0229"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:99798"
     misc_feature    order(220760..220771,220892..220894,220898..220900,
                     220970..220975,221060..221065,221081..221083,
                     221087..221089,221171..221173)
                     /locus_tag="BSVBI22_B0229"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99798"
     misc_feature    order(220775..220777,220784..220786,220793..220795)
                     /locus_tag="BSVBI22_B0229"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99798"
     misc_feature    order(220883..220885,220895..220906,220910..220912)
                     /locus_tag="BSVBI22_B0229"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99798"
     gene            221256..222233
                     /locus_tag="BSVBI22_B0230"
                     /db_xref="GeneID:11686373"
     CDS             221256..222233
                     /locus_tag="BSVBI22_B0230"
                     /note="similar to SP:P41780; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ApbE family protein"
                     /protein_id="YP_005108246.1"
                     /db_xref="GI:376278213"
                     /db_xref="GeneID:11686373"
                     /translation="MSKMFTDLKRHGLNGPTMRTRWSAIFYAAADFDIAPLRRALQQA
                     VDEVDMQMSTWKPDSDLMRLNRAPVGVWVEVPARLMEVLRLAIEIGRATGGAFDAAMG
                     DAVKAWGFGPMEADQRLISEALAGPRVAAHDALELDISAMRVRKRAAVTLDLNGIAKG
                     YGVDRLADTLESFGIHSGLVGIDGEMRALELRPDGTPWAIAVEMPDYNRRAPHSVLAL
                     HNGAVATSGDYRHWVVAGGHRLSHTMDPHRGAPLSTPPASVTVVAKTCAQADAFATAL
                     MVLGPIAGSKLAQSLGLDVLFLLRDGETIRPQPVGALFSGHPYPLQKLG"
     misc_feature    221292..222209
                     /locus_tag="BSVBI22_B0230"
                     /note="Membrane-associated lipoprotein involved in
                     thiamine biosynthesis [Coenzyme metabolism]; Region: ApbE;
                     COG1477"
                     /db_xref="CDD:224394"
     gene            complement(222276..223451)
                     /locus_tag="BSVBI22_B0231"
                     /db_xref="GeneID:11686374"
     CDS             complement(222276..223451)
                     /locus_tag="BSVBI22_B0231"
                     /note="similar to GP:15073890; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="GAF/GGDEF domain-containing protein"
                     /protein_id="YP_005108247.1"
                     /db_xref="GI:376278214"
                     /db_xref="GeneID:11686374"
                     /translation="MTSSQCFLCLILLLLFIGFAAFAIPRILVNRKVHKAIVDLKDYV
                     SHASNQNVRMTGEVDILRAIVKRHPLEQTLTMLCRFVEKQIPGTRCSVLILDPSGKKV
                     GKSIAPSLPTHYNKALIGLEIGPNIGSCGAAMFLRRPVIISDIATHPNWLSFRDLALP
                     CGLRACWSMPAINGAGKVLGAFAIYSDTPRTPAQNELMVGQIAVELSMIAVDTAQTQE
                     RLASQAMHDDLTQLPNRRYIGKLLTQKKSARDGLSRDGFLLLIDLDDFKPVNDTYGHL
                     TGDEVLKEVAQRLLRIVCEEDTVARMGGDEFMIVLNGGTSKEQTDIIASRIIREVSKP
                     IEVSQHKPVKVGCSIGIVSTREWRSNKYIFDCADKAMYSAKSKGKNRFEYFEEKQAA"
     misc_feature    complement(222780..223280)
                     /locus_tag="BSVBI22_B0231"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    complement(222306..222779)
                     /locus_tag="BSVBI22_B0231"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(222537..222539,222666..222668))
                     /locus_tag="BSVBI22_B0231"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(222534..222545,222549..222551,
                     222615..222617,222627..222629,222639..222644,
                     222651..222653))
                     /locus_tag="BSVBI22_B0231"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(222474..222476,222561..222563))
                     /locus_tag="BSVBI22_B0231"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(223734..224627)
                     /locus_tag="BSVBI22_B0232"
                     /db_xref="GeneID:11686375"
     CDS             complement(223734..224627)
                     /locus_tag="BSVBI22_B0232"
                     /note="similar to GP:15159282; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108248.1"
                     /db_xref="GI:376278215"
                     /db_xref="GeneID:11686375"
                     /translation="MPIYELAALGAATCWALTGLISAWPAGQLGALTFNRIRQVFVTG
                     LLAVYVLATGAWHQMSAENIWPLLLSGFIGIFVGDTLLFATLNRVGPRRSGILFAMNA
                     PMTAILGWFVLGETLSLAAVAGIAITVFGVSLAIFFGKRRTQQHPWESVKGSLWVGIG
                     LGLLAALGQAVGSIIARPVMETGLDPFVGSLLRVGIAACCLTALAQLPLPAVKPRNPL
                     TFKVAAMTALAGFLSLALGMTMLLFALSGGKAGIVSTISATTPVILLPLLWLRTGECP
                     AAGAWIGAFFVVIGMALIFLR"
     misc_feature    complement(223737..224627)
                     /locus_tag="BSVBI22_B0232"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    complement(224217..224588)
                     /locus_tag="BSVBI22_B0232"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    complement(223737..224147)
                     /locus_tag="BSVBI22_B0232"
                     /note="EamA-like transporter family; Region: EamA;
                     cl17759"
                     /db_xref="CDD:266818"
     gene            224603..224743
                     /locus_tag="BSVBI22_B0233"
                     /db_xref="GeneID:11686376"
     CDS             224603..224743
                     /locus_tag="BSVBI22_B0233"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108249.1"
                     /db_xref="GI:376278216"
                     /db_xref="GeneID:11686376"
                     /translation="MLPAHKSAWCPYNILSARQRCRLRILPAGLPLLSVCKIAVYFFL
                     VK"
     gene            224867..225544
                     /locus_tag="BSVBI22_B0234"
                     /db_xref="GeneID:11686377"
     CDS             224867..225544
                     /locus_tag="BSVBI22_B0234"
                     /note="similar to GP:15140120; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005108250.1"
                     /db_xref="GI:376278217"
                     /db_xref="GeneID:11686377"
                     /translation="MERKRGSGVRMVYDLLRDEILDLKLAPGSPIDEVQLAERFGMSR
                     TPIREALVRLSSEGLVETLPNRSTMVSNIDFLNMHTFFDALVLMYRVTTRLAAQYHRP
                     EDLRIIHELQAQFTAAVDAQNALGMIATNAAFHAAIADAGRNAYFTGLFNRLLDEGRR
                     IMRLYYQSYDDRLPRRFVEEHEEIIAAIEARDVAQADRLGKIHAEQIVEQVRKLFERK
                     AVLDIEL"
     misc_feature    224867..225523
                     /locus_tag="BSVBI22_B0234"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    224900..225079
                     /locus_tag="BSVBI22_B0234"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(224960..224962,224963..224968,224990..225004,
                     225008..225013,225020..225022,225050..225055,
                     225059..225070)
                     /locus_tag="BSVBI22_B0234"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    225107..225475
                     /locus_tag="BSVBI22_B0234"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            225645..226607
                     /locus_tag="BSVBI22_B0235"
                     /db_xref="GeneID:11686378"
     CDS             225645..226607
                     /locus_tag="BSVBI22_B0235"
                     /note="similar to GP:15140121; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase family protein"
                     /protein_id="YP_005108251.1"
                     /db_xref="GI:376278218"
                     /db_xref="GeneID:11686378"
                     /translation="MKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVV
                     YCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLM
                     VIPRVLSRGSVIAAQKAHFKAILSAAPDLPAVIYNSPYYGFATRADLFFALRAEHPNL
                     VGFKEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPK
                     EVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEY
                     TLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA"
     misc_feature    225669..226460
                     /locus_tag="BSVBI22_B0235"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    order(225678..225680,225774..225776,225783..225791,
                     226050..226052,226134..226136)
                     /locus_tag="BSVBI22_B0235"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    order(225774..225776,225783..225791,226050..226052,
                     226134..226136,226269..226271)
                     /locus_tag="BSVBI22_B0235"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    order(225786..225788,225801..225806,225888..225893,
                     225963..225968,225990..225992,226002..226004)
                     /locus_tag="BSVBI22_B0235"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    226134..226136
                     /locus_tag="BSVBI22_B0235"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            complement(226670..227707)
                     /locus_tag="BSVBI22_B0236"
                     /db_xref="GeneID:11686379"
     CDS             complement(226670..227707)
                     /locus_tag="BSVBI22_B0236"
                     /note="similar to GP:15140123; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="malate/L-lactate dehydrogenase family protein"
                     /protein_id="YP_005108252.1"
                     /db_xref="GI:376278219"
                     /db_xref="GeneID:11686379"
                     /translation="MTDGTNLTIEKLHARVEEIFRKAGLNAIQAGAVARVIVAGERDH
                     CKSHGIYRIEGALRTVKAGKVKPDAVPELVAQEASAIVRVDAKGGFANPAFELGVPVL
                     AERARSHGLAALVINDCTHFSALWPEVEALTEKGLAGLIMCPSYATVAPTGGSKPLLG
                     TNPFAFGWPRRDNPPYVFDFATSVAARGEIELHRRAGKQLPEGWAIDKDGKPTTDPET
                     ALEGAMLPFGGHKGSAISTMIELLAGIMIGDRTSPEVLDFLGTTTLSPVHGELIIAFS
                     PEAFAAGRPGDPFARAEAFFEAIVGQGARLPSQRRFTARAASQSEGITLNKAEIDYLD
                     QLAEKGLDAVS"
     misc_feature    complement(226673..227704)
                     /locus_tag="BSVBI22_B0236"
                     /note="Malate/L-lactate dehydrogenases [Energy production
                     and conversion]; Region: COG2055"
                     /db_xref="CDD:224966"
     gene            complement(227721..227822)
                     /locus_tag="BSVBI22_B0237"
                     /db_xref="GeneID:11686380"
     CDS             complement(227721..227822)
                     /locus_tag="BSVBI22_B0237"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108253.1"
                     /db_xref="GI:376278220"
                     /db_xref="GeneID:11686380"
                     /translation="MLAKEQKRSDAGPEARMISIMPALLKKRPASKQ"
     gene            complement(227826..227924)
                     /locus_tag="BSVBI22_B0238"
                     /db_xref="GeneID:11686381"
     CDS             complement(227826..227924)
                     /locus_tag="BSVBI22_B0238"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108254.1"
                     /db_xref="GI:376278221"
                     /db_xref="GeneID:11686381"
                     /translation="MAYPERYFTAMDEKLSENAEWHFAKPVFSANG"
     gene            227944..229212
                     /locus_tag="BSVBI22_B0239"
                     /db_xref="GeneID:11686382"
     CDS             227944..229212
                     /locus_tag="BSVBI22_B0239"
                     /note="identified by match to PFAM protein family HMM
                     PF03772"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108255.1"
                     /db_xref="GI:376278222"
                     /db_xref="GeneID:11686382"
                     /translation="MLAKALRKFSGDRVALLRDYLSLFSGSAGRLVVSLVYFIALANT
                     LPTSDFGIFATASGTGVMLSRLVSLGFNSPLYRIATVKPRLLGVYTAGYLAALVVSLP
                     LLFLASWLVYLAFFDRDVAFLPFALVVIVAEALFWRSMEIIIIVNNGLNRFLIGAGLV
                     IFGTMTRAVAAVLFMWMTTTHDIAHWAWWYAGANAAGLIVALWFYPRIRLRFKPGLYM
                     RRISDSIAVMGAELLFYLQSELDKLLVLGIGGPATAGLYAIIMRLVDLTALPIRSFNM
                     MLVQKLMRTPDMLSSLRIRTGLEVAVFAISVAGLGALAIFLWIFPNALGSNVAPIVGL
                     LPLVLLVPGFRNLIEYQTEILYARGQSGLRTLNLALMTGAKALLVWQLLSHFGESRDW
                     LLGLNVVFAGLYILSLVFTYTSIRRPAKRI"
     misc_feature    227980..229194
                     /locus_tag="BSVBI22_B0239"
                     /note="Membrane protein involved in the export of
                     O-antigen and teichoic acid [General function prediction
                     only]; Region: RfbX; COG2244"
                     /db_xref="CDD:225153"
     misc_feature    228037..228795
                     /locus_tag="BSVBI22_B0239"
                     /note="Polysaccharide biosynthesis protein; Region:
                     Polysacc_synt_3; pfam13440"
                     /db_xref="CDD:257765"
     gene            complement(229220..229693)
                     /locus_tag="BSVBI22_B0240"
                     /db_xref="GeneID:11686383"
     CDS             complement(229220..229693)
                     /locus_tag="BSVBI22_B0240"
                     /note="similar to GP:6978955; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108256.1"
                     /db_xref="GI:376278223"
                     /db_xref="GeneID:11686383"
                     /translation="MENLSELHAADINRLEAHHQTLLDLCLQLEEAAEDVQTPGSPQD
                     YIKLADAIPRLLDETHELEETVLFPDFHRQSGSYFAGVVIERLKAEHRCDRLSAEELS
                     RTLRAVANGQCKLAPDTVAYMVRGFLESLRRHILSEKLMLEALLAAKSEQREVFG"
     misc_feature    complement(229256..229660)
                     /locus_tag="BSVBI22_B0240"
                     /note="Hemerythrin HHE cation binding domain; Region:
                     Hemerythrin; pfam01814"
                     /db_xref="CDD:250887"
     gene            complement(229750..229905)
                     /locus_tag="BSVBI22_B0241"
                     /db_xref="GeneID:11686384"
     CDS             complement(229750..229905)
                     /locus_tag="BSVBI22_B0241"
                     /note="similar to GP:6978956, and GP:6978956; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108257.1"
                     /db_xref="GI:376278224"
                     /db_xref="GeneID:11686384"
                     /translation="MTDAQIGLLVAAPAIICFSLILYRMGALQGAGTISAVTASVIIA
                     AVLFFGQ"
     gene            230009..230578
                     /locus_tag="BSVBI22_B0242"
                     /db_xref="GeneID:11686385"
     CDS             230009..230578
                     /locus_tag="BSVBI22_B0242"
                     /note="similar to GP:6978957; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, subunit III"
                     /protein_id="YP_005108258.1"
                     /db_xref="GI:376278225"
                     /db_xref="GeneID:11686385"
                     /translation="MLRSEDNAIAALAAGEGQEEEDSLLLWVLVWSELITFAILLVAF
                     MVMSVVDPQGVGLLRAHLSPGLAATNTVILLMSGWQAALAVRRRNNPKAVRRPLLFAA
                     LFGFCFVAVKLLEYSHEARFAGDEAAGSFFELYFLITGFHLLHVLFGSVILMLVAWRP
                     SRSNVLLIATLWHAIDLVWLVMFPILYLA"
     misc_feature    230060..230575
                     /locus_tag="BSVBI22_B0242"
                     /note="Heme-copper oxidase subunit III.  Heme-copper
                     oxidases are transmembrane protein complexes in the
                     respiratory chains of prokaryotes and mitochondria which
                     couple the reduction of molecular oxygen to water to,
                     proton pumping across the membrane. The...; Region:
                     Heme_Cu_Oxidase_III_like; cl00211"
                     /db_xref="CDD:260264"
     misc_feature    order(230066..230071,230111..230113,230123..230128,
                     230393..230398,230405..230407,230417..230419)
                     /locus_tag="BSVBI22_B0242"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238227"
     gene            230586..230864
                     /gene="norF"
                     /locus_tag="BSVBI22_B0243"
                     /db_xref="GeneID:11686386"
     CDS             230586..230864
                     /gene="norF"
                     /locus_tag="BSVBI22_B0243"
                     /note="similar to GP:6978958, and GP:6978958; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="norF protein"
                     /protein_id="YP_005108259.1"
                     /db_xref="GI:376278226"
                     /db_xref="GeneID:11686386"
                     /translation="MTDTTVHGSLNRTLAILLVLAVSGALIASFLGTYLAGIVVVLIL
                     AYAKACFVILDFMEMRGTRGALRPALLTWPAILLTLALARSVAVSLLG"
     gene            231024..231476
                     /gene="norC"
                     /locus_tag="BSVBI22_B0244"
                     /db_xref="GeneID:11686387"
     CDS             231024..231476
                     /gene="norC"
                     /locus_tag="BSVBI22_B0244"
                     /note="similar to GP:6978959, and SP:Q51662; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="nitric-oxide reductase, small subunit"
                     /protein_id="YP_005108260.1"
                     /db_xref="GI:376278227"
                     /db_xref="GeneID:11686387"
                     /translation="MAERLTKTGARNVFYGGSIFFFAIFVGLTAHSHYYMKTTSTDES
                     TLTSGVARGKHVWEKNSCINCHTLLGEGAYFAPELGNVWKRWAGDTDPESARETLKAW
                     MAAQPSGIEGRRQMPQFSLSDQELDDLADFLEWTSRIKTQNWPPNDAG"
     misc_feature    231171..231422
                     /gene="norC"
                     /locus_tag="BSVBI22_B0244"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            231502..232851
                     /gene="norB"
                     /locus_tag="BSVBI22_B0245"
                     /db_xref="GeneID:11686388"
     CDS             231502..232851
                     /gene="norB"
                     /locus_tag="BSVBI22_B0245"
                     /note="similar to GP:6978960, and SP:P98008; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="nitric-oxide reductase, large subunit"
                     /protein_id="YP_005108261.1"
                     /db_xref="GI:376278228"
                     /db_xref="GeneID:11686388"
                     /translation="MKYQSQKVAMLYFYGALALFVAQVLFGVVAGTIYVLPNTLSVLL
                     PFNIVRMIHTNALIVWLLMGFMGSTYYLLPEETETELYSTKLAVIQFWLFFVAAGVAV
                     AGYLFHIHEGREFLEQPFFIKVGIVVVCLIFLFNITLTALKGRKTTVQHSLLFGLWGL
                     ALFFLFAFYNPINLALDKLYWWYVIHLWVEGVWELIMASILAFLMIKLNGIDREVVEK
                     WLYVIVGLALFSGILGTGHHYYWIGAPGYWQWIGSLFSTLEVAPFFTMVMFTFVMTWR
                     AGRKHPNRAALLWSIGCSVMAFFGAGVWGFLHTLSSVNYYTHGTQLTAAHGHLAFFGA
                     YVMLNLAVMAYAIPEIRGRAPYNQWLSMVSFWMMCTAMSVMTFALTFAGVVQVHLQRV
                     LGENFMEVQDQLALFYWIRLGSGVVVVISALMFVWAVLVPGRQRSQKLSGFAQQPAE"
     misc_feature    <231502..232824
                     /gene="norB"
                     /locus_tag="BSVBI22_B0245"
                     /note="Nitric oxide reductase large subunit [Inorganic ion
                     transport and metabolism]; Region: NorB; COG3256"
                     /db_xref="CDD:225795"
     misc_feature    231514..232755
                     /gene="norB"
                     /locus_tag="BSVBI22_B0245"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:249600"
     misc_feature    order(231529..231534,231544..231546,231703..231705,
                     232462..232464,232483..232485,232492..232497,
                     232738..232740)
                     /gene="norB"
                     /locus_tag="BSVBI22_B0245"
                     /note="Low-spin heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238461"
     misc_feature    order(231589..231591,231598..231600,231622..231624,
                     231799..231804,231820..231822,231832..231834)
                     /gene="norB"
                     /locus_tag="BSVBI22_B0245"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238461"
     misc_feature    order(232057..232059,232099..232101,232210..232215,
                     232288..232290,232297..232299)
                     /gene="norB"
                     /locus_tag="BSVBI22_B0245"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238461"
     misc_feature    order(232210..232215,232477..232479)
                     /gene="norB"
                     /locus_tag="BSVBI22_B0245"
                     /note="Binuclear center (active site) [active]"
                     /db_xref="CDD:238461"
     misc_feature    order(232213..232215,232453..232458)
                     /gene="norB"
                     /locus_tag="BSVBI22_B0245"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238461"
     gene            232942..233754
                     /locus_tag="BSVBI22_B0246"
                     /db_xref="GeneID:11686389"
     CDS             232942..233754
                     /locus_tag="BSVBI22_B0246"
                     /note="similar to GP:6978961, GB:U10072, SP:P98177, and
                     PID:501087; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="CbbQ/NirQ/NorQ/GpvN family protein"
                     /protein_id="YP_005108262.1"
                     /db_xref="GI:376278229"
                     /db_xref="GeneID:11686389"
                     /translation="MTSLLKNVETASPAIPAYSPSGNECALFEMAWQRKLPLLLKGPT
                     GCGKTRFVSHMVARMGLPLSTVSCHDDLAAADLTGRYLLKGGDTIWMDGPLTRAVRDG
                     GICYLDEIVEARKDVAVVLYPLTDDRRILPLERTGELLDAPDSFMLVVSYNPGYQNLL
                     KSLKPSTRQRFVAIEFDFLPKEQEIAVVSEESGLAESRVAPLVDLAHRLRALKGHDLE
                     EGVSTRLLVYCAALIEAGMSQREAARAAMIEPLTDEPDVKAALLEIADAMLK"
     misc_feature    232942..233748
                     /locus_tag="BSVBI22_B0246"
                     /note="MoxR-like ATPases [General function prediction
                     only]; Region: COG0714"
                     /db_xref="CDD:223786"
     misc_feature    233017..>233325
                     /locus_tag="BSVBI22_B0246"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    233065..233088
                     /locus_tag="BSVBI22_B0246"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(233068..233088,233263..233265)
                     /locus_tag="BSVBI22_B0246"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    233251..233268
                     /locus_tag="BSVBI22_B0246"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    233491..233748
                     /locus_tag="BSVBI22_B0246"
                     /note="CbbQ/NirQ/NorQ C-terminal; Region: CbbQ_C;
                     pfam08406"
                     /db_xref="CDD:149460"
     gene            233766..235667
                     /gene="norD"
                     /locus_tag="BSVBI22_B0247"
                     /db_xref="GeneID:11686390"
     CDS             233766..235667
                     /gene="norD"
                     /locus_tag="BSVBI22_B0247"
                     /note="similar to GP:6978962, GB:K00396, GB:M10065,
                     GB:M12529, GB:X00199, GB:Z70760, GB:X92000, SP:P02649,
                     PID:1263123, PID:178849, PID:178851, PID:178853,
                     PID:579590, and PID:929610; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="norD protein"
                     /protein_id="YP_005108263.1"
                     /db_xref="GI:376278230"
                     /db_xref="GeneID:11686390"
                     /translation="MLDFLELEETVGRAWHRLIGKTGSWPQYPDHAVQLVDIRQRLAI
                     CFRGFGGDIAVQIAPARARTSTHRLGLRRRMALGEEKLAQPLRDEATLMLPPEIALFP
                     DRQLNYDLYVWLVGYMAVMPMDADALPEDALRRDLAALQIAEQTVERACRAFPGLKPR
                     YKRLCAAILAERPKRPLHRLEQQVEARILSLLKQGADLPDDALPTIFPHRGPAGYLPA
                     LPVPLWPGLMKREEVAPRTGEDEPVRNSQSEGAETGRQIAQRERQDPRHADRSPFILN
                     RFEKILAMAEMVSVDRPSDDSDEQNAKSADELDDLTLGERKGRPAARFRFDLDLPPEA
                     VDRSLLTAELTYPEWDYRKGAYLPDHCAVLAAPVQEKEKPLELDAAAQSLVRRVRRQF
                     EILRPGREVLRAQLDGTDLDLDAVVRSRCDLAAGGQGSDRVHLMSRPQANDLAVTLLV
                     DVSLSTDAWVDNRRVLDVEKEALLVLANGIAACGDRCSILTFTSRRRSWVRVETVKDF
                     DESFGPTVEHRIAALKPGFYTRMGAAMRHATAKLAEQPNRKKLLLLLTDGKPNDVDHY
                     EGRFALEDSRRAAGEARAKGVNVFAVTVDREASAHLPALFGRGGYALVANLAKLPVAL
                     PAIYRMLAG"
     misc_feature    233766..235664
                     /gene="norD"
                     /locus_tag="BSVBI22_B0247"
                     /note="Nitric oxide reductase activation protein
                     [Inorganic ion transport and metabolism]; Region: NorD;
                     COG4548"
                     /db_xref="CDD:226921"
     misc_feature    235095..235607
                     /gene="norD"
                     /locus_tag="BSVBI22_B0247"
                     /note="norD type: Denitrifying bacteria contain both
                     membrane bound and periplasmic nitrate reductases.
                     Denitrification plays a major role  in completing the
                     nitrogen cycle by converting nitrate or nitrite to
                     nitrogen gas. The pathway for microbial...; Region:
                     vWA_norD_type; cd01454"
                     /db_xref="CDD:238731"
     misc_feature    order(235116..235118,235122..235124,235128..235130,
                     235350..235352,235434..235436)
                     /gene="norD"
                     /locus_tag="BSVBI22_B0247"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238731"
     gene            235847..236131
                     /locus_tag="BSVBI22_B0248"
                     /db_xref="GeneID:11686391"
     CDS             235847..236131
                     /locus_tag="BSVBI22_B0248"
                     /note="similar to GP:14523804; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108264.1"
                     /db_xref="GI:376278231"
                     /db_xref="GeneID:11686391"
                     /translation="MSSQPVSTIPVIDVRTIPPITRHATIFSMIDTLEPGEVLEIVND
                     HDPVPLRNQLEHRNPGAFSWVYKETGPLWRVEIGRRKVHASDHECTCGNH"
     misc_feature    235880..236128
                     /locus_tag="BSVBI22_B0248"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG4309"
                     /db_xref="CDD:226759"
     gene            236167..237534
                     /locus_tag="BSVBI22_B0249"
                     /db_xref="GeneID:11686392"
     CDS             236167..237534
                     /locus_tag="BSVBI22_B0249"
                     /note="similar to GP:14523803, and GP:14523803; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108265.1"
                     /db_xref="GI:376278232"
                     /db_xref="GeneID:11686392"
                     /translation="MFGATLSRWTLSYFASSLAFLIAGVGLMVEGFGYPFHGIRAPET
                     LILVHIIAIGWLALLMGGALLQFVPVLVARPLWGSGGGLPALLLLLAGLVGLLCGFAG
                     MAGFGEPPAWLLPFSGLLLIAGFSILVLMLAMTIWQARPIALPARFVAVGLACLLAVA
                     FLGGIFTLAFSGMSENDMLLNIAGLSAPIHAALGLGGWMTFTAMGVSYRLLTMFLLSP
                     DDERRTTRLVWWAGAAALTVLGAGVAAFAFGQDRADVVLLAALLPGVASVVLYAFDMR
                     AVYRQRKRKAIELNSAASIPAFAAMVLAILLALALPWTGPSDPMIGALVYLFVFGWLT
                     GLSLAQLYKIVPFLTWLECYGPVMGRVPTPRVQDIVSEKPARRWFCIYYTGVALATLA
                     LGAGYPVAFQLASALNLIAILALTVHFFRARRLMDVPEAVRLPNGVAIPHLIYAGGPV
                     PRRSK"
     gene            237531..238058
                     /locus_tag="BSVBI22_B0250"
                     /db_xref="GeneID:11686393"
     CDS             237531..238058
                     /locus_tag="BSVBI22_B0250"
                     /note="similar to GP:14523802, and GP:14523802; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108266.1"
                     /db_xref="GI:376278233"
                     /db_xref="GeneID:11686393"
                     /translation="MTVQELAPYELDVRPLLKSGVEPFQAIMGAVDSLAPGQGLLLIA
                     PFKPVPLFAVLERKGFEAKPEPIGEGDWQVLFSPVVEPLAEVQLSKNVGSPDIWPDPL
                     QYLDCTDMDPPEPLVRILAEVENMSAGEVLFALLHREPLFLFPELENRGHQWVGNFDE
                     TGKTYRIMIRVGGGG"
     misc_feature    237558..237764
                     /locus_tag="BSVBI22_B0250"
                     /note="Uncharacterized conserved protein (DUF2249);
                     Region: DUF2249; pfam10006"
                     /db_xref="CDD:255691"
     misc_feature    237843..238040
                     /locus_tag="BSVBI22_B0250"
                     /note="Uncharacterized conserved protein (DUF2249);
                     Region: DUF2249; pfam10006"
                     /db_xref="CDD:255691"
     gene            238065..238391
                     /locus_tag="BSVBI22_B0251"
                     /db_xref="GeneID:11686394"
     CDS             238065..238391
                     /locus_tag="BSVBI22_B0251"
                     /note="similar to GP:14523801, and GP:14523801; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108267.1"
                     /db_xref="GI:376278234"
                     /db_xref="GeneID:11686394"
                     /translation="MEPKQLERIKACVREALRAVQDPELAVNLVDLGMIYAVEISDDG
                     MVHVKMTTTTRGCPAAGFLTQAVQACIEEIEGVTGARVELTYEPEWKPEMAIPEVQAI
                     FAAPSF"
     misc_feature    238065..238373
                     /locus_tag="BSVBI22_B0251"
                     /note="Predicted metal-sulfur cluster biosynthetic enzyme
                     [General function prediction only]; Region: PaaD; COG2151"
                     /db_xref="CDD:225062"
     gene            238515..239690
                     /locus_tag="BSVBI22_B0252"
                     /db_xref="GeneID:11686395"
     CDS             238515..239690
                     /locus_tag="BSVBI22_B0252"
                     /note="similar to GP:15156967, and GP:15156967; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108268.1"
                     /db_xref="GI:376278235"
                     /db_xref="GeneID:11686395"
                     /translation="MQHPVRRRAIFFIGGYDPKTPEAFFNRLLREIARFGALWDVKTQ
                     VSPVSENASSEIGSVTIETRSAEGWSTQTDFNFLVLDKIVLADFARPLPVRLWKYLVA
                     FADFVLSGTAFRFFARAWRFALYFLYPFLALVLFALAGWLAARLTAPWLGLAGWIVGL
                     FVFFLALATLGNRWSTNHLMDLWSFSRNFMRGQRPDAEALMQRFAEEIDRRVAAGHYD
                     EVIVIAHSTGGMLMLDVAARCLAADRAFATRAPNVVLLTLGSTALKAGYHPAAGKFRQ
                     DVQRLVDEPALEWCEMQCLTDVINFYKTDPVAEMKLKRPADRAFPLVRQVRIKDMLQP
                     DIYRRIKRNFFRVHYQYVFGNTKAYWYDFFQICCGPASLSERMRDMLVGTAKESAQQ"
     gene            239687..240271
                     /locus_tag="BSVBI22_B0253"
                     /db_xref="GeneID:11686396"
     CDS             239687..240271
                     /locus_tag="BSVBI22_B0253"
                     /note="similar to GP:15074522, and GP:15074522; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108269.1"
                     /db_xref="GI:376278236"
                     /db_xref="GeneID:11686396"
                     /translation="MMPLIALIVWSIGLVAWVVIRIPHQRRARKIKVARTARTLADRL
                     ALGAATVGLSVVPLVYVATGFPKFADYTFQPWMGWIGTLIELLFLWLFYASHKQLGKN
                     WSVSLDIRREHKLVTDGLYRYVRHPMYLSFWLWAIAQFFLLPNWIAGLAGLLGVAILY
                     FYRIEHEEAMMREAFGSAYDEYSSRIGRIIPKPW"
     misc_feature    239708..240268
                     /locus_tag="BSVBI22_B0253"
                     /note="Putative protein-S-isoprenylcysteine
                     methyltransferase [Posttranslational modification, protein
                     turnover, chaperones]; Region: STE14; COG2020"
                     /db_xref="CDD:224931"
     gene            240222..240920
                     /locus_tag="BSVBI22_B0254"
                     /db_xref="GeneID:11686397"
     CDS             240222..240920
                     /locus_tag="BSVBI22_B0254"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01409"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108270.1"
                     /db_xref="GI:376278237"
                     /db_xref="GeneID:11686397"
                     /translation="MTNIPAASAVSFPNPGKSAAAETDRMNRRSPFLGLLAGAALVLP
                     SLPAEAKTQQAAMPPNATSPHQADVYLLRGFADIFSTGIDEIGAELQAAGVNAHVQGH
                     AAWRLVLNRIVADQQKNGHLPVVLIGHSLGANAAIYIAEELERRGIAVDYMATFAATG
                     PDPLPGNVRRVVNFYFKQHGWGLPLVPGPRSHGHLENRDFSNAKDVGHFNIEKQRPLQ
                     AEVVRDVLAVVNAD"
     misc_feature    240318..240917
                     /locus_tag="BSVBI22_B0254"
                     /note="Thioesterase domains of type I polyketide synthases
                     or non-ribosomal peptide synthetases [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: COG3319"
                     /db_xref="CDD:225856"
     gene            240996..241145
                     /locus_tag="BSVBI22_B0255"
                     /db_xref="GeneID:11686398"
     CDS             240996..241145
                     /locus_tag="BSVBI22_B0255"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108271.1"
                     /db_xref="GI:376278238"
                     /db_xref="GeneID:11686398"
                     /translation="MKNHNFYWAIPLIEERICAARRLKNSGAALVLCLNADNREDHAE
                     YNLTI"
     gene            241276..242406
                     /locus_tag="BSVBI22_B0256"
                     /db_xref="GeneID:11686399"
     CDS             241276..242406
                     /locus_tag="BSVBI22_B0256"
                     /note="similar to GB:J05016, SP:P13667, PID:181508,
                     GB:J05016, SP:P13667, and PID:181508; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="copper-containing nitrite reductase"
                     /protein_id="YP_005108272.1"
                     /db_xref="GI:376278239"
                     /db_xref="GeneID:11686399"
                     /translation="MADQIQVNRRTILAGAALAGALGPVLSATSAWGQGTMRKASAEE
                     IAALPRQKVELVDPPFVHAHTQVAEGGPKVVQFTMVIEEKKIVIDDAGTEVHAMTFNG
                     TVPGPLVVVHQDDYLELTLINPETNTLLHNIDFHAATGALGGGGLTEINPGEKTVLRF
                     KATKPGVFVYHCAPPGMVPWHVVSGMNGAVMVLPREGLHDGKGNKLTYDKVYYVGEQD
                     FYVPRDENGNYKTYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKALTAKSGEK
                     VLIIHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAAAAFYTFRQP
                     GIYAYVNHNLIEAFELGAVAHFKVTGEWNDDLMTSILAPSGM"
     misc_feature    241417..242397
                     /locus_tag="BSVBI22_B0256"
                     /note="nitrite reductase, copper-containing; Region:
                     Cu_nitrite_red; TIGR02376"
                     /db_xref="CDD:131429"
     misc_feature    241495..241860
                     /locus_tag="BSVBI22_B0256"
                     /note="Cupredoxin domain 1 of Copper-containing nitrite
                     reductase; Region: CuRO_1_CuNIR; cd11020"
                     /db_xref="CDD:259906"
     misc_feature    order(241666..241668,241789..241791,241816..241818,
                     241831..241833)
                     /locus_tag="BSVBI22_B0256"
                     /note="Type 1 (T1) Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259906"
     misc_feature    order(241675..241677,241681..241701,241747..241758,
                     241762..241767,241774..241782,241786..241788,
                     241819..241821)
                     /locus_tag="BSVBI22_B0256"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259906"
     misc_feature    order(241681..241683,241786..241788)
                     /locus_tag="BSVBI22_B0256"
                     /note="Type II Cu binding site [ion binding]; other site"
                     /db_xref="CDD:259906"
     misc_feature    241897..242352
                     /locus_tag="BSVBI22_B0256"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     gene            242539..243459
                     /locus_tag="BSVBI22_B0257"
                     /db_xref="GeneID:11686400"
     CDS             242539..243459
                     /locus_tag="BSVBI22_B0257"
                     /note="similar to GP:14523796, and GP:2773329; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="NirV protein, putative"
                     /protein_id="YP_005108273.1"
                     /db_xref="GI:376278240"
                     /db_xref="GeneID:11686400"
                     /translation="MAKVAGKQRLRDWAVAVPAVLLAVASGLFVVDATGGTERSKTEM
                     KVALPQTVTIKPRTMTYRADGDFQKNNYPVDAPLTTRKLRRSFEIMKYQVTGAEYRRC
                     VDDGACQPPEDLPHNRNWASADKPVVGVSYTDAEDYAAWLSKKTGSVWHLPTDERWAF
                     AAGTRFADDAVGIEGDESKNPALRWLRDYEQQSARKQDRNQTVRPLGAFGENEYGLAD
                     IGGNVWEWTQTCHRRVNIDAYGKVASETTVCGVYVVNGKHRAAMSSFIRNPKTGGCSV
                     GVPPDNLGFRLVRDGRWYAPVLMRLKDFTS"
     misc_feature    242563..243426
                     /locus_tag="BSVBI22_B0257"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1262"
                     /db_xref="CDD:224182"
     misc_feature    242680..243405
                     /locus_tag="BSVBI22_B0257"
                     /note="Sulfatase-modifying factor enzyme 1; Region:
                     FGE-sulfatase; cl19582"
                     /db_xref="CDD:267935"
     gene            243560..244255
                     /locus_tag="BSVBI22_B0258"
                     /db_xref="GeneID:11686401"
     CDS             243560..244255
                     /locus_tag="BSVBI22_B0258"
                     /note="similar to GP:6978954; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/FNR family transcriptional regulator"
                     /protein_id="YP_005108274.1"
                     /db_xref="GI:376278241"
                     /db_xref="GeneID:11686401"
                     /translation="MAMIDRGLVRKLSLFAKMRDDELDRLVSYATSRRVPQGESIFEQ
                     GDEASCFYLLLHGRLKVNQVTPDGQQIIVRMVHPGDLFGFARALQRNDYPGTATAVME
                     SIVLAWPTELWDYFVEQNPGLAMNAIQTIGKRLEEAHTRIREMSTEEVERRVAHAVLR
                     LSRQAGKKEETGIRIDFPISRQDIAEMTGTTLHTVSRILSNWETKGLVQGGRQKLLVL
                     DSAGLRRLAEGED"
     misc_feature    243581..244216
                     /locus_tag="BSVBI22_B0258"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    243599..243934
                     /locus_tag="BSVBI22_B0258"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    order(243806..243811,243836..243844)
                     /locus_tag="BSVBI22_B0258"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    order(243902..243910,243920..243928)
                     /locus_tag="BSVBI22_B0258"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    244007..244216
                     /locus_tag="BSVBI22_B0258"
                     /note="helix_turn_helix, cAMP Regulatory protein
                     C-terminus; DNA binding domain of prokaryotic regulatory
                     proteins belonging to the catabolite activator protein
                     family; Region: HTH_CRP; cd00092"
                     /db_xref="CDD:238044"
     misc_feature    244016..244021
                     /locus_tag="BSVBI22_B0258"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    order(244091..244093,244097..244105,244130..244132)
                     /locus_tag="BSVBI22_B0258"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    244130..244150
                     /locus_tag="BSVBI22_B0258"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    order(244133..244138,244148..244150)
                     /locus_tag="BSVBI22_B0258"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    244133..244138
                     /locus_tag="BSVBI22_B0258"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            244338..245393
                     /locus_tag="BSVBI22_B0259"
                     /db_xref="GeneID:11686402"
     CDS             244338..245393
                     /locus_tag="BSVBI22_B0259"
                     /note="similar to GP:15140338; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family sugar-binding transcriptional
                     regulator"
                     /protein_id="YP_005108275.1"
                     /db_xref="GI:376278242"
                     /db_xref="GeneID:11686402"
                     /translation="MHISRKKATIYDLSVLSGSSPSTVSAVLNGTWRKRRISQATAEA
                     ILQLADQHAYTANRQAQGLRHSRSGLVGLLLPLHDNRFFSAMAQIFEAHVRARSLCPV
                     MVSASRDPEEERETAETLISYAIDELFICGATDPDGLHELCEKAALPHVNIDLPGSRA
                     PSVTTDNFAGGKMLTAAIIEYFGEEAPLQPEDLCLFGGRNDESTRQRICGFHQVKQTV
                     LGADPEGCVFKTGYSPANTLVVLNDYRARHGRLPRGLFVNSSINLEGLLRFMAEHPGE
                     PLNDIVIGCYDYDPFASFLPFPVISILQDVEGMIAKAFDLMERRVTEPELHLIMPKLI
                     APRSAITGPLDSLKDIK"
     misc_feature    244359..245351
                     /locus_tag="BSVBI22_B0259"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    244368..244529
                     /locus_tag="BSVBI22_B0259"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(244368..244370,244392..244406,244410..244415,
                     244422..244424,244446..244451,244458..244460,
                     244497..244499,244506..244508,244515..244520,
                     244524..244529)
                     /locus_tag="BSVBI22_B0259"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    244497..244526
                     /locus_tag="BSVBI22_B0259"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    244545..245339
                     /locus_tag="BSVBI22_B0259"
                     /note="Ligand binding domain of DNA transcription
                     repressor specific for fructose (FruR) and its close
                     homologs; Region: PBP1_FruR; cd06274"
                     /db_xref="CDD:107269"
     misc_feature    order(244569..244571,244599..244604,244608..244613,
                     244620..244622,244635..244637,244644..244646,
                     244650..244652,244704..244706,245127..245129,
                     245217..245219,245223..245225)
                     /locus_tag="BSVBI22_B0259"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107269"
     misc_feature    order(244581..244583,244593..244595,244791..244796,
                     244821..244832,244956..244958,245112..245114,
                     245196..245198)
                     /locus_tag="BSVBI22_B0259"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107269"
     gene            complement(245574..245795)
                     /locus_tag="BSVBI22_B0260"
                     /db_xref="GeneID:11686403"
     CDS             complement(245574..245795)
                     /locus_tag="BSVBI22_B0260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108276.1"
                     /db_xref="GI:376278243"
                     /db_xref="GeneID:11686403"
                     /translation="MTLLLMIVYSCAGMRFKKFVNEPAPQVLKRATAKEAVIPSTPLR
                     ILRFIVPPLPLTAFAILRHSIQWAGGDHN"
     gene            245794..246846
                     /locus_tag="BSVBI22_B0261"
                     /db_xref="GeneID:11686404"
     CDS             245794..246846
                     /locus_tag="BSVBI22_B0261"
                     /note="similar to GP:2661681; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter, periplasmic sugar-binding
                     protein, putative"
                     /protein_id="YP_005108277.1"
                     /db_xref="GI:376278244"
                     /db_xref="GeneID:11686404"
                     /translation="MKGLKMTGALAGVLMMAATTAHAEVKDAVVGFLMPDQASTRYEE
                     RDYPGFAAQMKTLCESCKVLYLNADGDATKQQQQFNSVISQGAKVIVLDAVDTAAAAS
                     LVKLAQSQGIKVIAYDRPIPDAKSDFYVSFDNEAIGKSIAESLVKHLKDKGVPTDKGG
                     VLQINGSPTDAAAGLIKNGIHAGLKDSGYKTLAEYDTPEWAPSKAQQWASGQITRFGD
                     QIVGVVAANDGTAGGAIAAMKAAGVDPLPPVTGNDATIAALQLIISGDQYNTINKPSE
                     IVASEAARVAVQLLGDKAPKAETTLYNTPSKLFVPVVVTAENLKAEIIDKKVVPAATL
                     CVDRYAEGCKKLGITN"
     misc_feature    245809..246804
                     /locus_tag="BSVBI22_B0261"
                     /note="ABC-type xylose transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     XylF; COG4213"
                     /db_xref="CDD:226668"
     misc_feature    245878..246735
                     /locus_tag="BSVBI22_B0261"
                     /note="Periplasmic xylose-binding component of the
                     ABC-type transport systems that belong to a family of
                     pentose/hexose sugar-binding proteins of the type I
                     periplasmic binding protein (PBP1) superfamily; Region:
                     PBP1_ABC_xylose_binding; cd01538"
                     /db_xref="CDD:107251"
     misc_feature    order(245917..245919,246145..246147,246319..246321,
                     246550..246552,246610..246612)
                     /locus_tag="BSVBI22_B0261"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107251"
     gene            247151..248011
                     /locus_tag="BSVBI22_B0262"
                     /db_xref="GeneID:11686405"
     CDS             247151..248011
                     /locus_tag="BSVBI22_B0262"
                     /note="similar to GP:2661682, and GP:12659326; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter, ATP-binding protein,
                     putative"
                     /protein_id="YP_005108278.1"
                     /db_xref="GI:376278245"
                     /db_xref="GeneID:11686405"
                     /translation="MRHILLYARESEIMSQDHKAAATSSQPVLRLSGISKNFGAVSAL
                     TDIDLEVFPGEVVALVGDNGAGKSTLVKTLAGVHQPTSGTIEFNGEKVVLSSPGVALD
                     LGIATVFQDLALCENLDVVANIFLGREISPYRLDEVSMEIKAWKLLNELSARIPSVRE
                     PVASLSGGQRQTVAISRSLLLDPKLIMLDEPTAALGVAQTAEVLDLIERVRDRGVIMI
                     SHNMEDVRAVADRIVVLRLGCNNGIFYPDSSNEELVAAITGATSNSVSRRAERRLAQH
                     DNAHGRGEVR"
     misc_feature    247232..247864
                     /locus_tag="BSVBI22_B0262"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    247235..247864
                     /locus_tag="BSVBI22_B0262"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    247331..247354
                     /locus_tag="BSVBI22_B0262"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(247340..247345,247349..247357,247478..247480,
                     247715..247720,247808..247810)
                     /locus_tag="BSVBI22_B0262"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    247469..247480
                     /locus_tag="BSVBI22_B0262"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    247643..247672
                     /locus_tag="BSVBI22_B0262"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    247703..247720
                     /locus_tag="BSVBI22_B0262"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    247727..247738
                     /locus_tag="BSVBI22_B0262"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    247796..247816
                     /locus_tag="BSVBI22_B0262"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     gene            248008..249246
                     /locus_tag="BSVBI22_B0263"
                     /db_xref="GeneID:11686406"
     CDS             248008..249246
                     /locus_tag="BSVBI22_B0263"
                     /note="similar to GP:2661683, and GP:2661683; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter, permease protein"
                     /protein_id="YP_005108279.1"
                     /db_xref="GI:376278246"
                     /db_xref="GeneID:11686406"
                     /translation="MNDINTLLDRQDVRVRHDKGVSGAIRTFIDRVKSGDLGSLPVIV
                     GLLIIWTVFQTLNPVFLSSNNLVNLLFDCSTIGVISLGIVCVLMLGEIDLSVGSISGL
                     SSAIIGVLWVNNGWPVGVAIIAALCAGALAGFLYALLYNRFSMPSFISTLAGLLAALG
                     LQLYLLGNTGSINLPYGSWLVSFGQLLVMPRPLSYALALVAGLAIFFTGFRAAQRRRT
                     AGLSAPSAAGIALKALVITLIIGCGVFYLNQSRGVPWMFALFVALVIAMNYALTRTRW
                     GRCVQAVGGNREAARRAGINVNFIYVSAFMACSTLAAAGGIMAAARLASSSQQAGTGD
                     VNLNAIAAAVIGGTSLFGGRGSAWSALLGIIVIQSIASGLTLLDLSSSLRYMITGAVL
                     AIAVIVDSLARRSRQSHGRA"
     misc_feature    248227..249204
                     /locus_tag="BSVBI22_B0263"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    248869..248925
                     /locus_tag="BSVBI22_B0263"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            249533..250261
                     /locus_tag="BSVBI22_B0264"
                     /db_xref="GeneID:11686407"
     CDS             249533..250261
                     /locus_tag="BSVBI22_B0264"
                     /note="similar to GP:11036625, GB:M57506, GB:M57502,
                     SP:P22362, PID:184506, and PID:339729; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ribitol dehydrogenase"
                     /protein_id="YP_005108280.1"
                     /db_xref="GI:376278247"
                     /db_xref="GeneID:11686407"
                     /translation="MAQDLNGRVAAVTGAASGIGFECAKHMIGAGITVFLVDRDENAL
                     AEKCVELGDKAKPLVVDLLDPASVATMMPQILEQAGQLDIFHANAGSYIGEPLWEGDP
                     DAWDRMLNLNINAAFRTVHAVLPHMMERKTGDIIMTSSVAGVVPVIWEPIYTASKHAV
                     QAFVHTVRRQVAPHGIRVGGVLPGPVVTALISDWPQAKLDEALAAGSLMEPKEVAESV
                     MFMLTRPRNITIRDLVILPQSLDL"
     misc_feature    249536..250249
                     /locus_tag="BSVBI22_B0264"
                     /note="Short-chain alcohol dehydrogenase of unknown
                     specificity [General function prediction only]; Region:
                     COG4221"
                     /db_xref="CDD:226674"
     misc_feature    249560..250237
                     /locus_tag="BSVBI22_B0264"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(249572..249574,249578..249589,249644..249652,
                     249710..249718,249794..249802,249863..249865,
                     249944..249952,249989..249991,250001..250003,
                     250079..250090,250094..250096)
                     /locus_tag="BSVBI22_B0264"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(249866..249868,249950..249952,249989..249991,
                     250001..250003)
                     /locus_tag="BSVBI22_B0264"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            250274..251878
                     /locus_tag="BSVBI22_B0265"
                     /db_xref="GeneID:11686408"
     CDS             250274..251878
                     /locus_tag="BSVBI22_B0265"
                     /note="similar to GP:15158921; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ribitol kinase"
                     /protein_id="YP_005108281.1"
                     /db_xref="GI:376278248"
                     /db_xref="GeneID:11686408"
                     /translation="MTNYYLGVDVGTGSARAGLFDAGGTILASARRDIAIWREAGGIV
                     EQSSDDIWQAVCESVREVVRVAGVDPAAVAGIGYDATCSLVVLGEGGKPLAVGPSNDR
                     ARNIIVWMDHRAGEQAERINTTKADVLGYVGGAISPEMETPKLLWLKEHKPETFAAAW
                     QFFDLTDFLTWKSCGSLARSACTVTCKWTYLSHEKRWDETYFRAVGLGELADESFVRI
                     GTDVRAGGENLGGLSKQAAAELGLRPGTAIAAGLIDAHAGGIGTVGARGSEGRILSRM
                     AYVFGTSACTMTTTEQPVFVDGVWGPYFSAMVPGLWLNEGGQSAAGAAIDHLIHMHPF
                     AAEAEKAAADQGKGLADSLAAEVEARGGPEKTAMIVGDIHVVPEFLGNRAPFADPDAR
                     AVIAGLDLDTGMDSLAALYLAGLCGLGYGVRQIIEAQRAKGIVTDTIVVSGGAARSNL
                     VRQVLADATGLVVTASTSPEPVLLGSAMLGAVASGAYPDLVTAMQVMSELGARNRPDA
                     RRAKWHDHRFEAFMLLQATARKIRYL"
     misc_feature    250274..251875
                     /locus_tag="BSVBI22_B0265"
                     /note="Ribulose kinase [Energy production and conversion];
                     Region: AraB; COG1069"
                     /db_xref="CDD:223995"
     misc_feature    250283..251869
                     /locus_tag="BSVBI22_B0265"
                     /note="Yersinia Pseudotuberculosis carbohydrate
                     kinase-like subgroup; belongs to the FGGY family of
                     carbohydrate kinases; Region: FGGY_YpCarbK_like; cd07782"
                     /db_xref="CDD:212663"
     misc_feature    order(250286..250288,250292..250294,250298..250300,
                     250319..250321,250325..250327,250331..250333,
                     250343..250348,250358..250360,250493..250510,
                     250661..250672,250691..250693,250814..250819,
                     250826..250828,250832..250834,250847..250849,
                     250946..250948,250955..250957,251012..251014,
                     251018..251020,251042..251044,251051..251056,
                     251156..251158,251168..251194,251420..251422,
                     251432..251434,251687..251695,251699..251704,
                     251708..251725,251759..251764)
                     /locus_tag="BSVBI22_B0265"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212663"
     misc_feature    order(250298..250300,250304..250315,250319..250321,
                     250514..250519,250598..250600,251033..251038,
                     251111..251119,251126..251128,251237..251239,
                     251249..251251,251318..251320,251600..251608,
                     251615..251617,251687..251689)
                     /locus_tag="BSVBI22_B0265"
                     /note="active site"
                     /db_xref="CDD:212663"
     misc_feature    order(250298..250300,250304..250315,250319..250321,
                     251033..251035,251111..251119,251237..251242,
                     251246..251251,251318..251323,251327..251329,
                     251600..251608,251615..251617)
                     /locus_tag="BSVBI22_B0265"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:212663"
     misc_feature    order(250298..250300,250307..250309,251033..251035)
                     /locus_tag="BSVBI22_B0265"
                     /note="catalytic site [active]"
                     /db_xref="CDD:212663"
     misc_feature    order(250298..250300,251033..251035)
                     /locus_tag="BSVBI22_B0265"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212663"
     misc_feature    order(250304..250309,250514..250519,250598..250600,
                     250688..250690,250832..250834,251033..251038,
                     251117..251119,251126..251128,251216..251218)
                     /locus_tag="BSVBI22_B0265"
                     /note="carbohydrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212663"
     misc_feature    order(251240..251242,251252..251254,251261..251263,
                     251387..251389,251393..251395,251408..251413,
                     251447..251464,251486..251494)
                     /locus_tag="BSVBI22_B0265"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212663"
     gene            complement(252010..252675)
                     /locus_tag="BSVBI22_B0266"
                     /db_xref="GeneID:11686409"
     CDS             complement(252010..252675)
                     /locus_tag="BSVBI22_B0266"
                     /note="similar to GP:15158337, and GP:15158337; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108282.1"
                     /db_xref="GI:376278249"
                     /db_xref="GeneID:11686409"
                     /translation="MRRAPAPQPSYRLIPSCFPPIGLFDTVATAADLEAVMELAGWTN
                     DRLVEERLYRLARTEWVFGRTNSSIVMASFLHVAPGGMRFNGSELGAWYSAAKLTTAI
                     IEVAHHMRREAVATGIARLARTFRTYTARLEGSFVDISGEKETMADIYDHTSYAASQR
                     FGEEMRATGETSILFDSLRHEGGINAVAFRPSRILEVTQADHYEITVEASSRRIEARK
                     LPA"
     misc_feature    complement(252109..252429)
                     /locus_tag="BSVBI22_B0266"
                     /note="RES domain; Region: RES; smart00953"
                     /db_xref="CDD:214933"
     gene            complement(252672..253148)
                     /locus_tag="BSVBI22_B0267"
                     /db_xref="GeneID:11686410"
     CDS             complement(252672..253148)
                     /locus_tag="BSVBI22_B0267"
                     /note="similar to SP:P08500, GB:M18576, PID:551957,
                     PID:581499, SP:P08500, GB:M18576, PID:551957, and
                     PID:581499; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108283.1"
                     /db_xref="GI:376278250"
                     /db_xref="GeneID:11686410"
                     /translation="MLDARRFTPASRKRLSAPGLRTFLAIADLWKLDEQQRLLVLGLP
                     SRSTYYNWVKAVREHRDITLDVDVLMRLSAVLGIHQALGVLYPGEAAGRKWLHTPNGA
                     SLFGGQPPLQLVASGTQDGLMAVRRFLDAARGGLYMEPNALDRAFHPYHDEDVVFS"
     misc_feature    complement(252744..252884)
                     /locus_tag="BSVBI22_B0267"
                     /note="Protein of unknown function (DUF2384); Region:
                     DUF2384; pfam09722"
                     /db_xref="CDD:255508"
     gene            complement(253217..255136)
                     /locus_tag="BSVBI22_B0268"
                     /note="This region contains an authentic frame shift and
                     is not the result of a sequencing artifact; ABC
                     transporter, ATP-binding protein, authentic frameshift;
                     identified by match to TIGR protein family HMM TIGR00954"
                     /db_xref="GeneID:11686411"
     gene            255443..255682
                     /locus_tag="BSVBI22_B0269"
                     /db_xref="GeneID:11686412"
     CDS             255443..255682
                     /locus_tag="BSVBI22_B0269"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108284.1"
                     /db_xref="GI:376278251"
                     /db_xref="GeneID:11686412"
                     /translation="MENLVTEGFKASRPRRMVLDASAKLCCWPVEFRFSFQGALECRF
                     LPAGESRLSLRHINMAPIYEGSFRLKDTSAASGGM"
     gene            255695..258058
                     /locus_tag="BSVBI22_B0270"
                     /db_xref="GeneID:11686413"
     CDS             255695..258058
                     /locus_tag="BSVBI22_B0270"
                     /note="similar to GP:14523755; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator NosR, putative"
                     /protein_id="YP_005108285.1"
                     /db_xref="GI:376278252"
                     /db_xref="GeneID:11686413"
                     /translation="MIRAFFGKGRAPSIEGNFSRYPHVNQRFFRPFLFIMGQLGLLLF
                     LAMLAVAPARAADIGKYLPSLDPQVLFQGADSIGEPQGEPPIAPVKKGNELLGYAYLN
                     SDFTNATGYSGKPIRIVVGIDTKGVIRGFKLVDHKEPIVLIGIPEPKVVAALNSLVNS
                     DMTAVAAGQIKPPQVEIVSGATVTVLVMGDSVVRSAVGLIRSGRLGNAPVQAVVADAP
                     RAVNMDLVEEKDWQTLIGDGSVRSLKLTVGEVTQAFRDAKHDEAAANPETADPEDEFI
                     ELYVAPASVPSIGISLLGKEGYERLRKQLKPGQQAILVAGDGAYSFKGSGYVRGGIFD
                     RIELMQDGQGVRFRDKNHTRIGDLMADGAPSLREIALFRVPEGFAFDVTRPWDMQLLV
                     QRGFGARDKANVSYDVGYNLPEQYMLKQPEPAPAKPVATADAPRQPQPVGEATAADIL
                     GENSPLWVKMWEMNRVNVVIAGISILILVAIFFFQDSLVRHPRFFTWLRRGYLLFILV
                     WLGFYNNAQLSVVNVLTFTNSLITGFNWEFFLTSPLIFILWGATAAGLLFWGRGPFCG
                     WLCPFGALQELTNNLAQWLKVPQVKLPWGLHERLWPLKYIIFLGLFALSLYSMALAEL
                     FAEVEPFKTSIILKFARDWPFVIYALTLLAVGLFVERFYCRYLCPLGAALAIPGRIRM
                     FEWLKRWQECGSPCQRCAKECPVEAIHPEGQINVNECIYCMHCQELYHDDQRCPHMIQ
                     VRVKREKFAARNAPLAAAAERGGGPARPIISVKGKPVETPVNPGPAA"
     misc_feature    255848..257239
                     /locus_tag="BSVBI22_B0270"
                     /note="Regulator of nitric oxide reductase transcription
                     [Transcription]; Region: NosR; COG3901"
                     /db_xref="CDD:226417"
     misc_feature    257186..257890
                     /locus_tag="BSVBI22_B0270"
                     /note="ferredoxin-type protein, NapH/MauN family; Region:
                     napH_; TIGR02163"
                     /db_xref="CDD:233754"
     misc_feature    257321..257452
                     /locus_tag="BSVBI22_B0270"
                     /note="4Fe-4S binding domain; Region: Fer4_5; pfam12801"
                     /db_xref="CDD:257308"
     misc_feature    257618..257737
                     /locus_tag="BSVBI22_B0270"
                     /note="4Fe-4S binding domain; Region: Fer4_5; pfam12801"
                     /db_xref="CDD:257308"
     misc_feature    257768..>257899
                     /locus_tag="BSVBI22_B0270"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            258079..259998
                     /gene="nosZ"
                     /locus_tag="BSVBI22_B0271"
                     /db_xref="GeneID:11686414"
     CDS             258079..259998
                     /gene="nosZ"
                     /locus_tag="BSVBI22_B0271"
                     /note="reduces nitrous oxide to nitrogen"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrous-oxide reductase"
                     /protein_id="YP_005108286.1"
                     /db_xref="GI:376278253"
                     /db_xref="GeneID:11686414"
                     /translation="MTEETRKSQLSRRQLLGTSAFVAAAGASGLGGALLAGSSETALA
                     AGAAKGGMSPEVKPGELDEYYVFFSSGQCGEVRIVGLPSMRELMRIPVFNRDSATGWG
                     LTNESRKVLTEGLLPQDREFLKDRGDIFLNGDLHHPHPSFTDGTYDGRYLYANDKANT
                     RVCRIRLDVMKCDKIIQLPNQHTVHGLRVQKYPKTGYVFCNGEDRVPIPNDGSHLNDV
                     KQYHAIFTAVDGETMKVAWQVMVDGNLDNVDCDYQGKYAFSTCYNSEEGTTLAEMMSS
                     EQDWIVVFNLKRIEEAVANGDFKEMNGVPVIDGRHGSKYTRYIPVPNSPHGINTAPDG
                     IHVVANGKLSPTVTVFDVRKFDDLFDDKIKPRDAVVAEPELGLGPLHTAYDDKGNAYT
                     TLFIDSQICKWNIEDAKRAFKGEKVDPIRQKLDVHYQPGHNHSSMGQTKEVDGKWLIS
                     LNKFSKDRYLNVGPLKPENDQLIDISGDKMVIVHDGPSFAEPHDATIVHRSKINPVSF
                     WSREDPFFADAVAQAKADGLDLMEANEVVRDGNKVRVYMTSSAPAFGLTEFTVQQDDE
                     VTVYVTNIDEIEDLTHGFAIVNYGVNMEVAPQATASVTFKASKPGVWWYYCSWFCHAM
                     HMEMQGRMLVEPKKA"
     misc_feature    258082..259989
                     /gene="nosZ"
                     /locus_tag="BSVBI22_B0271"
                     /note="nitrous-oxide reductase; Validated; Region:
                     PRK02888"
                     /db_xref="CDD:235082"
     misc_feature    259702..259986
                     /gene="nosZ"
                     /locus_tag="BSVBI22_B0271"
                     /note="The C-terminal cupredoxin domain of Nitrous-oxide
                     reductase; Region: N2OR_C; cd04223"
                     /db_xref="CDD:259885"
     misc_feature    order(259810..259815,259819..259821,259837..259854,
                     259858..259860,259891..259896,259900..259902,
                     259906..259920,259924..259926,259930..259938,
                     259942..259950,259954..259959,259963..259965,
                     259969..259971,259975..259983)
                     /gene="nosZ"
                     /locus_tag="BSVBI22_B0271"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259885"
     misc_feature    order(259822..259824,259927..259929,259939..259941,
                     259951..259953,259960..259962)
                     /gene="nosZ"
                     /locus_tag="BSVBI22_B0271"
                     /note="CuA binuclear site [ion binding]; other site"
                     /db_xref="CDD:259885"
     gene            260004..261398
                     /gene="nosD"
                     /locus_tag="BSVBI22_B0272"
                     /db_xref="GeneID:11686415"
     CDS             260004..261398
                     /gene="nosD"
                     /locus_tag="BSVBI22_B0272"
                     /note="similar to SP:P19843, GB:X04803, SP:P02248,
                     PID:1304128, PID:1490419, PID:340058, PID:340068, and
                     PID:825728; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="copper ABC transporter, periplasmic
                     copper-binding protein"
                     /protein_id="YP_005108287.1"
                     /db_xref="GI:376278254"
                     /db_xref="GeneID:11686415"
                     /translation="MVLPRLFRTAGIMSLLAAALCAGAQARQIDVAVGESVQAAIEKA
                     EPGDVVRLRAGRHEGAVVIDRAIELTGEPGAVLDGLGTGNAITVNAPNAIVRGLEVHG
                     SGDNLPDLHSGIFVSRTATGARVENNRLIGNTYGIYLHGAADSIAIGNEVLGRRGVRM
                     AETGSGVSVWNAPGAQVVGNTIRYGRDGIYTNASRKNIFRDNVMEDVRFAVHYMYTDD
                     SAVIGNVSRNNSVGFAIMYTNRLKILNNVSEGDRDHGLLLNYANSSIITGNRVVGRMQ
                     PIERWLEAGLQKGEHGVPGEEKVEASAGETARLGPEKCVFIYNANKNKFSENSFENCS
                     IGIHFTAGSEGNAMSGNSFINNRNQVKYVGTRNLDWSVDGRGNYWSDNPAFDLDGDGI
                     ADSPYRPNDLIDRVLWTVPQAKILINSPAVDTIRWAQTQFPALLPGGVVDSHPLMKPL
                     LKPTAQLKESKHND"
     misc_feature    260028..261371
                     /gene="nosD"
                     /locus_tag="BSVBI22_B0272"
                     /note="Nitrous oxidase accessory protein [Inorganic ion
                     transport and metabolism]; Region: NosD; COG3420"
                     /db_xref="CDD:225954"
     misc_feature    260172..260579
                     /gene="nosD"
                     /locus_tag="BSVBI22_B0272"
                     /note="Domain present in carbohydrate binding proteins and
                     sugar hydrolses; Region: CASH; smart00722"
                     /db_xref="CDD:214788"
     misc_feature    260595..261185
                     /gene="nosD"
                     /locus_tag="BSVBI22_B0272"
                     /note="Domain present in carbohydrate binding proteins and
                     sugar hydrolses; Region: CASH; smart00722"
                     /db_xref="CDD:214788"
     gene            261436..262386
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /db_xref="GeneID:11686416"
     CDS             261436..262386
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="similar to SP:P19844, GB:X04803, SP:P02248,
                     PID:1304128, PID:1490419, PID:340058, PID:340068, and
                     PID:825728; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="copper ABC transporter, ATP-binding protein"
                     /protein_id="YP_005108288.1"
                     /db_xref="GI:376278255"
                     /db_xref="GeneID:11686416"
                     /translation="MATFGTGSETVVLDKVTKSYGGFNAISDASFRLMAGENIALVGH
                     NGAGKTTMIKLMLGLIRPTKGAVRVLGEHPAAGAFAARLRLGYLPEHVSFNMALTGAE
                     TLGFYARLKQVPFGQADALLERVGLAHAAHRRVGTYSKGMRQRLGLAQALLGQPAVLL
                     LDEPTTGLDPALRQSFYEILESLRQEGTTILMSSHALTELETKVGRVIIANKGKVIAD
                     GSIDALRRISRLPMRIRVEVNDVSCLPVETGNLLLRWHRLGPDLYETEAPAEGKMELV
                     RRIVAMNDKLNELDIIPPTLDELYAHFLNMGDMAVQEAAE"
     misc_feature    261460..262335
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    261466..262080
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    261562..261585
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(261571..261576,261580..261588,261703..261705,
                     261919..261924,262018..262020)
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    261694..261705
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    261847..261876
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    261907..261924
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    261931..261942
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    262006..262026
                     /gene="nosF"
                     /locus_tag="BSVBI22_B0273"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            262383..263213
                     /gene="nosY"
                     /locus_tag="BSVBI22_B0274"
                     /db_xref="GeneID:11686417"
     CDS             262383..263213
                     /gene="nosY"
                     /locus_tag="BSVBI22_B0274"
                     /note="similar to GP:2177176, GB:L06175, and PID:189449;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrous-oxide reductase, nosY component"
                     /protein_id="YP_005108289.1"
                     /db_xref="GI:376278256"
                     /db_xref="GeneID:11686417"
                     /translation="MNNIAIIATKEIQEGLRNRWVLATTLLLAALALSMTFLGSAPTG
                     SSVAASKLDVVIVSLSSLTIFLIPLIALLISHDAIVGEMERGTMLLLLSYPLSRIQVV
                     LGKFIGQLAILAFATLFGYGVAALALAATGTGVDAASWISFLKLIGSSILLGAVFIAI
                     GFLASTLVRERSTAAGIAIGVWLFFVLIYDAALLALLVFDQGQTIGSAALNALLLLNP
                     ADSYRLLNFGTGQAGALTGMGGMAGNATLSAPALALALGLWAVLPLSLSMLGLLRKEL
                     "
     misc_feature    262401..>262973
                     /gene="nosY"
                     /locus_tag="BSVBI22_B0274"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_2; pfam12679"
                     /db_xref="CDD:257216"
     gene            263210..263749
                     /locus_tag="BSVBI22_B0275"
                     /db_xref="GeneID:11686418"
     CDS             263210..263749
                     /locus_tag="BSVBI22_B0275"
                     /note="similar to GP:2177177; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="protein disulfide isomerase NosL, putative"
                     /protein_id="YP_005108290.1"
                     /db_xref="GI:376278257"
                     /db_xref="GeneID:11686418"
                     /translation="MKRALFLAPFFFALLAGCSPAEKQEPATPFALTENAMGRYCGMN
                     VLEHPGPKGQIILRPTNEPIWFSSARDTLAFTMLPEEPKNIAAIYVSDMAKAPNWDEP
                     GANNWIDAHKAFFVIESGAVGGMGAKEAVPFSDRAAAERFTADNGGRIVSFDEMPRDY
                     VLGEQTAQHVEPDGESHMH"
     misc_feature    263210..263746
                     /locus_tag="BSVBI22_B0275"
                     /note="Predicted lipoprotein involved in nitrous oxide
                     reduction [Energy production and conversion]; Region:
                     NosL; COG4314"
                     /db_xref="CDD:226764"
     gene            263761..264753
                     /locus_tag="BSVBI22_B0276"
                     /db_xref="GeneID:11686419"
     CDS             263761..264753
                     /locus_tag="BSVBI22_B0276"
                     /note="similar to GP:14523761, and GP:2177178; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="nosX protein"
                     /protein_id="YP_005108291.1"
                     /db_xref="GI:376278258"
                     /db_xref="GeneID:11686419"
                     /translation="MSITRRRVLVGGAVAATFSMLPRFAFAQGEQQPVIWQGQALGAP
                     AKIIFYHPGRKVAERLVGESAREAERLENIFSLYRPDSEIVRLNHTGALASPAPEMVE
                     LLGICRTCWQLSDGLFDPTVQPLWQCLRKHFSQANPAPEGPSRAEWDAALAKIGFDHV
                     LFNAERIAFTKPGMALTLNGIAQGYVTDRVVGLLRDAGVSEALVDMGEYRAIGGQPDG
                     KPWRIGIADLEAGAAPEEFIDIMDQALATSSFAGFQFEESGRFNHLLNPKTGYSAALY
                     RRVTVVAPDTAMADALATAFSLMEPAQIKETLKKLPGIFAYTVSRDGEKRRFGA"
     misc_feature    263965..264747
                     /locus_tag="BSVBI22_B0276"
                     /note="Membrane-associated lipoprotein involved in
                     thiamine biosynthesis [Coenzyme metabolism]; Region: ApbE;
                     COG1477"
                     /db_xref="CDD:224394"
     gene            264868..265566
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /db_xref="GeneID:11686420"
     CDS             264868..265566
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="similar to GP:15158856, GB:L06214, PID:153222, and
                     PID:886941; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator NnrR"
                     /protein_id="YP_005108292.1"
                     /db_xref="GI:376278259"
                     /db_xref="GeneID:11686420"
                     /translation="MAAIIDWALVRSLPVFSGMDDAAFEQLMGLAMPRAVPKGSAVFK
                     QGEEARLFYLLVQGRLKVMQVTADGQQLIVRVVNPGEFFGFAMALGREDYPGTPLAVV
                     DCSVIAWSMEMMTAFMASNPALAVNTMQMIGRRLDAAHSRIREISTQEVEQHVAHAVL
                     RLVRETGIQEDTGLRIDFPVSRQDIAELTGTTLHTVSRIVSQWQSKGWVEGGRQSLLV
                     RDLRRLRQIAEGEI"
     misc_feature    264892..265512
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    264910..265245
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    order(265117..265122,265147..265155)
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    order(265213..265221,265231..265239)
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    265327..265332
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    265384..265506
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="helix_turn_helix, cAMP Regulatory protein; Region:
                     HTH_CRP; smart00419"
                     /db_xref="CDD:128696"
     misc_feature    order(265402..265404,265408..265416,265441..265443)
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    265441..265461
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    order(265444..265449,265459..265461)
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    265444..265449
                     /gene="nnrR"
                     /locus_tag="BSVBI22_B0277"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            265704..266144
                     /locus_tag="BSVBI22_B0278"
                     /db_xref="GeneID:11686421"
     CDS             265704..266144
                     /locus_tag="BSVBI22_B0278"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudoazurin"
                     /protein_id="YP_005108293.1"
                     /db_xref="GI:376278260"
                     /db_xref="GeneID:11686421"
                     /translation="MRNTAIKFAAAGLFALLAAPALAENIEVHMLNKGAEGAMVFEPS
                     YIKANAGDTITFIPMDKGHNVETVKDMIPDGAEKFKSKINEHYTVTVNQPGAYLIKCT
                     PHYAMGMVALIAVGDKPENLEKIVSAKKPKVVQERLDKILAEVK"
     misc_feature    265782..266129
                     /locus_tag="BSVBI22_B0278"
                     /note="Pseudoazurin (Paz) is a type I blue copper
                     electron-transfer protein; Region: Pseudoazurin; cd04218"
                     /db_xref="CDD:259880"
     misc_feature    order(265890..265892,266004..266006,266013..266015,
                     266028..266030)
                     /locus_tag="BSVBI22_B0278"
                     /note="Type 1 (T1) Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259880"
     gene            266195..267436
                     /locus_tag="BSVBI22_B0279"
                     /db_xref="GeneID:11686422"
     CDS             266195..267436
                     /locus_tag="BSVBI22_B0279"
                     /note="similar to GP:15158853, and GP:14523798; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108294.1"
                     /db_xref="GI:376278261"
                     /db_xref="GeneID:11686422"
                     /translation="MTTQQGLQASPATMPSERKGGIPRGLKMTGPVILSYGFRPFFLG
                     GAIWAVMAMLLWILSLTIGLPLGGSYGALNWHAHEMVFGFSSAVLAGFLLTAVPNWTG
                     RLPVSGGPLAVLCGVWLAGRLAFLAPDLVHIDVAVAIESLFLPFLLFIAAREIIAGHQ
                     WRNLKVLGGIAGVMIANFAFHYLVLTDGDVTFANRIGVSAYVLLVTLIGGRIIPSFTR
                     NWLNRMGKTRFPVPFNRYDALTLIVGVVACLSWIFLPESSLTAVLALIAAAFHLVRLY
                     RWRGWTVAREKLLVILHVAYLFVPGGFVAIALSALDRLNPFSALHVMTVGAIGAMMLA
                     VMTRATRGHTGRELVASPMTQIAYVCIIAAAVIRPFAEIMPNFFHTLLAASALLWMLA
                     FGLFVVEYGPMLLRKRRSRMG"
     misc_feature    266249..267433
                     /locus_tag="BSVBI22_B0279"
                     /note="Uncharacterized protein involved in response to NO
                     [Inorganic ion transport and metabolism]; Region: NnrS;
                     COG3213"
                     /db_xref="CDD:225754"
     gene            complement(267510..268550)
                     /locus_tag="BSVBI22_B0280"
                     /db_xref="GeneID:11686423"
     CDS             complement(267510..268550)
                     /locus_tag="BSVBI22_B0280"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, periplasmic binding protein,
                     putative"
                     /protein_id="YP_005108295.1"
                     /db_xref="GI:376278262"
                     /db_xref="GeneID:11686423"
                     /translation="MTTTRRDILLGAAAFGLASIATRLPAYAQDASAAPEKPELMFGV
                     GGKPLFYYLPLTIAERKGFFEEEGIKATINDFGGGAKSLQALIGGSVDVVTGAYEHTI
                     RMQNRGQDIKAVCELGRFPGICIGVRKDLAGDIKTIADLKGQNVGVTAPGSSTSLLLQ
                     YALIKNGLSPDAASIIGIGGGASAVAAIKKGEIAALVHLDPVITRLEVDGDITLLLDT
                     HTEEGTRQLFDGTNPAATVYVQQSFIDANPVTTQRVVNAFVKSLKWIHNASADEVADT
                     VPEEYLLGDRALYKTGFEKSRAMYSQKGPIAEDGFKSLFEMLKTLDPELAGANITFAQ
                     TFDPRFVEAARA"
     misc_feature    complement(267519..268550)
                     /locus_tag="BSVBI22_B0280"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    complement(267726..268454)
                     /locus_tag="BSVBI22_B0280"
                     /note="NMT1-like family; Region: NMT1_2; cl17432"
                     /db_xref="CDD:266680"
     gene            complement(268576..269367)
                     /locus_tag="BSVBI22_B0281"
                     /db_xref="GeneID:11686424"
     CDS             complement(268576..269367)
                     /locus_tag="BSVBI22_B0281"
                     /note="similar to GP:15158995; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, permease protein"
                     /protein_id="YP_005108296.1"
                     /db_xref="GI:376278263"
                     /db_xref="GeneID:11686424"
                     /translation="MKKPMLFLAQLGIAVAVILVWHLFTATHLFGNPAKAQFFFATPG
                     DVALRTYKWFVDGTIWYHLGITLLEAMLAFAIGAVGGVLIGFWFARKPLLAAIFDPYV
                     KAANSLPRVVLAPIFALWLGLGIWSKVALGVSLVFFIVFFNVYQGVKEVNQTVLSNAR
                     MLGMNERQLLRNVYLPSALSWMFSSLHTAVGFAVVGAVVGKYLGSSAGLGYLIHQAEG
                     VFDVTGVFAGMLVLTAFVLLIDWGVSIIEQRLLVWRPKAAGQNGA"
     misc_feature    complement(268597..269367)
                     /locus_tag="BSVBI22_B0281"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(268648..269181)
                     /locus_tag="BSVBI22_B0281"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268654..268659,268666..268671,
                     268675..268680,268687..268692,268720..268725,
                     268762..268767,268774..268785,268804..268806,
                     268813..268818,268858..268860,268909..268911,
                     268918..268923,268933..268935,268939..268944,
                     268951..268953,268957..268959,268963..268968,
                     269014..269016,269020..269025,269032..269061,
                     269065..269076,269101..269103,269116..269121,
                     269128..269133))
                     /locus_tag="BSVBI22_B0281"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268768..268785,269014..269058))
                     /locus_tag="BSVBI22_B0281"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268690..268692,268720..268722,
                     268729..268731,268765..268767,268981..268983,
                     269014..269016))
                     /locus_tag="BSVBI22_B0281"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268837..268839,268849..268854,
                     268870..268908))
                     /locus_tag="BSVBI22_B0281"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(269364..270209)
                     /locus_tag="BSVBI22_B0282"
                     /db_xref="GeneID:11686425"
     CDS             complement(269364..270209)
                     /locus_tag="BSVBI22_B0282"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00972"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP binding protein"
                     /protein_id="YP_005108297.1"
                     /db_xref="GI:376278264"
                     /db_xref="GeneID:11686425"
                     /translation="MSAYPKLVQSNEPHPTAIELKDVQISFRLADGGRFDAVAESNLA
                     VAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQGLNRKAGYLFQQDAL
                     MPWKTVLENVAIGLEIAGTPKAKAREQAREWLNKVGLGTFGDRYPHMLSGGQRKRVGL
                     AQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLWSQDKKAVMFVTHDLEEAIALAD
                     RVVIMSAGPRARIMAEYRIPLARPREISEIRLDNQFHEIHREIWSALKEEVLKGYQQT
                     SGERS"
     misc_feature    complement(269397..270167)
                     /locus_tag="BSVBI22_B0282"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    complement(269493..270158)
                     /locus_tag="BSVBI22_B0282"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    complement(270024..270047)
                     /locus_tag="BSVBI22_B0282"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(order(269586..269588,269685..269690,
                     269916..269918,270021..270029,270033..270038))
                     /locus_tag="BSVBI22_B0282"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(269916..269927)
                     /locus_tag="BSVBI22_B0282"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(269733..269762)
                     /locus_tag="BSVBI22_B0282"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(269685..269702)
                     /locus_tag="BSVBI22_B0282"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(269667..269678)
                     /locus_tag="BSVBI22_B0282"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(269580..269600)
                     /locus_tag="BSVBI22_B0282"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            270236..270538
                     /locus_tag="BSVBI22_B0283"
                     /db_xref="GeneID:11686426"
     CDS             270236..270538
                     /locus_tag="BSVBI22_B0283"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108298.1"
                     /db_xref="GI:376278265"
                     /db_xref="GeneID:11686426"
                     /translation="MRFAAIIHLYSLLRRHAFAEQGRGWLPALPGCEEDAPGWKPSLY
                     LSGKKMKCKAEIALQTNHINVLMRNIIATPYPQRPPPFPVARQYDRDCEGASRCED"
     gene            complement(270444..270587)
                     /locus_tag="BSVBI22_B0284"
                     /db_xref="GeneID:11686427"
     CDS             complement(270444..270587)
                     /locus_tag="BSVBI22_B0284"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108299.1"
                     /db_xref="GI:376278266"
                     /db_xref="GeneID:11686427"
                     /translation="MTRIFSENRFTLFGMRSNLHNGLPLRNRGHIALQPEKAAGAADK
                     ALQ"
     gene            complement(270636..271568)
                     /locus_tag="BSVBI22_B0285"
                     /db_xref="GeneID:11686428"
     CDS             complement(270636..271568)
                     /locus_tag="BSVBI22_B0285"
                     /note="similar to GP:15158836; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="protease, putative"
                     /protein_id="YP_005108300.1"
                     /db_xref="GI:376278267"
                     /db_xref="GeneID:11686428"
                     /translation="MATNATPSLSMGPVLFLWDGPKWRDFYFRIADEAPVSHVTVGEI
                     VCSKRFHFVDPYMEAVIERLQQAGKTVSLGSLALVMLEREAKQVRQTIEKATLPVEAN
                     DLSALGLLSGKPHTVGPLVNVYNAATAKVLAERSATSICLPPELPLASIREIVKGAPD
                     IAFEVFSFGRVPLAISARCAHARSKGHIKDNCQFVCGEEPDGLPVKTLDSQPFLALNG
                     VQTLSHTCQAFLEDMPELKAAGVSRFRLSPQVCDMVAVAQIHEDVLLEKIDPDEGVAR
                     LKEVYPAVPLSNGFLHGGIGAAWVSRQRSMAAGH"
     misc_feature    complement(270663..271544)
                     /locus_tag="BSVBI22_B0285"
                     /note="putative protease; Provisional; Region: PRK15447"
                     /db_xref="CDD:237968"
     gene            complement(271571..272548)
                     /locus_tag="BSVBI22_B0286"
                     /db_xref="GeneID:11686429"
     CDS             complement(271571..272548)
                     /locus_tag="BSVBI22_B0286"
                     /note="similar to GP:15158837; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="U32 family peptidase"
                     /protein_id="YP_005108301.1"
                     /db_xref="GI:376278268"
                     /db_xref="GeneID:11686429"
                     /translation="MELICPAGTPSALREAVQAGADAVYCGFRDETNARNFPGLNFSR
                     DELRDAIGFAHARNCQVFVAINTFMRAGDEHIWYKAVDDAAALGADAVILADFGLMAY
                     TAERHPNQRLHVSVQASASNADAISFLIDTFKAKRVVLPRVLTIADIAKLGRKIPCEM
                     EVFVFGGLCVMAEGRCSLSSYATGKSPNMNGVCSPASHVRYRHDGSELVSELGDYTIN
                     RFPAGEAAGYPTLCKGRFNIGDEEGYAFEDPVSLDVMDHIDELRAAGVSALKIEGRQR
                     GKAYVAEVVSTLRQTLAAGPEKRAALLSRLRALSEGQQTTSGAYEKRWR"
     misc_feature    complement(271574..272548)
                     /locus_tag="BSVBI22_B0286"
                     /note="Collagenase and related proteases
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0826"
                     /db_xref="CDD:223896"
     gene            complement(272539..273063)
                     /locus_tag="BSVBI22_B0287"
                     /db_xref="GeneID:11686430"
     CDS             complement(272539..273063)
                     /locus_tag="BSVBI22_B0287"
                     /note="similar to GP:15158838, and GP:15158838; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108302.1"
                     /db_xref="GI:376278269"
                     /db_xref="GeneID:11686430"
                     /translation="MMKIPQAVAAPARLVPPFLLNPLVSRVFHQVIRAHPGLFERLGE
                     HVNKRFGFRPSDLPFAFLVEPGKPRISVFRQDAAFEADAAIEGPLVMLLALLEGKLDG
                     DALFFSRDITVTGDMEAMLALRNALDDCNVDLPADLGNGAGPFGPVVRSIAGYIREKA
                     LGADAHDREAHSWN"
     misc_feature    complement(272563..273063)
                     /locus_tag="BSVBI22_B0287"
                     /note="Putative lipid carrier protein [Lipid metabolism];
                     Region: COG3154"
                     /db_xref="CDD:225696"
     gene            273177..274691
                     /gene="ubiD"
                     /locus_tag="BSVBI22_B0288"
                     /db_xref="GeneID:11686431"
     CDS             273177..274691
                     /gene="ubiD"
                     /locus_tag="BSVBI22_B0288"
                     /note="similar to GP:14523816; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="YP_005108303.1"
                     /db_xref="GI:376278270"
                     /db_xref="GeneID:11686431"
                     /translation="MKSSSSLPTHYDCLQSFLTELEKRGDLVRIARPVSLVHEVTEIH
                     RRVLEADGPALLFENPVDAEGRTQTIPLLANLFGSERRIAWGLGRLPEELPLLAEMLA
                     ELRAPKPPRSAGEIWEKLPMAKAALNMRPRQVSRAPVHGLVMEGASVNLDTLPIQWCW
                     PGEPAPLITWPLVITRAPDDPSDVNVGIYRMQKLGENRLIMRWLAHRGGARHHRMWQK
                     RGEDMPVAIAIGVDPATILAAVMPLPEGMSELAFSGLLGGRRPCVTQGRTVPLMVPAN
                     AEIVLEGRVSATQTAPEGPYGDHTGYYNSVEAFPVMQVTAITMRKKPVYLSTYTGRPP
                     DEPSRLGEVMNQLFVPVVRKQFPEIADLWLPPAACSYRAMVVSIDKRYPGQARRVMMG
                     LWSMLPQFSYTKLIIAVDPDIDVHNWDDVMWALATRFDASRDVVTLSDTPVDYLDFAS
                     PRSGLGGKLGLDATNKIGPETDREWGKVLAMNEETIARVDAIWDELGLDRDKRI"
     misc_feature    273201..274673
                     /gene="ubiD"
                     /locus_tag="BSVBI22_B0288"
                     /note="3-polyprenyl-4-hydroxybenzoate decarboxylase and
                     related decarboxylases [Coenzyme metabolism]; Region:
                     UbiD; COG0043"
                     /db_xref="CDD:223121"
     gene            274688..275278
                     /locus_tag="BSVBI22_B0289"
                     /db_xref="GeneID:11686432"
     CDS             274688..275278
                     /locus_tag="BSVBI22_B0289"
                     /note="catalyzes the formation of 2-octaprenylphenol from
                     3-octaprenyl-4-hydroxybenzoate"
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="YP_005108304.1"
                     /db_xref="GI:376278271"
                     /db_xref="GeneID:11686432"
                     /translation="MKRIVIGVSGASGSLIPLKLLERLAVMEEVETHLVISDAAQQTL
                     RYELGANGYSLLYRLAARTYAVEDVGAAIASGSVPTAGMIIAPCSMRTLSAIANGYSD
                     SLLTRAADVHLKERRKLVLIARETPLHLVHLRNMCTVTEMGAIVMPPVPAFYLQPQTV
                     EDVASQVAARAIDLIGVGTPQAQSWNPEEKPRRKAG"
     misc_feature    274688..275242
                     /locus_tag="BSVBI22_B0289"
                     /note="3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
                     Provisional; Region: PRK06029"
                     /db_xref="CDD:235677"
     gene            complement(275288..275824)
                     /locus_tag="BSVBI22_B0290"
                     /db_xref="GeneID:11686433"
     CDS             complement(275288..275824)
                     /locus_tag="BSVBI22_B0290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108305.1"
                     /db_xref="GI:376278272"
                     /db_xref="GeneID:11686433"
                     /translation="MKAAPILAAIHAAKDVPVDPLLAEIAARGKQDGLRVAGFFQHRG
                     KDTEECCRDIEIEHIATGITQIISQPLGTGSRGCRLDPAALADVAGALLGELEAGAQL
                     LILNRFGKGETEGHGFRSVIEAAYARQIPVLTVVRETYIDGWRDFAGPCGTLLAPNSE
                     SVTDWFNAVMAPPLRAAI"
     misc_feature    complement(275330..275806)
                     /locus_tag="BSVBI22_B0290"
                     /note="Protein of unknown function (DUF2478); Region:
                     DUF2478; pfam10649"
                     /db_xref="CDD:256108"
     gene            complement(275821..276756)
                     /locus_tag="BSVBI22_B0291"
                     /db_xref="GeneID:11686434"
     CDS             complement(275821..276756)
                     /locus_tag="BSVBI22_B0291"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /protein_id="YP_005108306.1"
                     /db_xref="GI:376278273"
                     /db_xref="GeneID:11686434"
                     /translation="MVTLFDRKNAGGQPAGDNPAGHHGHQHQSGYTTYQEPDTRVPPK
                     PRPVFDAVSVNGVTIDEADILTEAQNHPAENPGAALLSAARALAVRELLLQRAREIGI
                     EPEHEKDAEGRAETDEDALVRMVIEREVDVPSASRDEAQRYYENNRHRFTSAPILEAS
                     HILIAADPADQETRDAARQTATRLAAAVIAEPATFASVALEYSSCPSGAQGGNLGQLT
                     RGSTVPEFERALERMTPGETTANPIESRFGYHIVRLDRRVEGEELPFDYVVDKIAGWL
                     EASTWSKAVSQYIAILAAEAEITGIDLLSGEDGGE"
     misc_feature    complement(275824..>276492)
                     /locus_tag="BSVBI22_B0291"
                     /note="Parvulin-like peptidyl-prolyl isomerase
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: SurA; COG0760"
                     /db_xref="CDD:223831"
     misc_feature    complement(275989..276276)
                     /locus_tag="BSVBI22_B0291"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:250020"
     gene            complement(276762..277487)
                     /gene="narI"
                     /locus_tag="BSVBI22_B0292"
                     /db_xref="GeneID:11686435"
     CDS             complement(276762..277487)
                     /gene="narI"
                     /locus_tag="BSVBI22_B0292"
                     /note="similar to GB:M64929, SP:Q00005, SP:Q00007, and
                     PID:190422; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="respiratory nitrate reductase, gamma subunit"
                     /protein_id="YP_005108307.1"
                     /db_xref="GI:376278274"
                     /db_xref="GeneID:11686435"
                     /translation="MASYFNTFLFGIYPYIALSVLALGSIVRYDREPYTWRSGSSQLL
                     RRRQLMWGSVLFHLGVLVIFAGHFVGLLTPIWIFDTLGISHEAKQILAIVAGGIAGLM
                     AIIGASMLVHRRLFDPRVRASSRPSDTLIIILLWVQLLLGLSSIPVSLQHIDGGEMVK
                     FMNWAQGIFTFNPAASSYVADASIMFKMHIFLGLTIFILFPFTRLVHMLSAPVRYIWR
                     PGYQVVRERNHTAAPSHLRAPAE"
     misc_feature    complement(276807..277475)
                     /gene="narI"
                     /locus_tag="BSVBI22_B0292"
                     /note="Nitrate reductase gamma subunit; Region:
                     Nitrate_red_gam; pfam02665"
                     /db_xref="CDD:251457"
     gene            complement(277498..278205)
                     /gene="narJ"
                     /locus_tag="BSVBI22_B0293"
                     /db_xref="GeneID:11686436"
     CDS             complement(277498..278205)
                     /gene="narJ"
                     /locus_tag="BSVBI22_B0293"
                     /note="similar to GP:11344603, GB:L08239, and PID:950412;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="respiratory nitrate reductase, delta subunit"
                     /protein_id="YP_005108308.1"
                     /db_xref="GI:376278275"
                     /db_xref="GeneID:11686436"
                     /translation="MNRTLKIISLLLSYPSPELQAGRAELKAALEGEKNLSPGVRRLL
                     DKLVDYICTADLYEAQERYVHLFDRTRSLSLHLFEHVHGESRDRGQAMVDLGQMYEDN
                     GFDIDAKELPDYLPLFLEFLSTRSTEEIHDLLTQTGHITAAIGERLRKRQSPYAGAFA
                     ALLHLANAKPDEKLVGELLRQEEDDPDDLAALDRIWEEEAVTFGANAGENACGPDRLR
                     MQMRAAHRKPASPSTQI"
     misc_feature    complement(277663..278205)
                     /gene="narJ"
                     /locus_tag="BSVBI22_B0293"
                     /note="Nitrate reductase delta subunit [Energy production
                     and conversion]; Region: NarJ; COG2180"
                     /db_xref="CDD:225091"
     gene            complement(278205..279743)
                     /gene="narH"
                     /locus_tag="BSVBI22_B0294"
                     /db_xref="GeneID:11686437"
     CDS             complement(278205..279743)
                     /gene="narH"
                     /locus_tag="BSVBI22_B0294"
                     /note="similar to GB:D90359, GB:M73442, GB:M73444,
                     GB:X07024, SP:P21675, and PID:29733; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="respiratory nitrate reductase, beta subunit"
                     /protein_id="YP_005108309.1"
                     /db_xref="GI:376278276"
                     /db_xref="GeneID:11686437"
                     /translation="MKIRAQIGMVLNLDKCIGCHTCSITCKNVWTNREGVEYAWFNNV
                     ETKPGVGFPKEWENQKKWNGGWVRKKNGKIEPKMGAKWRILAKIFANPDLPEIDDYYE
                     PFDFDYGHLQTAGESRTMPTARPRSLISGERMEKIEWGPNWEEILGGEFAKRSKDYNF
                     EGVEKEIYGQFENTFMMYLPRLCEHCLNPTCVAACPSGAIYKREDDGIVLIDQEKCRG
                     WRMCVSGCPYKKIYYNWSSGKSEKCIFCYPRIESGQPTVCSETCVGRIRYLGVMLYDA
                     DRISEAASTANEQDLYQEQLNIFLDPNDPAVIEQARKDGVPDAWLEAAKHSPVYKMAM
                     DWKIAFPLHPEYRTLPMVWYVPPLSPLQSAAQAGKLGMDGPLPDVRSMRIPVRYLANL
                     LTAGKEKPVISALERMLAMRAYMRAKTIDGVIDEAIADRVGMSGAMIEEMYNIMAIAN
                     YEDRFVIPTSHREITEDAYDVRGSCGFTFGNGCSGGTSTEDLFGAKRQKVVQTPTDIF
                     REQV"
     misc_feature    complement(278211..279743)
                     /gene="narH"
                     /locus_tag="BSVBI22_B0294"
                     /note="Nitrate reductase beta subunit [Energy production
                     and conversion]; Region: NarY; COG1140"
                     /db_xref="CDD:224063"
     misc_feature    complement(278928..279224)
                     /gene="narH"
                     /locus_tag="BSVBI22_B0294"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     misc_feature    complement(<278793..>278954)
                     /gene="narH"
                     /locus_tag="BSVBI22_B0294"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cl00470"
                     /db_xref="CDD:260445"
     misc_feature    complement(278433..278672)
                     /gene="narH"
                     /locus_tag="BSVBI22_B0294"
                     /note="Respiratory nitrate reductase beta C-terminal;
                     Region: Nitr_red_bet_C; pfam14711"
                     /db_xref="CDD:258848"
     gene            complement(279740..283504)
                     /gene="narG"
                     /locus_tag="BSVBI22_B0295"
                     /db_xref="GeneID:11686438"
     CDS             complement(279740..283504)
                     /gene="narG"
                     /locus_tag="BSVBI22_B0295"
                     /note="similar to SP:P09152; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="respiratory nitrate reductase, alpha subunit"
                     /protein_id="YP_005108310.1"
                     /db_xref="GI:376278277"
                     /db_xref="GeneID:11686438"
                     /translation="MSLLLDRLNFLARRNVGTFSEGHGVTTNESRDWEDAYRKRWQHD
                     KIVRSTHGVNCTGSCSWKIYVKGGIITWETQQTDYPRTRADLPNHEPRGCPRGASYSW
                     YIYSANRVKYPLIRSRLLKLWRKERAVKTPVAAWAAIQQDPAKRSDYMKVRGLGGFVR
                     ATWDEVNEIIAAANAYTTKTYGPDRVVGFSPIPAMSMVSYAAGSRYLSLLGGVCMSFY
                     DWYCDLPPASPMTWGEQTDVPESADWYNAGFLMLWGSNVPQTRTPDAHFYTEARYKDA
                     KSVVVCPDYSEAAKFSDLWLHPKQGTDAALAMAFGHVMLREYHLDRQVPYFEDYCRKY
                     SDFPMLVMLTKKDGHYVPGRFVRASDFADNLGEGNNPDWKTVGFDTKSGAYVAPQGSI
                     GFRWGDDGKWNLEEKDGKGKDVELAKSFIDKDAHDAVADVAFPYFGNLDHEHFEGTDH
                     DSILVRKVPARTLKLKEGDVMVATVFDLFAANYGLDRGLGDENCAKSYDDGLPYTPAW
                     AEKITGVPRAQIIAVAREFATNAEKTNGRSMVIVGAGLNHWYHMDMNYRGIINMLVMC
                     GCVGQSGGGWSHYVGQEKLRPQTGWTALAFALDWTRPPRHMNSTSFFYAHTDQWRYET
                     VKVQDILSPTAPEGNWDGTMMDYNIRAERMGWLPSAPQLQVNPLEVAKQAAESGKDAK
                     DFVAGALKNGSITMSCEDPDHEANWPRNMFVWRSNLLGSSGKGHEYFLKHLLGTSNGL
                     LGKDLGQEGAQESREAVWHEHAPEGKLDLLVTLDFRMSTTCVYSDIVLPTATWYEKND
                     LNTSDMHPFIHPLSSAADPAWEARSDWEIFKGIAKKFSDVAPEVLGVEKDVVLVPALH
                     DTAGELAQPKDVLDWKRGEVEPIPGKTMPSVVVVERDYPNLYKRYTSVGPLLDKLGNG
                     GKGISWNTQHEVDLLAKLNGKVGEPGTSEGRPRIDTDIDATEVILSLAPETNGEVAVK
                     AWAALSKFTGRDHTHLAIPKEDEKIRYRDIVAQPRKIISSPTWSGLESESVCYNAGYT
                     NVHELIPWRTLTGRQQLYQDHLWMRAFGEGFCVYRPPIDTRTVSSAIRAKTDGQPHLV
                     LNFITPHQKWGIHSTYSDNLLMLTLNRGGPVVWIAEPDAARAGIADNDWVEIYNSNGA
                     IVARAVVSQRMREGTTFMYHAQEKIVNTPGSPLTGQRGGIHNSVTRVITKPTHMIGGY
                     AHQAYGFNYYGTVGSNRDEFVVVRTLDKVDWMEGPLEEGNKSSQVKEAAE"
     misc_feature    complement(279800..283504)
                     /gene="narG"
                     /locus_tag="BSVBI22_B0295"
                     /note="Nitrate reductase alpha subunit [Energy production
                     and conversion]; Region: NarG; COG5013"
                     /db_xref="CDD:227346"
     misc_feature    complement(283382..283495)
                     /gene="narG"
                     /locus_tag="BSVBI22_B0295"
                     /note="Respiratory nitrate reductase alpha N-terminal;
                     Region: Nitr_red_alph_N; pfam14710"
                     /db_xref="CDD:258847"
     misc_feature    complement(281000..283375)
                     /gene="narG"
                     /locus_tag="BSVBI22_B0295"
                     /note="Respiratory nitrate reductase A (NarGHI), alpha
                     chain (NarG) and related proteins. Under anaerobic
                     conditions in the presence of nitrate, E. coli synthesizes
                     the cytoplasmic membrane-bound quinol-nitrate
                     oxidoreductase (NarGHI), which reduces nitrate to...;
                     Region: MopB_Nitrate-R-NarG-like; cd02750"
                     /db_xref="CDD:239151"
     misc_feature    complement(order(283223..283225,283322..283324,
                     283328..283330,283340..283342,283352..283354))
                     /gene="narG"
                     /locus_tag="BSVBI22_B0295"
                     /note="[4Fe-4S] binding site [ion binding]; other site"
                     /db_xref="CDD:239151"
     misc_feature    complement(order(281033..281035,281117..281119,
                     281126..281128,281177..281188,281339..281344,
                     281354..281362,281765..281767,281858..281863,
                     281867..281878,282596..282598,282602..282604,
                     282647..282649,282653..282658,282662..282664,
                     282725..282730,282737..282739,282743..282745,
                     282836..282838,282842..282844,282932..282934,
                     283217..283219,283343..283345,283349..283351))
                     /gene="narG"
                     /locus_tag="BSVBI22_B0295"
                     /note="molybdopterin cofactor binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239151"
     misc_feature    complement(279821..280243)
                     /gene="narG"
                     /locus_tag="BSVBI22_B0295"
                     /note="Respiratory nitrate reductase A (NarGHI), alpha
                     chain (NarG) and related proteins. Under anaerobic
                     conditions in the presence of nitrate, E. coli synthesizes
                     the cytoplasmic membrane-bound quinol-nitrate
                     oxidoreductase (NarGHI), which reduces nitrate to...;
                     Region: MopB_CT_Nitrate-R-NarG-like; cd02776"
                     /db_xref="CDD:239177"
     misc_feature    complement(order(279842..279847,279941..279943,
                     280007..280009,280196..280210,280217..280228))
                     /gene="narG"
                     /locus_tag="BSVBI22_B0295"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239177"
     gene            complement(283528..286215)
                     /gene="narK"
                     /locus_tag="BSVBI22_B0296"
                     /db_xref="GeneID:11686439"
     CDS             complement(283528..286215)
                     /gene="narK"
                     /locus_tag="BSVBI22_B0296"
                     /note="similar to GP:14348603; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite extrusion protein"
                     /protein_id="YP_005108311.1"
                     /db_xref="GI:376278278"
                     /db_xref="GeneID:11686439"
                     /translation="MSTTAFTVCFAVWTIFAIIGIEIRSELGLTETQFGLLVGTPILT
                     GSLIRVILGIWADRYGGRAIFTLTMLVSAVATYLLTYATTYPQMLLAALGVGVAGGSF
                     SVGVAYVSRWYPPEKQGVALGIFGAGNVGAAVTKFFAPMVMVAFGWHTVAEVWAAAMV
                     VMALVYYFTTNDDPVLVERRRKGEKPTSTLMELEPLKNIQVWRFSLYYFFVFGAFVAL
                     SLWLPQYLIHVYGVDIRFAGIIAAFFSIPASLFRAYGGHLSDVYGARRVMYWTFAVSL
                     VATFILSYPPTDYVIQSDNGPLAFHAEMGVIGFTVTVFILGFFMALGKAAVFKHIPVY
                     YPGNVGAVGGLVGMIGGLGGFILPILFGVLLDQTGLWTSCFMLLFVIVVVSFVWMHVS
                     IRQMEHAAEGKATEELPAFAELQGLKKAEVKPATGESVLTDWRPDDPAFWEQKGRRIA
                     KRNLWLSIPALLLSFAIWQVWSVVVAKLPLVGYQFTTDQLFWLAALPGISGATLRIFY
                     SFMVPIFGGRLWTTLTTWSLVIPAIGIGYAVQNPDTPYFIFLLLALFCGFGGGNFASS
                     MSNISFFFPKTEKGNAAALNAGLGNLGVSVVQFVVPLVITAGIFGKLGGNPAMVATAA
                     GEAPLWLQNAGFIFVPFIIVTAFANWFGMNDIASAKASFADQAVIFRRRHNWIMCWLY
                     IGTFGSFIGYSAGFPLLTNILFPEVNALQFAFLGPLVGALSRSGSGWLADKYGGGRVT
                     IWAFILMMVGVAGVLYFVGIKDEPNAFWGFFAAFILLFFATGIGNASTFQMIPAIMAK
                     DMERLMPMASAEERRRQADKESAAITGFTSAIAAFGAFFIPKGYGTSISLTGGPEMAL
                     WAFLIFYVTCLIITWGVYTRKGGLLYDVERRLKPAAAAA"
     misc_feature    complement(285025..286215)
                     /gene="narK"
                     /locus_tag="BSVBI22_B0296"
                     /note="Nitrate/nitrite transporter [Inorganic ion
                     transport and metabolism]; Region: NarK; COG2223"
                     /db_xref="CDD:225133"
     misc_feature    complement(285049..286203)
                     /gene="narK"
                     /locus_tag="BSVBI22_B0296"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(285154..285156,285163..285168,
                     285175..285180,285187..285192,285220..285222,
                     285229..285234,285244..285246,285253..285258,
                     285265..285267,285460..285462,285472..285474,
                     285481..285483,285493..285495,285505..285507,
                     285547..285549,285556..285561,285568..285573,
                     285580..285582,285820..285822,285835..285840,
                     285847..285852,285886..285888,285895..285897,
                     285904..285909,285916..285921,286057..286062,
                     286066..286071,286081..286083,286090..286095,
                     286102..286104,286153..286158,286162..286170,
                     286177..286179))
                     /gene="narK"
                     /locus_tag="BSVBI22_B0296"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    complement(283585..284928)
                     /gene="narK"
                     /locus_tag="BSVBI22_B0296"
                     /note="lysophospholipid transporter LplT; Provisional;
                     Region: PRK11195; cl19150"
                     /db_xref="CDD:267503"
     misc_feature    complement(283588..284901)
                     /gene="narK"
                     /locus_tag="BSVBI22_B0296"
                     /note="Nitrate/nitrite transporter [Inorganic ion
                     transport and metabolism]; Region: NarK; COG2223"
                     /db_xref="CDD:225133"
     gene            286505..287215
                     /gene="ftrB"
                     /locus_tag="BSVBI22_B0297"
                     /db_xref="GeneID:11686440"
     CDS             286505..287215
                     /gene="ftrB"
                     /locus_tag="BSVBI22_B0297"
                     /note="upregulated by FixLJ/FixK under oxygen limitation;
                     involved in regulation of genes involved in carbon and
                     amino acid metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator FtrB"
                     /protein_id="YP_005108312.1"
                     /db_xref="GI:376278279"
                     /db_xref="GeneID:11686440"
                     /translation="MRRDDKIALKNQPLFADMADATFERIMRPSFVQSFPPRTMLLTE
                     NEPADFLFAVLDGLVLMSASSQDGDTALEILRPGDVFILAAVLNNDVCLQSAQTLTAT
                     RVLMVPAELVREQMSEDPAFMHAVVFELARAYRRLVKELKAQKLRSCAQRLANWIVKE
                     SLANDGADVVTIPYEKRILAAYLGMTPENLSRSFANLASHGVHVQASAIRITDKAGLL
                     QFAAPSSLIDQEEPTRPA"
     misc_feature    286505..287212
                     /gene="ftrB"
                     /locus_tag="BSVBI22_B0297"
                     /note="transcriptional activator FtrB; Provisional;
                     Region: ftrB; PRK09392"
                     /db_xref="CDD:181817"
     misc_feature    286544..286885
                     /gene="ftrB"
                     /locus_tag="BSVBI22_B0297"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    order(286748..286753,286778..286786)
                     /gene="ftrB"
                     /locus_tag="BSVBI22_B0297"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    order(286844..286852,286862..286870)
                     /gene="ftrB"
                     /locus_tag="BSVBI22_B0297"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    286955..287164
                     /gene="ftrB"
                     /locus_tag="BSVBI22_B0297"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     gene            complement(287270..288286)
                     /locus_tag="BSVBI22_B0298"
                     /db_xref="GeneID:11686441"
     CDS             complement(287270..288286)
                     /locus_tag="BSVBI22_B0298"
                     /note="similar to GP:5802909; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar-binding protein, putative"
                     /protein_id="YP_005108313.1"
                     /db_xref="GI:376278280"
                     /db_xref="GeneID:11686441"
                     /translation="MKLREFAKHMGLSATTVSRALSGYPEVAESTRKRVMEEAIRLGY
                     RPNVNAVRLVTGRAGAIGVVMGRNSEFHFAEFMRGMAERLGQDEVDILVSPTSPTGND
                     DEVQLCHRLATSGRVDAVIVTSPRPNDERIRMLHKLGMPFLVHGRSQIDIPHAWLDID
                     NESAVYHSTAHLLDLGHKRIAMINGRHGFTFSLHRDAGYRKALESRGIDFDPDLVEHG
                     DFTDEIGYCLARKLLERNPRPTAFVAGSMMTALGIYRAARSFGLTIGKDISVIAHDDV
                     ISFLSAGNMVPSLTATRSSMRAAGKRCADLLMDILDGRAPTEIHELWPVELILRESAT
                     RVPE"
     misc_feature    complement(287276..288286)
                     /locus_tag="BSVBI22_B0298"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(288122..288277)
                     /locus_tag="BSVBI22_B0298"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(288125..288130,288134..288139,
                     288146..288148,288155..288157,288194..288196,
                     288203..288208,288221..288223,288230..288235,
                     288239..288253,288275..288277))
                     /locus_tag="BSVBI22_B0298"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(288128..288157)
                     /locus_tag="BSVBI22_B0298"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(287303..288109)
                     /locus_tag="BSVBI22_B0298"
                     /note="Ligand-binding domain of DNA transcription
                     repressors specific for raffinose (RafR) and
                     alpha-glucosides (AglR) which are members of the LacI-GalR
                     family of bacterial transcription regulators; Region:
                     PBP1_AglR_RafR_like; cd06271"
                     /db_xref="CDD:107266"
     misc_feature    complement(order(287465..287467,287549..287551,
                     287702..287704,287810..287821,287852..287857,
                     288059..288061,288071..288073))
                     /locus_tag="BSVBI22_B0298"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107266"
     gene            complement(288294..288410)
                     /locus_tag="BSVBI22_B0299"
                     /db_xref="GeneID:11686442"
     CDS             complement(288294..288410)
                     /locus_tag="BSVBI22_B0299"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108314.1"
                     /db_xref="GI:376278281"
                     /db_xref="GeneID:11686442"
                     /translation="MKAVWIYCTMNDHKLQTPSAPIVKCMEAAIIRRPACPV"
     gene            288637..289902
                     /locus_tag="BSVBI22_B0300"
                     /db_xref="GeneID:11686443"
     CDS             288637..289902
                     /locus_tag="BSVBI22_B0300"
                     /note="similar to GP:5802910, and GP:2828820; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter, periplasmic sugar-binding
                     protein"
                     /protein_id="YP_005108315.1"
                     /db_xref="GI:376278282"
                     /db_xref="GeneID:11686443"
                     /translation="MRVLTGALVACAAFGFATGWAQAVEISIAANSTGDNIKFLQEQV
                     AKFEKDTGNKVNIISMPSSSSEQFSQYRLWLAAGNSDVDVYQTDIVWAPQLSDQFIDL
                     TEATKDVTDAHFPSIIASQTVNGKLVALPFYTDAPALFYRKDLLEKYNKPVPKTWDEM
                     AATAKDIMEKERADGKADLWGFVFQGNAYEGLTCNALEWIKSSGGGQIVEPDGEISVN
                     NEKAAAAIDRARGWIGTISPQGVLGYQEEESRGVWQTGNAVFMRNWPYVYALSNSADS
                     AVKGKFDVAPLPAMAEGEPPASALGGWNLAVSKYSTKQDAAIALVKFLASPEVQKAEA
                     VELSRLPTIEALYDDKDVIAAQPFMANWKPIFQNAVPRPSAATKVKYNEVSSKFWTAV
                     HKTLAGSGTAAENLELLEVELTELKGSGW"
     misc_feature    288637..289845
                     /locus_tag="BSVBI22_B0300"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    288727..289629
                     /locus_tag="BSVBI22_B0300"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            289979..290956
                     /locus_tag="BSVBI22_B0301"
                     /db_xref="GeneID:11686444"
     CDS             289979..290956
                     /locus_tag="BSVBI22_B0301"
                     /note="similar to GP:5802911, and GP:2828821; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter, permease protein"
                     /protein_id="YP_005108316.1"
                     /db_xref="GI:376278283"
                     /db_xref="GeneID:11686444"
                     /translation="MTETSLDASRSLRVRAHSDLGAQRIRSAWIFLAPTLIVLAIVAG
                     WPLLRTVYFSLTNASLTNLAGAEFVGFKNYFSWVTLKSGRTVYSGLLTDMAWWRAVWN
                     TIRFTLLSVSLETIFGLVVALVLNANFRGRGLVRAAILIPWAIPTIVSAKMWGWMLND
                     QFGILNHILLNLGIISHKIAWTANPDTAMIAILIVDVWKTTPFMALLILAGLQMVPSD
                     IYEAARIDGVHPLKVFWRVTLPLIRPALMVAIIFRMLDALRIFDLIYVLTPNNAQTKT
                     MSVYARENLFDFDKFAYGAAASTMLFLIIAGITVLYMFFGRVNIGGRGE"
     misc_feature    290054..290929
                     /locus_tag="BSVBI22_B0301"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    290279..290893
                     /locus_tag="BSVBI22_B0301"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(290324..290329,290336..290341,290354..290356,
                     290381..290392,290396..290425,290432..290437,
                     290441..290443,290567..290572,290579..290581,
                     290585..290587,290594..290599,290603..290605,
                     290615..290620,290627..290629,290678..290680,
                     290720..290725,290732..290734,290753..290764,
                     290771..290776,290813..290818,290846..290851,
                     290858..290863,290867..290872,290879..290884,
                     290891..290893)
                     /locus_tag="BSVBI22_B0301"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(290399..290443,290753..290770)
                     /locus_tag="BSVBI22_B0301"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(290441..290443,290552..290554,290771..290773,
                     290807..290809,290816..290818,290846..290848)
                     /locus_tag="BSVBI22_B0301"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(290630..290668,290684..290689,290699..290701)
                     /locus_tag="BSVBI22_B0301"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            290959..291786
                     /locus_tag="BSVBI22_B0302"
                     /db_xref="GeneID:11686445"
     CDS             290959..291786
                     /locus_tag="BSVBI22_B0302"
                     /note="similar to GP:5802912, and GP:13517311; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter, permease protein"
                     /protein_id="YP_005108317.1"
                     /db_xref="GI:376278284"
                     /db_xref="GeneID:11686445"
                     /translation="MMRFVKRSAFYLLVALIILVAVFPFYYAIITSFKSGTALFQVDY
                     WPKSLSLDNYTGVLTQGSFVRSLGNSLLVATVVVAISLLLAVTAAYALARVRFRGRGL
                     LLLTILSVSMFPQIAVLAGLFELIRFLGIFNTPLALIFSYMIFTLPFTVWVLTTFMRD
                     LPVEIEEAAIVDGASPWVIITRVFMPLMWPALVTTGLLAFISAWNEFLFALTFTSSGS
                     QRTVPVAIALLSGSSQFEIPWGNIMAASVIVTVPLVILVLIFQRRIVSGLTAGGVKG"
     misc_feature    290959..291780
                     /locus_tag="BSVBI22_B0302"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    291157..291705
                     /locus_tag="BSVBI22_B0302"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(291205..291210,291217..291222,291235..291237,
                     291265..291276,291280..291309,291316..291321,
                     291325..291327,291391..291393,291397..291399,
                     291403..291405,291412..291417,291421..291423,
                     291433..291438,291445..291447,291496..291498,
                     291538..291543,291550..291552,291571..291582,
                     291589..291594,291631..291636,291664..291669,
                     291676..291681,291685..291690,291697..291702)
                     /locus_tag="BSVBI22_B0302"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(291283..291327,291571..291588)
                     /locus_tag="BSVBI22_B0302"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(291325..291327,291385..291387,291589..291591,
                     291625..291627,291634..291636,291664..291666)
                     /locus_tag="BSVBI22_B0302"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(291448..291486,291502..291507,291517..291519)
                     /locus_tag="BSVBI22_B0302"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            291793..292794
                     /locus_tag="BSVBI22_B0303"
                     /db_xref="GeneID:11686446"
     CDS             291793..292794
                     /locus_tag="BSVBI22_B0303"
                     /note="similar to GP:5802913; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter, ATP-binding protein"
                     /protein_id="YP_005108318.1"
                     /db_xref="GI:376278285"
                     /db_xref="GeneID:11686446"
                     /translation="MAELQLRDVRKSFGSFEVIKGVDMDIRPGEFMVFVGPSGCGKST
                     LLRLIAGLEEITSGTLSIDGTVVNSFNPSRRGIAMVFQSYALYPHMTVYENMAFGMQL
                     AGKSRQECKARIHAAAEMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEP
                     LSNLDAALRVATRLEIARLHQSMEDTTMIYVTHDQVEAMTLADRICVLRDGRVEQIGT
                     PLELYEKPNSLFVAGFIGSPKMNFLTGPHAEPFGAHTVGLRSEHLAIVPERGHWSGQV
                     VHTEILGSDTYVYIDLGLEEPLVVRESGVSARKPGETLSISPTGDHVHRFDEKGRAV"
     misc_feature    291793..292779
                     /locus_tag="BSVBI22_B0303"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    291802..292443
                     /locus_tag="BSVBI22_B0303"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    291898..291921
                     /locus_tag="BSVBI22_B0303"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(291907..291912,291916..291924,292036..292038,
                     292264..292269,292369..292371)
                     /locus_tag="BSVBI22_B0303"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    292027..292038
                     /locus_tag="BSVBI22_B0303"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    292192..292221
                     /locus_tag="BSVBI22_B0303"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    292252..292269
                     /locus_tag="BSVBI22_B0303"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    292276..292287
                     /locus_tag="BSVBI22_B0303"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    292357..292377
                     /locus_tag="BSVBI22_B0303"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    292558..292770
                     /locus_tag="BSVBI22_B0303"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            292833..293642
                     /locus_tag="BSVBI22_B0304"
                     /db_xref="GeneID:11686447"
     CDS             292833..293642
                     /locus_tag="BSVBI22_B0304"
                     /note="similar to GP:5802914; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108319.1"
                     /db_xref="GI:376278286"
                     /db_xref="GeneID:11686447"
                     /translation="MPSTRRIFMPIRTIVWGENIHEQINEIVRSIYPEGMHNTIAGAL
                     NEDGAIEATTATLQEPEHGLLTERLAQTDVLVWWGHMDHGGVSDDVVERVARRVFEGM
                     GLIVLHSGHFSKIFKRLMGTPCALKWREAGERERVWVVNRGHPIAQGLEETFVLENEE
                     MYGEQFSVPEPLETVFISWFAGGEVFRSGMTWRRGAGNVFYFRPGHETYPTYHDANVR
                     TVLRNAVKWAYNPQPAWTGIHTAPNVPVEKALEPIVERGPKLHKAGEAGYR"
     misc_feature    292857..293639
                     /locus_tag="BSVBI22_B0304"
                     /note="Trehalose utilization protein [Carbohydrate
                     transport and metabolism]; Region: ThuA; COG4813"
                     /db_xref="CDD:227150"
     misc_feature    293154..293156
                     /locus_tag="BSVBI22_B0304"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153222"
     gene            293651..294697
                     /locus_tag="BSVBI22_B0305"
                     /db_xref="GeneID:11686448"
     CDS             293651..294697
                     /locus_tag="BSVBI22_B0305"
                     /note="similar to GP:5802915; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="YP_005108320.1"
                     /db_xref="GI:376278287"
                     /db_xref="GeneID:11686448"
                     /translation="MRLLILGTGGMAENHAEAFKAIEGVEVVAACDVSAVRVDAFSEN
                     HDIHNRFTRLEDALAWNRFDAVANVTPDAVHHPTTLALVGAGKHVFCEKPLAESYEKA
                     AEMADAAQQAGVVNMVNLTYRNVAPLQKAREMVMAGEIGQVRHFEASYLQSWLVSKAW
                     GDWKTESKWLWRLSTRHGSNGVLGDVGIHILDFATYAIGSDVERASAHLKTFEKAENN
                     HIGEYVLDANDSFVMMAEYANGALGVIHASRWATGHLNELRLRIHGDKGALEILHTPT
                     GSSLRGSIGEDIETPVWRDIDAGTVETNYQRFARAVADGTELEPSFCHAANLQRVLDH
                     AMHVDKPLPEVATG"
     misc_feature    293651..294688
                     /locus_tag="BSVBI22_B0305"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    293651..294007
                     /locus_tag="BSVBI22_B0305"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    294044..294397
                     /locus_tag="BSVBI22_B0305"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            294934..295431
                     /locus_tag="BSVBI22_B0306"
                     /db_xref="GeneID:11686449"
     CDS             294934..295431
                     /locus_tag="BSVBI22_B0306"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108321.1"
                     /db_xref="GI:376278288"
                     /db_xref="GeneID:11686449"
                     /translation="MTRIFSENRFTLFGMRSKYSPLLFLRDQTGRFNGLFCCSLVCAN
                     GLANQANWYSLKARESWSMRMKYTKPDIILQSVTRLEEQNAWEIKMRVIFRNIGSHIL
                     TLPIPMEKILDGGVRHTLTMSEAADEAQRIVITDLLATAALNADWLDENVRAAIYNAF
                     PNARP"
     gene            295745..297373
                     /locus_tag="BSVBI22_B0307"
                     /db_xref="GeneID:11686450"
     CDS             295745..297373
                     /locus_tag="BSVBI22_B0307"
                     /note="similar to GP:15073164, and GP:12055084; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, putative"
                     /protein_id="YP_005108322.1"
                     /db_xref="GI:376278289"
                     /db_xref="GeneID:11686450"
                     /translation="MPQRVSPLAPFQNKTFRALWSATLVSNLGGLVQTVGAGWMMATI
                     ARSDDMVALVQASTTLPVMIFSVAAGALADNFDRRRIMLVAQILLLGISVILAACAYF
                     NVLTPWMLLSFTFLIGCGGALHNPSWQASMGDIVPRHDLPAAVALNSMSFNLMRSIGP
                     AIGGLIVAAAGAAFAFIFNAFSYCALILALWQWKPQTAKSTLPREKFGGAMVAGLRYV
                     SMSPNLLKVMFRGFLFGLSAIVILALLPLVARDLVKGTALTYGIMLGFFGLGAIGGAI
                     LSARLRELMGNEWLVRGSFVAFAASCVLLSLSRQMWLSCLFLLPAGVAWVLALSLFNV
                     TVQLSTPRWVVGRALALYQTATFGGMAAGSWLWGALADTFGVPNALLVSAAVLLFGAL
                     IGLLLPQPEFESLNLDPLNRFSEPQLRLDLRSRSGPIMIMVDYKIAQDDVPAFLAAMT
                     LRRRIRIRDGARQWALLRDLENPELWTESYHVPTWVEYVRHNQRRTQADAEVSERLLA
                     LHCGTTPPVVHRMIERQTVPVHDDMPLKTHLDLT"
     misc_feature    295757..297322
                     /locus_tag="BSVBI22_B0307"
                     /note="Transmembrane secretion effector; Region: MFS_3;
                     pfam05977"
                     /db_xref="CDD:253487"
     misc_feature    295790..296938
                     /locus_tag="BSVBI22_B0307"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(295832..295834,295841..295849,295853..295858,
                     295907..295909,295916..295921,295928..295930,
                     295940..295945,295949..295954,296105..296110,
                     296117..296122,296129..296134,296141..296143,
                     296177..296182,296189..296194,296210..296212,
                     296447..296449,296456..296461,296468..296473,
                     296480..296482,296522..296524,296534..296536,
                     296546..296548,296555..296557,296567..296569,
                     296708..296710,296717..296722,296729..296731,
                     296741..296746,296753..296755,296786..296791,
                     296798..296803,296810..296815,296822..296824)
                     /locus_tag="BSVBI22_B0307"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            297360..297476
                     /locus_tag="BSVBI22_B0308"
                     /db_xref="GeneID:11686451"
     CDS             297360..297476
                     /locus_tag="BSVBI22_B0308"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108323.1"
                     /db_xref="GI:376278290"
                     /db_xref="GeneID:11686451"
                     /translation="MILPDKASFLCSLSLQFTGSGKALPEFSLFPIYLLTGN"
     gene            complement(297530..297856)
                     /locus_tag="BSVBI22_B0309"
                     /db_xref="GeneID:11686452"
     CDS             complement(297530..297856)
                     /locus_tag="BSVBI22_B0309"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108324.1"
                     /db_xref="GI:376278291"
                     /db_xref="GeneID:11686452"
                     /translation="MKLNLERRTGTGGTKLTGHILHPEAFEREFGAAKPADKKCQTGK
                     LLADRTPRPWTFTLKAGLLAHGSTLPPAFPAFASGMGRKARRLQLRGQLRHCPPTMGK
                     RTGFPS"
     gene            298050..298271
                     /gene="nrdH"
                     /locus_tag="BSVBI22_B0310"
                     /db_xref="GeneID:11686453"
     CDS             298050..298271
                     /gene="nrdH"
                     /locus_tag="BSVBI22_B0310"
                     /note="similar to GP:1800061; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin-like protein nrdH"
                     /protein_id="YP_005108325.1"
                     /db_xref="GI:376278292"
                     /db_xref="GeneID:11686453"
                     /translation="MNVTVYSKPACVQCTATTRALDRQGIDYKVIDISADANAFDLVQ
                     GMGYRQVPVVVAGENHWAGFRPDMISSLA"
     misc_feature    298053..298268
                     /gene="nrdH"
                     /locus_tag="BSVBI22_B0310"
                     /note="NrdH-redoxin (NrdH) family; NrdH is a small
                     monomeric protein with a conserved redox active CXXC motif
                     within a TRX fold, characterized by a glutaredoxin
                     (GRX)-like sequence and TRX-like activity profile. In
                     vitro, it displays protein disulfide reductase...; Region:
                     NrdH; cd02976"
                     /db_xref="CDD:239274"
     misc_feature    order(298080..298082,298089..298091)
                     /gene="nrdH"
                     /locus_tag="BSVBI22_B0310"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239274"
     gene            298285..298692
                     /gene="nrdI"
                     /locus_tag="BSVBI22_B0311"
                     /db_xref="GeneID:11686454"
     CDS             298285..298692
                     /gene="nrdI"
                     /locus_tag="BSVBI22_B0311"
                     /note="in Salmonella NrdI has a stimulatory effect on the
                     ribonucleotide reductase activity of NrdH with NrdEF"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide reductase stimulatory protein"
                     /protein_id="YP_005108326.1"
                     /db_xref="GI:376278293"
                     /db_xref="GeneID:11686454"
                     /translation="MSLIVYFSSRSGNTHRFVERLGVRSSRIPLEASGALQVREPFVL
                     VTPTYGGGSTKGAVPNPVIRFLNDADNRALIRGVIAAGNSNFGEAFCIAGNIISAKCG
                     VPYLYRFELLGTAEDVGNVRNGMEQFWTRQTQA"
     misc_feature    298285..298686
                     /gene="nrdI"
                     /locus_tag="BSVBI22_B0311"
                     /note="ribonucleotide reductase stimulatory protein;
                     Reviewed; Region: nrdI; PRK03600"
                     /db_xref="CDD:179603"
     gene            298743..300884
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /db_xref="GeneID:11686455"
     CDS             298743..300884
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /note="Catalyzes the rate-limiting step in dNTP synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     alpha"
                     /protein_id="YP_005108327.1"
                     /db_xref="GI:376278294"
                     /db_xref="GeneID:11686455"
                     /translation="MTAGKPAKSSDGLDYHALNAMLNLYDEDGKIQLDCDRQAARQYF
                     LQHVNQNTVFFHNLREKLDYLVAEGYYEQTVLDQYSFNFVRDLFDEAYARKFRFPTFL
                     GAFKYYTSYTLKTFDGKRYLERYEDRVCMVALTLARGDEQLARDLVEEIISGRYQPAT
                     PTFLNAGKKQRGELVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALCLTNLREAGA
                     PIKQIENQSSGIIPVMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENA
                     DEKIRIKTLSLGVVIPDITFELARNNEDMYLFSPYDVQRVYGVPLTEISVTEKYREMV
                     NDAQIAKKKINAREFFQVLAEIQFESGYPYIMFEDTVNRANPIDGRITMSNLCSEILQ
                     VSEASLFHEDLSYEYLGKDISCNLGSLNIAAAMDAPDFGKTIETSIRALTAVSDMSHI
                     GCVPSVARGNAESHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVAYHAVRAS
                     NRIAVETGKSFKGFEKSKYASGEYFDKYTDQAWAPATEKVRRIFEDAGIAIPTQDDWC
                     ALKKAVMEGGLYNQNLQAVPPTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAA
                     FMTNDNLEYYQDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFRDTATTRDINRAQIYA
                     WKKGIKTIYYIRLRQMALEGTQVQGCVSCAL"
     misc_feature    298743..300881
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /note="ribonucleotide-diphosphate reductase subunit alpha;
                     Validated; Region: PRK08188"
                     /db_xref="CDD:236179"
     misc_feature    298785..299030
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /note="Ribonucleotide reductase N-terminal; Region: RNR_N;
                     pfam08343"
                     /db_xref="CDD:254744"
     misc_feature    299115..300824
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /note="Class I ribonucleotide reductase; Region: RNR_I;
                     cd01679"
                     /db_xref="CDD:153088"
     misc_feature    order(299220..299225,299268..299273,299355..299357,
                     299895..299897,299901..299903,299907..299909,
                     299988..299990,300498..300515)
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /note="active site"
                     /db_xref="CDD:153088"
     misc_feature    order(299259..299261,299298..299303,299310..299312,
                     299319..299324,299331..299336,299343..299345,
                     299388..299390,299424..299426,299436..299441,
                     299445..299450,299457..299462,299469..299483)
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153088"
     misc_feature    order(299271..299273,299895..299897,299901..299903,
                     299907..299909,299982..299984,300813..300818)
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:153088"
     misc_feature    order(299292..299300,299307..299309,299343..299345,
                     299382..299384,299424..299426,299439..299441)
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /note="effector binding site; other site"
                     /db_xref="CDD:153088"
     misc_feature    order(299619..299621,299628..299633,299637..299642,
                     299781..299783,299793..299795,299814..299816,
                     300753..300761,300765..300770,300780..300785,
                     300789..300794)
                     /gene="nrdE"
                     /locus_tag="BSVBI22_B0312"
                     /note="R2 peptide binding site; other site"
                     /db_xref="CDD:153088"
     gene            300899..301888
                     /gene="nrdF"
                     /locus_tag="BSVBI22_B0313"
                     /db_xref="GeneID:11686456"
     CDS             300899..301888
                     /gene="nrdF"
                     /locus_tag="BSVBI22_B0313"
                     /note="B2 or R2 protein; type 1b enzyme; catalyzes the
                     rate-limiting step in dNTP synthesis; converts nucleotides
                     to deoxynucleotides; forms a homodimer and then a
                     multimeric complex with NrdE"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     beta"
                     /protein_id="YP_005108328.1"
                     /db_xref="GI:376278295"
                     /db_xref="GeneID:11686456"
                     /translation="MNMQYKTATKGRPASVRAINWNRIEDDKDLEVWNRLTGNFWLPE
                     KVPLSNDIQSWETLKPQEKQLTIRVFTGLTLLDTIQNAVGAVKLMDDALTPHEEAVLS
                     NISFMEAVHARSYSSIFSTLCLTPDVDDAYRWSEENEFLQRKSTLILDQYHADDPLKK
                     KIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRALE
                     VLSEEKRQEIKDFAFELLLELYDNEVRYTEALYDGVGLTEDVKKFLHYNANKALMNLG
                     YEALFPAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWAF"
     misc_feature    300953..301768
                     /gene="nrdF"
                     /locus_tag="BSVBI22_B0313"
                     /note="Ribonucleotide Reductase, R2/beta subunit,
                     ferritin-like diiron-binding domain; Region: RNRR2;
                     cd01049"
                     /db_xref="CDD:153108"
     misc_feature    order(300953..300955,300986..300988,301007..301009,
                     301202..301207,301214..301216,301223..301228,
                     301235..301237,301244..301246,301292..301297,
                     301304..301306)
                     /gene="nrdF"
                     /locus_tag="BSVBI22_B0313"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    order(301019..301021,301127..301129,301220..301222,
                     301229..301231,301241..301243,301496..301501,
                     301511..301513)
                     /gene="nrdF"
                     /locus_tag="BSVBI22_B0313"
                     /note="putative radical transfer pathway; other site"
                     /db_xref="CDD:153108"
     misc_feature    order(301127..301129,301220..301222,301229..301231,
                     301400..301402,301502..301504,301511..301513)
                     /gene="nrdF"
                     /locus_tag="BSVBI22_B0313"
                     /note="diiron center [ion binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    301241..301243
                     /gene="nrdF"
                     /locus_tag="BSVBI22_B0313"
                     /note="tyrosyl radical; other site"
                     /db_xref="CDD:153108"
     gene            complement(302058..302282)
                     /locus_tag="BSVBI22_B0314"
                     /db_xref="GeneID:11686457"
     CDS             complement(302058..302282)
                     /locus_tag="BSVBI22_B0314"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108329.1"
                     /db_xref="GI:376278296"
                     /db_xref="GeneID:11686457"
                     /translation="MHVAILPPSLSLGALRGIRRLSAFDRRWGGRVSMPETYSSKNNF
                     SRIRILFLLFFNRLKLKDLLFSHHFTAQIT"
     gene            302416..302508
                     /locus_tag="BSVBI22_B0315"
                     /db_xref="GeneID:11686458"
     CDS             302416..302508
                     /locus_tag="BSVBI22_B0315"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108330.1"
                     /db_xref="GI:376278297"
                     /db_xref="GeneID:11686458"
                     /translation="MLKKAFLEHDPGGMNEYWQDYNFIRMCLYC"
     gene            302493..302624
                     /locus_tag="BSVBI22_B0316"
                     /db_xref="GeneID:11686459"
     CDS             302493..302624
                     /locus_tag="BSVBI22_B0316"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108331.1"
                     /db_xref="GI:376278298"
                     /db_xref="GeneID:11686459"
                     /translation="MLILLIPFIWIEARSNRQYCLWTSWNLRGVSSFIAQSAPFYRE"
     gene            302754..303515
                     /gene="minC"
                     /locus_tag="BSVBI22_B0317"
                     /db_xref="GeneID:11686460"
     CDS             302754..303515
                     /gene="minC"
                     /locus_tag="BSVBI22_B0317"
                     /note="blocks the formation of polar Z-ring septums"
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor"
                     /protein_id="YP_005108332.1"
                     /db_xref="GI:376278299"
                     /db_xref="GeneID:11686460"
                     /translation="MPLTKMNQVLTETRPIRLKGRSFLAMVLSPELPLDGWLELLDDL
                     ARRSSGFFLGRPVVLDMENLAIERAQLVYLLQALNDRGVWIMGVEGARPSLLGPGMPP
                     AMRGGQPAADFEAPAGEPQANPGAPEPQISQAVRAPGHAVHAMPSMVITEPVRSGQSV
                     YFPEGDVTIVGSVASGAEVVAGGSIHIYGTLRGRALAGTAGNTSARIFCRKLEAELVA
                     IDGLYKTAEDLEPRFRGQAVQLWLDGDYMMIDTLS"
     misc_feature    302769..303512
                     /gene="minC"
                     /locus_tag="BSVBI22_B0317"
                     /note="septum formation inhibitor; Reviewed; Region: minC;
                     PRK05177"
                     /db_xref="CDD:235357"
     misc_feature    303198..303509
                     /gene="minC"
                     /locus_tag="BSVBI22_B0317"
                     /note="Septum formation inhibitor MinC, C-terminal domain;
                     Region: MinC_C; pfam03775"
                     /db_xref="CDD:146423"
     gene            303543..304358
                     /gene="minD"
                     /locus_tag="BSVBI22_B0318"
                     /db_xref="GeneID:11686461"
     CDS             303543..304358
                     /gene="minD"
                     /locus_tag="BSVBI22_B0318"
                     /note="similar to GP:15160138, and SP:P18197; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinD"
                     /protein_id="YP_005108333.1"
                     /db_xref="GI:376278300"
                     /db_xref="GeneID:11686461"
                     /translation="MGKVIVVTSGKGGVGKTTSTAALGAALAQRNEKVVVVDFDVGLR
                     NLDLVMGAERRVVYDFVNVIQGDAKLTQALIRDKRLETLYLLPASQTRDKDTLTEEGV
                     DLVIDQLKKSFDWVICDSPAGIERGATLAMRHADVAVVVTNPEVSSVRDSDRIIGLLD
                     SKTLKAERGEKMDKHLLLTRYDPSRAERGDMLKVEDVLEILSIPLLGIIPESQDVLRA
                     SNVGSPVTLADQRSAPAMAYLDAARRLAGEDVPMNVPSEKRGLLGKLFGRRAA"
     misc_feature    303543..304355
                     /gene="minD"
                     /locus_tag="BSVBI22_B0318"
                     /note="Septum formation inhibitor-activating ATPase [Cell
                     division and chromosome partitioning]; Region: MinD;
                     COG2894"
                     /db_xref="CDD:225447"
     misc_feature    303552..304256
                     /gene="minD"
                     /locus_tag="BSVBI22_B0318"
                     /note="Bacterial cell division requires the formation of a
                     septum at mid-cell. The site is determined by the min
                     operon products MinC, MinD and MinE. MinC is a nonspecific
                     inhibitor of the septum protein FtsZ. MinE is the
                     supressor of MinC. MinD plays a pivotal...; Region: MinD;
                     cd02036"
                     /db_xref="CDD:238993"
     misc_feature    303570..303596
                     /gene="minD"
                     /locus_tag="BSVBI22_B0318"
                     /note="P-loop; other site"
                     /db_xref="CDD:238993"
     misc_feature    order(303579..303581,303585..303596,304170..304172)
                     /gene="minD"
                     /locus_tag="BSVBI22_B0318"
                     /note="ADP binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:238993"
     misc_feature    303654..303662
                     /gene="minD"
                     /locus_tag="BSVBI22_B0318"
                     /note="Switch I; other site"
                     /db_xref="CDD:238993"
     misc_feature    303897..303911
                     /gene="minD"
                     /locus_tag="BSVBI22_B0318"
                     /note="Switch II; other site"
                     /db_xref="CDD:238993"
     gene            304355..304627
                     /gene="minE"
                     /locus_tag="BSVBI22_B0319"
                     /db_xref="GeneID:11686462"
     CDS             304355..304627
                     /gene="minE"
                     /locus_tag="BSVBI22_B0319"
                     /note="works in conjunction with MinC and MinD to enable
                     cell division at the midpoint of the long axis of the
                     cell"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division topological specificity factor
                     MinE"
                     /protein_id="YP_005108334.1"
                     /db_xref="GI:376278301"
                     /db_xref="GeneID:11686462"
                     /translation="MSIFRFFTRQQASAPQARERLQVLLAHERASYGGQSDLVAVLRE
                     EILAVIAKHIKVDREKVSVKMDRGDQVSTLEVDIELPLTAKKGRAA"
     misc_feature    304355..304612
                     /gene="minE"
                     /locus_tag="BSVBI22_B0319"
                     /note="cell division topological specificity factor MinE;
                     Reviewed; Region: minE; PRK00296"
                     /db_xref="CDD:234718"
     gene            304671..304838
                     /locus_tag="BSVBI22_B0320"
                     /db_xref="GeneID:11686463"
     CDS             304671..304838
                     /locus_tag="BSVBI22_B0320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108335.1"
                     /db_xref="GI:376278302"
                     /db_xref="GeneID:11686463"
                     /translation="MNRGTLLARLRELQALPKFQKRDICSISSFLSLDALAEHVRVCE
                     EAAGVASAAQS"
     gene            complement(304955..305031)
                     /gene="tRNA-Asp-2"
                     /locus_tag="BSVBI22_Bt02"
                     /db_xref="GeneID:11686464"
     tRNA            complement(304955..305031)
                     /gene="tRNA-Asp-2"
                     /locus_tag="BSVBI22_Bt02"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:11686464"
     gene            complement(305167..305559)
                     /locus_tag="BSVBI22_B0321"
                     /db_xref="GeneID:11686465"
     CDS             complement(305167..305559)
                     /locus_tag="BSVBI22_B0321"
                     /note="similar to GP:15159179, and GP:15159179; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108336.1"
                     /db_xref="GI:376278303"
                     /db_xref="GeneID:11686465"
                     /translation="MGIFDKIKNAIWGEAQAATPTAETPAATPSTPAAPVPAAGSAAP
                     ASGSVDVGAILDAAVKKSGQALNWKTFIVDLMKALGLDSSLQHRKELAQELGYTGDIN
                     DSATMNVWLHKQVIQKLKDSGGKLPAGL"
     misc_feature    complement(305179..305553)
                     /locus_tag="BSVBI22_B0321"
                     /note="Domain of unknown function (DUF3597); Region:
                     DUF3597; pfam12200"
                     /db_xref="CDD:256897"
     gene            305935..306981
                     /locus_tag="BSVBI22_B0322"
                     /db_xref="GeneID:11686466"
     CDS             305935..306981
                     /locus_tag="BSVBI22_B0322"
                     /note="similar to GP:14524112, and GP:17428750; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter,
                     periplasmic spermidine/putrescine-binding protein,
                     putative"
                     /protein_id="YP_005108337.1"
                     /db_xref="GI:376278304"
                     /db_xref="GeneID:11686466"
                     /translation="MKFARLALMGGIFATVAFTVGPAFARDLTVASWGGNYQDAQREI
                     YFKPFAEKTGKPLLDESWDGGYGVIQSKVKAGSPNWDVVQVEAEELALGCADGLYEKI
                     DWDKVGGKDKFLDSAVNDCGVGAIVWSTAIAYNGDKLKDGPKSWADFWDVKKFPGKRS
                     LRKSAKYTLEFALMADGVDKDDVYDVLSTPEGVDRAFKKLDELKPHIVWWEAGAQPLQ
                     LLASDEVVMASAYNGRITGINRSEGKNFKVVWPGSIYAVDSWVILKGAENKDAGLDFI
                     AFASEPEHQVKLPKYVAYGLPNKEAAAKVPEEYAADLPTAKANMKDALALDVDFWIDH
                     SEELTKRFNAWLAQ"
     misc_feature    305947..306969
                     /locus_tag="BSVBI22_B0322"
                     /note="Spermidine/putrescine-binding periplasmic protein
                     [Amino acid transport and metabolism]; Region: PotD;
                     COG0687"
                     /db_xref="CDD:223759"
     gene            307055..308122
                     /locus_tag="BSVBI22_B0323"
                     /db_xref="GeneID:11686467"
     CDS             307055..308122
                     /locus_tag="BSVBI22_B0323"
                     /note="similar to GP:14524111; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter,
                     ATP-binding protein, putative"
                     /protein_id="YP_005108338.1"
                     /db_xref="GI:376278305"
                     /db_xref="GeneID:11686467"
                     /translation="MTDYRIRFENISKSYGDFKVIDGLNLDIERGEFVSLLGPSGSGK
                     TTLLMMLAGFENPSSGTIHVDGKSINSVPSYKRNMGVVFQNYALFPHMTVAENIAFPL
                     QMRGVGKAQAAEKVARVLDMVQLSAMSERKPSQLSGGQQQRVALARALVFEPHVVLMD
                     EPLGALDKQLREQMQLDIRALHNRLGLTIVFVTHDQSEALTMSDRIAVFNKGKIEQIG
                     SPRAIYDEPQTRFVAEFIGETNLAEGTVESVEGSRILIRLKDGAAIAASSASRPISGQ
                     NVLLSIRPERIELGEADGAENRLAARVMDSVYQGDHLRIQLEAKAHNFVVRLDRKARE
                     WQPGADVAASFKAADCWTILV"
     misc_feature    307070..308107
                     /locus_tag="BSVBI22_B0323"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    307070..307765
                     /locus_tag="BSVBI22_B0323"
                     /note="ATP-binding cassette domain of the polyamine
                     transporter; Region: ABC_PotA_N; cd03300"
                     /db_xref="CDD:213267"
     misc_feature    307166..307189
                     /locus_tag="BSVBI22_B0323"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213267"
     misc_feature    order(307175..307180,307184..307192,307304..307306,
                     307532..307537,307634..307636)
                     /locus_tag="BSVBI22_B0323"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213267"
     misc_feature    307295..307306
                     /locus_tag="BSVBI22_B0323"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213267"
     misc_feature    307460..307489
                     /locus_tag="BSVBI22_B0323"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213267"
     misc_feature    307520..307537
                     /locus_tag="BSVBI22_B0323"
                     /note="Walker B; other site"
                     /db_xref="CDD:213267"
     misc_feature    307544..307555
                     /locus_tag="BSVBI22_B0323"
                     /note="D-loop; other site"
                     /db_xref="CDD:213267"
     misc_feature    307622..307642
                     /locus_tag="BSVBI22_B0323"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213267"
     misc_feature    307892..308107
                     /locus_tag="BSVBI22_B0323"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            308056..309294
                     /locus_tag="BSVBI22_B0324"
                     /db_xref="GeneID:11686468"
     CDS             308056..309294
                     /locus_tag="BSVBI22_B0324"
                     /note="similar to GP:14524110, and SP:P23860; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter, permease
                     protein, putative"
                     /protein_id="YP_005108339.1"
                     /db_xref="GI:376278306"
                     /db_xref="GeneID:11686468"
                     /translation="MAAGCGRGRKLQGRRLLDHPRMTAPSSRTLRAGLLVTPLLIFIV
                     VFFLSPLGVMMKQAVSDTAVLHVLPQTAEAISQWDGQSGPTPAMKEALVADLKGSSDQ
                     QAIGDMVRRLNSAQAGFRTLMSKTLRAIDKEGPPPDLEAVDKRWSRPEFWLAIANALS
                     PLTDRNLLAAVDMERDTSGEIVSMAPGSSANRAIMIRTFWIAALVTLACVAIGYPYAV
                     LLVSSSGWVRNVLFAAVLLPLWTSLLVRTAAWFILLQDKGLINDSLIWLGITDRPFPL
                     IFNRTGVVIAMTHVLLPFMVLPIYSVLVSIPGNLMPAAASLGAPPWRAFLRVLLPLSM
                     RGILSGMLLVFMSAIGYYITPALIGGPGDQMISSIIAYYATGSANWGMAGALGLVLLV
                     ACLILYAVYGRLTADDEGRA"
     misc_feature    308422..309291
                     /locus_tag="BSVBI22_B0324"
                     /note="2-aminoethylphosphonate transport system permease
                     PhnU; Provisional; Region: PRK15050"
                     /db_xref="CDD:237888"
     misc_feature    308638..309240
                     /locus_tag="BSVBI22_B0324"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(308686..308691,308698..308703,308716..308718,
                     308746..308757,308761..308790,308797..308802,
                     308806..308808,308917..308922,308926..308928,
                     308935..308937,308944..308949,308953..308955,
                     308965..308970,308977..308979,309028..309030,
                     309070..309075,309082..309084,309103..309114,
                     309121..309126,309163..309165,309190..309195,
                     309202..309207,309211..309216,309223..309228,
                     309235..309240)
                     /locus_tag="BSVBI22_B0324"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(308764..308808,309103..309120)
                     /locus_tag="BSVBI22_B0324"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(308806..308808,308902..308904,309121..309123,
                     309157..309159,309190..309192)
                     /locus_tag="BSVBI22_B0324"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(308980..309018,309034..309039,309049..309051)
                     /locus_tag="BSVBI22_B0324"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            309297..310073
                     /locus_tag="BSVBI22_B0325"
                     /db_xref="GeneID:11686469"
     CDS             309297..310073
                     /locus_tag="BSVBI22_B0325"
                     /note="similar to GP:14524109, GB:X59932, SP:P41240,
                     PID:30256, and PID:30315; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter, permease
                     protein"
                     /protein_id="YP_005108340.1"
                     /db_xref="GI:376278307"
                     /db_xref="GeneID:11686469"
                     /translation="MGRVAKILFGVAAVVFLVAPLFAILPLAFTSSVFLTYPVPGWSV
                     RWFEELTTAEVWRRAIVNSLIIGFGTMALATVLGTMAALGLRTRGLFLSGPIRTLFLL
                     PMVVPAVVLGVGMQLFFVRLDIANSYFGVIVAHTVVSIPFVLVSVSGALAGIDRRLEL
                     AAESLGAAPLTVFRKITLPLAMPGIASGGVLAFATSLDEVVLTLFVAGPNQRTLARQM
                     FSTIRENISPAIAAAAFLFISGTVLIGLAAVLFKGRASPQ"
     misc_feature    309303..310070
                     /locus_tag="BSVBI22_B0325"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    309474..309938
                     /locus_tag="BSVBI22_B0325"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(309522..309527,309534..309539,309552..309554,
                     309582..309593,309597..309626,309633..309638,
                     309642..309644,309705..309710,309714..309716,
                     309720..309722,309729..309734,309738..309740,
                     309750..309755,309762..309764,309813..309815,
                     309855..309860,309867..309869,309888..309899,
                     309906..309911)
                     /locus_tag="BSVBI22_B0325"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(309600..309644,309888..309905)
                     /locus_tag="BSVBI22_B0325"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(309642..309644,309690..309692,309906..309908)
                     /locus_tag="BSVBI22_B0325"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(309765..309803,309819..309824,309834..309836)
                     /locus_tag="BSVBI22_B0325"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            310385..310564
                     /locus_tag="BSVBI22_B0326"
                     /db_xref="GeneID:11686470"
     CDS             310385..310564
                     /locus_tag="BSVBI22_B0326"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108341.1"
                     /db_xref="GI:376278308"
                     /db_xref="GeneID:11686470"
                     /translation="MQAGSLRERFRCGLSIMIELQVFHFGTAILYSQAPSKFWGIEIY
                     ISKIAHINFIKLTFL"
     gene            310561..310785
                     /locus_tag="BSVBI22_B0327"
                     /db_xref="GeneID:11686471"
     CDS             310561..310785
                     /locus_tag="BSVBI22_B0327"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108342.1"
                     /db_xref="GI:376278309"
                     /db_xref="GeneID:11686471"
                     /translation="MSAMFNKFLNKTELSFETYWKLALIDAPALHLLSGGVRYRILRA
                     SLKRCFSFRFVQAAVLVKKFMFCNEIARVR"
     gene            311022..311549
                     /locus_tag="BSVBI22_B0328"
                     /db_xref="GeneID:11686472"
     CDS             311022..311549
                     /locus_tag="BSVBI22_B0328"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108343.1"
                     /db_xref="GI:376278310"
                     /db_xref="GeneID:11686472"
                     /translation="MSDPFYMNNLCNLDTPKGRAHSYINTYNVERAFRDNYTRYEYSF
                     IEFYAEHLCDLSRAFKGDMQMVLLLATVAQVALRADMIVENSGGRVQELPPSRRGITT
                     YRLADVTGIPRETTRRKLTAMEKMGWLTRENNFWCLAYEGDDAKIHQDLADVIDRSFR
                     RAARFYVAVTPLVNS"
     misc_feature    311307..>311435
                     /locus_tag="BSVBI22_B0328"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     gene            complement(311691..312191)
                     /locus_tag="BSVBI22_B0329"
                     /db_xref="GeneID:11686473"
     CDS             complement(311691..312191)
                     /locus_tag="BSVBI22_B0329"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108344.1"
                     /db_xref="GI:376278311"
                     /db_xref="GeneID:11686473"
                     /translation="MKTLITALFLAGIALSAASAPAAAAGFECAYKKAPGDMKHVPDI
                     KYLEGGLTPAMFHQRLAEMVQKLVADKVPPALIVDHFVWAYCPSVAADKSLNDKQKTE
                     HVRRFAADVAALAYTAPSADELDVLVTLPLTQNLLDQIDSAAKDKKISRDDWMLNALQ
                     HAIPTP"
     gene            complement(312188..315412)
                     /locus_tag="BSVBI22_B0330"
                     /db_xref="GeneID:11686474"
     CDS             complement(312188..315412)
                     /locus_tag="BSVBI22_B0330"
                     /note="similar to GP:15141215; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrophobe/amphiphile efflux-1 family protein"
                     /protein_id="YP_005108345.1"
                     /db_xref="GI:376278312"
                     /db_xref="GeneID:11686474"
                     /translation="MLSSVFINRPRLAIVIAIVITLAGLIAVTRIPVAQFPDIVPPQV
                     SVTATYPGASAETVEAAIAQPIEAQVNGVDDMIYMSSTSGNNGTYTLTVTFKVGSDPN
                     LNTVNVQNRVRLAEANLPQEVTRLGVTVKKQSSSFLQIITLLSPDSRYDELFLNNYGV
                     INVVDRLARVPGVGQAQSFGTFNYSMRIWFNTDALTSLNLTPNDIVNAISSQNVQAAV
                     GRLGAPPMTDQQQIQLTLTTQGRLTDAKQFENIIIRANPDGSSVRLKDVARVELAAQS
                     YDTIGRLNGKPASVIAVYQAPGSNAVAAAEGVRNVMEQLKQSFPAGLDYKITYDTTVF
                     VSSTIHEVIKTLLEAFVLVVVVVFIFLGNFRATLIPTLAVPVSLIGTFAVLLVLGFSA
                     NTISLFAMILAIGIVVDDAIVVVENVERVMAETGLPPKEAAKQAMQEITAPIIAITLV
                     LLSVFVPVAFIPGITGALYAQFALTVSVAMLISAINALTLSPALCGVFLKPHQGRKKS
                     LYGRTMDKLSSGIEKISDGYAHIVRRLVRMAFLSIVLVAGLGAGAYFLNTIVPTGFLP
                     EEDQGLFFVQVNLPPAASQSRTAAVVSEIEADITKMAGVADVTSVTGFSFIDGLAVSN
                     AGLMIVTLKPLEERLKDNITVFDVIAEVNRRTAAIPSAVAITMNLPPILGLGSSGGFQ
                     YQLEDQEGQSPQQLASVAQGLVMAANQNPKLSRVFTTFATDTPQLNLNIDRQKALSLG
                     VSPNNIIQALQSTLGGYFVNNFNTLGRTWQVIIQGEQQDRKTVEDIYRINVRSSHGDM
                     VPLRSLVSVEERLGPLYITRYNNYRSASIQGNAAPGVSSGEALAAMAQVSKTTLPSGY
                     GYEWTGTALQELQAAGQTSMILALAVLFAYLFLVALYESWTIPVGVLLSVTAGLAGAM
                     LALWITGLSNDIYAQIGIVVLIALASKNGILIVEFAKERREEGVPLEQAAIIGARQRF
                     RPVMMTSFAFILGLVPLVIAVGAAAASRRAVGTSVFGGMIAASAVGIFLIPMLYVVLE
                     RVREWGHARILRKPLYEEEKQEKADGDASGPTVPPTQPEDRGLS"
     misc_feature    complement(312320..315412)
                     /locus_tag="BSVBI22_B0330"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     misc_feature    complement(312296..>312889)
                     /locus_tag="BSVBI22_B0330"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(315416..316651)
                     /locus_tag="BSVBI22_B0331"
                     /db_xref="GeneID:11686475"
     CDS             complement(315416..316651)
                     /locus_tag="BSVBI22_B0331"
                     /note="similar to GP:14524048; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="YP_005108346.1"
                     /db_xref="GI:376278313"
                     /db_xref="GeneID:11686475"
                     /translation="MVAFWTCRNAWFQHLPFAKRGDENAPSGPRRLRPWFLVLALGLA
                     ACSEDKSAPQQAAPLPPIPVGVIKITERPTHPQLSFVGRVEATDSVDLIARVDGFLDK
                     RTFTEGQAVKTGDLLFVLQKDALQAALDAAQANLAKAQADADNLKLQTERARSLYKQK
                     TVSQAMLDDRVAAEKQALAVVQQAQASLEQAQINLGYTDIRAPFSGRIGMANFSVGAL
                     VGPSSGPLATIVSQDPIYVTFPVSDKTILDLTEGGRTATDRSNVAVSLTLSNGMTYPQ
                     TGAIDFTGIKINPNTDTLMVRAQFPNPNNVLIDGQYVQVTAASKHPVEALLVPQKAIM
                     TDQSGNYVLAVGEDNKVIQRQITQGSTFGSNVVVKSGLAVGDQVVVDGLQRIRPGQKV
                     DPQIVDATTPAQKAMSVGN"
     misc_feature    complement(315476..316462)
                     /locus_tag="BSVBI22_B0331"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    complement(<316292..316390)
                     /locus_tag="BSVBI22_B0331"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    complement(315722..316054)
                     /locus_tag="BSVBI22_B0331"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(316837..317370)
                     /locus_tag="BSVBI22_B0332"
                     /db_xref="GeneID:11686476"
     CDS             complement(316837..317370)
                     /locus_tag="BSVBI22_B0332"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108347.1"
                     /db_xref="GI:376278314"
                     /db_xref="GeneID:11686476"
                     /translation="MSDLVFIAFPDEQKAEEVRQRVLELQREYLIELGDAVVVVKDSD
                     GRVKLNQLVNSTAAGAVSGALWGTLIGFIFFMPLVGTALGAATGAIGGKLTDVGIDDN
                     FMKDAASVLQPGSAGLFLLIRKMTTDKVLADLKGIGGTVVRTSLDEKAENALRKAIAE
                     HVVSSATQTAPTGTSGA"
     misc_feature    complement(316867..317370)
                     /locus_tag="BSVBI22_B0332"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4803"
                     /db_xref="CDD:227140"
     gene            complement(317445..317618)
                     /locus_tag="BSVBI22_B0333"
                     /db_xref="GeneID:11686477"
     CDS             complement(317445..317618)
                     /locus_tag="BSVBI22_B0333"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108348.1"
                     /db_xref="GI:376278315"
                     /db_xref="GeneID:11686477"
                     /translation="MFVPDLCWSLNQKAAGRGENGVFRGMSDAKLWSTHIHTALRRFS
                     PYKISPTNSFAIS"
     gene            318068..319462
                     /locus_tag="BSVBI22_B0334"
                     /note="This region contains an authentic point mutation,
                     causing a premature stop, and is not the result of a
                     sequencing artifact; glutamate decarboxylase, authentic
                     point mutation; similar to SP:P34210, and PID:550102;
                     identified by sequence similarity; putative"
                     /pseudo
                     /db_xref="GeneID:11686478"
     gene            319535..321068
                     /locus_tag="BSVBI22_B0335"
                     /note="This region contains an authentic frame shift and
                     is not the result of a sequencing artifact; amino acid
                     antiporter, putative, authentic frameshift; similar to
                     GP:6009438, and SP:Q54152; identified by sequence
                     similarity; putative"
                     /pseudo
                     /db_xref="GeneID:11686479"
     gene            321104..322057
                     /locus_tag="BSVBI22_B0336"
                     /db_xref="GeneID:11686480"
     CDS             321104..322057
                     /locus_tag="BSVBI22_B0336"
                     /note="catalyzes the formation of glutamate from
                     glutamine"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaminase"
                     /protein_id="YP_005108349.1"
                     /db_xref="GI:376278316"
                     /db_xref="GeneID:11686480"
                     /translation="MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGL
                     AVVTADGQTFKTGDADFAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSV
                     IALELHNGKSLSPLVNAGAIATASLVPGDTADARWNNILECQCGFAGRRLKLSNEVNQ
                     SEQTTNFHNRAIAWLLYSAGTCYSDPMEAVDIYTRQCSTLVTATDLATMGATLAAGGV
                     NPISGKRMVSAGNVAPILAEMTMEGLYTASGDWAYTVGLPGKSGVGGGIMAVVPGELA
                     IAAFSPPLDPAGNSVKAMAAVAAVADSLGHNLYTTRGKVSS"
     misc_feature    321104..322054
                     /locus_tag="BSVBI22_B0336"
                     /note="glutaminase; Reviewed; Region: PRK12356"
                     /db_xref="CDD:237073"
     gene            322205..322549
                     /gene="hdeA"
                     /locus_tag="BSVBI22_B0337"
                     /db_xref="GeneID:11686481"
     CDS             322205..322549
                     /gene="hdeA"
                     /locus_tag="BSVBI22_B0337"
                     /note="inactive form"
                     /codon_start=1
                     /transl_table=11
                     /product="acid-resistance protein"
                     /protein_id="YP_005108350.1"
                     /db_xref="GI:376278317"
                     /db_xref="GeneID:11686481"
                     /translation="MIKALFNKNTALAAVTILALSGGAMAESAKTHKTDMAKKKVSEL
                     TCEDFNGLEESFKPTVVGWVVGFNKKGKEEDAVIDVDGIETVTPAIIEACKQEPKASF
                     WKKAEAELKKVF"
     misc_feature    322205..322546
                     /gene="hdeA"
                     /locus_tag="BSVBI22_B0337"
                     /note="acid-resistance protein; Provisional; Region:
                     PRK10208"
                     /db_xref="CDD:182307"
     gene            322712..322810
                     /locus_tag="BSVBI22_B0338"
                     /db_xref="GeneID:11686482"
     CDS             322712..322810
                     /locus_tag="BSVBI22_B0338"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108351.1"
                     /db_xref="GI:376278318"
                     /db_xref="GeneID:11686482"
                     /translation="MQGVENAFGLSLVIRYIYYGLRCDKLVILKKS"
     gene            323062..323313
                     /locus_tag="BSVBI22_B0339"
                     /db_xref="GeneID:11686483"
     CDS             323062..323313
                     /locus_tag="BSVBI22_B0339"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108352.1"
                     /db_xref="GI:376278319"
                     /db_xref="GeneID:11686483"
                     /translation="MQHPWEASGANVIFARMKNYKAYWQEEQIMQFLNDYAAFIDVVA
                     LLCLIILAVAGAIRQKSIGLIILALAVTFWALVRFFKLI"
     gene            complement(323390..324982)
                     /locus_tag="BSVBI22_B0340"
                     /db_xref="GeneID:11686484"
     CDS             complement(323390..324982)
                     /locus_tag="BSVBI22_B0340"
                     /note="similar to SP:P77473; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="YP_005108353.1"
                     /db_xref="GI:376278320"
                     /db_xref="GeneID:11686484"
                     /translation="MKRHHWLIATFACIVFAIIAPALAAVYTSSVVAAHREQIQLTLF
                     ATYAIERTDTTFSGVSQALMQTQMLTDKPCSKEHMDDLKRIAIETRPITEIGYFDDGL
                     LKCTSWGMAGMRVAAGTPAFTTRNGVKVVLNMTASIPTTANMLGLQRGAYCILIDPKW
                     FVDEIVPKGVQIAVASPDGTVVAALNHPDPAVIRQFLKPSDTKPPSRYLGAVVRGSDW
                     TAIAITPRASIWTSMQEELLVFLPIAGVISTGMVILTIWLSRRRLSLRGELAIAIRRR
                     EFTVVYQPLIELKTGICVGAEALVRWRRPDGAMVMPDLFIPIAENSKMISQITEQVVA
                     NTVRDLGDVLAADEALHVAINMADDDLAQGRILTVVQRAIRGTGIRTEQIWLEATERG
                     FMDPKSTRTIIEKARELGHFIAIDDFGTGYSSLHYLQELPVDTLKIDKSFISTLGTDS
                     ATSPIAAHIIAMAKSLDLIIVAEGIERQEQADYLIAHGVQFGQGWLYSPPLPAQEFIE
                     FYKAQKATKGAGPAIIRKKKHA"
     misc_feature    complement(323423..324982)
                     /locus_tag="BSVBI22_B0340"
                     /note="Predicted signal transduction protein containing
                     sensor and EAL domains [Signal transduction mechanisms];
                     Region: COG4943"
                     /db_xref="CDD:227279"
     misc_feature    complement(324260..324880)
                     /locus_tag="BSVBI22_B0340"
                     /note="CSS motif domain associated with EAL; Region:
                     CSS-motif; pfam12792"
                     /db_xref="CDD:257300"
     misc_feature    complement(323468..324184)
                     /locus_tag="BSVBI22_B0340"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(325277..325543)
                     /locus_tag="BSVBI22_B0341"
                     /db_xref="GeneID:11686485"
     CDS             complement(325277..325543)
                     /locus_tag="BSVBI22_B0341"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108354.1"
                     /db_xref="GI:376278321"
                     /db_xref="GeneID:11686485"
                     /translation="MSHRTIFLPKMAHPDTLDGPALLILSIAKTRMGAYPVYPPYRLG
                     NTVNGEVRVCHRAPLGASDQLIVRRIAGYDCNTPQHRWSIIRPG"
     gene            325772..326659
                     /locus_tag="BSVBI22_B0342"
                     /db_xref="GeneID:11686486"
     CDS             325772..326659
                     /locus_tag="BSVBI22_B0342"
                     /note="identified by match to PFAM protein family HMM
                     PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005108355.1"
                     /db_xref="GI:376278322"
                     /db_xref="GeneID:11686486"
                     /translation="MRFNLRALQAFEAVSRHLSVLKAAEELGITSSAVSHQLRILTED
                     LGYNLIEREGRNIVLTERGLQFARHLQDAFRHVQLAMVEGRSVQNDRVRIAACSSFCQ
                     GFLIDLVADTIAQEGGYEIDMRMYANDPQLASVVADIFVTSDDIPHGYWATDLFTEQL
                     VAVCTPACRDEELKTRSVPFIKNEALELTGECRWLLYKQELPETELPVENRLILRTSH
                     FILALEMANRGLGMALVPDFLARAGLQSGELVQLYPAVIPSGRKYKICCRSSLRTKPP
                     YSQAIRQIILATSPEARSA"
     misc_feature    325784..326635
                     /locus_tag="BSVBI22_B0342"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    325784..325960
                     /locus_tag="BSVBI22_B0342"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    326042..326632
                     /locus_tag="BSVBI22_B0342"
                     /note="LysR substrate binding domain; Region:
                     LysR_substrate; pfam03466"
                     /db_xref="CDD:251977"
     gene            complement(326780..328195)
                     /locus_tag="BSVBI22_B0343"
                     /db_xref="GeneID:11686487"
     CDS             complement(326780..328195)
                     /locus_tag="BSVBI22_B0343"
                     /note="similar to GP:3510759; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate
                     guanylyltransferase/mannose-6-phosphate isomerase"
                     /protein_id="YP_005108356.1"
                     /db_xref="GI:376278323"
                     /db_xref="GeneID:11686487"
                     /translation="MSFIPVIISGGSGSRLWPLSRDAHPKPFIKLPDGETLIGKTYAR
                     ASRLVNAEQILTVTNRDFLFLTLDAYAAAGAAQMENTFLLEPLGRDTAPAVALAALHA
                     AEAYGPDATLLVMPADHLIEDEQAFAEAVAKARALAEAGRIVTFGIVPDRPETGFGYI
                     EVQGTDVQRFVEKPDEATAQTYVESGRYFWNSGMFCFKALSMIDAMQRYAPQVLAGAR
                     AALAQARRGNNGETKTLEIARDEFAATPAISIDYAVMEKADNMACVPVSCGWSDIGSW
                     AAMADLVTPDENGNRLRGETILEDTTNSFVLSETRLVSLVGVHDLLVVDTPDALLVAH
                     RDKAQEVRSVFNKLRKQGHEAAKLHRTAHRPWGTYTVLEEGDGFKIKRIEVKPGRRLS
                     LQAHHHRSEHWIVVSGTAKVTNGDREILLTTNQSTYIPCGFRHRLENPGILPLVLIEV
                     QSGEYLGEDDIVRYDDVYGRV"
     misc_feature    complement(326786..328189)
                     /locus_tag="BSVBI22_B0343"
                     /note="mannose-1-phosphate
                     guanylyltransferase/mannose-6-phosphate isomerase; Region:
                     GMP_PMI; TIGR01479"
                     /db_xref="CDD:233431"
     misc_feature    complement(327362..328189)
                     /locus_tag="BSVBI22_B0343"
                     /note="GDP-M1P_Guanylyltransferase catalyzes the formation
                     of GDP-Mannose; Region: GDP-M1P_Guanylyltransferase;
                     cd02509"
                     /db_xref="CDD:133003"
     misc_feature    complement(order(327842..327844,328166..328168,
                     328172..328174))
                     /locus_tag="BSVBI22_B0343"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133003"
     misc_feature    complement(326798..327250)
                     /locus_tag="BSVBI22_B0343"
                     /note="Mannose-6-phosphate isomerase; Region:
                     MannoseP_isomer; pfam01050"
                     /db_xref="CDD:144587"
     gene            complement(328192..329625)
                     /locus_tag="BSVBI22_B0344"
                     /db_xref="GeneID:11686488"
     CDS             complement(328192..329625)
                     /locus_tag="BSVBI22_B0344"
                     /note="similar to GP:2738951, SP:P06187, GB:K03551,
                     GB:X52093, PID:154137, and PID:47739; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucomutase, putative"
                     /protein_id="YP_005108357.1"
                     /db_xref="GI:376278324"
                     /db_xref="GeneID:11686488"
                     /translation="MSSNSLKFGTSGLRGLAVELNGLPAYAYTMAFVQMLAAKGQLQK
                     GDKVFIGRDLRPSSPDIAALAMGAIEDAGFTPVNCGVLPTPALSYYAMGAKAPSIMVT
                     GSHIPDDRNGLKFYRRDGEIDKDDEAAISAAYRKLPAILAARKHVGSTETDAALQAYA
                     DRYAGFLGKGSLNGLRVGVYQHSSVARDLLMYLLTTLGVEPVALGRSDIFVPVDTEAL
                     RPEDIALLAQWGKSDRLDAIVSTDGDADRPLIADEHGQFVRGDLAGAITATWVGADTL
                     VTPVTSNTALESRFPKVLRTRVGSPYVIASMAQASTGNSGPVIGFEANGGVLLGSTVE
                     RNGRSLTALPTRDALLPILACLATVHEKKTPLSTIARSYGFRVALSDRLQNIPQEAST
                     AFLALLEDADKRASLFPAGDAIVRVETIDGVKLFFQSGNAVHYRASGNAPELRCYVES
                     SDDTQAAKLQALGLEIARKALKDATRP"
     misc_feature    complement(328204..329625)
                     /locus_tag="BSVBI22_B0344"
                     /note="Phosphomannomutase [Carbohydrate transport and
                     metabolism]; Region: {ManB}; COG1109"
                     /db_xref="CDD:224034"
     misc_feature    complement(328234..329607)
                     /locus_tag="BSVBI22_B0344"
                     /note="ManB is a bacterial phosphomannomutase (PMM) that
                     catalyzes the conversion of mannose 6-phosphate to
                     mannose-1-phosphate in the second of three steps in the
                     GDP-mannose pathway, in which GDP-D-mannose is synthesized
                     from fructose-6-phosphate. In...; Region: ManB; cd03088"
                     /db_xref="CDD:100090"
     misc_feature    complement(order(328291..328293,328306..328314,
                     328318..328320,328648..328650,328654..328656,
                     328660..328662,328726..328734,328783..328785,
                     328885..328890,328894..328896,328900..328902,
                     329284..329286,329308..329316,329584..329586,
                     329593..329595,329599..329601))
                     /locus_tag="BSVBI22_B0344"
                     /note="active site"
                     /db_xref="CDD:100090"
     misc_feature    complement(order(328291..328293,328306..328314,
                     328318..328320,328648..328650,328654..328656,
                     328660..328662,328726..328728,328732..328734,
                     328783..328785,328885..328887,329314..329316,
                     329593..329595))
                     /locus_tag="BSVBI22_B0344"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100090"
     misc_feature    complement(order(328888..328890,328894..328896,
                     328900..328902,329314..329316))
                     /locus_tag="BSVBI22_B0344"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100090"
     gene            complement(329745..330851)
                     /locus_tag="BSVBI22_B0345"
                     /db_xref="GeneID:11686489"
     CDS             complement(329745..330851)
                     /locus_tag="BSVBI22_B0345"
                     /note="similar to GP:7799513, and GP:7799513; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108358.1"
                     /db_xref="GI:376278325"
                     /db_xref="GeneID:11686489"
                     /translation="MDRRTFAKSLAGLGAMPFAVNTASAGAAKEGKTMLELMGGSITD
                     VPGIKLGHHTLTRRPTGCSVLLCEEGATAGVDVRGSAPGTRETDLLDPINFVQKVQAI
                     LLSGGSAYGLAAATGVMRYLEENNLGFEIGKGVVPIVPAAILMDLGVGDFSVRPDEEA
                     GYLACKAATAAPSGEGNIGAGAGATVGKMFGMDYAMKGGLGTASYKVPGTEIVVGAIV
                     AVNAVGDVRAPNSHRILAGARTEDGKGFRNTMAAIMQGHGVVKSGGANTTIGAIATNA
                     PFGKAELKKIAGMAHDGFARTINPVHTMWDGDTIFALSTGKAKDGQADVTAIGAIAAS
                     VMADAVARAVVQAESLPHLNLPAHRDYMIAESTR"
     misc_feature    complement(329820..330728)
                     /locus_tag="BSVBI22_B0345"
                     /note="nylC-like family; composed of proteins with
                     similarity to Flavobacterium endo-type
                     6-aminohexanoate-oligomer hydrolase (EIII), the product of
                     the nylon oligomer degradation gene, nylC. EIII is an
                     amide hydrolase that catalyzes the degradation of...;
                     Region: nylC_like; cd02252"
                     /db_xref="CDD:239070"
     misc_feature    complement(order(329931..329936,330051..330053,
                     330189..330191,330195..330197,330417..330425))
                     /locus_tag="BSVBI22_B0345"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:239070"
     misc_feature    complement(330051..330056)
                     /locus_tag="BSVBI22_B0345"
                     /note="cleavage site"
                     /db_xref="CDD:239070"
     gene            complement(330875..332230)
                     /locus_tag="BSVBI22_B0346"
                     /db_xref="GeneID:11686490"
     CDS             complement(330875..332230)
                     /locus_tag="BSVBI22_B0346"
                     /note="identified by match to PFAM protein family HMM
                     PF03595"
                     /codon_start=1
                     /transl_table=11
                     /product="voltage gated chloride channel family protein"
                     /protein_id="YP_005108359.1"
                     /db_xref="GI:376278326"
                     /db_xref="GeneID:11686490"
                     /translation="MRKSYKRVPVIRRSHAMWMSPRVWKPRLVFWCGALAIGIISVGF
                     AEAADIAQDWFHSLTSGSPLRAWLPLLITPLGFMFCSWVALVWFPNSGGSGIPQAIAA
                     RHLNDHEDRSLLLSIRVATGKIVLTIIGLFCGASIGREGPTVQIGASIMLQAARFGGM
                     EKARGLILAGSAAGIAAAFNTPLAGIVFAIEEMGRAYAARTNGLVLSAVILAGLASLG
                     LVGNYNYFGFTTVTASTGKDWILTIACGIFGGAFGAAFSALALNMGRRVRRRVQKAPL
                     RNMVIFAGICGLLVALIGIASGGMTFGAGYDQARSAVEGATLPPFYFVEKFTVGLLSM
                     ISGIPGGIFAPSLSVGAGLGSTIGLLLGTSASLAAVLGMAGYFAGAVQAPMTAFVIIL
                     EMTGNHSNVIPLMCASMLGYGTARLISHEPLYHALSRIFVADILRQRRAREKTIQPEL
                     T"
     misc_feature    complement(330956..332119)
                     /locus_tag="BSVBI22_B0346"
                     /note="ClC chloride channel family. These protein
                     sequences, closely related to the ClC Eric family, are
                     putative halogen ion (Cl-, Br- and I-) transport proteins
                     found in eubacteria. They belong to the ClC superfamily of
                     chloride ion channels, which share a...; Region:
                     EriC_like; cd01034"
                     /db_xref="CDD:238506"
     misc_feature    complement(order(330959..330961,331196..331210,
                     331805..331819,331940..331954))
                     /locus_tag="BSVBI22_B0346"
                     /note="putative ion selectivity filter; other site"
                     /db_xref="CDD:238506"
     misc_feature    complement(331811..331813)
                     /locus_tag="BSVBI22_B0346"
                     /note="putative pore gating glutamate residue; other site"
                     /db_xref="CDD:238506"
     misc_feature    complement(331655..331657)
                     /locus_tag="BSVBI22_B0346"
                     /note="putative H+/Cl- coupling transport residue; other
                     site"
                     /db_xref="CDD:238506"
     gene            complement(332289..332450)
                     /locus_tag="BSVBI22_B0347"
                     /db_xref="GeneID:11686491"
     CDS             complement(332289..332450)
                     /locus_tag="BSVBI22_B0347"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108360.1"
                     /db_xref="GI:376278327"
                     /db_xref="GeneID:11686491"
                     /translation="MGDSTILAIANSFEVRKAASPENGSGAATPQGYWVELALAGNTV
                     ISKWKAFWI"
     gene            332425..333918
                     /gene="guaB"
                     /locus_tag="BSVBI22_B0348"
                     /db_xref="GeneID:11686492"
     CDS             332425..333918
                     /gene="guaB"
                     /locus_tag="BSVBI22_B0348"
                     /note="catalyzes the synthesis of xanthosine monophosphate
                     by the NAD+ dependent oxidation of inosine monophosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="inosine 5'-monophosphate dehydrogenase"
                     /protein_id="YP_005108361.1"
                     /db_xref="GI:376278328"
                     /db_xref="GeneID:11686492"
                     /translation="MAKIVESPTGALALTFDDVLLQPGHSEVMPGQVDLRTRIAKDIE
                     LNLPLLSAAMDTVTESRLAIAMAQAGGIGVIHRNLSPERQAEEVRQVKKFESGMVVNP
                     VTIGPDATLADAQALMKAHGISGIPVVENATKGPGRLVGILTNRDVRFASDPKQKIYE
                     LMTRENLITVHENVNQDEAKRLLHSHRIEKLLVVDDKGRCVGLVTVKDIEKSQLNPNA
                     AKDAQGRLRAAAATSVGADGFERAERLIDAGVDLLVVDTAHGHSQRVLDAVARIKKAY
                     PNVAVLAGNVATTAGTQALIDVGADAVKVGIGPGSICTTRIVAGVGVPQLSAIMSAVE
                     AAQKQNIPVIADGGIKFSGDFAKALAAGAVAAMAGSLLAGTEESPGEVYLHQGRSFKA
                     YRGMGSVGAMARGSADRYFQAEVRDELKLVPEGIEGQVAYKGPISAVLHQLAGGLRAS
                     MGYVGAKTLEEFRETATFVRISNAGLRESHSHGVAITRESPNYPGGM"
     misc_feature    332440..333912
                     /gene="guaB"
                     /locus_tag="BSVBI22_B0348"
                     /note="inosine 5'-monophosphate dehydrogenase; Reviewed;
                     Region: PRK05567"
                     /db_xref="CDD:235507"
     misc_feature    332461..333837
                     /gene="guaB"
                     /locus_tag="BSVBI22_B0348"
                     /note="IMPDH: The catalytic domain of the inosine
                     monophosphate dehydrogenase. IMPDH catalyzes the
                     NAD-dependent oxidation of inosine 5'-monophosphate (IMP)
                     to xanthosine 5' monophosphate (XMP). It is a
                     rate-limiting step in the de novo synthesis of...; Region:
                     IMPDH; cd00381"
                     /db_xref="CDD:238223"
     misc_feature    order(332578..332580,333355..333363,333460..333462,
                     333466..333468,333529..333534,333601..333603,
                     333607..333615,333694..333699)
                     /gene="guaB"
                     /locus_tag="BSVBI22_B0348"
                     /note="active site"
                     /db_xref="CDD:238223"
     misc_feature    332719..333060
                     /gene="guaB"
                     /locus_tag="BSVBI22_B0348"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains in the
                     inosine 5' monophosphate dehydrogenase (IMPDH) protein.
                     IMPDH is an essential enzyme that catalyzes the first step
                     unique to GTP synthesis, playing a...; Region:
                     CBS_pair_IMPDH; cd04601"
                     /db_xref="CDD:239974"
     gene            complement(334123..335196)
                     /locus_tag="BSVBI22_B0349"
                     /db_xref="GeneID:11686493"
     CDS             complement(334123..335196)
                     /locus_tag="BSVBI22_B0349"
                     /note="similar to GP:15140396; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c family protein"
                     /protein_id="YP_005108362.1"
                     /db_xref="GI:376278329"
                     /db_xref="GeneID:11686493"
                     /translation="MRWSDVGIYGVVFCLSLGYFAATSDSSRSKPASARPHASNVAEN
                     STKAAPQNAAAAAAVADKEKEKAPAAKAVEPEQAAWDIADPDTLPDNAWGKIVRQGRD
                     LITETYAHIGPEVADEAKRFAGNNLSCQNCHLEAGTKQYGLPLVGVYGDFPQYRSREG
                     QIGTIEDRINGCMTRSLNGEPLPLDSAEMKAMVAYIKYVSAGTVVGEETKGRGSGKMP
                     ELKRAADPVHGEKLYAEICAACHGADGQGKRTGVVGDAKGYEFPPLWGPDSFNDGAGM
                     NRLISAANFIHANMPNGVSLEEPQLEPEDAWDIAAFFQSKPRPAKANLQNDFPNRLEK
                     PVDASYGPYADSFPAQVHKVGPF"
     misc_feature    complement(334126..335016)
                     /locus_tag="BSVBI22_B0349"
                     /note="Cytochrome c [Energy production and conversion];
                     Region: COG3258"
                     /db_xref="CDD:225797"
     misc_feature    complement(334252..334521)
                     /locus_tag="BSVBI22_B0349"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            complement(335265..336218)
                     /gene="oxyR"
                     /locus_tag="BSVBI22_B0350"
                     /db_xref="GeneID:11686494"
     CDS             complement(335265..336218)
                     /gene="oxyR"
                     /locus_tag="BSVBI22_B0350"
                     /note="similar to GP:4098965, and GP:4098965; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator OxyR"
                     /protein_id="YP_005108363.1"
                     /db_xref="GI:376278330"
                     /db_xref="GeneID:11686494"
                     /translation="MFTVRQIRYFDALASTLHFRKAAELAHVSQPALSAQIAEMEAIA
                     GAPLFERSQRQVIMTELGKHLYPGIKAILRELQKLEEIAAQSRGVLQTGIKLGIIPTV
                     APYLVPVLIPLLHEQHPSFRLQLRESVTAKLLEELHAGDLDAIVAALPIDDEKLSHQK
                     LFDDRFLIATSTNDHTVLASPMTQNHAALERLLLLEEGHCMRDQALAVCTLPSQRQLV
                     KYGATSMSTLLQMVSHGMGLTLIPEIAVRAEARSNHMRIVPFEGEQPKREIALFWRRQ
                     SMRGKGFRALAECIAESANKLKIDPSKIDTLLDNPSTPSYS"
     misc_feature    complement(335343..336209)
                     /gene="oxyR"
                     /locus_tag="BSVBI22_B0350"
                     /note="DNA-binding transcriptional regulator OxyR;
                     Provisional; Region: PRK11151"
                     /db_xref="CDD:182999"
     misc_feature    complement(336030..336206)
                     /gene="oxyR"
                     /locus_tag="BSVBI22_B0350"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(335349..335939)
                     /gene="oxyR"
                     /locus_tag="BSVBI22_B0350"
                     /note="The C-terminal substrate-binding domain of the
                     LysR-type transcriptional regulator OxyR, a member of the
                     type 2 periplasmic binding fold protein superfamily;
                     Region: PBP2_OxyR; cd08411"
                     /db_xref="CDD:176103"
     misc_feature    complement(order(335517..335522,335526..335531,
                     335538..335540,335547..335552,335559..335561,
                     335838..335852,335874..335876,335886..335888,
                     335895..335900,335907..335909))
                     /gene="oxyR"
                     /locus_tag="BSVBI22_B0350"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176103"
     gene            336388..337887
                     /gene="katA"
                     /locus_tag="BSVBI22_B0351"
                     /db_xref="GeneID:11686495"
     CDS             336388..337887
                     /gene="katA"
                     /locus_tag="BSVBI22_B0351"
                     /note="similar to SP:Q59170, GB:L08666, SP:P45880,
                     PID:190200, and PID:190201; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="YP_005108364.1"
                     /db_xref="GI:376278331"
                     /db_xref="GeneID:11686495"
                     /translation="MTDRPIMTTSAGAPIPDNQNSLTAGERGPILMQDYQLIEKLSHQ
                     NRERIPERAVHAKGWGAYGTLTITGDISRYTKAKVLQPGAQTPMLARFSTVAGELGAA
                     DAERDVRGFALKFYTQEGNWDLVGNNTPVFFVRDPLKFPDFIHTQKRHPRTHLRSATA
                     MWDFWSLSPESLHQVTILMSDRGLPTDVRHINGYGSHTYSFWNDAGERYWVKFHFKTM
                     QGHKHWTNAEAEQVIGRTRESTQEDLFSAIENGEFPKWKVQVQIMPELDADKTPYNPF
                     DLTKVWPHADYPPIDIGVMELNRNPENYFTEVENAAFSPSNIVPGIGFSPDKMLQARI
                     FSYADAHRHRLGTHYESIPVNQPKCLVHHYHRDGQMNVYGGIKTGNPDAYYEPNSFNG
                     PVEQPSAKEPPLCISGNADRYNHRIGNDDYSQPRALFNLFDAAQKQRLFSNIAAAMKG
                     VPGFIVERQLGHFKLIHPEYEAGVRKALKDAHGYDANTIALNEKITAAE"
     misc_feature    336400..337845
                     /gene="katA"
                     /locus_tag="BSVBI22_B0351"
                     /note="Catalase [Inorganic ion transport and metabolism];
                     Region: KatE; COG0753"
                     /db_xref="CDD:223824"
     misc_feature    336529..337821
                     /gene="katA"
                     /locus_tag="BSVBI22_B0351"
                     /note="Clade 3 of the heme-binding enzyme catalase;
                     Region: catalase_clade_3; cd08156"
                     /db_xref="CDD:163712"
     misc_feature    order(336529..336531,336544..336546,336685..336690,
                     336745..336750,336793..336807,336811..336813,
                     336820..336822,336838..336855,336865..336867,
                     336874..336876,337066..337068,337075..337077,
                     337084..337089,337099..337101,337108..337113,
                     337120..337122,337189..337194,337207..337209,
                     337213..337215,337291..337293,337297..337302,
                     337306..337308,337315..337317,337336..337341,
                     337363..337365,337369..337371,337378..337380,
                     337387..337395,337402..337407,337414..337422,
                     337426..337431,337435..337446,337456..337458,
                     337468..337473,337477..337479,337486..337488,
                     337492..337500,337537..337554,337732..337737,
                     337741..337743,337747..337749,337759..337761)
                     /gene="katA"
                     /locus_tag="BSVBI22_B0351"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163712"
     misc_feature    order(336550..336552,336664..336666,336766..336768,
                     336781..336783,336805..336807,337384..337386,
                     337396..337398)
                     /gene="katA"
                     /locus_tag="BSVBI22_B0351"
                     /note="heme binding pocket [chemical binding]; other site"
                     /db_xref="CDD:163712"
     misc_feature    order(336775..336777,336904..336906,336916..336918,
                     336925..336927,336931..336933,336961..336963,
                     337027..337029,337033..337035,337228..337239,
                     337657..337659,337666..337671)
                     /gene="katA"
                     /locus_tag="BSVBI22_B0351"
                     /note="NADPH binding site [chemical binding]; other site"
                     /db_xref="CDD:163712"
     gene            337982..338191
                     /locus_tag="BSVBI22_B0352"
                     /db_xref="GeneID:11686496"
     CDS             337982..338191
                     /locus_tag="BSVBI22_B0352"
                     /note="similar to GP:9082308; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108365.1"
                     /db_xref="GI:376278332"
                     /db_xref="GeneID:11686496"
                     /translation="MYSASESAGGSDMMLAIFIFMTIAMWFCWFGRLSIALVCMFLCL
                     ALATKEFLWEIHSADYGYSMPWVQL"
     gene            338220..338846
                     /locus_tag="BSVBI22_B0353"
                     /db_xref="GeneID:11686497"
     CDS             338220..338846
                     /locus_tag="BSVBI22_B0353"
                     /note="identified by match to PFAM protein family HMM
                     PF02600"
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide bond formation protein DsbB, putative"
                     /protein_id="YP_005108366.1"
                     /db_xref="GI:376278333"
                     /db_xref="GeneID:11686497"
                     /translation="MNAVNMHEPGLSASRQSGNLFAPLQFLYLIAMLFVLAGILTAAM
                     VLQYGAGEVPCPLCLLQRMAMFGVCFGVMLQLRYGPSFRFSGIGLLFAIVLLIISVRQ
                     TLLDIYPRPGHEYIGSTVFGLHMPVWSILIALALIAAFAVQMMFWGGRHGQTIAQIKN
                     HPVINGLGTILALYVLAVATINMASVFVQCGVGQCHTMGYALLGYPGK"
     misc_feature    338259..>338603
                     /locus_tag="BSVBI22_B0353"
                     /note="Disulfide bond formation protein DsbB
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: DsbB; COG1495"
                     /db_xref="CDD:224412"
     gene            339023..340312
                     /locus_tag="BSVBI22_B0354"
                     /db_xref="GeneID:11686498"
     CDS             339023..340312
                     /locus_tag="BSVBI22_B0354"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00563"
                     /codon_start=1
                     /transl_table=11
                     /product="sun protein, putative"
                     /protein_id="YP_005108367.1"
                     /db_xref="GI:376278334"
                     /db_xref="GeneID:11686498"
                     /translation="MRLGGRLQAAIEVLGEIEAGKRPASDVLKEWGAAHRFAGAGDRA
                     VIGNIVYDALRRKLSILWRMDADDARALAFGGLLADDGMDIEMVDAALHGDRFAPEGL
                     DAARRAAWQSRDLATAPAHIQADVPEWCIPSLEELFGERWVSEGKALATRPPVDLRVN
                     SLKATPEKTLAALEKAGAAPAPFLAQALRIPPIEALGRHPNVQGEQAFLDGWFEVQDL
                     GSQLAALFAGVKPGEQVLDYCAGAGGKTLALAAAMGNSGQIHAYDAERARLSPMHERL
                     QRAGVRNTQVYGGLDELGPLAGKMDLVLTDAPCTGSGTWRRRPDAKWRLNEQQLERRV
                     QDQQDVLDSARRFVKPGGRLAYVTCSLFAEENTRQVARFLGENPDFKEIAPQTLWGTV
                     VQDDSAGKPVFLSHGSVFSPLSTGTDGFYVSILQRQN"
     misc_feature    339275..340303
                     /locus_tag="BSVBI22_B0354"
                     /note="tRNA and rRNA cytosine-C5-methylases [Translation,
                     ribosomal structure and biogenesis]; Region: Sun; COG0144"
                     /db_xref="CDD:223222"
     misc_feature    339725..340093
                     /locus_tag="BSVBI22_B0354"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(339734..339754,339809..339814,339887..339889,
                     339938..339940)
                     /locus_tag="BSVBI22_B0354"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            340603..341058
                     /locus_tag="BSVBI22_B0355"
                     /db_xref="GeneID:11686499"
     CDS             340603..341058
                     /locus_tag="BSVBI22_B0355"
                     /note="identified by match to PFAM protein family HMM
                     PF02584"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108368.1"
                     /db_xref="GI:376278335"
                     /db_xref="GeneID:11686499"
                     /translation="MSAQRIAEPDFKERVEESFGRQAAMKLIGAELTRCEPGIVEVEM
                     PFREELTQQHGILHAGMISAALDSACGYAALTLMPADAAVLTIEFKVNLLAPGKGERF
                     LFRGEVTKPGRTIMVSDGQAFAVTDTEVRLIATMTGTMMVVQDRKGLQG"
     misc_feature    340681..341028
                     /locus_tag="BSVBI22_B0355"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    340759..>341013
                     /locus_tag="BSVBI22_B0355"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    order(340771..340773,340858..340860,340879..340890)
                     /locus_tag="BSVBI22_B0355"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    order(340774..340776,340780..340782,340789..340791,
                     340861..340875,340879..340881)
                     /locus_tag="BSVBI22_B0355"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    order(340777..340779,340801..340806,340813..340818,
                     340858..340860)
                     /locus_tag="BSVBI22_B0355"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            341055..341687
                     /locus_tag="BSVBI22_B0356"
                     /db_xref="GeneID:11686500"
     CDS             341055..341687
                     /locus_tag="BSVBI22_B0356"
                     /note="Enables the cleavage of the glycosidic bond in both
                     5'-methylthioadenosine and S-adenosylhomocysteine"
                     /codon_start=1
                     /transl_table=11
                     /product="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase"
                     /protein_id="YP_005108369.1"
                     /db_xref="GI:376278336"
                     /db_xref="GeneID:11686500"
                     /translation="MMKTVAGKRLLYVMAADAEYGRHLAKLFTPLMIGVGPVEAAVNL
                     ASALAHLKLAGDMPDLVISLGSAGSAKLPQAEVYQVSSVSYRDMDASPIGFEKGVTPF
                     LDLPETVELPFRVAGIDTASLSTGGNIVSGKAYERIEADMVDMETYACLRACQAVGVP
                     LLGLRGISDGASELKHVGDWTQYLHVIDEKLAGAVARVERAVADGLLSPS"
     misc_feature    341055..341681
                     /locus_tag="BSVBI22_B0356"
                     /note="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase; Validated; Region: PRK06026"
                     /db_xref="CDD:180353"
     gene            341796..343358
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /db_xref="GeneID:11686501"
     CDS             341796..343358
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="contains glutamine-hydrolyzing domain and glutamine
                     amidotransferase; GMP-binding domain; functions to produce
                     GMP from XMP in the IMP pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="YP_005108370.1"
                     /db_xref="GI:376278337"
                     /db_xref="GeneID:11686501"
                     /translation="MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADE
                     AFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVES
                     GHDREFGRAFLDVQEDSPLFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPY
                     AVIADEKRKYYGVQFHPEVVHTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRK
                     QVGSGKVICALSGGVDSSVAALLAHEAVGDQLTCILVDHGLMRKDEAQQVVEMFREHY
                     NLPLILVDASDRFIGALEGESDPEKKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYP
                     DVIESVSFTGGPSVTIKSHHNVGGLPERMKMQLVEPLRELFKDEVRLLGKELGLPDSF
                     IGRHPFPGPGLAIRCPGGVTRGKLEILREADAIYLDEIRKAGLYDAIWQAFAVLLPVQ
                     TVGVMGDGRTYEFVCALRAVTSVDGMTADFYHYDMNFLGNAATRIINEVRGINRVVYD
                     VTSKPPGTIEWE"
     misc_feature    341817..343355
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="GMP synthase; Reviewed; Region: guaA; PRK00074"
                     /db_xref="CDD:234614"
     misc_feature    341823..342374
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in GMP synthetase; Region: GATase1_GMP_Synthase;
                     cd01742"
                     /db_xref="CDD:153213"
     misc_feature    order(341844..341849,341967..341975,342051..342056,
                     342204..342206,342321..342323)
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="AMP/PPi binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153213"
     misc_feature    order(341970..341972,342054..342056)
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="candidate oxyanion hole; other site"
                     /db_xref="CDD:153213"
     misc_feature    order(342051..342053,342321..342323,342327..342329)
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153213"
     misc_feature    order(342063..342065,342207..342209,342315..342317)
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="potential glutamine specificity residues [chemical
                     binding]; other site"
                     /db_xref="CDD:153213"
     misc_feature    342465..343352
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="The C-terminal domain of GMP synthetase. It
                     contains two subdomains; the ATP pyrophosphatase domain
                     which closes to the N-termial and the dimerization domain
                     at C-terminal end. The ATP-PPase is a twisted,
                     five-stranded parallel beta-sheet sandwiched...; Region:
                     GMP_synthase_C; cd01997"
                     /db_xref="CDD:238955"
     misc_feature    order(342465..342539,342543..342575,342579..342611,
                     342642..342755,342771..342818,342846..342875,
                     342888..342962,342978..343022)
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="ATP Binding subdomain [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    order(342477..342485,342489..342500,342552..342554,
                     342558..342560,342921..342923)
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="Ligand Binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    order(343047..343085,343110..343139,343146..343178,
                     343188..343235,343254..343280,343284..343352)
                     /gene="guaA"
                     /locus_tag="BSVBI22_B0357"
                     /note="Dimerization subdomain; other site"
                     /db_xref="CDD:238955"
     gene            343667..344875
                     /locus_tag="BSVBI22_B0358"
                     /db_xref="GeneID:11686502"
     CDS             343667..344875
                     /locus_tag="BSVBI22_B0358"
                     /note="identified by match to PFAM protein family HMM
                     PF00589"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family site specific
                     recombinase"
                     /protein_id="YP_005108371.1"
                     /db_xref="GI:376278338"
                     /db_xref="GeneID:11686502"
                     /translation="MLTDTKLRNLKPKDKLYKVNDRDGLYVAITPAGSISFRYNYSIH
                     GRQETITFGRYGVGGITLAEARERLGEAKKMIAAGKSPAKEKARDKARVKDAETFGAW
                     AEKWLRGYQMSETTRNMRRGTYERDLKPKFGNRKLIEITHEDLRALTDAIVEQGRPST
                     AVVCREIMMLVFRWAIERGQKVENPADLVRPSTIAKFEPRDRALTPEEIGLMYQYMER
                     IGTPPSIRAAAKLLLLTMVRKSELTNATWSEINFIDALWTIPKERMKRRNPHLVFLSR
                     QVLEIFTALKTFAGGSEYVLPSRYDSDLPMSSATLNQVLTLTYRLAQKEGQSLGKFGP
                     HDLRRTASTLLHEAGYNTDWIEKCLAHEQKGVRAVYNKAEYRDQRRAMLQDWADMIDE
                     WTIRKIRPKD"
     misc_feature    343670..344836
                     /locus_tag="BSVBI22_B0358"
                     /note="integrase; Provisional; Region: PRK09692"
                     /db_xref="CDD:170049"
     misc_feature    343742..344830
                     /locus_tag="BSVBI22_B0358"
                     /note="Bacteriophage P4 integrase. P4-like integrases are
                     found in temperate bacteriophages, integrative plasmids,
                     pathogenicity and symbiosis islands, and other mobile
                     genetic elements.  They share the same fold in their
                     catalytic domain and the overall...; Region: INT_P4;
                     cd00801"
                     /db_xref="CDD:238416"
     misc_feature    order(344378..344380,344459..344461,344669..344671,
                     344678..344680,344747..344749,344774..344776)
                     /locus_tag="BSVBI22_B0358"
                     /note="active site"
                     /db_xref="CDD:238416"
     misc_feature    order(344378..344380,344459..344461,344669..344671,
                     344678..344680,344747..344749,344774..344776)
                     /locus_tag="BSVBI22_B0358"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238416"
     gene            345160..345390
                     /locus_tag="BSVBI22_B0359"
                     /db_xref="GeneID:11686503"
     CDS             345160..345390
                     /locus_tag="BSVBI22_B0359"
                     /note="similar to SP:P37447, GB:X76902, and PID:436890;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein, putative"
                     /protein_id="YP_005108372.1"
                     /db_xref="GI:376278339"
                     /db_xref="GeneID:11686503"
                     /translation="MEKELRRASKVLISKKQLLEMNPLCERTIYNFEKQGKFPQRIAL
                     SSRKVVWDLAEVEAWIDACKHSSPAPRPGMGA"
     misc_feature    345193..345339
                     /locus_tag="BSVBI22_B0359"
                     /note="Prophage CP4-57 regulatory protein (AlpA); Region:
                     Phage_AlpA; pfam05930"
                     /db_xref="CDD:114641"
     gene            345471..346529
                     /locus_tag="BSVBI22_B0360"
                     /db_xref="GeneID:11686504"
     CDS             345471..346529
                     /locus_tag="BSVBI22_B0360"
                     /note="similar to GP:8117186, and GP:8117186; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="repA-related protein"
                     /protein_id="YP_005108373.1"
                     /db_xref="GI:376278340"
                     /db_xref="GeneID:11686504"
                     /translation="MSSRNSGLKPIGAVIGDSGGLLERLENIRKRNSDRTPAAERGRP
                     SNVSTVHEQMERAKERDKALSLVRKPPQGDAQPDFFAPSLYDVGGRDNRSVMDVAVFR
                     LSKKDKRAGELIRYDLPDGYVEVSAGAHGMASVWDYDIVLMMVSHLTEAMNRYREGKG
                     GKPGRVFRLHVSDILRFARRGNGSSQVKGVEAALDRLRGTTIKTVRESGRFRATEAEG
                     LIARYRVLSRTDTKKISSVEIEAPEWIYREVTGGKRPEVLTVHRDYFLIEPGIGRFIY
                     RLARRAAGRDSAKWAFKTLYERSGSGGSFKKFCFFLRGIIKADDLPEYALCEEAGKDG
                     PLLVMRHRNSSSEPLGGS"
     misc_feature    345738..346448
                     /locus_tag="BSVBI22_B0360"
                     /note="Replication initiator protein A; Region: RPA;
                     pfam10134"
                     /db_xref="CDD:255779"
     gene            complement(347578..347904)
                     /locus_tag="BSVBI22_B0361"
                     /db_xref="GeneID:11686505"
     CDS             complement(347578..347904)
                     /locus_tag="BSVBI22_B0361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108374.1"
                     /db_xref="GI:376278341"
                     /db_xref="GeneID:11686505"
                     /translation="MMNDIFFGLMMLGGFFVLGIGMWALGQWLRRKGFGPQLDALDKQ
                     YTALQHRVNRLALPAAAHFYGGMGMLNRMPLFGSKNQVVLVERVRMAILQMEEEERQR
                     GRGINR"
     misc_feature    complement(<347815..347889)
                     /locus_tag="BSVBI22_B0361"
                     /note="Protein of unknown function (DUF3260); Region:
                     DUF3260; cl11881"
                     /db_xref="CDD:264482"
     gene            complement(347907..349550)
                     /locus_tag="BSVBI22_B0362"
                     /db_xref="GeneID:11686506"
     CDS             complement(347907..349550)
                     /locus_tag="BSVBI22_B0362"
                     /note="similar to GB:X72841, SP:P31149, SP:Q09028,
                     SP:Q16576, PID:1016273, and PID:297904; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="trbL protein"
                     /protein_id="YP_005108375.1"
                     /db_xref="GI:376278342"
                     /db_xref="GeneID:11686506"
                     /translation="MQRTTVFALVGAVLLLSATSAMAAGVDLAQSNTSMNSLLRLIQN
                     ASNQWAPRLHDYALWLLGCLAVIQLVWTFAPLVMRGAELGDLLHELVKYILVIGFFYA
                     MLDHATEWGGAIVNSFRQAGAHAAGLGSAELMPGDMFSTAVDFSRQVLTAGVSMFSPI
                     TSVVVAVSALIVPMCFTFIAALVFVTLVEAYVIINAAVLFMGFGGSQWTREYALAPIR
                     YAVAVGAKLFVLTLIVGLIMQVSAEWSAAYTNDEASLMTLVGLSLVCAYLTKTIPELI
                     GGMISGTSMGGGSAIGGMAAAGAAGAAAAIATVATSGAAAPAAGALGAAGTGGGAASA
                     AGGGLASALNASMAGGSTTGGIGGATGVGSAGIGASTGGGSGATAKAAGSRVGGGAAS
                     GSANPVSAAASPASQESGSGLKQAAKQAGKAAKGGDDDMDQQAVAQQRQMTPKEGTGG
                     NGKTVAQGAEVATRALGVLGAISVPGMESSHGLSLGGTGSPPPVPGSDSPASDDGAES
                     TAQAESNIIRPASDTTSTGDVGALNVPGMASSVNSQSET"
     misc_feature    complement(348702..349466)
                     /locus_tag="BSVBI22_B0362"
                     /note="P-type conjugative transfer protein TrbL; Region:
                     TrbL_P; TIGR02783"
                     /db_xref="CDD:131830"
     gene            complement(349553..349735)
                     /locus_tag="BSVBI22_B0363"
                     /db_xref="GeneID:11686507"
     CDS             complement(349553..349735)
                     /locus_tag="BSVBI22_B0363"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108376.1"
                     /db_xref="GI:376278343"
                     /db_xref="GeneID:11686507"
                     /translation="MMISKALIAALCLVSALGGSALTAVVVTNAAAPECAAVGNGHQD
                     DQFRSRPNTRGPSEGF"
     gene            complement(349738..350529)
                     /locus_tag="BSVBI22_B0364"
                     /db_xref="GeneID:11686508"
     CDS             complement(349738..350529)
                     /locus_tag="BSVBI22_B0364"
                     /note="similar to SP:P03833, GB:X01007, GB:X13109,
                     GB:X16345, GB:Y00525, PID:43821, SP:P03833, GB:X01007,
                     GB:X13109, GB:X16345, GB:Y00525, and PID:43821; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="trbJ protein"
                     /protein_id="YP_005108377.1"
                     /db_xref="GI:376278344"
                     /db_xref="GeneID:11686508"
                     /translation="MEMESQKTSAYAARKFGRDAALALAMASAGLGVSLYMAPAPAYA
                     IYCSNCSTFYQQMYEYAEAVNTQLNTAQQLQTQIQQYDNMIKQGMSLPSRMFNTITGD
                     LQRVASVYNSAQSLGRNISNLDEQFRQQFKGYDSYLNSIGQGQNNMPQRYRDWAQSGF
                     DNARTAMQAAGVNTSTFEDENALLDQLASRSQSAIGRQQAIQAGNEIAAQNVQQLQKL
                     RDLVATQITLQGNYMAQQNERQSVSDASEQQFRSRENTRGPSEGF"
     misc_feature    complement(349741..350433)
                     /locus_tag="BSVBI22_B0364"
                     /note="P-type conjugative transfer protein TrbJ; Region:
                     TrbJ_Ti; TIGR02780"
                     /db_xref="CDD:131827"
     gene            350627..350779
                     /locus_tag="BSVBI22_B0365"
                     /db_xref="GeneID:11686509"
     CDS             350627..350779
                     /locus_tag="BSVBI22_B0365"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108378.1"
                     /db_xref="GI:376278345"
                     /db_xref="GeneID:11686509"
                     /translation="MIYVRELSVNLQEIVSQHYVLIAFFMTSGTGLAVRFDTFCGQKK
                     PTEVSF"
     gene            complement(350797..351021)
                     /locus_tag="BSVBI22_B0366"
                     /db_xref="GeneID:11686510"
     CDS             complement(350797..351021)
                     /locus_tag="BSVBI22_B0366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108379.1"
                     /db_xref="GI:376278346"
                     /db_xref="GeneID:11686510"
                     /translation="MKTAHRISALANQLNELQACLGRASGRPSKSVMEAQRIAAELAS
                     LLEEWHLETLHIPETERDLYRVQNPYYAAH"
     gene            complement(351024..351242)
                     /locus_tag="BSVBI22_B0367"
                     /db_xref="GeneID:11686511"
     CDS             complement(351024..351242)
                     /locus_tag="BSVBI22_B0367"
                     /note="similar to GP:14523605, GB:L33243, GB:L43601,
                     GB:L43602, GB:L43604, GB:L43605, GB:L43610, GB:L43617,
                     GB:L43618, SP:P98161, PID:799335, PID:903758, and
                     PID:904223; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="traC protein"
                     /protein_id="YP_005108380.1"
                     /db_xref="GI:376278347"
                     /db_xref="GeneID:11686511"
                     /translation="MDKLARKTLSERRADALSELETAKARLAKLDNEAAERIGRIAIK
                     SGLVNLELTDDQVREEFDRIVERISKGN"
     misc_feature    complement(<351030..351188)
                     /locus_tag="BSVBI22_B0367"
                     /note="TraC-like protein; Region: TraC; cl06725"
                     /db_xref="CDD:263014"
     gene            351912..352292
                     /locus_tag="BSVBI22_B0368"
                     /db_xref="GeneID:11686512"
     CDS             351912..352292
                     /locus_tag="BSVBI22_B0368"
                     /note="similar to SP:P17909; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="traJ protein"
                     /protein_id="YP_005108381.1"
                     /db_xref="GI:376278348"
                     /db_xref="GeneID:11686512"
                     /translation="MAGENAIEAIKPHSRGTRPRRERIEVWVSIDEKKELAERADQAG
                     LSNAAFLRAVGLNLPIGSRADLEAVRQLAKVNGDLGRVAGLLKLWLAEKRGQGARPID
                     VEAMMMDFRAIQEDMRALMGKISK"
     misc_feature    351960..352283
                     /locus_tag="BSVBI22_B0368"
                     /note="conjugal transfer relaxosome component TraJ;
                     Provisional; Region: PRK13877"
                     /db_xref="CDD:184361"
     gene            352289..354241
                     /locus_tag="BSVBI22_B0369"
                     /db_xref="GeneID:11686513"
     CDS             352289..354241
                     /locus_tag="BSVBI22_B0369"
                     /note="similar to GB:X62949, GB:L35249, SP:P15313,
                     SP:P21281, PID:179563, PID:37794, PID:522193, PID:587442,
                     GB:X62949, GB:L35249, SP:P15313, SP:P21281, PID:179563,
                     PID:37794, PID:522193, and PID:587442; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="traI protein, putative"
                     /protein_id="YP_005108382.1"
                     /db_xref="GI:376278349"
                     /db_xref="GeneID:11686513"
                     /translation="MIAHRINRERKASSPARLIKYMVAAKGGIDPTSWERTADYILDS
                     ANGTTEGEKVGSYRVTNCGTDDPADAAILIQTTQAANTRSKAEKTYHFVYSFPPGEQP
                     DLETLHAIEDELCAAIGLDEHQRVSAVHIDTDNLHVHVAINKVHPTGLQNIEPYYDQF
                     RLMEACERLEVKHGLQRTFHGLEAKQRYQNRDIELLPAKAPEQRDSLFRKHLRNAYDL
                     SISEPPEAKTLNGLRKLSDTRLQRQSVDKAEPVRIGAKVASVEAQSGIETLTGYAARE
                     LAPAMRQATSWQELHDAAAEHGLEVRQRGAGLVIGEPDLGIWAKASNVGRDLSMKALT
                     DRLGPFQPSERQAEAKANRKRYEPRPRRPDNPTTAGLFNQYQRERQAAILARRQGFDQ
                     IKRESAAFNAQVRQWSQTERMLLKVAGKGPTKRLMYGTIKQQADASRQKNRQSADARR
                     QALFKQTTMPTWADWLTQQAERGNAEALAVLRDRKERTRRWNGELLTADRADKAKAVV
                     LDKLKPRARKDGTMAYSTIDGGMVIDRKTHVQAQKATTGAALVALELASKRFEGQALI
                     VEGTDEFRLEVAQLAGMHGLKVTFTDPAMEQMRRETAEQKEMEKAFQAEVYGQKGIQV
                     REGSKSASVMPQCGKKRPEGRSNDLT"
     misc_feature    352289..>354091
                     /locus_tag="BSVBI22_B0369"
                     /note="Relaxase/Mobilisation nuclease domain; Region:
                     Relaxase; cl19391"
                     /db_xref="CDD:267744"
     gene            complement(354648..356072)
                     /locus_tag="BSVBI22_B0370"
                     /db_xref="GeneID:11686514"
     CDS             complement(354648..356072)
                     /locus_tag="BSVBI22_B0370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108383.1"
                     /db_xref="GI:376278350"
                     /db_xref="GeneID:11686514"
                     /translation="MGLRAAILVDGGALTRQQDAIEEGLALFRDLHSSFPTADVTYNL
                     ANGLVAATGFPPHNENWLNHQELTRARRAEARQCFWKVAQDQDADSTLRTQAWTNIAN
                     QFSNSYRLGEAQDGWLAALEIDPENGVAASSAARNLLWLYERGGCSELTRIEALMLAK
                     IADRHRDRIIQYAGAQAAEQIAAFACELGDPPPRSPHKNPFITWAERERLTLAPVVEL
                     IDPTMGKLDWLMLPGIVERESGTDGMPPPVFAMFNMLKSDFILARDLLWRAVDESVWP
                     ATGRFGDTLDYATYGPDASALILAHRTALDLLDKVAVAANHYFEFGLPPDKVYFGKLW
                     RGGPDRATGIRPLNAKVEQAIRGGTSALYGLVELADDYDSSAGILRSQKDLRNAGTHR
                     FVVLHDLGDPAHSRQAPEIEHHRREPFTQEALRALRVARSAIQMLVLSISQHEQGLVE
                     RTEGLIESLLVPDHDWIRGRDDET"
     gene            complement(356226..357251)
                     /locus_tag="BSVBI22_B0371"
                     /db_xref="GeneID:11686515"
     CDS             complement(356226..357251)
                     /locus_tag="BSVBI22_B0371"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108384.1"
                     /db_xref="GI:376278351"
                     /db_xref="GeneID:11686515"
                     /translation="MPFEIRPWEAIVENYGCTILLGNGASISVNPSFSYTSLLQHATE
                     QNLLPDDAQQLFNFFKTNDFELVLRIVWQASNVNRSLRIPDERTHATYVALRDCLIQT
                     VRDIHPEHGAVSAHLPTIYQFLKRFQTVISLNYDLVVYWAITYGLDIDDRHAFKDCFV
                     GGGTFNDDWQRFRQPIRGERSTSLVFYPHGSLVLCRNLVEQERKIHNLQDGLLEAVLQ
                     CWQDGQVVPLFVSEGTWSQKITSIQNSYYLSTVYREVLKSQRDTLVVYGWGFAEQDIH
                     LLQRMNGTGINRVAVSVFRGDQAYCNRVFQIIHDVLGAHVEVEFFNSESPGCWIHPPH
                     QEPRPAG"
     gene            complement(357285..358010)
                     /locus_tag="BSVBI22_B0372"
                     /db_xref="GeneID:11686516"
     CDS             complement(357285..358010)
                     /locus_tag="BSVBI22_B0372"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108385.1"
                     /db_xref="GI:376278352"
                     /db_xref="GeneID:11686516"
                     /translation="MISIVLLGKYGVQDLSLPHGQLLYGLLNTLRDLDARTLMLALAE
                     VVATTGDLRARVNPKYRFDERLHDLTQCLLLDGYIIKSKMLVQTDPSITDAAPLEDDL
                     IDALQKSGAPRAQEIIAKINDSAGAFRSTPPDYNASLVNARVALETLAGDVAAHNASQ
                     QPTPPTYNPSKWGEVLVFLRSSGEITVEEEKGLAGVFGFLSPGAHRPMGIPEDQMTRL
                     GRSFALHMCWFLLKNHLLRIQQP"
     gene            complement(358189..359910)
                     /locus_tag="BSVBI22_B0373"
                     /db_xref="GeneID:11686517"
     CDS             complement(358189..359910)
                     /locus_tag="BSVBI22_B0373"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00634"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108386.1"
                     /db_xref="GI:376278353"
                     /db_xref="GeneID:11686517"
                     /translation="MIHNIFSTLPSFKNLGDLKPGLNVLLAQKTEGASTKQTRNRAGK
                     TSFVELVHFLLGADAGPESIFRTPELAEHTFGMDFDLNSERTVVERSGGSKAKIFVTA
                     PPAAKVKFSATEWCTFLGEQMFGLSSLEAAGSKPPSFRSLFAYFVRRQASGAFMTPEK
                     QATMQGTSDMQMALMFLLGLDWQIARDWQAVRDREKTLEELKKAAGNGVFGSIIGKVA
                     DLRTELTIQEARLKKLHAEVGTFQVLPEYRELEVESATLTRELNDLANANTIDFSAIR
                     DLENALASEIPPDHEDLQAVYQEAGIVLPGLVKRRYEDVKSFHDSVVRNRKDYLSSEL
                     EAAKLRIELRDSKKAQLDQRRGEILGILKSHGALEQFLKLQGELGRLESEVESLRQRF
                     EAAEQLEGTRNELDIERNRLTIRLRRDFAEQKDRLAEAIVAFEETSQRLYESAGSMTV
                     DETSNGPIFKFPMQGERSKGIKNMQIFCFDMMLMRLCAKRQMGPGFLIHDSHLFDGVD
                     GRQVISALRLGSEIAQELGFQYIVTMNEDDAFKETIDGFDLNDHVLPTRLTDATEDGG
                     LFGIRFG"
     misc_feature    complement(358195..359883)
                     /locus_tag="BSVBI22_B0373"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG5293"
                     /db_xref="CDD:227612"
     misc_feature    complement(358195..358605)
                     /locus_tag="BSVBI22_B0373"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2326); Region: DUF2326; pfam10088"
                     /db_xref="CDD:255744"
     gene            complement(360152..360976)
                     /locus_tag="BSVBI22_B0374"
                     /db_xref="GeneID:11686518"
     CDS             complement(360152..360976)
                     /locus_tag="BSVBI22_B0374"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108387.1"
                     /db_xref="GI:376278354"
                     /db_xref="GeneID:11686518"
                     /translation="MLKAHPNDFMACRPWGNVGDRKNDGYLPSARILFQSYAPNELSA
                     TEAIKKINEDFEGAKEHWEDYFDEWTFVHNAPDGRLGPHIIEALAKLAQDNPQLKIGH
                     CGYEEMLTKFRQLSLQDLESWFGPSLTMEANVNLGFGDLTAVLTHISITPVPTASEVK
                     NVSRGKIEANLLSQAVADFLKIGMQKSPLVAQFFNSWKNPTYGEQIAQAFKSEYVKLR
                     DGVSQLHPDEIFGRLEAWAGGTTNTTPAHKAAVLAVLAYLFDKCEIFEDAQAMGAA"
     gene            complement(361121..361315)
                     /locus_tag="BSVBI22_B0375"
                     /db_xref="GeneID:11686519"
     CDS             complement(361121..361315)
                     /locus_tag="BSVBI22_B0375"
                     /note="similar to GB:M23326, GB:X15261, GB:X13954,
                     PID:1049195, PID:2358067, PID:312412, PID:37046,
                     PID:37048, PID:37298, PID:37324, and PID:540457;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-damage-inducible protein J, putative"
                     /protein_id="YP_005108388.1"
                     /db_xref="GI:376278355"
                     /db_xref="GeneID:11686519"
                     /translation="MASSNDVVRARIDGHIKEEATNVLSGMGLSVSDAIRILLTRIAT
                     DKALPFDINRVQAQPSIKKP"
     misc_feature    complement(<361157..361312)
                     /locus_tag="BSVBI22_B0375"
                     /note="DNA-damage-inducible protein J [DNA replication,
                     recombination, and repair]; Region: RelB; COG3077"
                     /db_xref="CDD:225619"
     gene            361725..361910
                     /locus_tag="BSVBI22_B0376"
                     /db_xref="GeneID:11686520"
     CDS             361725..361910
                     /locus_tag="BSVBI22_B0376"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108389.1"
                     /db_xref="GI:376278356"
                     /db_xref="GeneID:11686520"
                     /translation="MQMCRLGGVYEKAGRGRTCENVVLWFDSRPAGPGMLPVMDETPQ
                     YTAGQKLFRIDLNYCFS"
     gene            362022..362570
                     /locus_tag="BSVBI22_B0377"
                     /db_xref="GeneID:11686521"
     CDS             362022..362570
                     /locus_tag="BSVBI22_B0377"
                     /note="similar to GB:D14695, and PID:285961; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane antigen, putative"
                     /protein_id="YP_005108390.1"
                     /db_xref="GI:376278357"
                     /db_xref="GeneID:11686521"
                     /translation="MKNLFRTAALMVPLSLALAYGAQAKEIPIGKPQLLGGMEIAAVY
                     LQPIEMEPEGMMRPAKDSDVHLEADIKAAKDNTNGFAEGDWVPYLVVSYELTHLDNGK
                     VQKGDFMPMVANDGPHYGDNVKLDGPGKYKLKLFVSPPSANQHAHFGRHVDKETGVGP
                     WFKPVTAEYEFVYAGTGKKGAY"
     misc_feature    362022..362555
                     /locus_tag="BSVBI22_B0377"
                     /note="Uncharacterized protein probably involved in
                     high-affinity Fe2+ transport [Inorganic ion transport and
                     metabolism]; Region: Tpd; COG3470"
                     /db_xref="CDD:226001"
     gene            362574..362972
                     /locus_tag="BSVBI22_B0378"
                     /db_xref="GeneID:11686522"
     CDS             362574..362972
                     /locus_tag="BSVBI22_B0378"
                     /note="similar to GB:M20730, SP:P16534, GB:M24197,
                     PID:150496, and PID:150515; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108391.1"
                     /db_xref="GI:376278358"
                     /db_xref="GeneID:11686522"
                     /translation="MARPLTQTMLHRSCDGFAKFANAFRKAVWGGVVLLAVASSVAWA
                     EEPTFRLEFKDGVITPDRLEVPANTRFRIELVNTGSMPAEFESLELRKEKVIAAQSET
                     VMVIRTLDPGEYPFFDDFHPGGTPAILIAK"
     misc_feature    362667..362939
                     /locus_tag="BSVBI22_B0378"
                     /note="Cupredoxin-like domain; Region: Cupredoxin_1;
                     pfam13473"
                     /db_xref="CDD:257797"
     gene            362979..363815
                     /locus_tag="BSVBI22_B0379"
                     /db_xref="GeneID:11686523"
     CDS             362979..363815
                     /locus_tag="BSVBI22_B0379"
                     /note="similar to GP:6469262, and GP:6469262; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="FTR1 family iron permease"
                     /protein_id="YP_005108392.1"
                     /db_xref="GI:376278359"
                     /db_xref="GeneID:11686523"
                     /translation="MNVQDFNILFVIWRECIEALLVVGILNAWLSHRPAQEQRTGRIW
                     LWSGVAAGLAGALVLAFLLLTVGDMLSDDAQDYFQTAIVLLAAGLIVQMVFWMRKHGR
                     TLKKELHASLTDVADKANWLGVFALAALAVMREGSEAAVFLYGTMAGISASNYNALVA
                     ALIGLAAALGTYWLLQLGSRVLSWNAFFRITEVMLLFLAGSLLLTGIDHLISLGVLPP
                     LSARLWNTSAILSDNGMLGGLVSGLTGYRARPVLIEVLVFFAYWTIVLWFLSRPRALQ
                     TA"
     misc_feature    362979..>363800
                     /locus_tag="BSVBI22_B0379"
                     /note="High-affinity Fe2+/Pb2+ permease [Inorganic ion
                     transport and metabolism]; Region: FTR1; COG0672"
                     /db_xref="CDD:223744"
     gene            363776..365209
                     /locus_tag="BSVBI22_B0380"
                     /db_xref="GeneID:11686524"
     CDS             363776..365209
                     /locus_tag="BSVBI22_B0380"
                     /note="similar to SP:P35097, and GB:Z47792; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108393.1"
                     /db_xref="GI:376278360"
                     /db_xref="GeneID:11686524"
                     /translation="MVSVPASRPANRLIAGEEKRLQRALARTGLWLRDHQRAIRAIQW
                     VIIGAYAGLLIIPLMTPMPDRLSHIWSNAVLFAQFMFWGIWWPFVLVSMVLMGRTWCG
                     VFCPEGALAEAASRHGYGRATPRWIKWKGWPFVAFACTTIYGQMVSVYQYPKPVIIVL
                     GGSTLAAMAVGFLYGREKRVWCRYLCPVSGVFAVLAKLAPVYYRVDRETWNDWERKPG
                     TPMPHVNCAPLVPIKTMRGASACHMCGRCAGFKDAIQLSGRSPSYEVVEVAGDAPKPW
                     ESLLIIFGMMGIAAGAFQWASSPIYVDVKQWLAEWLVEHGGIAMIQPQLPWWVLTNYP
                     DLNDMMTPLDGGLMIAYILAVACITSIAVGGLVAIANWALGGWKAARFHHLVQCLIPM
                     AGCGVFLGLSATTVTLLKAEDVPLAFVSDLRILLLLGAVVWSAWLLWSVARRYTSSMA
                     RRLVATAMGALATGVAAFNLVLLFWIW"
     misc_feature    363833..365092
                     /locus_tag="BSVBI22_B0380"
                     /note="Polyferredoxin [Energy production and conversion];
                     Region: NapH; COG0348"
                     /db_xref="CDD:223425"
     misc_feature    364007..>364123
                     /locus_tag="BSVBI22_B0380"
                     /note="4Fe-4S binding domain; Region: Fer4_5; pfam12801"
                     /db_xref="CDD:257308"
     gene            complement(365467..367836)
                     /gene="xfp"
                     /locus_tag="BSVBI22_B0381"
                     /db_xref="GeneID:11686525"
     CDS             complement(365467..367836)
                     /gene="xfp"
                     /locus_tag="BSVBI22_B0381"
                     /note="similar to SP:Q9AEM9; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphoketolase"
                     /protein_id="YP_005108394.1"
                     /db_xref="GI:376278361"
                     /db_xref="GeneID:11686525"
                     /translation="MPAKGPLTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREPLQP
                     EHIKPRLLGHWGTTPGLNFIYAHLNRIIQQRNANVIYICGPGHGGPGMVANTYLEGTY
                     SEIYPAISEDEAGMERLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFD
                     NPDLVVACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLNGYKIANPTVLARL
                     SDDDLDNLFRGYGYEPFFVEGSEPADMHQKMAATLDTIFQRIQDIKKNADVHSPERPR
                     WPMIILRSPKGWTGPKTVDGLVVENYWRAHQVPVANCRENDAHRKILEDWMKSYDPSD
                     LFDEKGALKPELRALAPKGEARIGANPHANGGLLRKELHMPDFRQYAVNVTEPGAIEA
                     QSTKILGDFLRDVMKLNETEKNFRIFGPDETASNRLGSVLEATNRVWMAETLDMDDHL
                     AADGRVMEVLSEHLCQGWLEGYLLSGRHGFFSCYEAFIHIIDSMFNQHAKWLQVAREL
                     EWRKPISSLNYLLTSHVWRQDHNGFSHQDPGFVDLVANKSADIVRVYFPPDANTLLWV
                     GDHCLKTWNRVNVIVAGKQPEPQWLTMAEAEKHCEAGLGIWEWAGTEDGLEPDIVMAC
                     AGDVPTMETLAAVDLLRQSLPHLRIRVVNVVDLMVLQSPHQHPHGISDEEFDRMFTTN
                     RPVIFAYHGYPYLIHRLVYKRTNHSNFHVRGFIEQGTTTTPFDMTVLNELDRFHLAME
                     AVERLPLGESVAKPLIDNFTEKLALHKDYIRQHGEDMPEIRDWKWTWPR"
     misc_feature    complement(365470..367824)
                     /gene="xfp"
                     /locus_tag="BSVBI22_B0381"
                     /note="putative phosphoketolase; Provisional; Region:
                     PRK05261"
                     /db_xref="CDD:235379"
     misc_feature    complement(366910..367587)
                     /gene="xfp"
                     /locus_tag="BSVBI22_B0381"
                     /note="Thiamine pyrophosphate (TPP) family,
                     Phosphoketolase (PK) subfamily, TPP-binding module; PK
                     catalyzes the conversion of D-xylulose 5-phosphate and
                     phosphate to acetyl phosphate,
                     D-glyceraldehyde-3-phosphate and H2O. This enzyme requires
                     divalent...; Region: TPP_PK; cd02011"
                     /db_xref="CDD:238969"
     misc_feature    complement(order(367216..367218,367222..367224,
                     367315..367326,367396..367398))
                     /gene="xfp"
                     /locus_tag="BSVBI22_B0381"
                     /note="TPP-binding site; other site"
                     /db_xref="CDD:238969"
     misc_feature    complement(366118..366654)
                     /gene="xfp"
                     /locus_tag="BSVBI22_B0381"
                     /note="D-xylulose 5-phosphate/D-fructose 6-phosphate
                     phosphoketolase; Region: XFP; pfam03894"
                     /db_xref="CDD:252232"
     misc_feature    complement(365479..366087)
                     /gene="xfp"
                     /locus_tag="BSVBI22_B0381"
                     /note="XFP C-terminal domain; Region: XFP_C; pfam09363"
                     /db_xref="CDD:255316"
     gene            complement(367866..369071)
                     /locus_tag="BSVBI22_B0382"
                     /db_xref="GeneID:11686526"
     CDS             complement(367866..369071)
                     /locus_tag="BSVBI22_B0382"
                     /note="Enables the production of acetyl-CoA by
                     phosphorylating acetate in the presence of ATP and a
                     divalent cation"
                     /codon_start=1
                     /transl_table=11
                     /product="acetate kinase"
                     /protein_id="YP_005108395.1"
                     /db_xref="GI:376278362"
                     /db_xref="GeneID:11686526"
                     /translation="MKKQLVTFNAGSSTVKIGVFECDENAVRKVSKGDIDLTGSPLRF
                     RLRGENGNLDIVLSASGADEITTILGELFDKLAEHIDPSRILAVGHRVVFGGDDFAQA
                     VLIDDDNLEAIERLSIFAPLHQPKSLALIKAVRKIFPHLAQTASFDTAFHQTIPDTVR
                     RFAIPQELHDRGIKRFGFHGLSYKSVIGNFSQRAPELAEGKIIAAHLGSGASLCAMHK
                     RKSLDTSMSFSTLDGIPMATRCGALDPGVLLHLLQQEKMEADALADLLYHRSGLLGLS
                     GLSGDTRDLLESDAPQAHTALDIFALRIAGEICRLASTPNGLDAVIFTAGIGEHQPAI
                     RAAICQRLAWQGVELDPAANDENAFCITSRTSRTAAFVLPTDEEQIIASETFEIIRQM
                     PATARSAFA"
     misc_feature    complement(367887..369071)
                     /locus_tag="BSVBI22_B0382"
                     /note="acetate kinase; Provisional; Region: PRK07058"
                     /db_xref="CDD:235922"
     gene            369310..369471
                     /locus_tag="BSVBI22_B0383"
                     /db_xref="GeneID:11686527"
     CDS             369310..369471
                     /locus_tag="BSVBI22_B0383"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108396.1"
                     /db_xref="GI:376278363"
                     /db_xref="GeneID:11686527"
                     /translation="MVHVRIVLDQNHMAGPCIPGIQGTTFDIGFPNHRGEFPALFAPA
                     QEACPPNFL"
     gene            369514..370677
                     /locus_tag="BSVBI22_B0384"
                     /db_xref="GeneID:11686528"
     CDS             369514..370677
                     /locus_tag="BSVBI22_B0384"
                     /note="identified by match to PFAM protein family HMM
                     PF00067"
                     /codon_start=1
                     /transl_table=11
                     /product="heme-thiolate monooxygenase, putative"
                     /protein_id="YP_005108397.1"
                     /db_xref="GI:376278364"
                     /db_xref="GeneID:11686528"
                     /translation="MTSPTERPKQDWDPRSEAVLSDQIGAYDAMRHQCPVAHSDYLGW
                     SLFSYDDVVRVLDDHETFSSVVSAHLSVPSGMDPPQHTAFRQLVERYFEPERIKAFEP
                     ICREISKKLVCELPRDAEIDLVTQFAQLYAVRIQCAFLGWPDSLQGPLLDWVNKNHAA
                     TLACDTKAMAAIALEFDEYIRDLLDERRKLGADAPDDVTTRLLRDRIDGRNLTHEEIV
                     SILRNWTVGELGTITACVGILCHYLAKSQQTQALMRGGPDLLPAAIDEILRLHAPLIS
                     NRRVTTRAVVVGGREIPAGEKITLMWASANRDEAVFDKPDELRLNRDPALNLLYGRGI
                     HVCPGAELARAELRILMEELLGQTRKLDLVPGSVPALAVYPASGFSRLPARIS"
     misc_feature    369550..370668
                     /locus_tag="BSVBI22_B0384"
                     /note="Cytochrome P450 [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: CypX;
                     COG2124"
                     /db_xref="CDD:225035"
     gene            complement(370748..371425)
                     /locus_tag="BSVBI22_B0385"
                     /db_xref="GeneID:11686529"
     CDS             complement(370748..371425)
                     /locus_tag="BSVBI22_B0385"
                     /note="similar to GP:14524114; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005108398.1"
                     /db_xref="GI:376278365"
                     /db_xref="GeneID:11686529"
                     /translation="MTEASGNEWIKPIQRQNLSELAYTTLREALMEGRLKPGEDLPLR
                     PISRSFGISATPMREALLRLVAEHALEIDARGRISVPHLTRAELLEVRKLRGFLEGNA
                     AREATLNATPEAVDALEQIHFELITAQDAGDFPTAIGFNTKFHLKMCEIAGLPVTHEL
                     VSNLWVRCGPLISHLYDAGIPANWNPHPHVLIVKAIRARDPDMAYKELNRDIEGSGAG
                     LLAHVKD"
     misc_feature    complement(370751..371419)
                     /locus_tag="BSVBI22_B0385"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    complement(371186..371374)
                     /locus_tag="BSVBI22_B0385"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    complement(order(371201..371203,371207..371212,
                     371240..371242,371249..371254,371258..371272,
                     371294..371299,371300..371302,371369..371371))
                     /locus_tag="BSVBI22_B0385"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(370784..371167)
                     /locus_tag="BSVBI22_B0385"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            371483..371704
                     /locus_tag="BSVBI22_B0386"
                     /db_xref="GeneID:11686530"
     CDS             371483..371704
                     /locus_tag="BSVBI22_B0386"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108399.1"
                     /db_xref="GI:376278366"
                     /db_xref="GeneID:11686530"
                     /translation="MSYNGKCDGTLAVEEPCAGGGLVSPLYKCLSAPVAGQVVCVRFR
                     GVFFGKAVVDVTYPDHVVMFLFSESVQNA"
     gene            371697..372704
                     /locus_tag="BSVBI22_B0387"
                     /db_xref="GeneID:11686531"
     CDS             371697..372704
                     /locus_tag="BSVBI22_B0387"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00692"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase, zinc-containing"
                     /protein_id="YP_005108400.1"
                     /db_xref="GI:376278367"
                     /db_xref="GeneID:11686531"
                     /translation="MPKAVLSVIATRPGGPEVLELVPRELPALKRGEMRVRVHAAGVN
                     RPDAMQRAGQYPPPPGVTDVLGLELSGVVLEIAEDVTRFGPGDRIMALVAGGAYSEEA
                     IVQADVCIPVPAGLSMVEAAGIPETYFTVWSNLFQHAGLQPGETVLLHGGTSGIGVTA
                     TLLAKAIGARMITTCGSDDKCRASEALGAIASINYRTTDFVEAGRALTEGRGPEVVID
                     MVGGSYMQRNLQLVAEDGRIAQIAFQQGSEAQMDMGPLLFKRLTLTGSTLRARPLVMK
                     AALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAAHAHLEASAHTGKIILKTAACDA
                     A"
     misc_feature    371709..372683
                     /locus_tag="BSVBI22_B0387"
                     /note="putative NAD(P)H quinone oxidoreductase, PIG3
                     family; Region: quinone_pig3; TIGR02824"
                     /db_xref="CDD:234027"
     misc_feature    371718..372677
                     /locus_tag="BSVBI22_B0387"
                     /note="PIG3 p53-inducible quinone oxidoreductase; Region:
                     p53_inducible_oxidoreductase; cd05276"
                     /db_xref="CDD:176180"
     misc_feature    order(371826..371831,372072..372074,372084..372086,
                     372093..372095,372147..372149,372156..372164,
                     372219..372224,372234..372236,372279..372281,
                     372351..372356,372417..372422,372426..372428,
                     372492..372500,372642..372644,372657..372659)
                     /locus_tag="BSVBI22_B0387"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176180"
     gene            372788..373999
                     /locus_tag="BSVBI22_B0388"
                     /db_xref="GeneID:11686532"
     CDS             372788..373999
                     /locus_tag="BSVBI22_B0388"
                     /note="similar to SP:P04816, GB:L19201, SP:P32174,
                     PID:304996, GB:U00096, and PID:1790325; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter,
                     periplasmic amino acid-binding protein, putative"
                     /protein_id="YP_005108401.1"
                     /db_xref="GI:376278368"
                     /db_xref="GeneID:11686532"
                     /translation="MRLSRLLIGASLGVALSSTAFTAALADVKFGSLYPISGSLALLG
                     EESARGLELAVDEVNAAGGIKGEKVVLERGDAVDNNQATGEARRLISLVGVKAIFGTY
                     SSARVIAASQVSELAGIPYFEMGAVADEVTGRGLQYLFRTNPTAENMAKDSVDMLIKG
                     IAPGLGKDPKDMKIGIIYEDSSYGTSVAGHQEDNAKAAGLTVVLKSGYPSNTVDMSSL
                     VLELREKGADVVMQTSYQNDSVLFLQQANEAGYKPLAIIGGGGGYSMQPTADAVGHDL
                     IDGVFDADYTQYAVNTSATPGLTEFVEAYKAKYGSQPRSGHSLTNYVGAKAIFQALNA
                     GEGFEPDQIVSAVKALDIPDGQTAAGYGVKFGKNNQNERATMMGMQWQDGKLVTVYPE
                     NAAIAKMRFKK"
     misc_feature    372872..373909
                     /locus_tag="BSVBI22_B0388"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     misc_feature    372923..373936
                     /locus_tag="BSVBI22_B0388"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     gene            374048..374932
                     /locus_tag="BSVBI22_B0389"
                     /db_xref="GeneID:11686533"
     CDS             374048..374932
                     /locus_tag="BSVBI22_B0389"
                     /note="similar to GP:19715091; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter,
                     permease protein"
                     /protein_id="YP_005108402.1"
                     /db_xref="GI:376278369"
                     /db_xref="GeneID:11686533"
                     /translation="MTTFLQILLNGLMLGGLFAIVAVGLTLIFGIVKVVNFAHGEFLM
                     AGMFVTWLITTKLGLHPYAAVIIVLPAMFILGALTQRLLIQPLMASDDGHAQIFATVG
                     LSTAMINLALLIFGADIANTPNFGLRTPIEIGPLRVLTGQVFIFLGAIVLVVALQLFL
                     KNSQTGRAIRAVAQHRSAAELMGVNVSRIYILCFGLGAACVGLAAVLIAPLYPTSSNI
                     GTYFVLTAFVVVVLGGLGSIPGAFVGALIIGVIDTMSGYYIGSDLREAVVFGIFLLIL
                     ILKPSGLFGKQLNLSHLS"
     misc_feature    374099..374899
                     /locus_tag="BSVBI22_B0389"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    374576..374632
                     /locus_tag="BSVBI22_B0389"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            374942..376779
                     /locus_tag="BSVBI22_B0390"
                     /note="This region contains an authentic frame shift and
                     is not the result of a sequencing artifact; branched-chain
                     amino acid ABC transporter, ATP-binding/permease protein,
                     authentic frameshift; similar to GP:17985077, GB:M99427,
                     PID:151709, and SP:Q52451; identified by sequence
                     similarity; putative"
                     /db_xref="GeneID:11686534"
     gene            376766..377470
                     /locus_tag="BSVBI22_B0391"
                     /db_xref="GeneID:11686535"
     CDS             376766..377470
                     /locus_tag="BSVBI22_B0391"
                     /note="similar to SP:P22731; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter,
                     ATP-binding protein"
                     /protein_id="YP_005108403.1"
                     /db_xref="GI:376278370"
                     /db_xref="GeneID:11686535"
                     /translation="MLTLEHVDAGYGRATILQDVSLEVKEGEIVTIVGANGAGKTTTL
                     RTIVGQIQPRAGKITFLGEDITHLPAHEVVDRGIILIPEGRQLFPDMTVRENLQMGTY
                     RRAARAAQESRMEEVLELFPRVRERLDQTASSLSGGEQQMVAIARGMMANPRILMFDE
                     PSLGLAPIVVSQVFDVVRKIAATGTTVLIVEQNVFTTLKVANRGYVLENGRVVLADSS
                     EALLNNDHVRRAYLGI"
     misc_feature    376766..377467
                     /locus_tag="BSVBI22_B0391"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    376769..377437
                     /locus_tag="BSVBI22_B0391"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    376865..376888
                     /locus_tag="BSVBI22_B0391"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(376874..376879,376883..376891,377012..377014,
                     377240..377245,377339..377341)
                     /locus_tag="BSVBI22_B0391"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    377003..377014
                     /locus_tag="BSVBI22_B0391"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    377168..377197
                     /locus_tag="BSVBI22_B0391"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    377228..377245
                     /locus_tag="BSVBI22_B0391"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    377252..377263
                     /locus_tag="BSVBI22_B0391"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    377327..377347
                     /locus_tag="BSVBI22_B0391"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            377473..378270
                     /gene="fabG"
                     /locus_tag="BSVBI22_B0392"
                     /db_xref="GeneID:11686536"
     CDS             377473..378270
                     /gene="fabG"
                     /locus_tag="BSVBI22_B0392"
                     /note="Catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-(acyl-carrier-protein) reductase"
                     /protein_id="YP_005108404.1"
                     /db_xref="GI:376278371"
                     /db_xref="GeneID:11686536"
                     /translation="MELTEITPESLRLRPSHKERNVLITGAARGIGRAIAQAFVERSA
                     TVGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAIDDTGLVFDTVVNNA
                     GISPKHNGVAHKVWEMAPDEWRRLVDVNLTGTFNTIRALTPGMVEARRGWIVNTSSVA
                     GKTYSPIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVN
                     AEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYMA"
     misc_feature    377515..378264
                     /gene="fabG"
                     /locus_tag="BSVBI22_B0392"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    377530..378261
                     /gene="fabG"
                     /locus_tag="BSVBI22_B0392"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(377548..377550,377554..377559,377563..377565,
                     377620..377628,377773..377781,377938..377946,
                     377986..377988,377998..378000,378076..378087)
                     /gene="fabG"
                     /locus_tag="BSVBI22_B0392"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(377860..377862,377944..377946,377986..377988,
                     377998..378000)
                     /gene="fabG"
                     /locus_tag="BSVBI22_B0392"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            378275..379093
                     /locus_tag="BSVBI22_B0393"
                     /db_xref="GeneID:11686537"
     CDS             378275..379093
                     /locus_tag="BSVBI22_B0393"
                     /note="identified by match to PFAM protein family HMM
                     PF00745"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase family protein"
                     /protein_id="YP_005108405.1"
                     /db_xref="GI:376278372"
                     /db_xref="GeneID:11686537"
                     /translation="MITGHTKLYGIVANPIAHVKTPEEVNKHFAALGHDGVLVPFHVL
                     PENLAQFVNSLRKLENPGGLVVTVPHKTAILSLCDRLEGDAAAIGAANVIRRESDGTL
                     VGVMLDGKGFVSGLVASDIDVTGMNACLFGAGGAASAIAFALAEAGVARLTIVNRSED
                     KARDLAARVSERYPAVQIDAGAPQTASRDLIINATSLGLRAGDPLPLDDLAFHAGQIV
                     AEVIMEPEVTPLLAAARDKGARIHFGRPMLRQQIRLMAEHMGAKANADVQKPTE"
     misc_feature    378275..379048
                     /locus_tag="BSVBI22_B0393"
                     /note="Shikimate 5-dehydrogenase [Amino acid transport and
                     metabolism]; Region: AroE; COG0169"
                     /db_xref="CDD:223247"
     misc_feature    378305..378556
                     /locus_tag="BSVBI22_B0393"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    378596..379027
                     /locus_tag="BSVBI22_B0393"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    order(378596..378598,378941..378943,379016..379018,
                     379025..379027)
                     /locus_tag="BSVBI22_B0393"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    order(378671..378673,378680..378682,378740..378745,
                     378854..378862,378935..378937,379004..379006,
                     379013..379018)
                     /locus_tag="BSVBI22_B0393"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            379098..380732
                     /locus_tag="BSVBI22_B0394"
                     /db_xref="GeneID:11686538"
     CDS             379098..380732
                     /locus_tag="BSVBI22_B0394"
                     /note="identified by match to PFAM protein family HMM
                     PF00070"
                     /codon_start=1
                     /transl_table=11
                     /product="GMC family oxidoreductase"
                     /protein_id="YP_005108406.1"
                     /db_xref="GI:376278373"
                     /db_xref="GeneID:11686538"
                     /translation="MAYALPQDACFDFIIVGGGTAGCILAEALTRSGRNRVLLCEAGG
                     EARSPWIRIPAGFYKLLVNRRYNWGFWSEEEAATNFRRIAIPRGKGLGGSTLINGMIY
                     VRGQPQDYEGWRERGATGWGWDDVLPYFKAIERWTLPDPDGLRGRSGPLPVNEVVEKT
                     PIGDAFIAAAVAQGQCFNPDYNGRRQDGVGWYQVNQAGGERYSADRAWLEQARKRPNL
                     TVLTGARVMRILLEGRKAAGVALRHKGSEQTVYGAEVILAAGAVQTPQLLELSGIGDP
                     VRLQGIGIEPIHALPGVGENYLDHFCTRMNWRVSQPITLNELTRGPRLVGEVLKYVLK
                     RRGVLTYGTGLNHAFLRSRPELDRPDVQFFFMHASYANAAERKLHRFPGMTLGVTQLR
                     PRSCGSIHAISPDLSVQPAIAPNFLDHEEDRRVMVDGMKLARDIIEQKPMDAFRVAEL
                     SPGSNCNSDEDWLSFARANGQTIYHAAGTCRMGVDPLAVVDPSLCVHGIAGLRVIDAS
                     VMPEMVSGNTQAAVMMLAAKAADIVLEDKGQAPAGR"
     misc_feature    379128..380729
                     /locus_tag="BSVBI22_B0394"
                     /note="choline dehydrogenase; Validated; Region: PRK02106"
                     /db_xref="CDD:235000"
     misc_feature    379128..>379223
                     /locus_tag="BSVBI22_B0394"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    379323..379997
                     /locus_tag="BSVBI22_B0394"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    380274..380678
                     /locus_tag="BSVBI22_B0394"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            380757..382187
                     /locus_tag="BSVBI22_B0395"
                     /db_xref="GeneID:11686539"
     CDS             380757..382187
                     /locus_tag="BSVBI22_B0395"
                     /note="similar to GP:15159844; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase family protein"
                     /protein_id="YP_005108407.1"
                     /db_xref="GI:376278374"
                     /db_xref="GeneID:11686539"
                     /translation="MYPNLTLIVGGEERNKGSAGTLCLTDPADGRELTIAPRAGRAEA
                     LQAAAAEKGFAEWSALSALERSKIMRRAADIMRERADAAARIMSMEQGKPLAEARGEW
                     LGSADLLDWFAEEGRRVYGRIVPSRAPNIQIQVLKHPIGPVAAFTPWNFPAWNTMQKV
                     APALGAGCSVVIKPASDTPGTAWLIGKCLLEAGLPPKAVSVIWGTTSELSDALIKAPE
                     FRKVSLTGSTRVGRIVAAQAGEYLKKVTMELGGHGPVIVAADADLDHLIPLAVQWKFR
                     NCGQVCVSPTRFIVEASIHDEFIRRFSEKARELKVGKGVEEGTQMGPLTSQNQLETVL
                     SMVEDALTKGAKIETGGNRIGDTGNFYEPTILSGMTAEMLAMNEEPFGPLALVMRVHS
                     LDEAIAESNRLPVGLGAYLFTSSMTTAHRVQNHLQAGMLGVNHFALALPETPFGGVRD
                     SGFGSEGGLEGIEAYLTTMTVTTMMV"
     misc_feature    380829..382154
                     /locus_tag="BSVBI22_B0395"
                     /note="Mitochondrial succinate-semialdehyde dehydrogenase
                     and ALDH family members 5A1 and 5F1-like; Region:
                     ALDH_F5_SSADH_GabD; cd07103"
                     /db_xref="CDD:143421"
     misc_feature    order(380937..380939,380964..380966,381087..381089,
                     381096..381101,381105..381131,381147..381155,
                     381168..381170,381414..381416,381450..381452,
                     381462..381464,381471..381473,381642..381644,
                     381654..381656,381792..381794,381996..381998,
                     382002..382007,382017..382019,382023..382025,
                     382032..382034,382038..382058,382074..382076,
                     382083..382088,382104..382106,382119..382121)
                     /locus_tag="BSVBI22_B0395"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143421"
     misc_feature    order(381192..381206,381228..381230,381273..381275,
                     381279..381284,381426..381437,381444..381446,
                     381453..381458,381498..381506,381600..381602,
                     381891..381893,381897..381899,381975..381977,
                     382089..382091)
                     /locus_tag="BSVBI22_B0395"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143421"
     misc_feature    order(381204..381206,381498..381500,381591..381593,
                     381600..381602)
                     /locus_tag="BSVBI22_B0395"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143421"
     gene            382279..383442
                     /locus_tag="BSVBI22_B0396"
                     /db_xref="GeneID:11686540"
     CDS             382279..383442
                     /locus_tag="BSVBI22_B0396"
                     /note="similar to SP:P02917, GB:L19201, SP:P32174,
                     PID:304996, GB:U00096, and PID:1790325; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter,
                     periplasmic amino acid-binding protein, putative"
                     /protein_id="YP_005108408.1"
                     /db_xref="GI:376278375"
                     /db_xref="GeneID:11686540"
                     /translation="MLAGAAPASADIKMGSLYPFSGPLALLGDESARGLEIAVEEINA
                     KGGVQGEKIVLVRGDAVDNNQAIGEARRLISVENVAGIFGTFSSGRAVAASQVSELAG
                     VPYFELGAVADEITDRGLENVYRANPYARDFAQMIVEMLQKKIAPKLGKDSKDLKIAV
                     IYEDSSYGTSVAKHEETFLKEAGLNMVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTS
                     YQSDSVLFLQQANEGGYKPSAIVGAGGGYSLQPTADAVGHDVIEAAYDVDFTQFAVNT
                     SFTPGLEEFVEAYKKKYGETPRSGHSLTNYVGAKVILEALNKVKGFDAAAVKQALSAV
                     DIEAGKTAMGYGFKFDQNNQNERASMMGMQWQDGKLVTVYPDAAAISEIRLPQ"
     misc_feature    382315..383352
                     /locus_tag="BSVBI22_B0396"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     misc_feature    382366..383379
                     /locus_tag="BSVBI22_B0396"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     gene            383505..384632
                     /locus_tag="BSVBI22_B0397"
                     /db_xref="GeneID:11686541"
     CDS             383505..384632
                     /locus_tag="BSVBI22_B0397"
                     /note="similar to GP:15075876; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase, zinc-containing"
                     /protein_id="YP_005108409.1"
                     /db_xref="GI:376278376"
                     /db_xref="GeneID:11686541"
                     /translation="MKFKAAVLDRHGVERPYNQTKPLVIREIELREPKADEVLVKLAA
                     SGLCHSDLSVINGDRSRQIPMVLGHEAAGVVEKIGEGVTDLVPGDHVVCVFVPNCGHC
                     QPCAEGRPALCEPGAAANGKGEMLSGGLRLFCDDGDVYHHCGVSAYAEYAVMSRYSII
                     RIEKDIPLHIAALMGCAVLTGTGSIFNTGLVKPGSRVAIAGLGGVGLAAVMGAVAAGA
                     TEIIALDMFDDKLALAEQLGATKTFNVQSEGVVEAVKEYTKGGVDAAFEYAGSGAALA
                     MCYALTKRGGEVVTAGLPNPKNMLSIPAVSLVAEEKSIRGSYLGSGVPTRDIPLFLDL
                     YRKGKLPVEKLLTHRIKLEEINEGFERLAAGKAIRQVVEFN"
     misc_feature    383505..384626
                     /locus_tag="BSVBI22_B0397"
                     /note="Zn-dependent alcohol dehydrogenases, class III
                     [Energy production and conversion]; Region: AdhC; COG1062"
                     /db_xref="CDD:223990"
     misc_feature    383511..384623
                     /locus_tag="BSVBI22_B0397"
                     /note="Zinc-dependent alcohol dehydrogenases (ADH) and
                     class III ADG (AKA formaldehyde dehydrogenase); Region:
                     liver_ADH_like1; cd08281"
                     /db_xref="CDD:176241"
     misc_feature    order(383646..383654,383661..383663,384030..384032,
                     384042..384044,384105..384119,384177..384182,
                     384192..384194,384306..384314,384324..384326,
                     384375..384383,384453..384461,384588..384590,
                     384609..384611)
                     /locus_tag="BSVBI22_B0397"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:176241"
     misc_feature    order(383646..383648,383652..383654,383709..383711,
                     384030..384032)
                     /locus_tag="BSVBI22_B0397"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176241"
     misc_feature    order(383652..383654,383709..383711,383787..383789,
                     384381..384383)
                     /locus_tag="BSVBI22_B0397"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176241"
     misc_feature    order(383799..383801,383808..383810,383817..383819,
                     383841..383843)
                     /locus_tag="BSVBI22_B0397"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176241"
     gene            384837..385832
                     /locus_tag="BSVBI22_B0398"
                     /db_xref="GeneID:11686542"
     CDS             384837..385832
                     /locus_tag="BSVBI22_B0398"
                     /note="similar to SP:P49307; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, putative"
                     /protein_id="YP_005108410.1"
                     /db_xref="GI:376278377"
                     /db_xref="GeneID:11686542"
                     /translation="MKLVFFGVGHWHSGMHAQAAEAAGAEIVAAWDNEPEKAAAFVAQ
                     FGGMVSPTIEEALALKPDLAVVMGRPAEMAALARRLILEGVPMLIEKPVGVSGAMMKP
                     LVDLAEQRNAFVSVALPYCFSPLLAEADALRDTNRLGAISHSHFRLINGPPQRYVNDG
                     VAWVLDASISGGGALRNLGIHGINGFVNLCGGQEITVESVSFGRQLFDTSVEDYALVV
                     LRAADGTIGVVEAGYTFASMTQGIFEWRVDARNASLTDHGPCLSVLTLDDGKMRERPA
                     MPVVDRYDDIMVNTISRLCNGGKPAVTLRDLWRAMDLIDRCYALSAKRSAPLCLA"
     misc_feature    384837..385829
                     /locus_tag="BSVBI22_B0398"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    <384927..385187
                     /locus_tag="BSVBI22_B0398"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; cl19130"
                     /db_xref="CDD:267483"
     misc_feature    385236..385532
                     /locus_tag="BSVBI22_B0398"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            385820..387106
                     /locus_tag="BSVBI22_B0399"
                     /db_xref="GeneID:11686543"
     CDS             385820..387106
                     /locus_tag="BSVBI22_B0399"
                     /note="identified by match to PFAM protein family HMM
                     PF01408"
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="YP_005108411.1"
                     /db_xref="GI:376278378"
                     /db_xref="GeneID:11686543"
                     /translation="MLGVGIIGAGHFGAAHAKALQSVPNARLVAACRNDTQGLGAFIE
                     AFGGAGYLDYRDLLSDPNVDAVVIALPHHLHTDVAIACAEAGKHIMIEKPMAPTVAEC
                     RDILAAAQKAGVTLMPGHTMRFTLPFMAAKRITDEGELGNMRYGSSRMIKLWMEGNRR
                     DWHLDPATGGGMLFTAGIHALDRLVAFSGCRATHVSAIAATSFHHQKADDMALLLLRF
                     GDQAAGQVASIGYRDGAFISGDELVFDNGVLTVDFFNGVTLGRGLKWQPVENSIEPAV
                     SEQGLIRQWNAFVHAVETGTTPPVTGEDGLHVVACIEAAFKASRERREVAVEAYNVLP
                     GRKLPSWAHPSSCWMGHFLAPYILSRMQALKCPGLTSRNCGTVVAQASMAMGQRVRKT
                     QPLGGLAGLGMSPRRICRSVLASGSGEGMAESSARV"
     misc_feature    385820..386806
                     /locus_tag="BSVBI22_B0399"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    385823..386179
                     /locus_tag="BSVBI22_B0399"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     gene            complement(386884..387837)
                     /locus_tag="BSVBI22_B0400"
                     /db_xref="GeneID:11686544"
     CDS             complement(386884..387837)
                     /locus_tag="BSVBI22_B0400"
                     /note="similar to SP:P24137, GB:M88627, SP:P43334, and
                     PID:476741; identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter, ATP-binding protein"
                     /protein_id="YP_005108412.1"
                     /db_xref="GI:376278379"
                     /db_xref="GeneID:11686544"
                     /translation="MTETPLLSVRGLAKHYQTRSATLKILDNVSFDIARGEVVGLVGE
                     SGSGKTTIGRSVLRLIEPTAGQIMFDGADVATLSAREMRRQRRRMQYIFQDPFASLSP
                     RMTIGEILMEGLNIQGIGTKAERLERARKALEQVELPPDTINRYAHEFSGGQRQRIGI
                     ARALTLEPDFIVADEPVSALDVSIQAQVVNLLRDLQQRLGLTMLFISHDLAVVEYICD
                     RVIVLYLGRIMEIASSEDLYARPQHPYTRALLSAIPSPDPDARTERQILRGDIPSPAN
                     PPSGCVFRTRCPMAIDACATTVPQLREVRPGHFKACIRDNI"
     misc_feature    complement(386917..387828)
                     /locus_tag="BSVBI22_B0400"
                     /note="ABC-type oligopeptide transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     AppF; COG4608"
                     /db_xref="CDD:226967"
     misc_feature    complement(387142..387822)
                     /locus_tag="BSVBI22_B0400"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(387688..387711)
                     /locus_tag="BSVBI22_B0400"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(387214..387216,387313..387318,
                     387556..387558,387685..387693,387697..387702))
                     /locus_tag="BSVBI22_B0400"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(387556..387567)
                     /locus_tag="BSVBI22_B0400"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(387361..387390)
                     /locus_tag="BSVBI22_B0400"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(387313..387330)
                     /locus_tag="BSVBI22_B0400"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(387295..387306)
                     /locus_tag="BSVBI22_B0400"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(387208..387228)
                     /locus_tag="BSVBI22_B0400"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(386902..387159)
                     /locus_tag="BSVBI22_B0400"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(387834..388850)
                     /locus_tag="BSVBI22_B0401"
                     /db_xref="GeneID:11686545"
     CDS             complement(387834..388850)
                     /locus_tag="BSVBI22_B0401"
                     /note="similar to GB:M88627, SP:P43334, and PID:476741;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter, ATP-binding protein"
                     /protein_id="YP_005108413.1"
                     /db_xref="GI:376278380"
                     /db_xref="GeneID:11686545"
                     /translation="MSRQPILDIKGLRTVFRTRAREIVTVNDVDIVVNPGETVALVGE
                     SGSGKSVTSLSIMRLLARKVGFIDAGSIILRGKSGQTVDLAAIDEEAMRRIRGNDIGM
                     VFQEPMTSLNPVYTIGDQIGEPLRVHRGTSRREALEAAVELLDRVGIPDARRRAGQYP
                     HELSGGMRQRATIAMALICNPTLLIADEPTTALDVTIQAQILDLMQKLQSESGMGMLF
                     VTHNLGVVAEIAQRVVVMYAGRIVESGPVKEVFRNPRHPYTMGLLRSMPRLGDATEMK
                     RRGEKLNTIPGMVPGLANLPSGCAFAPRCSFAVEACHAAVPPLASVNEHHGSRCIRWQ
                     EIAA"
     misc_feature    complement(387852..388835)
                     /locus_tag="BSVBI22_B0401"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppD; COG0444"
                     /db_xref="CDD:223521"
     misc_feature    complement(388116..388835)
                     /locus_tag="BSVBI22_B0401"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(388701..388724)
                     /locus_tag="BSVBI22_B0401"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(388188..388190,388287..388292,
                     388536..388538,388698..388706,388710..388715))
                     /locus_tag="BSVBI22_B0401"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(388536..388547)
                     /locus_tag="BSVBI22_B0401"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(388335..388364)
                     /locus_tag="BSVBI22_B0401"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(388287..388304)
                     /locus_tag="BSVBI22_B0401"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(388269..388280)
                     /locus_tag="BSVBI22_B0401"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(388182..388202)
                     /locus_tag="BSVBI22_B0401"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(387861..388133)
                     /locus_tag="BSVBI22_B0401"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(388861..389778)
                     /locus_tag="BSVBI22_B0402"
                     /db_xref="GeneID:11686546"
     CDS             complement(388861..389778)
                     /locus_tag="BSVBI22_B0402"
                     /note="similar to GP:12541464; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase family protein"
                     /protein_id="YP_005108414.1"
                     /db_xref="GI:376278381"
                     /db_xref="GeneID:11686546"
                     /translation="MSKFFGVVPPVVTPLNDDHSVDYDSYTRVLEHLIEGGCHGLFAL
                     GSTSEVVFYDEADRRRILEHTVKVANGRVPVIAGVIDPATDRVIAHAKAAKDVGADAV
                     VVTAPFYTITSQPEIIDHFRMVRDAVDIPLIAYDIPVCVHAKLTRQTVVTLANEGTII
                     GLKDSSGDDGNFRYALLDLAKNKNMFLMTGSEIVVDNALLMGAHGVVPGLANVDPAGY
                     VRLWDAAQRGDWVAARKEQERLCRLFEIVWVGAGRVSGGAAGVGAFKTAMRSLGIIST
                     NKMARPRQALNTAEAGRIDAILRSVGLLD"
     misc_feature    complement(388885..389760)
                     /locus_tag="BSVBI22_B0402"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(389290..389292,389374..389376,
                     389638..389646,389653..389655,389749..389751))
                     /locus_tag="BSVBI22_B0402"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(389158..389160,389290..389292,
                     389374..389376,389638..389646,389653..389655))
                     /locus_tag="BSVBI22_B0402"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(388933..388938,389419..389421,
                     389431..389433,389452..389457,389527..389532,
                     389623..389628,389641..389643))
                     /locus_tag="BSVBI22_B0402"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    complement(389290..389292)
                     /locus_tag="BSVBI22_B0402"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            complement(389798..390706)
                     /locus_tag="BSVBI22_B0403"
                     /db_xref="GeneID:11686547"
     CDS             complement(389798..390706)
                     /locus_tag="BSVBI22_B0403"
                     /note="similar to GP:15160372; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter, permease protein"
                     /protein_id="YP_005108415.1"
                     /db_xref="GI:376278382"
                     /db_xref="GeneID:11686547"
                     /translation="MRSSIHASRLRKMGQSIPASTGPMARSANRFLQNRAAIFGLVLL
                     TPLLFAVLTYPLWLPYKPNDIDLMAMNSAPSWKHWFGTDGVGRDVFARTMEGGRISLL
                     VAVSSVVLSTAIGFLIGAISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGI
                     WSTVVVIALLSWPVLSRMIRARLLELREREFVMASRGMGAGLGHLLFRHGLPNSIDIL
                     VVYATLQVANAILLEAGLSFLGLGVPPPAASWGNMLNAARSTAVLEQFPWQWLFPGGA
                     LVLAVLAINFIGDGLRDAFDPRAELN"
     misc_feature    complement(389813..390664)
                     /locus_tag="BSVBI22_B0403"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(390482..390649)
                     /locus_tag="BSVBI22_B0403"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    complement(389918..390415)
                     /locus_tag="BSVBI22_B0403"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(389918..389920,389948..389953,
                     389993..389998,390005..390016,390035..390037,
                     390044..390049,390089..390091,390140..390142,
                     390149..390154,390164..390166,390170..390175,
                     390182..390184,390188..390190,390194..390199,
                     390248..390250,390254..390259,390266..390295,
                     390299..390310,390338..390340,390353..390358,
                     390365..390370))
                     /locus_tag="BSVBI22_B0403"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(389999..390016,390248..390292))
                     /locus_tag="BSVBI22_B0403"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(389918..389920,389948..389950,
                     389957..389959,389996..389998,390212..390214,
                     390248..390250))
                     /locus_tag="BSVBI22_B0403"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(390068..390070,390080..390085,
                     390101..390139))
                     /locus_tag="BSVBI22_B0403"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(390672..391631)
                     /locus_tag="BSVBI22_B0404"
                     /db_xref="GeneID:11686548"
     CDS             complement(390672..391631)
                     /locus_tag="BSVBI22_B0404"
                     /note="similar to GB:X07820, SP:P09238, and PID:36629;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter, permease protein"
                     /protein_id="YP_005108416.1"
                     /db_xref="GI:376278383"
                     /db_xref="GeneID:11686548"
                     /translation="MLRYCLHRLLIGLGMLLALTILIFVLLQLTPGDPIDAYINPNVA
                     MTQAEMDALRAQLGLDRPLPVQYLAWLGQAVQGNLGHSLQRFNETVSGLIASRIGPTL
                     LLMAAGLAIAIVIGVTTGIISAVRRNSFLDYSFSVLALLGISSPAFLTALLGLYVFSV
                     RLKWAPSGGMLTPATDFSIPDLLRHLALPALVLSIGHAALIMRYMRSSMLETLNQDYV
                     RTARAKGVREFWVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLI
                     NAVETRDYPVIMGATLVIGACVIIVNILTDLAYAVIDPRIKVT"
     misc_feature    complement(390678..391631)
                     /locus_tag="BSVBI22_B0404"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(390711..391340)
                     /locus_tag="BSVBI22_B0404"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(390711..390716,390723..390728,
                     390735..390740,390744..390749,390756..390761,
                     390810..390815,390840..390845,390852..390863,
                     390882..390884,390891..390896,390936..390938,
                     390987..390989,390996..391001,391011..391013,
                     391017..391022,391029..391031,391035..391037,
                     391041..391046,391167..391169,391173..391178,
                     391185..391214,391218..391229,391260..391262,
                     391275..391280,391287..391292))
                     /locus_tag="BSVBI22_B0404"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(390846..390863,391167..391211))
                     /locus_tag="BSVBI22_B0404"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(390759..390761,390810..390812,
                     390819..390821,390843..390845,391059..391061,
                     391167..391169))
                     /locus_tag="BSVBI22_B0404"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(390915..390917,390927..390932,
                     390948..390986))
                     /locus_tag="BSVBI22_B0404"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(391731..393314)
                     /locus_tag="BSVBI22_B0405"
                     /db_xref="GeneID:11686549"
     CDS             complement(391731..393314)
                     /locus_tag="BSVBI22_B0405"
                     /note="similar to GP:15158790, and GP:6969001; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter, periplasmic
                     peptide-binding protein"
                     /protein_id="YP_005108417.1"
                     /db_xref="GI:376278384"
                     /db_xref="GeneID:11686549"
                     /translation="MRLRNFYSALALSAAVFAGPLYAAAPAMAAGTISGGFDVGPGGF
                     QGNFNPLAATGGFTWLVTYFEPLVIYDDKLENIVGDLAKSFEISPDQLTYTFKLAHAK
                     WHDGEPFTSKDAKFTFDLARNGKTGSVFAARLASIASVETPDEKTVVIKLKEPSPSML
                     DTLTKVMMLPEHALASIPPEQLAKNAWWSSTPIGTGPFKFNKYVADQYVELTANPDYR
                     GGRPQVDKLINRYFADPAAAIAALRSGEIQFTYVDSNDVSTFSSDSAFRVIEGDSFVV
                     NYVGFNQEVPLWKDLKVRQAFMHAINRDAIIQSLYGGAAKPANCVYVADRLVPKAIDA
                     YAYDPQKARQLLDEAGWDKINGSKPITILTYYNSPLVANVLAAMQAMLAQVGINIVPR
                     TVDTPTYNSIVYKQGGTADEFPLIFAGLQNGPDPSSINIGLNEKQIPPAGSNIMRIRM
                     PAVTKALDAALAETNPAKRDARYQDVCKATNANLPWGTMWVANRYGVASSKLENFIWT
                     PAPAGGPYQAHPEKWAILE"
     misc_feature    complement(391746..393314)
                     /locus_tag="BSVBI22_B0405"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(391800..393200)
                     /locus_tag="BSVBI22_B0405"
                     /note="The substrate-binding domain of an ABC-type
                     nickel/oligopeptide-like import system contains the type 2
                     periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like; cd00995"
                     /db_xref="CDD:173853"
     gene            complement(393311..394039)
                     /locus_tag="BSVBI22_B0406"
                     /db_xref="GeneID:11686550"
     CDS             complement(393311..394039)
                     /locus_tag="BSVBI22_B0406"
                     /note="identified by match to PFAM protein family HMM
                     PF00392"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005108418.1"
                     /db_xref="GI:376278385"
                     /db_xref="GeneID:11686550"
                     /translation="MKNPIKPLKRAPLLHVSVQESLRAYIEDNGLQAGAPLPPEGELA
                     ARLGVSRNSVREAIKALESVGVLESRRGIGVFVKAFSFEPLLENLAYGLGGALRQIEE
                     VIAIRRALEIGLIDKTLERIGEDDIKELRDTLEKMRQRAERGEGFPEEDRHFHQLLFR
                     CQDNEVLLRLIEVFWLAFYKAFDFVNLQNIDPMATWRDHVAIVDAIEARDVVAVRKQL
                     DRHYSGINQVIAQNRTASLTGRKT"
     misc_feature    complement(393335..394030)
                     /locus_tag="BSVBI22_B0406"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(393806..394000)
                     /locus_tag="BSVBI22_B0406"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(393815..393826,393830..393835,
                     393863..393865,393872..393877,393881..393895,
                     393917..393922,393926..393928,393995..393997))
                     /locus_tag="BSVBI22_B0406"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(393377..393736)
                     /locus_tag="BSVBI22_B0406"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            394199..395776
                     /locus_tag="BSVBI22_B0407"
                     /db_xref="GeneID:11686551"
     CDS             394199..395776
                     /locus_tag="BSVBI22_B0407"
                     /note="identified by match to PFAM protein family HMM
                     PF00218"
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family protein"
                     /protein_id="YP_005108419.1"
                     /db_xref="GI:376278386"
                     /db_xref="GeneID:11686551"
                     /translation="MRGSPRNLCRVQGMIEEIVNRLRGKLIVSCQPVPESPFDNVASV
                     VAYARAAEASGASGLRIEGAANVAATAQASTLPVIGLIKRDLDDSPVRITPFLEDVAA
                     LCDAGAAIVAVDATDRRRPVPAAELIGEIKRRGRIAMADISTLAEARNALAAGADIIG
                     TTMSGYTGEGPTPKDPDLDLVAHCSRLGSFLIAEGRYNSPQQAGEAIRAGADAVVVGS
                     AITRPEHITGWFRDAVESAAKPSSPVLAFDIGGTKTLAALVRGREILERRVMTTPASV
                     GSESWIGAIASLSADWQGRYQRAAIAVTGRVDGEIWSSLNPETLAIPPDYPLGRRMGA
                     ALGAPVEVINDAQAAAWGENRFGAARGRDMVFLTISSGIGGGIVLGGRLIRGARGIAG
                     SLGQVLVAGPSGFVRLETLASGFGIAKMALEAGHAGDARSVFSAAAAGEGWARRILLD
                     AASQLAAAVAGLQAIVDPECIVIGGGVGMADGFLDMLREALGSHSAVMRPDIVAAELG
                     ADAGIIGVADLAATYFS"
     misc_feature    394244..394888
                     /locus_tag="BSVBI22_B0407"
                     /note="N-acetylmannosamine-6-phosphate epimerase (NanE)
                     converts N-acetylmannosamine-6-phosphate to
                     N-acetylglucosamine-6-phosphate. This reaction is part of
                     the pathway that allows the usage of sialic acid as a
                     carbohydrate source. Sialic acids are a family of...;
                     Region: NanE; cd04729"
                     /db_xref="CDD:240080"
     misc_feature    order(394283..394285,394289..394291,394376..394378,
                     394439..394441,394445..394447,394538..394540,
                     394619..394621,394682..394684,394694..394696,
                     394778..394786,394847..394849)
                     /locus_tag="BSVBI22_B0407"
                     /note="putative active site cavity [active]"
                     /db_xref="CDD:240080"
     misc_feature    394928..395770
                     /locus_tag="BSVBI22_B0407"
                     /note="Transcriptional regulator/sugar kinase
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: NagC; COG1940"
                     /db_xref="CDD:224851"
     misc_feature    394931..>395305
                     /locus_tag="BSVBI22_B0407"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cd00012"
                     /db_xref="CDD:212657"
     misc_feature    order(394940..394951,394955..394957,394961..394963,
                     395231..395233,395300..395305)
                     /locus_tag="BSVBI22_B0407"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            395800..396966
                     /locus_tag="BSVBI22_B0408"
                     /note="This region contains an authentic point mutation,
                     causing a premature stop, and is not the result of a
                     sequencing artifact; Bme15 protein, authentic point
                     mutation; similar to GP:5478245, and SP:Q9KR69; identified
                     by sequence similarity; putative"
                     /db_xref="GeneID:11686552"
     gene            397066..397341
                     /locus_tag="BSVBI22_B0409"
                     /db_xref="GeneID:11686553"
     CDS             397066..397341
                     /locus_tag="BSVBI22_B0409"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108420.1"
                     /db_xref="GI:376278387"
                     /db_xref="GeneID:11686553"
                     /translation="MEQSKMRIYQLLHEAISLKGILKEPFKPKDLRRIVPGWPYAWYF
                     SFLAQNCADNQPAGSAMFLRVGRGEYCLNQDADFAFDSARAATACGK"
     gene            complement(397342..398100)
                     /locus_tag="BSVBI22_B0410"
                     /db_xref="GeneID:11686554"
     CDS             complement(397342..398100)
                     /locus_tag="BSVBI22_B0410"
                     /note="similar to GP:5478244, and GP:5478244; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/FNR family transcriptional regulator"
                     /protein_id="YP_005108421.1"
                     /db_xref="GI:376278388"
                     /db_xref="GeneID:11686554"
                     /translation="MGISSEDNVLHNIFENQPINSAFNTDDLGTLKSLPVSLKHYPPH
                     TIVSRQGDWTNSILIINSGWSCIYRDLPEGDRQILDFPMKGDFLGFRAGLGFNYYTLF
                     AITDLSVVEISLDILAEKMRKSPPLAMTFMELTARQRTILLEHLINLGRRTSLARIAH
                     LMLELGFRTKANGTGDAHGFYCPLTQGELADALGLTPIHINRMLRELREDNLLVFKNN
                     EVRFLNRPALMQVCSFDENYLSANIFTNIHLIPR"
     misc_feature    complement(397447..398064)
                     /locus_tag="BSVBI22_B0410"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(397705..398040)
                     /locus_tag="BSVBI22_B0410"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(397804..397809,397831..397836))
                     /locus_tag="BSVBI22_B0410"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(397720..397728,397738..397746))
                     /locus_tag="BSVBI22_B0410"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(397417..397635)
                     /locus_tag="BSVBI22_B0410"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     misc_feature    complement(397627..397632)
                     /locus_tag="BSVBI22_B0410"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(397513..397515,397540..397548,
                     397567..397569))
                     /locus_tag="BSVBI22_B0410"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(397495..397515)
                     /locus_tag="BSVBI22_B0410"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(397495..397497,397507..397512))
                     /locus_tag="BSVBI22_B0410"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(397507..397512)
                     /locus_tag="BSVBI22_B0410"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            398463..399230
                     /locus_tag="BSVBI22_B0411"
                     /db_xref="GeneID:11686555"
     CDS             398463..399230
                     /locus_tag="BSVBI22_B0411"
                     /note="similar to GP:5478243, and GP:5478243; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_005108422.1"
                     /db_xref="GI:376278389"
                     /db_xref="GeneID:11686555"
                     /translation="MNISPQFKDESKNPHNIYASKISTEKDQLYEVERPLLVIIDSRA
                     LDRECLAHGLTNNSVDMTIATFSSYEQWQHQRRNRKAAVVLFNVGGQKVSDPAVGNYL
                     KNLVADCAPAPVILLADKEEISQVVRALEHGVKGYIPTSVNVHVCVEALRLAMAGGTF
                     VPASSVLALRHATEAGGQRIQPLGGMFTQRQAEVVNALRRGKANKIIAYELKLRESTV
                     KVHIRNIMKKLKASNRTEVACIINELFPSETAFSDLQ"
     misc_feature    398571..399194
                     /locus_tag="BSVBI22_B0411"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    <398799..398918
                     /locus_tag="BSVBI22_B0411"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cl19078"
                     /db_xref="CDD:267431"
     misc_feature    399021..399191
                     /locus_tag="BSVBI22_B0411"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(399024..399032,399069..399077,399099..399104,
                     399108..399113,399117..399131,399162..399164)
                     /locus_tag="BSVBI22_B0411"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(399057..399059,399063..399065,399069..399071,
                     399162..399170,399177..399179,399186..399191)
                     /locus_tag="BSVBI22_B0411"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            399267..401456
                     /locus_tag="BSVBI22_B0412"
                     /db_xref="GeneID:11686556"
     CDS             399267..401456
                     /locus_tag="BSVBI22_B0412"
                     /note="similar to GP:5478242, and GP:5478242; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide biosynthesis protein Bme12"
                     /protein_id="YP_005108423.1"
                     /db_xref="GI:376278390"
                     /db_xref="GeneID:11686556"
                     /translation="MIISDVSSANGRQPVADLLETIKRRKLMLTLPIIAGVGVGFAGY
                     LTAPVSYVSESVLVLDMRRLQALPNESAITPLPQDSPVLRSELDIINSRMMAQKVIEL
                     LQAENIAVPMDVHSRTVLSSQPDRITLSKNARDFDPAVRERQQIDLLLSRLRVSNDGR
                     SFTIFISYRAPDPVYAARVANAFATAYLNHQVDVQQSAARRVSEWLGEKLVTLRNDLE
                     TAERVAEDFRQKSRLAGEQGQISFQAQRVMALNTEIVAATGAVSTAQARLQTAQALKN
                     NNEAPAMTEILASPAIQNLRNEEARVQRHLDELKANGALKSAEIPVLMAERESLKQQI
                     TAQVDEIIKSLSNEIRIAVQRRTSLEKELKEAETDLAKANQAQVRVAQLDREANASRV
                     VYETYLTRYKQLIEQDGIAIPEAQLISQAEPAMAKASPRLINWLLVGLGLGGLFAVAG
                     TMLREALDKIRPAQTTALALPGIPAATLLPVSPQLTVPILVNRGVDSASPFGRAIKSV
                     HDRLRALIRGRDSLALSVVSLSEGDGKGLLVTALAQQIAATGVPVAVIDTTCGKSGLG
                     EAFGLPVGNMQSLIGRKLNGAALIHDHGSGIDFITPNRQAQEGEWLGELIAQLRPDHR
                     IILVNLPSYAEDKRSALMTRATDTALLVVNADRRDAKATAAMVQVLASFGRKPALAVV
                     SQMASPYAGWIGKHIVAHGWAERIGAHLRAIRVRGREAPSTPMEEQA"
     misc_feature    399273..400643
                     /locus_tag="BSVBI22_B0412"
                     /note="Uncharacterized protein involved in
                     exopolysaccharide biosynthesis [Cell envelope biogenesis,
                     outer membrane]; Region: GumC; COG3206"
                     /db_xref="CDD:225747"
     misc_feature    399315..399824
                     /locus_tag="BSVBI22_B0412"
                     /note="Chain length determinant protein; Region: Wzz;
                     pfam02706"
                     /db_xref="CDD:251487"
     misc_feature    400836..401234
                     /locus_tag="BSVBI22_B0412"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            401466..402713
                     /locus_tag="BSVBI22_B0413"
                     /db_xref="GeneID:11686557"
     CDS             401466..402713
                     /locus_tag="BSVBI22_B0413"
                     /note="similar to GP:5478241, GP:5478241, GB:M83667,
                     SP:P49716, and PID:189176; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide biosynthesis protein Bme11"
                     /protein_id="YP_005108424.1"
                     /db_xref="GI:376278391"
                     /db_xref="GeneID:11686557"
                     /translation="MSKIIVRNSITRHLRAALLSSALLLATGGLAAADGNIYRVGAND
                     VLQVTVYGQPALTGLYPVDVDGNIGYPVVGNISVQGLTTLQISEKIASSLSQHIPGLT
                     VTATINQYAPVFVMGDVKAPGKYEFRPGMVALELMALGGGAGKGEAPSVTAGMQLISA
                     QQEYADLQMQITAQTIRRARFEAELKGTDFTYAVPEQTAANKDMVALTRHMVEGERTL
                     FNVRRNNLAAERRALEAQAASYGDEITTLQQSIKLHDTEIQLLQENVNSSKSLVDRGL
                     AAKSSLRDMERDLSSTRRDALELASFLARARQNQLAVEQRIANLDETRRSEAASSLQE
                     IDLNMARMQRRSNSQLEAMAEIAKSSGQISSADMRRKLIFTISRNVNGAYQEIAANER
                     TEIKPGDILRIELDMSKLGGSPS"
     misc_feature    401544..>401987
                     /locus_tag="BSVBI22_B0413"
                     /note="Periplasmic protein involved in polysaccharide
                     export, contains    SLBB domain of b-grasp fold [Cell
                     wall/membrane/envelope biogenesis]; Region: Wza; COG1596"
                     /db_xref="CDD:224512"
     misc_feature    401547..401786
                     /locus_tag="BSVBI22_B0413"
                     /note="Polysaccharide biosynthesis/export protein; Region:
                     Poly_export; pfam02563"
                     /db_xref="CDD:251377"
     misc_feature    401802..>401891
                     /locus_tag="BSVBI22_B0413"
                     /note="SLBB domain; Region: SLBB; pfam10531"
                     /db_xref="CDD:256045"
     gene            complement(402818..403798)
                     /locus_tag="BSVBI22_B0414"
                     /db_xref="GeneID:11686558"
     CDS             complement(402818..403798)
                     /locus_tag="BSVBI22_B0414"
                     /note="similar to GP:5478240; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="fucose synthetase family protein"
                     /protein_id="YP_005108425.1"
                     /db_xref="GI:376278392"
                     /db_xref="GeneID:11686558"
                     /translation="MISTAETGREPVYSLTGKKIFVAGHTGMVGSAILRRLQHEDCDI
                     ITAAHSVLDLTRQGPTENFISGHRPDVIIIAAARVGGILANSRFPADFLYDNLAIGMN
                     LIHAAHQIGVERLLWLGSSCIYPRDAAQPLTEDALLTGPLEPTNEAYAIAKIAGLKYA
                     QSCARQFGDRFITAMPTNLYGPNDNFDPTSSHVLPALIRRVHEARMRGAEEVVLWGSG
                     KPLREFLHVDDLADACLHLLRFYNGIEPVNIGSGEEISIKELALTVARIVGYEGRFEH
                     DLSKPDGTPRKLLDTSRIEALGWQPRIRLEDGLRDVYRNWLEETAGSVAA"
     misc_feature    complement(402857..403744)
                     /locus_tag="BSVBI22_B0414"
                     /note="GDP-fucose synthetase, extended (e) SDRs; Region:
                     GDP_FS_SDR_e; cd05239"
                     /db_xref="CDD:187550"
     misc_feature    complement(402830..403738)
                     /locus_tag="BSVBI22_B0414"
                     /note="GDP-4-keto-6-deoxymannose-3,
                     5-epimerase-4-reductase; Region: PLN02725"
                     /db_xref="CDD:178326"
     misc_feature    complement(order(403262..403264,403268..403273,
                     403340..403342,403352..403354,403439..403447,
                     403502..403504,403562..403564,403568..403576,
                     403634..403645,403652..403654,403712..403723,
                     403727..403729))
                     /locus_tag="BSVBI22_B0414"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187550"
     misc_feature    complement(order(403340..403342,403352..403354,
                     403439..403441,403511..403513))
                     /locus_tag="BSVBI22_B0414"
                     /note="active site"
                     /db_xref="CDD:187550"
     misc_feature    complement(order(403133..403135,403157..403159,
                     403208..403210,403265..403267,403352..403354,
                     403439..403441))
                     /locus_tag="BSVBI22_B0414"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187550"
     gene            complement(403782..404852)
                     /locus_tag="BSVBI22_B0415"
                     /db_xref="GeneID:11686559"
     CDS             complement(403782..404852)
                     /locus_tag="BSVBI22_B0415"
                     /note="similar to GP:5478239, and SP:P15527; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-mannose 4,6-dehydratase Bme9"
                     /protein_id="YP_005108426.1"
                     /db_xref="GI:376278393"
                     /db_xref="GeneID:11686559"
                     /translation="MQDKTALIVGVTGQDGAYLSELLLGKGYRVHGLKRRSSSFNTAR
                     IDHLYQDPHEEDIRFRLHFGDLTDATNLCRVIQEVQPDEIYNLGAQSHVQVSFETPEY
                     TANADALGTLRLLESMRILGLGKSCRFYQASTSELFGNSSHHAQNEQTPFAPRSPYAT
                     AKLYAYWTTVNYRDAYGFHASNGILFNHESPLRGETFVTRKITRAVAAIERGLQDRLR
                     LGNLEARRDWGHARDYVEGMWRILQEDTPDDYVLATGETHTVREFIEHAFKAVDKQIV
                     WHGDGVDEVGIDRKTGNCLIEIDPRYFRPNEVDFLMGDASKAKDRLGWQHTTGFENLV
                     AEMVDWDLRNIMREVGRNDFYG"
     misc_feature    complement(403809..404849)
                     /locus_tag="BSVBI22_B0415"
                     /note="GDP-D-mannose dehydratase [Cell envelope
                     biogenesis, outer membrane]; Region: Gmd; COG1089"
                     /db_xref="CDD:224014"
     misc_feature    complement(403824..404840)
                     /locus_tag="BSVBI22_B0415"
                     /note="GDP-mannose 4,6 dehydratase, extended (e) SDRs;
                     Region: GDP_MD_SDR_e; cd05260"
                     /db_xref="CDD:187570"
     misc_feature    complement(order(404286..404300,404367..404369,
                     404379..404381,404451..404459,404535..404537,
                     404580..404582,404586..404594,404655..404663,
                     404742..404750,404808..404825))
                     /locus_tag="BSVBI22_B0415"
                     /note="NADP-binding site; other site"
                     /db_xref="CDD:187570"
     misc_feature    complement(order(403935..403940,404262..404267,
                     404325..404333,404337..404345,404349..404354,
                     404361..404366,404370..404375,404382..404387,
                     404391..404402,404493..404498,404505..404507,
                     404514..404519,404526..404528,404538..404543,
                     404553..404564,404568..404570,404577..404588,
                     404622..404624,404628..404636,404640..404654,
                     404658..404666,404721..404726,404733..404750,
                     404814..404819))
                     /locus_tag="BSVBI22_B0415"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    complement(order(403929..403934,403941..403943,
                     403947..403949,404073..404075,404175..404177,
                     404181..404183,404190..404201,404250..404252,
                     404259..404267,404292..404294,404379..404381,
                     404445..404453,404574..404582))
                     /locus_tag="BSVBI22_B0415"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    complement(order(403935..403940,404325..404333,
                     404337..404345,404349..404354,404361..404366,
                     404370..404375,404382..404387,404391..404402,
                     404505..404507,404514..404519,404526..404531,
                     404538..404543,404553..404555,404562..404564))
                     /locus_tag="BSVBI22_B0415"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    complement(order(404367..404369,404379..404381,
                     404451..404453,404532..404534))
                     /locus_tag="BSVBI22_B0415"
                     /note="active site"
                     /db_xref="CDD:187570"
     gene            405116..406366
                     /locus_tag="BSVBI22_B0416"
                     /note="This region contains an authentic point mutation,
                     causing a premature stop, and is not the result of a
                     sequencing artifact; glycosyltransferase, putative,
                     authentic point mutation; similar to GP:5478238, and
                     GP:5478238; identified by sequence similarity; putative"
                     /db_xref="GeneID:11686560"
     gene            406387..407622
                     /locus_tag="BSVBI22_B0417"
                     /db_xref="GeneID:11686561"
     CDS             406387..407622
                     /locus_tag="BSVBI22_B0417"
                     /note="similar to GP:5478237, and GP:5478237; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 1 family protein"
                     /protein_id="YP_005108427.1"
                     /db_xref="GI:376278394"
                     /db_xref="GeneID:11686561"
                     /translation="MDGSVVVSQLGARMHYAVPRIFASRERLAHFYTDICALQGWPRF
                     FNGLPPTMLPASVRRLVGRIPQGIPQERMTTFPGFGLHSAVRRLSNQTGPKSTANAIW
                     AGKTFGKLVAESGFHGASGLYAFSGEALELLATAKRQGLWTAVEQMIAPRMVVDQLAL
                     EEEALNPGWQHPVANDAHADVFAAREQAEWRIADVVVCPSAFVAHHLAEMGCAAEKIV
                     VVPYGVDDRFLLAPCPRLPGPLRVLTVGAVGLRKGAPYVGAVARMLKGEAQFRMVGPI
                     EIQAEAQVKLAASVELTGAIPRSEMRAQFKWADVFLLPSLCEGSATAVYEALAAGLPV
                     ICTPNTGSVVRHGIDGYIVPIRDVHETAQILRQLADNPALLARMSESARERGADFTVS
                     RYGERLVAALARHDRRQRA"
     misc_feature    <406897..407598
                     /locus_tag="BSVBI22_B0417"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    <406930..407592
                     /locus_tag="BSVBI22_B0417"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            407619..408815
                     /locus_tag="BSVBI22_B0418"
                     /db_xref="GeneID:11686562"
     CDS             407619..408815
                     /locus_tag="BSVBI22_B0418"
                     /note="similar to GP:5478236, and GP:5478236; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 1 family protein"
                     /protein_id="YP_005108428.1"
                     /db_xref="GI:376278395"
                     /db_xref="GeneID:11686562"
                     /translation="MKIIHVIGSYDPAKGGPQAVVVRLAAAQASLGHRVTIVSYSDDA
                     VSRRAAEATAMIPDFDKVQTLLLPMPDIYETFTGGRTANAVTALIRGADFVHLHGIWE
                     TNLLRASMLCRRFHIPYCVCCCGMLDIWSMQQKSWKKRLALKLGFRRMLDGAAFIHAL
                     NRDEIELMRPLGLKAPSLVIPNGVFLNEVEVGDMDVPGLPARRFILFLSRLHYKKGLD
                     ILADAYCRIAPHFRDVDLVVAGPDGGAEDAFRRKIAEYGLQHRVHMPGGLYGLAKIAA
                     LKRAACFCLPSRQEGFSVAITEALACGAPVVITDACHFPEVGEAGAGVVCALNAEMVG
                     DALAGVLEDLDKAAQMGASGARLVRENYTWPRIARQTIEAYQMYRARKAEPVKGENPF
                     RTIPAA"
     misc_feature    407619..408764
                     /locus_tag="BSVBI22_B0418"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    407622..408737
                     /locus_tag="BSVBI22_B0418"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. Bme6 in Brucella
                     melitensis has been shown to be involved in the
                     biosynthesis of a polysaccharide; Region: GT1_Bme6_like;
                     cd03821"
                     /db_xref="CDD:99991"
     misc_feature    order(407664..407666,408240..408248,408438..408440,
                     408501..408503)
                     /locus_tag="BSVBI22_B0418"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99991"
     gene            complement(408886..409608)
                     /gene="omp31-2"
                     /locus_tag="BSVBI22_B0419"
                     /db_xref="GeneID:11686563"
     CDS             complement(408886..409608)
                     /gene="omp31-2"
                     /locus_tag="BSVBI22_B0419"
                     /note="similar to GB:X70959, SP:P42459, PID:452384,
                     GB:X70959, SP:P42459, and PID:452384; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein, 31 kDa"
                     /protein_id="YP_005108429.1"
                     /db_xref="GI:376278396"
                     /db_xref="GeneID:11686563"
                     /translation="MKSVILASIAAMFATSAMAADVVVSEPSAPTAAPVDTFSWTGGY
                     IGINAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGA
                     ETDFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGK
                     VKSAFNLGDDASALHTWSDKTKAGWTLGAGAEYAINNNWTLKSEYLYTDLGKRNLVDV
                     DNSFLESKVNFHTVRVGLNYKF"
     misc_feature    complement(408889..409608)
                     /gene="omp31-2"
                     /locus_tag="BSVBI22_B0419"
                     /note="Opacity protein and related surface antigens [Cell
                     envelope biogenesis, outer membrane]; Region: COG3637"
                     /db_xref="CDD:226163"
     gene            complement(410005..410619)
                     /locus_tag="BSVBI22_B0420"
                     /db_xref="GeneID:11686564"
     CDS             complement(410005..410619)
                     /locus_tag="BSVBI22_B0420"
                     /note="similar to GP:5478235; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_005108430.1"
                     /db_xref="GI:376278397"
                     /db_xref="GeneID:11686564"
                     /translation="MTITQSGSPHSIAGRKQTSRPLEGGATFTLKHRLQRLLWQAAWL
                     ALAAWTPSCLWRWRGMVLNAFGADIHKSAIVRASAHIWWPGNLSMGAHSSLGPGAICY
                     NVAPVTLAPFAIVSQRAHLCTAGHDIDQASFPLTAAPIHIAAYGWVAAEAFVGPGVHI
                     GEGAVLGARSVSFRDLDAWAVYTGNPAKPVRQRRKNTDYSIHRF"
     misc_feature    complement(410050..410370)
                     /locus_tag="BSVBI22_B0420"
                     /note="wcaF-like: This group is composed of the protein
                     product of the E. coli wcaF gene and similar proteins.
                     WcaF is part of the gene cluster responsible for the
                     biosynthesis of the extracellular polysaccharide colanic
                     acid. The wcaF protein is predicted to...; Region:
                     LbH_wcaF_like; cd05825"
                     /db_xref="CDD:100063"
     misc_feature    complement(order(410065..410067,410113..410115,
                     410170..410172,410179..410181,410185..410187,
                     410236..410244,410260..410262,410278..410280,
                     410284..410286,410314..410316,410338..410340,
                     410344..410346))
                     /locus_tag="BSVBI22_B0420"
                     /note="putative trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100063"
     misc_feature    complement(order(410062..410064,410068..410073,
                     410098..410103,410116..410121,410155..410157,
                     410170..410175,410179..410181,410236..410238,
                     410242..410244,410332..410334,410338..410340))
                     /locus_tag="BSVBI22_B0420"
                     /note="putative active site [active]"
                     /db_xref="CDD:100063"
     misc_feature    complement(order(410242..410244,410332..410334,
                     410338..410340))
                     /locus_tag="BSVBI22_B0420"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:100063"
     misc_feature    complement(order(410050..410052,410062..410064,
                     410068..410073,410077..410079,410098..410103,
                     410116..410121,410125..410127,410155..410157,
                     410170..410175,410179..410181,410236..410238,
                     410242..410244))
                     /locus_tag="BSVBI22_B0420"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100063"
     gene            complement(410631..411893)
                     /locus_tag="BSVBI22_B0421"
                     /note="This region contains an authentic point mutation,
                     causing a premature stop, and is not the result of a
                     sequencing artifact; membrane protein Bme3, authentic
                     point mutation; similar to GP:5478234, and GP:5478234;
                     identified by sequence similarity; putative"
                     /db_xref="GeneID:11686565"
     gene            complement(411890..412507)
                     /locus_tag="BSVBI22_B0422"
                     /db_xref="GeneID:11686566"
     CDS             complement(411890..412507)
                     /locus_tag="BSVBI22_B0422"
                     /note="similar to GP:5478233, and GP:5478233; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="Bme2 protein"
                     /protein_id="YP_005108431.1"
                     /db_xref="GI:376278398"
                     /db_xref="GeneID:11686566"
                     /translation="MTLYAFPCAILVGLAAMFFSQPLLTLQDDGRPADVIIVPGGDGA
                     PRAAQAAQLWKDGRSPYILATGDGDCLLNKHIMMAKGVPPSAILVECRSGSTWQNARF
                     SAPLLRRLHAKSALIVTNWFHSRRAVASFRTACPQMHFTSSPVADADMPGGFPGTPPV
                     IEHVVKEYAKLGWYLISGRIRPQNLTDSGPAMAFASVYNTTEAGL"
     misc_feature    complement(411995..412408)
                     /locus_tag="BSVBI22_B0422"
                     /note="YdcF-like. YdcF-like is a large family of mainly
                     bacterial proteins, with a few members found in fungi,
                     plants, and archaea. Escherichia coli YdcF has been shown
                     to bind S-adenosyl-L-methionine (AdoMet), but a
                     biochemical function has not been...; Region: YdcF-like;
                     cd06259"
                     /db_xref="CDD:99750"
     misc_feature    complement(order(412007..412009,412130..412132,
                     412139..412141,412151..412153,412211..412213,
                     412220..412222))
                     /locus_tag="BSVBI22_B0422"
                     /note="putative active site [active]"
                     /db_xref="CDD:99750"
     gene            complement(412504..413385)
                     /locus_tag="BSVBI22_B0423"
                     /db_xref="GeneID:11686567"
     CDS             complement(412504..413385)
                     /locus_tag="BSVBI22_B0423"
                     /note="similar to GP:5478232; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="YP_005108432.1"
                     /db_xref="GI:376278399"
                     /db_xref="GeneID:11686567"
                     /translation="MTVSVLIMTLNEEANLPACLASLDWCDDIVVLDSFSTDRTVEIA
                     RAAGARIYQRAYDTEDRQRMYGLTEIEFRHAWVYTPDADEITPPDLRDEMLAIAADPD
                     RPEVFFKARYKNMFMGRWIRHASLYPTWITRLVRPDRVHFERSVHSRASGGPGGELQA
                     HFIHYSSNKGLAAWYDKHNRYSSVEADLAASKRLERHIDWGGLLSGEPERRRRTLKSL
                     SYNLPFRPSLRFLYMYILRGGFLDGKPGYLYCRLLAAYEFMIVVKTEEHRRKQSAMPQ
                     APARRPLDAKEPERHMV"
     misc_feature    complement(412573..413385)
                     /locus_tag="BSVBI22_B0423"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(412636..413382)
                     /locus_tag="BSVBI22_B0423"
                     /note="UDP-glucose LOS-beta-1,4 glucosyltransferase is
                     required for biosynthesis of lipooligosaccharide; Region:
                     Beta4Glucosyltransferase; cd02511"
                     /db_xref="CDD:133005"
     misc_feature    complement(order(413137..413139,413143..413145))
                     /locus_tag="BSVBI22_B0423"
                     /note="putative metal binding site; other site"
                     /db_xref="CDD:133005"
     gene            complement(413382..414509)
                     /locus_tag="BSVBI22_B0424"
                     /db_xref="GeneID:11686568"
     CDS             complement(413382..414509)
                     /locus_tag="BSVBI22_B0424"
                     /note="similar to GP:15158359, GB:J00109, GB:K03512,
                     GB:M28637, GB:A15601, GB:K03513, GB:A11954, GB:X15943,
                     SP:P01258, SP:P06881, PID:1340176, PID:179799, PID:179828,
                     PID:180466, PID:296638, and PID:457134; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl-phosphate
                     alpha-N-acetylglucosaminyltransferase, putative"
                     /protein_id="YP_005108433.1"
                     /db_xref="GI:376278400"
                     /db_xref="GeneID:11686568"
                     /translation="MTSLSWITLLAFVLSVAFSFCMAFRGLAREWYLIDLPDYRKRHE
                     GAVPLCGGTAIFLSFFLTASLVKDGAGHADALVMMPGLTIILGTGVLDDRFRLPVTPR
                     FAIQLFAAVLIIAMAGVQQVFLDLNPSFIDDSGNIFAFERLGGPFLLLFAVAFIVGLV
                     NAVNMSDGVDGLAGSASAASFFWLAVISFDIGEHRLGLQSLALVAACLGFLVFNMRHR
                     WRAKASLFLGDGGSTLLGAALAGMVLILSSGRQAIAFPVLLWIVIVPVLDTLSLIVRR
                     LAARRSPFSADRQHLHHLLMDAGLTCGQTAIIVMALNLIAGATAYTAIRLDLPGWLMA
                     LALLAPAMAHLAFILRCTRGPRIADPAQAAKPNITFPGTTT"
     misc_feature    complement(413517..414482)
                     /locus_tag="BSVBI22_B0424"
                     /note="undecaprenyl-phosphate alpha-N-acetylglucosaminyl
                     1-phosphatetransferase; Region: ECA_wecA; TIGR02380"
                     /db_xref="CDD:131433"
     misc_feature    complement(413610..414392)
                     /locus_tag="BSVBI22_B0424"
                     /note="This subfamily contains Escherichia coli WecA,
                     Bacillus subtilis TagO and related proteins. WecA is an
                     UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate
                     (Und-P) GlcNAc-1-phosphate transferase that catalyzes the
                     formation of a phosphodiester bond...; Region:
                     GT_WecA_like; cd06853"
                     /db_xref="CDD:133463"
     misc_feature    complement(414231..414236)
                     /locus_tag="BSVBI22_B0424"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:133463"
     misc_feature    complement(413823..413834)
                     /locus_tag="BSVBI22_B0424"
                     /note="putative catalytic motif [active]"
                     /db_xref="CDD:133463"
     misc_feature    complement(order(413631..413642,413682..413684))
                     /locus_tag="BSVBI22_B0424"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133463"
     gene            414802..416295
                     /locus_tag="BSVBI22_B0425"
                     /db_xref="GeneID:11686569"
     CDS             414802..416295
                     /locus_tag="BSVBI22_B0425"
                     /note="similar to GP:15158365; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="YP_005108434.1"
                     /db_xref="GI:376278401"
                     /db_xref="GeneID:11686569"
                     /translation="MNRHRKGFIIATLEQYAGLMSNFLTMVAVSRLLGPAETGIGVVG
                     LGIAAIFFSMREFASAEFLIKIDKVEDRDVRTSLTLVMLATLILAAGLYLARDYLATS
                     YRDPSLMLFLNITIVAALVESASFPVVALLRREMAFGVLAWIRTAGSTCGAATTISMA
                     YLGFGHMSFAFGALSAALITTGFAFKAYPMKHLLRPSLASIGTAWQFGLYLGSSAGLN
                     KICETFPQLILGKFMSAASVGIYSRAGAVSGVPDRIFLSSIFTVAFPMLSAQVREGAD
                     IRRSYVQALSYISVVYWPAQAVVALLAYPAVHIILGKGWMEAAPIVALSSLASLFWFP
                     VILTYPLLMALGANRDAFLSNFISRAFSAGILCCAAFYGLMAVVLSQFISLPLQMVVS
                     FVYVHRHVQFSYRLLGLALLRSALVTFLTLLLPLGLVAADGFSLEIHWAKGILIGIVS
                     VLCWLAAVLATRHPFSAEVLPVLGWFGGKVTARLGLQGRRNMAAPAE"
     misc_feature    414802..416199
                     /locus_tag="BSVBI22_B0425"
                     /note="Membrane protein involved in the export of
                     O-antigen and teichoic acid [General function prediction
                     only]; Region: RfbX; COG2244"
                     /db_xref="CDD:225153"
     misc_feature    414814..416016
                     /locus_tag="BSVBI22_B0425"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:263758"
     gene            416311..417324
                     /locus_tag="BSVBI22_B0426"
                     /db_xref="GeneID:11686570"
     CDS             416311..417324
                     /locus_tag="BSVBI22_B0426"
                     /note="similar to GP:15158366; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="YP_005108435.1"
                     /db_xref="GI:376278402"
                     /db_xref="GeneID:11686570"
                     /translation="MSGPSVDVVIPNYNYARYLRVCAESVLSQDMEKLRLLIIDNAST
                     DNSVAVAREIAAADPRVELLLRPVNKGPHASFNDGIDWAGADYFVLLFADDVLTPGAL
                     QRAVSLMQHDRTIAFTYGRDIAIAGDAPMPELPLQPKAPPYRVETGRAFIERFCRLGV
                     FQIPAASLVVRTSAQKAAGHYSEALPHSDDYHMWLRLALRGRVAALDCIQVGLRTHGQ
                     NRSQQLLKDSQLQHILHTAHAGEYFFAHEGRALPDCDVLDGMLQKGIAERAYWSAMSH
                     FLRGDARGMQLFRFAFSRRLQTAFLPPVNYLLHRPDTARRLKRFFGGLPAKAFPVSAR
                     NGG"
     misc_feature    416320..>416676
                     /locus_tag="BSVBI22_B0426"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    416332..>416670
                     /locus_tag="BSVBI22_B0426"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    order(416341..416343,416347..416349,416425..416427,
                     416584..416586,416590..416592)
                     /locus_tag="BSVBI22_B0426"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(417280..418521)
                     /locus_tag="BSVBI22_B0427"
                     /db_xref="GeneID:11686571"
     CDS             complement(417280..418521)
                     /locus_tag="BSVBI22_B0427"
                     /note="similar to GP:15158364, and GP:15158364; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108436.1"
                     /db_xref="GI:376278403"
                     /db_xref="GeneID:11686571"
                     /translation="MKIGLFGQFGSGNTGNDGSLEAMLQMLARACPDADIVCICSRPE
                     IIAEKFHIAATPVGREPFVNGLLRRIDKALLQLPRRLSGFIAAVSIAQGLDLIIVPGT
                     GILDDFSENPFGWPFVIMRWSLAARLGGAKFAFVSIGAGPVVQPLSRFFVRVASRLAA
                     FRSYRDNVSYEFMQTLGINTRIDTVTADIAFALPVPDAGSKATAGRRCIGLGVMTYRG
                     WKKDSAQAPVIYETYLDKMADMAEGLLASGYRIRLLTGDISDLMAVDDLMARLAAPAR
                     ANIVFEPVTSLNGLMQQIAHTDIVVASRYHNIVCALATGRPAISLGYAAKNDALLHDA
                     GLDRFCHHIEDFDPQTVLMQVRQMFANLEQLREGVEAGVARYRLHLARQEEVLRTSLL
                     AGMPMEELTSVPGRYRESFRR"
     misc_feature    complement(417289..418521)
                     /locus_tag="BSVBI22_B0427"
                     /note="Polysaccharide pyruvyl transferase family protein
                     [Cell wall/membrane/envelope biogenesis]; Region: WcaK;
                     COG2327"
                     /db_xref="CDD:225208"
     gene            418638..420017
                     /locus_tag="BSVBI22_B0428"
                     /db_xref="GeneID:11686572"
     CDS             418638..420017
                     /locus_tag="BSVBI22_B0428"
                     /note="similar to GP:15158361; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 1 family protein"
                     /protein_id="YP_005108437.1"
                     /db_xref="GI:376278404"
                     /db_xref="GeneID:11686572"
                     /translation="MRGQAIAINWQRYISCPRYTGTRLRGSFSPEVRFPEPSRGKPGV
                     QLKSLAMKCAYFVRPHIGGTYSVFTRLRASLARSGMDLRWLAAGAPGEAVAVPREQGL
                     EDAMRRGDIIDRMGVLDEETRAKRFVDFLRENRFEAVFVNVLSHRFETNLVRYLPADI
                     LRVMIVHSITPGTYAAAQAIRDHVHATVGVSKRCRDDLVRGYGFDPSRTLVIPNGLTP
                     DPHVRCAAPEIEGGRLRLLYLGRIDDSSKGVFWLPAILRRLQCDYHLTVAGDGPDLAA
                     LRIKLAPFGNRISFTGWVAPSDVSWLVSQHDVMVMPSRYEGFGSTLIEAMSQGCPVVA
                     SRIPGVTDTIVTDGEDGFLFPIGNCRQAAQQIERLAADPRLRVAMGAAGVRKVIAEFD
                     SEIVGRAYAGLLQHLRENRPPITPPLALSQWSMPNALHKNLRSRLPQPVKNWLRRVRE
                     RVHTVWSTA"
     misc_feature    418797..419852
                     /locus_tag="BSVBI22_B0428"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases and named after YqgM in
                     Bacillus licheniformis about which little is known.
                     Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to...; Region:
                     GT1_YqgM_like; cd03801"
                     /db_xref="CDD:99974"
     misc_feature    418809..419870
                     /locus_tag="BSVBI22_B0428"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     gene            420055..421416
                     /locus_tag="BSVBI22_B0429"
                     /db_xref="GeneID:11686573"
     CDS             420055..421416
                     /locus_tag="BSVBI22_B0429"
                     /note="catalyzes the formation of 5-aminovulinate from
                     (S)-4-amino-5-oxopentanoate"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="YP_005108438.1"
                     /db_xref="GI:376278405"
                     /db_xref="GeneID:11686573"
                     /translation="MNLFTSQFRNSQLLASKAHALIPGGCHTYAKGDDQYPVLAPGFI
                     QRGSGAHVFDVDGHEYIEYGMGNRAVGLGHAYPPVVRAVREALQDGCNFTRPSAIELD
                     CAESFLELIEGAEMVKFCKDGSDATSGALRLARAYTGRDMVACCADHPFFSTDDWFIG
                     TTKMSAGIPASVSALTATFRYNDIASVEALFEDYPGRIAAIIMEPARADEPQDNFLHE
                     AMRIAHENGALFILDEMITGFRWHMRGAQKLYGIVPDLSCFGKALGNGFAISALAGKA
                     EYMRLGGLHHTDFPRVFLLSTTHGAETHAMAAAIATMAIYRDEPVIERLYEQGAKLAA
                     GINEAIAGHRLQDHVRLSGRPCCLTYSTLDGNGMPSQAFRILFLQETIRRGVLMPSLV
                     VSYTHSDADIARTIDAVHGALGIYVRALNDGVESCLVGRPSQVVYRRFNEDPASSCPP
                     PRL"
     misc_feature    420085..421377
                     /locus_tag="BSVBI22_B0429"
                     /note="glutamate-1-semialdehyde 2,1-aminomutase;
                     Provisional; Region: PRK06209"
                     /db_xref="CDD:180471"
     misc_feature    420085..421281
                     /locus_tag="BSVBI22_B0429"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     misc_feature    order(420421..420426,420433..420435,420664..420666,
                     420751..420753,420760..420762,420832..420837)
                     /locus_tag="BSVBI22_B0429"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    420835..420837
                     /locus_tag="BSVBI22_B0429"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            421395..422729
                     /locus_tag="BSVBI22_B0430"
                     /db_xref="GeneID:11686574"
     CDS             421395..422729
                     /locus_tag="BSVBI22_B0430"
                     /note="similar to GP:15158360, and GP:15158360; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108439.1"
                     /db_xref="GI:376278406"
                     /db_xref="GeneID:11686574"
                     /translation="MPTAKIVRGIALFLLAFAMTGGARAIAADTQFPLQVSGDRHRLQ
                     DAAATPCLLMGDAAWSLIAELRRDEAEAYLQDRRRRGFNAVLVNLLEHQFARNAPANT
                     YGDRPFKARAFGALNPQYFDHAAWVIGRAEALGITVFLASAYLGANGGGQGWYMAMEM
                     AGPKRMRAYGEVIARRFAGYRNIIWVLGGDFDAPDKRLVSSLAEGIAAVLPDAIQTVH
                     SSRDTDTARHWAGAGWLALDTVYDYDDVHKAVLARTAGAEMPVILLETLYENEHGTDA
                     GTIRRNAYGALLAGAAGQFFGNSPIWHFSAPGLFDSGGNWRKAPDSPGARSMGVLQNL
                     FSRLDWTKLQPDREKKITDRPGFYAARLPETGLAVIYGENGFALRKGAVDAGDAALWF
                     DPASGKTIVAGAPARENDLLVYHPPASRNADGHSDWVLLIGRMERLAFLQKE"
     misc_feature    421509..422204
                     /locus_tag="BSVBI22_B0430"
                     /note="Protein of unknown function (DUF4038); Region:
                     DUF4038; pfam13204"
                     /db_xref="CDD:257571"
     gene            422850..423911
                     /locus_tag="BSVBI22_B0431"
                     /db_xref="GeneID:11686575"
     CDS             422850..423911
                     /locus_tag="BSVBI22_B0431"
                     /note="similar to GP:15158370; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase/dehydratase family protein, putative"
                     /protein_id="YP_005108440.1"
                     /db_xref="GI:376278407"
                     /db_xref="GeneID:11686575"
                     /translation="MKVLVTGSQGYIGSVMVPMLIDAGHEVSGYDIGLYEHCLFKEGG
                     TVMNVPTIRKDVRDVSPRDLEGFDAVIHLAALSNDPLGNLNEDLTYAINHHASVAMAK
                     AAKLAGVGRFLFASSCSNYGISDAELIDETGELKPVTAYGRSKVRAEQEIRKLADASF
                     CPVYLRPATAYGVSPFLRFDIVLNNLVAWAVTKGLIYLKSDGTPWRPIVHIHDISRAF
                     MAAMEAPREKVWNEAFNVGSTAHNYRIRDIAGVVADNVPDCRIEYAQDAGPDTRSYRV
                     SFEKLAHVLPEAKPQWDAVAGTRELLAAYSRSTLTVEEFEGPRFQRIAHIRKLIAQGV
                     LDADLRRMDAHSHPLRAMA"
     misc_feature    422850..423794
                     /locus_tag="BSVBI22_B0431"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    422856..423560
                     /locus_tag="BSVBI22_B0431"
                     /note="extended (e) SDRs; Region: SDR_e; cd08946"
                     /db_xref="CDD:212494"
     misc_feature    order(422868..422870,422874..422885,422940..422945,
                     423048..423050,423066..423074,423123..423125,
                     423192..423200,423270..423272,423282..423284,
                     423348..423359)
                     /locus_tag="BSVBI22_B0431"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212494"
     misc_feature    order(423126..423128,423198..423200,423270..423272,
                     423282..423284)
                     /locus_tag="BSVBI22_B0431"
                     /note="active site"
                     /db_xref="CDD:212494"
     misc_feature    order(423198..423200,423270..423272,423354..423356,
                     423405..423407,423441..423443,423465..423467)
                     /locus_tag="BSVBI22_B0431"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212494"
     gene            423911..425263
                     /locus_tag="BSVBI22_B0432"
                     /db_xref="GeneID:11686576"
     CDS             423911..425263
                     /locus_tag="BSVBI22_B0432"
                     /note="similar to GP:15158371, and GP:15158371; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108441.1"
                     /db_xref="GI:376278408"
                     /db_xref="GeneID:11686576"
                     /translation="MDSGAPGRAGGAAMAAPQPDGAAIHRLAARLYPICRSLAGDGVR
                     ETLAIIGEYLPLHIHEVPTGTPLYDWKAPQEWIIREACIADLAGRRIVDFARHNLHVV
                     NFSMPVRARMSLDALKNHIHTLPDQPDLIPYRTCYHGESWGFCMAHNALLAMEDGEFD
                     VVIDAERRDGSLVFGEFIHRGQTDATFLLSAHLCHPSLANDNCSGLALLALLGEAMKS
                     RRTRLTYRLLFGPATFGALAWLRQNEDNLDHVRHGLVLSCLGDGGGPNYKRSRRGNAE
                     IDRIMDHVLAHCGLSGAAMHDFWPYGYDERQFCSPGFNLPVGMFQRSLYGRFPEYHTS
                     ADNLDFIKPEYLEQSFNMVMQTIEIAERNWVPLNMSPKGEPQLGRRGLYGSMGGDSRA
                     AQNAMAMLWVLNLADGGYSILDMAERSKLPFAMLADAADRLRDAGLIKETASQDLFAK
                     "
     misc_feature    423983..425227
                     /locus_tag="BSVBI22_B0432"
                     /note="M28 Zn-Peptidases; Region: M28_like_3; cd05644"
                     /db_xref="CDD:193522"
     misc_feature    424076..425230
                     /locus_tag="BSVBI22_B0432"
                     /note="Domain of unknown function (DUF2172); Region:
                     DUF2172; pfam09940"
                     /db_xref="CDD:255650"
     misc_feature    order(424484..424486,424490..424492,424511..424513,
                     424607..424612,424679..424681,424904..424906)
                     /locus_tag="BSVBI22_B0432"
                     /note="active site"
                     /db_xref="CDD:193522"
     misc_feature    order(424493..424495,424511..424513,424904..424906)
                     /locus_tag="BSVBI22_B0432"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193522"
     gene            complement(425226..425750)
                     /gene="rfbC"
                     /locus_tag="BSVBI22_B0433"
                     /db_xref="GeneID:11686577"
     CDS             complement(425226..425750)
                     /gene="rfbC"
                     /locus_tag="BSVBI22_B0433"
                     /note="similar to SP:P29202, and PID:148782; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="YP_005108442.1"
                     /db_xref="GI:376278409"
                     /db_xref="GeneID:11686577"
                     /translation="MHFTPLNINGAWSIEPERLKDERGWFARVYCEAAFAERKLETHF
                     PQHSLSFSREKGTLRGLHYQNEPHSETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVE
                     LSAENGVQLYIPEGCAHGFQTLTDDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEK
                     PSVISQKDLGWPFL"
     misc_feature    complement(425229..425750)
                     /gene="rfbC"
                     /locus_tag="BSVBI22_B0433"
                     /note="dTDP-4-dehydrorhamnose 3,5-epimerase and related
                     enzymes [Cell envelope biogenesis, outer membrane];
                     Region: RfbC; COG1898"
                     /db_xref="CDD:224810"
     gene            426071..427372
                     /locus_tag="BSVBI22_B0434"
                     /db_xref="GeneID:11686578"
     CDS             426071..427372
                     /locus_tag="BSVBI22_B0434"
                     /note="similar to GP:15158375; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase, putative"
                     /protein_id="YP_005108443.1"
                     /db_xref="GI:376278410"
                     /db_xref="GeneID:11686578"
                     /translation="MTIQAADISRDHSTVQARTGCRLCGKPLRHSFVDLGMSPPCESF
                     VTAERLDHMEPYYPLHAQVCDHCFLVQLKEYFSPADIFTEYAYFSSFATSWVSHAKNY
                     CDEITERLELNDNSFVVEIASNDGYLLQHFLPKNIPILGIEPAANVARTAIAKGVPTL
                     VDFFGSRLALEMIGEGRKADLIIGNNVLAQVPDLNDFVRGMQLLLKPEGVITLEFPHL
                     VNLIEQNQFDTIYHEHFSYFSLLTIRFMAQHHHLKVIDVEELPTHGGSLRVYLAHHGS
                     KRKVGPRVASLLKREESFGLNEISTYEQFAEKTRRTKRDLLSFLIAAKNAGKRICGYG
                     APGKGNTLLNYCGIGTDFLGFTVDRNPYKHGRFTPGMHIPIYDVSAIDNYRPDYILIL
                     PWNFKDEIIRQMQHVVEWGAKFIIPIPHVTLIDPALVTEER"
     misc_feature    426131..426319
                     /locus_tag="BSVBI22_B0434"
                     /note="Putative zinc binding domain; Region:
                     Methyltransf_13; pfam08421"
                     /db_xref="CDD:203938"
     misc_feature    426422..426724
                     /locus_tag="BSVBI22_B0434"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(426431..426451,426497..426499,426566..426574,
                     426623..426625)
                     /locus_tag="BSVBI22_B0434"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     misc_feature    426848..427327
                     /locus_tag="BSVBI22_B0434"
                     /note="C-methyltransferase C-terminal domain; Region:
                     Methyltransf_14; pfam08484"
                     /db_xref="CDD:254824"
     gene            427375..428184
                     /locus_tag="BSVBI22_B0435"
                     /db_xref="GeneID:11686579"
     CDS             427375..428184
                     /locus_tag="BSVBI22_B0435"
                     /note="similar to GP:15158376; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase family protein"
                     /protein_id="YP_005108444.1"
                     /db_xref="GI:376278411"
                     /db_xref="GeneID:11686579"
                     /translation="MKVVLFCGGLGTRIREYSENIPKPMIPLGHQPILHHVMEYYSDY
                     GHNDFVLCLGYKANVVKDFFLTIRPQTFADCVVSDGGRNVQLLEEVDRDWSVTLLDTG
                     IWRNIGERLWSARSHVMNEDIFLANYSDGLSDVDLDDMTQRFRASGKVACFLAVRPPL
                     TYHLADIAEGGDVRAFRTSNTSDIWINGGYFLFRKEIFDYMREGEELVLEPFSRLIAE
                     NQLMAYKYDGFWRSMDTLRDWQTLEDMVEKGDMPWKKHKAEQRAANIAIAL"
     misc_feature    427375..>428172
                     /locus_tag="BSVBI22_B0435"
                     /note="Nucleoside-diphosphate-sugar pyrophosphorylase
                     involved in lipopolysaccharide biosynthesis/translation
                     initiation factor 2B, gamma/epsilon subunits
                     (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis,
                     outer membrane / Translation, ribosomal structure...;
                     Region: GCD1; COG1208"
                     /db_xref="CDD:224129"
     misc_feature    427381..428136
                     /locus_tag="BSVBI22_B0435"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    order(427390..427392,427396..427398,427528..427530,
                     427756..427758,427762..427764)
                     /locus_tag="BSVBI22_B0435"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            428181..428837
                     /locus_tag="BSVBI22_B0436"
                     /db_xref="GeneID:11686580"
     CDS             428181..428837
                     /locus_tag="BSVBI22_B0436"
                     /note="similar to GP:15158377, and GP:6066675; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108445.1"
                     /db_xref="GI:376278412"
                     /db_xref="GeneID:11686580"
                     /translation="MIDLCALANPGRPLELLCLGAHSDDIEIGCGGTLLHLIETGTPL
                     HVEWCVLSGNEQRRAEAEASARDFLRGMDRFQLHVASLADSYFPAESRAIKEWLIAQR
                     GRGQPDIVFTHYHGDAHQDHRTVNELTWNLFRDQLILEYEIPKWDGDLGRPNAYSALP
                     ASIMERKIDLLMKHFGTQRSKDWFGPETFRGLARLRGMECRAPETYAEAFHARKLRLF
                     "
     misc_feature    428190..428828
                     /locus_tag="BSVBI22_B0436"
                     /note="Uncharacterized proteins, LmbE homologs [Function
                     unknown]; Region: COG2120"
                     /db_xref="CDD:225031"
     gene            428905..429036
                     /locus_tag="BSVBI22_B0437"
                     /db_xref="GeneID:11686581"
     CDS             428905..429036
                     /locus_tag="BSVBI22_B0437"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108446.1"
                     /db_xref="GI:376278413"
                     /db_xref="GeneID:11686581"
                     /translation="MAADKINLPAIKIGTVLQLPLVIVQPEDGPEQLMKQRRSGLLF"
     gene            complement(429033..430313)
                     /locus_tag="BSVBI22_B0438"
                     /db_xref="GeneID:11686582"
     CDS             complement(429033..430313)
                     /locus_tag="BSVBI22_B0438"
                     /note="similar to GP:15160336; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-xanthine permease"
                     /protein_id="YP_005108447.1"
                     /db_xref="GI:376278414"
                     /db_xref="GeneID:11686582"
                     /translation="MGYFPSWRLTSNAVVLPDERLPAAAAVPMGIQHLLAMSGSTIVA
                     PLLMGFDPNVAVFFSGIGTLLFFLITAGRVPSYLGSSFAFIAVVIAATGYSGSGPNPN
                     IAIALGGIIACGAFYSLIGLIVMFLGTGWVEKLMPPAVTGAIGVSIGLNLAPVAIGQL
                     KGTGAHTSIALLTVLCMAMISAYGPRGTRRLSVLFALLFGYLLVLIAGNGLGIVPGID
                     FTAVKNAAWFGLPHFTTPAFNWQAVTLIAPVAIVLVAENLGHIKALGSITGRNMDGYI
                     GRGFFSDGLATMISGAGGGTGVTTYAENIGVMAMTKVYSTLIFVIAAIMALILGMSPK
                     FGAILQTIPAPVLAGLAVSVFGLIASAMARIWIVNKVDFADSRNLFTVGVALIFGAGD
                     FTLNIGNFALGGIATSTLAALVLYQLLGIGRSDS"
     misc_feature    complement(429057..430313)
                     /locus_tag="BSVBI22_B0438"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     misc_feature    complement(429045..430289)
                     /locus_tag="BSVBI22_B0438"
                     /note="Xanthine/uracil permeases [Nucleotide transport and
                     metabolism]; Region: UraA; COG2233"
                     /db_xref="CDD:225142"
     gene            complement(430430..431926)
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /db_xref="GeneID:11686583"
     CDS             complement(430430..431926)
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="similar to SP:O66131; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="YP_005108448.1"
                     /db_xref="GI:376278415"
                     /db_xref="GeneID:11686583"
                     /translation="MSGYILAIDQGTTSTRSMLFDRNMRVVGLGQQEFTQHFPSSGWV
                     EHDAEEIWKSVQSTIRIALAQAGISAADVAAIGITNQRETTVVWDRISGKPVHRAIVW
                     QDRRTAQFCDELKRRNLEPLFTEKTGLLLDPYFSGTKLAWLLNHVPGLRERAQKGQVC
                     FGTIDSWLIYKLTGGKAHVTDATNASRTLIYHIGENRWDDELLDILGIPAAMLPEVKD
                     CAADFGMTDPALFGVSIPILGVAGDQQTAVIGNACFEPGMMKSTYGTGCFALLNTGTD
                     RVTSSNRLLTTIAYRLDGVTTYALEGSIFIAGAAVQWLRDEMGFISVVSEVSALAEKA
                     DPNQRIYLVPAFTGLGAPYWDAEARGAIFGLTRGTGRAEFARAALESVAYQTFDLLEA
                     MQGDWKGATNHTVLRVDGGMVASDWTMQRLADILNAPVDRPVFLETTVLGAAWLAASR
                     AGIWPDRKGFSERWQRDCRFEPAMPEKERESAIAGWRDSVSRCLTRPQ"
     misc_feature    complement(430433..431926)
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="Glycerol kinase [Energy production and conversion];
                     Region: GlpK; COG0554"
                     /db_xref="CDD:223628"
     misc_feature    complement(430457..431917)
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="Escherichia coli glycerol kinase-like proteins;
                     belongs to the FGGY family of carbohydrate kinases;
                     Region: FGGY_EcGK_like; cd07786"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(430565..430570,430574..430591,
                     430595..430600,430604..430612,430616..430618,
                     430850..430852,430856..430861,430865..430867,
                     430886..430888,430991..430993,431009..431014,
                     431018..431020,431024..431026,431033..431035,
                     431039..431041,431054..431074,431090..431092,
                     431096..431098,431123..431125,431132..431134,
                     431189..431194,431210..431215,431264..431275,
                     431339..431341,431345..431350,431366..431371,
                     431378..431383,431522..431527,431531..431533,
                     431537..431548,431555..431557,431591..431593,
                     431603..431605,431612..431614,431618..431623,
                     431681..431707,431801..431803,431849..431851,
                     431855..431857,431864..431869,431873..431875,
                     431879..431881,431888..431893,431900..431902,
                     431906..431908,431912..431917))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(430682..430684,430691..430699,
                     430946..430948,430952..430957,430991..430996,
                     431000..431005,431123..431125,431132..431140,
                     431195..431200,431525..431527,431621..431623,
                     431678..431686,431879..431881,431888..431896,
                     431900..431902))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="active site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(430682..430684,430691..430699,
                     430946..430948,430952..430957,430991..430996,
                     431000..431005,431132..431140,431879..431881,
                     431888..431896,431900..431902))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(431198..431200,431891..431893,
                     431900..431902))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(431198..431200,431900..431902))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(431123..431125,431195..431200,
                     431525..431527,431621..431623,431678..431686,
                     431891..431893))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="glycerol binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(431243..431248,431405..431407,
                     431414..431416,431645..431647,431744..431749,
                     431756..431758,431768..431773,431780..431782,
                     431831..431833))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(430805..430807,430814..430816,
                     430826..430852,430889..430891,430904..430906,
                     430910..430912,430979..430981,430988..430993,
                     431000..431002,431009..431011,431618..431620,
                     431795..431797,431804..431806,431813..431815))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(431225..431227,431231..431236))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="FBP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(430484..430486,430490..430501,
                     430505..430507,430511..430513,430715..430717,
                     430727..430729))
                     /gene="glpK"
                     /locus_tag="BSVBI22_B0439"
                     /note="protein IIAGlc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198361"
     gene            complement(432053..433354)
                     /locus_tag="BSVBI22_B0440"
                     /db_xref="GeneID:11686584"
     CDS             complement(432053..433354)
                     /locus_tag="BSVBI22_B0440"
                     /note="identified by match to PFAM protein family HMM
                     PF04024"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator family transporter"
                     /protein_id="YP_005108449.1"
                     /db_xref="GI:376278416"
                     /db_xref="GeneID:11686584"
                     /translation="MSRIEDRSLNGIAAADNGLTLVEMPEEAKTYLTKGMPAYRNASL
                     ALFLSGFATFSLLYCVQPLMPLFAKDFSITPTASSLSLSLSTGFLAFAIFFAAIIAER
                     FGRKSLMFASLLGSALCTIGCAVVPDWHMLLALRSLQGLLLGGVPAVAMSYLAEEIDP
                     RGLGASKGLYIAGNVFGGMAGRVITGTLAEYYSWRPALAVMGLLGLAAAIGFWALLPT
                     SRNFTPRTGLGARFHVSAWLSHLRNPALPMLIAIGFLVMGSFVTIYNYIGFRLIEPPY
                     NLSQTELGFIFTVYLFGIAASWSAGRIGDRLGHFTMLPIALAVEAAGCLLTLSASLPI
                     IVGGIIFLTVGFFMSHSVASALVGRLALEIKGHASSLYLLAYYLGSGIAGSAGGYFWT
                     ADGWWAVADFTFAMLALAFAAALAAAWFAREGQTDKPGLTF"
     misc_feature    complement(432158..433225)
                     /locus_tag="BSVBI22_B0440"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(432221..433219)
                     /locus_tag="BSVBI22_B0440"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(432215..432217,432224..432229,
                     432236..432241,432248..432253,432281..432283,
                     432290..432295,432305..432307,432314..432319,
                     432326..432328,432464..432466,432476..432478,
                     432485..432487,432497..432499,432509..432511,
                     432551..432553,432560..432565,432572..432577,
                     432584..432586,432821..432823,432839..432844,
                     432851..432856,432890..432892,432899..432904,
                     432911..432916,432923..432928,433064..433069,
                     433073..433078,433088..433090,433097..433102,
                     433109..433111,433160..433165,433169..433177,
                     433184..433186))
                     /locus_tag="BSVBI22_B0440"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            433459..434346
                     /locus_tag="BSVBI22_B0441"
                     /db_xref="GeneID:11686585"
     CDS             433459..434346
                     /locus_tag="BSVBI22_B0441"
                     /note="similar to GP:4106617; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005108450.1"
                     /db_xref="GI:376278417"
                     /db_xref="GeneID:11686585"
                     /translation="MELRHLRYFLAVAEEGNFTRAAAKLGIGQPPLSQQIRDLENEIG
                     VMLFHRVPHGAELTAAGAAFLEEATATIASSEKAKLAAQRAARGESGRLSLGFTASSA
                     FNPIVSGAIRHFRAKWPEVELFLTEMNTNLLIERLVRGELDTAFIRPGLEDPANVRMK
                     RLADEPMLVALPSHHRLAVYERLPLSALAGEPFVLFPRIVGLSLYDDIAAACRMAGFE
                     MNVTQEAPQMPSVVNLVAANLGVSIVPAAIAQIRLDGVTYRPIEGEPLVARLALASMK
                     SLRSPVHDNLISLLPRECI"
     misc_feature    433459..434328
                     /locus_tag="BSVBI22_B0441"
                     /note="DNA-binding transcriptional regulator HcaR;
                     Provisional; Region: PRK09906"
                     /db_xref="CDD:182137"
     misc_feature    433465..433641
                     /locus_tag="BSVBI22_B0441"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    433732..434328
                     /locus_tag="BSVBI22_B0441"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcrptional regulator BudR, which is
                     responsible for activation of the expression of the
                     butanediol operon genes; contains the type 2 periplasmic
                     binding fold; Region: PBP2_BudR; cd08451"
                     /db_xref="CDD:176142"
     misc_feature    order(433747..433749,433771..433773,433780..433785,
                     433789..433794,433801..433803,433825..433827,
                     433831..433833,433837..433839,433972..433974,
                     434074..434079,434134..434139,434155..434160,
                     434164..434169,434221..434223)
                     /locus_tag="BSVBI22_B0441"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176142"
     misc_feature    order(433750..433752,433900..433902,434044..434049,
                     434068..434070)
                     /locus_tag="BSVBI22_B0441"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176142"
     gene            434431..434871
                     /locus_tag="BSVBI22_B0442"
                     /db_xref="GeneID:11686586"
     CDS             434431..434871
                     /locus_tag="BSVBI22_B0442"
                     /note="this stereospecific enzymes reduces the R isomer of
                     methionine sulfoxide while MsrA reduces the S form;
                     provides protection against oxidative stress"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase B"
                     /protein_id="YP_005108451.1"
                     /db_xref="GI:376278418"
                     /db_xref="GeneID:11686586"
                     /translation="MKYQKSAEAIAKLSAEQYRVTQENGTERPGTGEYLYNKEPGIYV
                     DIVSGEPLFASSDKYESHCGWPSFTKPIERANVTELTDMSHGMVRTEVRSAHGDSHLG
                     HVFPDGPVDRGGLRYCINSASLRFVPKDRMEAEGYGDYLDQVEG"
     misc_feature    434431..434856
                     /locus_tag="BSVBI22_B0442"
                     /note="methionine sulfoxide reductase B; Provisional;
                     Region: PRK00222"
                     /db_xref="CDD:234692"
     gene            complement(434872..435999)
                     /locus_tag="BSVBI22_B0443"
                     /db_xref="GeneID:11686587"
     CDS             complement(434872..435999)
                     /locus_tag="BSVBI22_B0443"
                     /note="similar to GP:15159873, and SP:P45857; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_005108452.1"
                     /db_xref="GI:376278419"
                     /db_xref="GeneID:11686587"
                     /translation="MLLTDTQEQIREAARDFAQERLAPGAAARDREHAFPRAELTEMG
                     ALGFLGMLVPEEWGGSDLGMVAYALALEEIAAGDGACSTIVSVHSSVGCMPILRFGTE
                     DQKRRFLPKMACGEWIGGFALTEPQAGSDASALKTRARLDGDHYVIDGSKQFITSGKN
                     GNVVIVFAVTDPAAGKKGISAFIVPTDTPGYEVMSVEHKLGQHSSDTCALGFTNMRAP
                     VENRLGAEGEGYKIALANLEGGRIGIAAQAVGMARAAFEAARDYARERITFGKPIIEH
                     QAVAFRLADMATRIETARQMVLRAAALREAGKPCLTEASMAKLVASEMAEQVCSAAIQ
                     IHGGYGYLADYPVERIYRDVRVCQIYEGTSDVQRLVIARGL"
     misc_feature    complement(434875..435999)
                     /locus_tag="BSVBI22_B0443"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(434875..435987)
                     /locus_tag="BSVBI22_B0443"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(434905..434907,434911..434913,
                     434917..434925,435532..435534,435538..435540,
                     435631..435633,435637..435639,435727..435729))
                     /locus_tag="BSVBI22_B0443"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(435999..437189)
                     /gene="phbA-2"
                     /locus_tag="BSVBI22_B0444"
                     /db_xref="GeneID:11686588"
     CDS             complement(435999..437189)
                     /gene="phbA-2"
                     /locus_tag="BSVBI22_B0444"
                     /note="similar to GB:X03342, SP:P02433, and PID:36132;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="YP_005108453.1"
                     /db_xref="GI:376278420"
                     /db_xref="GeneID:11686588"
                     /translation="MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGA
                     GLAPEAVEEVIMGCVLPAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAH
                     DLILAGSADVIVAGGMESMTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRL
                     MGTFAEDCAEAYQFTREAQDAFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVT
                     IDEQPGKAKLDKIPTLRPAFREGGTVTAANSSSISDGAAALLLMRASEAEKRGLTPHA
                     VITGHATYADKPNLFSTAPIGAIRKLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLD
                     LPHDKVNIHGGACALGHPIGASGARILVTLLAALETHGLKRGIAGICLGGGEATAMGI
                     ERII"
     misc_feature    complement(436011..437183)
                     /gene="phbA-2"
                     /locus_tag="BSVBI22_B0444"
                     /note="acetyl-CoA acetyltransferase; Provisional; Region:
                     PRK06954"
                     /db_xref="CDD:180775"
     misc_feature    complement(436008..437168)
                     /gene="phbA-2"
                     /locus_tag="BSVBI22_B0444"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(436035..436040,436275..436277,
                     436335..436337,436341..436343,436347..436349,
                     436824..436826,436869..436871,436878..436883,
                     436902..436904,436926..436937,436968..436970,
                     436980..436982,436989..436991,437031..437033,
                     437112..437114))
                     /gene="phbA-2"
                     /locus_tag="BSVBI22_B0444"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(436047..436049,436137..436139,
                     436917..436919))
                     /gene="phbA-2"
                     /locus_tag="BSVBI22_B0444"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            complement(437258..438025)
                     /locus_tag="BSVBI22_B0445"
                     /db_xref="GeneID:11686589"
     CDS             complement(437258..438025)
                     /locus_tag="BSVBI22_B0445"
                     /note="similar to GP:9948613, GB:M29297, and SP:P20189;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase, putative"
                     /protein_id="YP_005108454.1"
                     /db_xref="GI:376278421"
                     /db_xref="GeneID:11686589"
                     /translation="MQIENRVFLITGAGSGLGAAVSKMAVEAGAKVVLLDVNAEAGEA
                     GAKALGASARFQRTDVASDTDGKAAIAAAIEAFGRIDVLVNCAGVAPGEKVLGREGAH
                     KLETFTRTISINLIGTFNMLRLAAEAMAKNEPGQGGERGVIINTASVAAFDGQIGQAA
                     YSASKGGVAAMTLPVARELARHGIRVMTIAPGIFKTPMMAGMPQEVQDALGASVPFPP
                     RLGEPAEYAALVHHIVENQMLNGEVIRLDGALRMAAK"
     misc_feature    complement(437270..438025)
                     /locus_tag="BSVBI22_B0445"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK08217"
                     /db_xref="CDD:181297"
     misc_feature    complement(437264..438016)
                     /locus_tag="BSVBI22_B0445"
                     /note="17hydroxysteroid dehydrogenase type 10
                     (HSD10)-like, classical (c) SDRs; Region:
                     HSD10-like_SDR_c; cd05371"
                     /db_xref="CDD:187629"
     misc_feature    complement(order(437429..437440,437444..437455,
                     437531..437533,437543..437545,437582..437590,
                     437687..437689,437762..437770,437846..437854,
                     437915..437920,437975..437983,437990..437992))
                     /locus_tag="BSVBI22_B0445"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187629"
     misc_feature    complement(order(437264..437275,437279..437326,
                     437330..437332,437339..437344,437351..437353,
                     437363..437371,437375..437383,437444..437446,
                     437471..437473,437477..437488,437492..437497,
                     437501..437509,437513..437518,437525..437530,
                     437537..437542,437549..437551,437555..437575,
                     437609..437617,437636..437638,437645..437650,
                     437657..437659,437666..437671,437678..437683,
                     437693..437695,437702..437707,437714..437716,
                     437720..437725,437732..437734,437738..437746))
                     /locus_tag="BSVBI22_B0445"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187629"
     misc_feature    complement(order(437264..437272,437492..437497,
                     437501..437506,437513..437518,437525..437530,
                     437537..437542,437549..437551,437555..437575,
                     437657..437659,437666..437671,437678..437680,
                     437693..437695,437705..437707,437714..437716,
                     437720..437725,437738..437746))
                     /locus_tag="BSVBI22_B0445"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187629"
     misc_feature    complement(order(437531..437533,437543..437545,
                     437582..437584,437684..437686))
                     /locus_tag="BSVBI22_B0445"
                     /note="active site"
                     /db_xref="CDD:187629"
     gene            complement(438038..439708)
                     /locus_tag="BSVBI22_B0446"
                     /db_xref="GeneID:11686590"
     CDS             complement(438038..439708)
                     /locus_tag="BSVBI22_B0446"
                     /note="similar to GB:M25667, GB:S66533, GB:S66534,
                     GB:S66541, SP:P17677, and PID:182970; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase, putative"
                     /protein_id="YP_005108455.1"
                     /db_xref="GI:376278422"
                     /db_xref="GeneID:11686590"
                     /translation="MTESPASARLDRYDDAVAQFDIAKAIALLAGNPDTGINACIECC
                     DRYTGENRVALRAISIDNTLTELTFEDLRDMSARVGNMLADAGISAGDVVAGLLPRTP
                     ELVATILGAWRIGAIYQPLFTAFGPKAIEQRFGTSGAKLVVTNLANRSKLAEVENCPR
                     VATILAPGESLPEGDIDFRAAVAAASTECEPVMRKGSDLFMMMSTSGTAGLPKGVPVP
                     LRALMAFGAYMRDAVGLRSDDIFWNIADPGWAYGLYYAVTGPLLLGVPTILNEGGFTA
                     ENTYDIIERLGVTSLAGSPTAFRLLMAAGPESAARVKGRLRVVSSAGEPLNPEVIRWF
                     DACLGAPIHDHYGQTELGMVVNNHHGLEHPVRQGSAGYAMPGYRVAVLDEAGKEVGPN
                     EPGVLAIDIDNSPLLWFTGYYKKDTPSISGGYYRTGDTVEFEPDGSISFIGRADDVIT
                     SSGYRIGPFDVESALLKHPAVNEAAVVGVPDPQRTEIVKAFVILAPGFEGTPELAEEL
                     ALHVKKQLSAHAYPRQIDFVAELPKTLSGKIQRFLLRKAEVEKQQQQN"
     misc_feature    complement(438053..439600)
                     /locus_tag="BSVBI22_B0446"
                     /note="Acyl-coenzyme A synthetases/AMP-(fatty) acid
                     ligases [Lipid metabolism]; Region: Acs; COG0365"
                     /db_xref="CDD:223442"
     misc_feature    complement(438071..439510)
                     /locus_tag="BSVBI22_B0446"
                     /note="Uncharacterized subfamily of medium-chain acyl-CoA
                     synthetase (MACS); Region: MACS_like_2; cd05973"
                     /db_xref="CDD:213320"
     misc_feature    complement(order(438140..438142,438146..438148,
                     438152..438157,438170..438172,438257..438259,
                     438344..438355,438359..438361,438377..438379,
                     438386..438388,438422..438424,438599..438601,
                     438650..438655,438662..438679,438734..438745,
                     438809..438811,438821..438823,438827..438829,
                     438887..438889,438956..438964,439337..439339))
                     /locus_tag="BSVBI22_B0446"
                     /note="active site"
                     /db_xref="CDD:213320"
     misc_feature    complement(order(439070..439075,439079..439096,
                     439103..439105))
                     /locus_tag="BSVBI22_B0446"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213320"
     misc_feature    complement(order(438152..438154,438170..438172,
                     438347..438355,438743..438745,438809..438811,
                     438818..438823,438974..438976))
                     /locus_tag="BSVBI22_B0446"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213320"
     misc_feature    complement(order(438344..438346,438359..438361,
                     438377..438379,438386..438388,438422..438424,
                     438599..438601,438662..438679,438734..438745))
                     /locus_tag="BSVBI22_B0446"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213320"
     gene            439835..440818
                     /locus_tag="BSVBI22_B0447"
                     /db_xref="GeneID:11686591"
     CDS             439835..440818
                     /locus_tag="BSVBI22_B0447"
                     /note="similar to GP:14523919; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005108456.1"
                     /db_xref="GI:376278423"
                     /db_xref="GeneID:11686591"
                     /translation="MERHNITPGFVEDALESVRQRGLDTAPLMAAAGLPQKVREPVTN
                     VQYGRLWWLIAQTIDDEFFGLAARPMRPGSFDLLCHAVLHAGTLERALRRALQFLNVV
                     LDDPRGELRIRDGMAHIVLTDAAGHRPAFAYRAYWLILMGVACWLVGRRIPLRTLDFA
                     CPAPVHRQDYHKFFGAPVLFDQPATRLVFSSTYLALPIIRSDVALENFLREAPANILI
                     RYRHDHDISSRVRAQLNALPAQEWPSFDDLAKGLRMSAPTLRRRLKAEGQSFGTIKDE
                     LRFVIAQKLLQEKKLSIAEVAAELGYSEPSAFYRAFQKWVGRSPGQFRVEP"
     misc_feature    439898..440428
                     /locus_tag="BSVBI22_B0447"
                     /note="Arabinose-binding domain of AraC transcription
                     regulator, N-term; Region: Arabinose_bd; pfam12625"
                     /db_xref="CDD:257172"
     misc_feature    440561..440806
                     /locus_tag="BSVBI22_B0447"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    440696..440806
                     /locus_tag="BSVBI22_B0447"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            440866..441045
                     /locus_tag="BSVBI22_B0448"
                     /db_xref="GeneID:11686592"
     CDS             440866..441045
                     /locus_tag="BSVBI22_B0448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108457.1"
                     /db_xref="GI:376278424"
                     /db_xref="GeneID:11686592"
                     /translation="MFSDAFLEIQCQGRGIYEWLKRKKAAPDWLDTKHSVDVGFAFIH
                     VVNRPSAVSAWKLPK"
     gene            441042..442280
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /db_xref="GeneID:11686593"
     CDS             441042..442280
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="catalyzes the formation of 3-phosphonooxypyruvate
                     from 3-phospho-D-glycerate in serine biosynthesis; can
                     also reduce alpha ketoglutarate to form
                     2-hydroxyglutarate"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="YP_005108458.1"
                     /db_xref="GI:376278425"
                     /db_xref="GeneID:11686593"
                     /translation="MTERLSLSRDRINVLLLEGISQTAVEYFKSSGYTNVTHLPKALD
                     KADLIKAISSAHIIGIRSRTQLTEEIFAAANRLIAVGCFSVGTNQVELKAARKRGIPV
                     FNAPFSNTRSVAELVIGEIIMLMRRIFPRSVSAHAGGWEKTAIGSREVRGKTLGIVGY
                     GNIGSQVGNLAESLGMTVRYYDTSDKLQYGNVKPAASLDELLKTSDVVSLHVPSSKST
                     SKLITEAKLRKMKKGAFLINNARGSVVDLEALAKVLQEGHLAGAAIDVFPVEPASNGE
                     RFSTPLQGLENVILTPHIGGSTEEAQERIGTEVTRKLVEYSDVGSTVGAVNFPQVQLP
                     PRPTGTRFMHVHENRPGILNSLMNVFSHHHINIASQFLQTDGEVGYLVMEADGVGEAS
                     DAVLQEIREIPGTIRARLLY"
     misc_feature    441045..442277
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="D-3-phosphoglycerate dehydrogenase; Provisional;
                     Region: PRK11790"
                     /db_xref="CDD:236985"
     misc_feature    441075..441989
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="Phosphoglycerate dehydrogenases, NAD-binding and
                     catalytic domains; Region: PGDH_3; cd12176"
                     /db_xref="CDD:240653"
     misc_feature    order(441222..441227,441291..441299,441366..441368)
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240653"
     misc_feature    order(441294..441296,441360..441362,441366..441368,
                     441378..441380,441516..441530,441582..441590,
                     441597..441599,441672..441680,441690..441695,
                     441702..441704,441756..441764,441834..441836,
                     441918..441920,441924..441929)
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240653"
     misc_feature    order(441372..441377,441384..441389,441393..441401,
                     441405..441410,441417..441419,441423..441425,
                     441432..441437,441444..441449,441453..441455,
                     441459..441494,441498..441500,441558..441563,
                     441840..441842,441849..441854,441861..441863,
                     441870..441875,441885..441890,441894..441896,
                     441903..441926,441930..441941,441945..441947)
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240653"
     misc_feature    order(441762..441764,441849..441851,441918..441920)
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240653"
     misc_feature    442062..442274
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="C-terminal ACT (regulatory) domain of
                     D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi
                     and bacteria; Region: ACT_3PGDH; cd04901"
                     /db_xref="CDD:153173"
     misc_feature    order(442077..442079,442083..442085,442137..442139)
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="L-serine binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153173"
     misc_feature    order(442083..442085,442089..442091,442098..442103,
                     442110..442112,442137..442139,442143..442163)
                     /gene="serA-2"
                     /locus_tag="BSVBI22_B0449"
                     /note="ACT domain interface; other site"
                     /db_xref="CDD:153173"
     gene            complement(442333..442827)
                     /gene="def"
                     /locus_tag="BSVBI22_B0450"
                     /db_xref="GeneID:11686594"
     CDS             complement(442333..442827)
                     /gene="def"
                     /locus_tag="BSVBI22_B0450"
                     /note="cleaves off formyl group from N-terminal methionine
                     residues of newly synthesized proteins; binds iron(2+)"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="YP_005108459.1"
                     /db_xref="GI:376278426"
                     /db_xref="GeneID:11686594"
                     /translation="MTVRLIVKYPDPRLRAAAEPVTTFDEGLRKLADDLLDTMRAAPG
                     IGITAPHIGISKRVVVLELDRAAGPKIYINPEIVWACEEKIRHQEGSVSMPGVVDEVE
                     RHARIRLRYQDLDGNEQTEESDGLLAVCHQHEIDQLDGIFWVQRLSRLRRERLIKRYE
                     KLQR"
     misc_feature    complement(442399..442812)
                     /gene="def"
                     /locus_tag="BSVBI22_B0450"
                     /note="Polypeptide or peptide deformylase; a family of
                     metalloenzymes that catalyzes the removal of the
                     N-terminal formyl group in a growing polypeptide chain
                     following translation initiation during protein synthesis
                     in prokaryotes. These enzymes utilize Fe(II)...; Region:
                     Pep_deformylase; cd00487"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(442417..442419,442426..442431,
                     442552..442560,442675..442677,442690..442698))
                     /gene="def"
                     /locus_tag="BSVBI22_B0450"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(442426..442428,442552..442554,
                     442675..442677,442690..442692))
                     /gene="def"
                     /locus_tag="BSVBI22_B0450"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(442417..442419,442429..442431,
                     442555..442557))
                     /gene="def"
                     /locus_tag="BSVBI22_B0450"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            complement(443573..444514)
                     /locus_tag="BSVBI22_B0451"
                     /db_xref="GeneID:11686595"
     CDS             complement(443573..444514)
                     /locus_tag="BSVBI22_B0451"
                     /note="similar to GB:Z29635, SP:P46374, PID:455002,
                     GB:Z29635, SP:P46374, and PID:455002; identified by
                     sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108460.1"
                     /db_xref="GI:376278427"
                     /db_xref="GeneID:11686595"
                     /translation="MASGLFALLDDIAAIAKMAAASLDDVAGQTAKASAKAAGIVIDD
                     TAVTPKYVVGLTPERELPVIWKITKGSLRNKLIFLLPIALVLGYFAPDFIMPLLMLGG
                     IYLAFEGTEKLVEFFLPHDEEEHSETQGNSAREIEASTVAGAIRTDFILSAEIMALTL
                     AGLPPSSIFTQAIILAAVGILITFAVYGVVGIIVKLDDMGASLFMHSHTSVGRKLGKG
                     LVGAMPVLLETLSSVGTIAMLWVGGSIIVHGLASLGFHTVEEFIRSVAQAIPAERFPF
                     PEAVRWVVTSFLQAVLAVLTGLVAVVIVHLAKRIARR"
     misc_feature    complement(443585..444514)
                     /locus_tag="BSVBI22_B0451"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2354"
                     /db_xref="CDD:225229"
     gene            444827..445150
                     /locus_tag="BSVBI22_B0452"
                     /db_xref="GeneID:11686596"
     CDS             444827..445150
                     /locus_tag="BSVBI22_B0452"
                     /note="identified by match to PFAM protein family HMM
                     PF01022"
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="YP_005108461.1"
                     /db_xref="GI:376278428"
                     /db_xref="GeneID:11686596"
                     /translation="MDTRLVMREQMEARANEVAELLKTLSHPARLMLACTLAEGEYSV
                     GELEEMLGIRQPTLSQQLGVLREADIVETRREAKQIYYRLVETKAAKLIDALYGIFCK
                     EGTDS"
     misc_feature    444890..445090
                     /locus_tag="BSVBI22_B0452"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(444890..444895,444899..444901,444908..444910,
                     444917..444922,444929..444934,444941..444943,
                     445031..445033)
                     /locus_tag="BSVBI22_B0452"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(444893..444898,444908..444916,444953..444961,
                     444986..444997,445001..445006,445013..445018,
                     445022..445027,445043..445051,445064..445072)
                     /locus_tag="BSVBI22_B0452"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(444953..444955,444962..444964)
                     /locus_tag="BSVBI22_B0452"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            445150..445557
                     /locus_tag="BSVBI22_B0453"
                     /db_xref="GeneID:11686597"
     CDS             445150..445557
                     /locus_tag="BSVBI22_B0453"
                     /note="similar to GP:14523677, and GP:14523677; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108462.1"
                     /db_xref="GI:376278429"
                     /db_xref="GeneID:11686597"
                     /translation="MALYMQALLGGMLIGLSAVLLLLLNGRVAGISGIVGRLLDGKQI
                     SGNLLFIIGLLMGPVVYAWIFGAFPATDIAASWPVILIAGLLVGVGTRMGSGCTSGHG
                     IVGLARFSRRSLVATIVFLIAGVIAASLAGAFL"
     misc_feature    445150..>445545
                     /locus_tag="BSVBI22_B0453"
                     /note="Predicted transporter component [General function
                     prediction only]; Region: COG2391"
                     /db_xref="CDD:225264"
     misc_feature    445165..445335
                     /locus_tag="BSVBI22_B0453"
                     /note="Domain of unknown function (DUF4341); Region:
                     DUF4341; pfam14241"
                     /db_xref="CDD:258431"
     gene            445554..445991
                     /locus_tag="BSVBI22_B0454"
                     /db_xref="GeneID:11686598"
     CDS             445554..445991
                     /locus_tag="BSVBI22_B0454"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108463.1"
                     /db_xref="GI:376278430"
                     /db_xref="GeneID:11686598"
                     /translation="MNRLSFLRLGAALAAGVIFSFGLSVSGMINPARVIGFLNIASGH
                     WDPSLAFVMGGGLLVTIPGIALCRRLSAPAFDTAFHLPTKTQIDRRLIAGSALFGIGW
                     GLGGFCPGPAVAALSLGLPQVALFVLAMAVGMIIHDRWLAKTL"
     misc_feature    445554..445988
                     /locus_tag="BSVBI22_B0454"
                     /note="Predicted transporter component [General function
                     prediction only]; Region: COG2391"
                     /db_xref="CDD:225264"
     misc_feature    445815..445943
                     /locus_tag="BSVBI22_B0454"
                     /note="Sulphur transport; Region: Sulf_transp; pfam04143"
                     /db_xref="CDD:190881"
     gene            complement(446014..446721)
                     /locus_tag="BSVBI22_B0455"
                     /db_xref="GeneID:11686599"
     CDS             complement(446014..446721)
                     /locus_tag="BSVBI22_B0455"
                     /note="similar to GP:14524042; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005108464.1"
                     /db_xref="GI:376278431"
                     /db_xref="GeneID:11686599"
                     /translation="MILLETKMAKENSNSGARWFPVYQGLCEAVVGHSLLPGTKLPED
                     ELASIYTVSRAVVRSALQALAHDRLVRLEPNRGAFVAEPSPEEAREVFEARSLIEPEI
                     AALAAKKATPKQIEELRQHLEREHDALQAGHDSDAIRLSALFHSYLAKIAGHSIFASF
                     VSELLPRSSLIIALYWQRREITCQNDAHHALVNAIEKHDAHEAAALMKTHILDLLSGL
                     SLNRIKKEQKRLADVLR"
     misc_feature    complement(446068..446715)
                     /locus_tag="BSVBI22_B0455"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    complement(446479..446658)
                     /locus_tag="BSVBI22_B0455"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(446488..446499,446503..446508,
                     446536..446538,446545..446550,446554..446568,
                     446590..446595,446596..446598))
                     /locus_tag="BSVBI22_B0455"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(446089..446454)
                     /locus_tag="BSVBI22_B0455"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            446967..448025
                     /locus_tag="BSVBI22_B0456"
                     /db_xref="GeneID:11686600"
     CDS             446967..448025
                     /locus_tag="BSVBI22_B0456"
                     /note="identified by match to PFAM protein family HMM
                     PF01594"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108465.1"
                     /db_xref="GI:376278432"
                     /db_xref="GeneID:11686600"
                     /translation="MSVQRASFYILLTLVTIAFAWLLIPYYTAVLWAVIMAVIFYPVQ
                     QWLVLLLRGRRNIAAFLSVLMCICLVIIPMLAIFGSLVDEGTSLYQRLSSREFDINGY
                     IARIMAALPESLEEWLKRFELGTFADWRARISSVVMQGSQLFAARLVSFGQNTLQFFI
                     GFGIMLYLLFFLFRDGADVGKKIRRAIPLSDDYTRQFLEKFTAVIRATVKGNIIIAII
                     QGMIGGVTFWLLGIEAALLWGVIMTFCSMLPAVGAALVWTPAAVWFFVSGDWWSGAIL
                     VVVGVLVIGLVDNLLRPPLVGKGTRMPDYVVLISTVGGISLIGINGFVIGPLIAAMFI
                     AAWSLLAEEQKDQHMPDQ"
     misc_feature    446967..448019
                     /locus_tag="BSVBI22_B0456"
                     /note="Predicted permease, member of the PurR regulon
                     [General function prediction only]; Region: yhhT; COG0628"
                     /db_xref="CDD:223701"
     gene            448153..448341
                     /locus_tag="BSVBI22_B0457"
                     /db_xref="GeneID:11686601"
     CDS             448153..448341
                     /locus_tag="BSVBI22_B0457"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108466.1"
                     /db_xref="GI:376278433"
                     /db_xref="GeneID:11686601"
                     /translation="MPRSGSVFGRRSKTEHPQNRCDYTRLQGTILQGRYAFTNSLKKK
                     PPRSDLSALGRYSLLQVE"
     gene            448644..449363
                     /locus_tag="BSVBI22_B0458"
                     /db_xref="GeneID:11686602"
     CDS             448644..449363
                     /locus_tag="BSVBI22_B0458"
                     /note="identified by match to PFAM protein family HMM
                     PF03130"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005108467.1"
                     /db_xref="GI:376278434"
                     /db_xref="GeneID:11686602"
                     /translation="MADSEDKKPPQASLSSEQTRKALIVAALRLFGAKGYEATSTREI
                     ASLTKANIGSIAYHFGGKEGLRLAAADYIVETFRLIAAQALGNFQPAGFSREEREDAR
                     AQMISALERMVHFIVARPETGEIVQFLLRELAHPTAALDRIYKGVFEPVHKRLCMIWE
                     AATGEAAESEATRLVVFTLVGQIFYFRIAQEAVKRRMNWPVMGSDQADMVAGVVKQNL
                     AAMLDARGPTGAQQPVADGGK"
     misc_feature    448668..449312
                     /locus_tag="BSVBI22_B0458"
                     /note="putative DNA-binding transcriptional regulator;
                     Provisional; Region: PRK11552"
                     /db_xref="CDD:236928"
     misc_feature    448710..448850
                     /locus_tag="BSVBI22_B0458"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    448944..449318
                     /locus_tag="BSVBI22_B0458"
                     /note="Domain of unknown function (DUF1956); Region:
                     DUF1956; pfam09209"
                     /db_xref="CDD:255234"
     gene            449368..450312
                     /locus_tag="BSVBI22_B0459"
                     /db_xref="GeneID:11686603"
     CDS             449368..450312
                     /locus_tag="BSVBI22_B0459"
                     /note="identified by match to TIGR protein family HMM
                     TIGR00998"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="YP_005108468.1"
                     /db_xref="GI:376278435"
                     /db_xref="GeneID:11686603"
                     /translation="MSLLCVIPFVSSLFAACGTQSLAVGHVEGEFVQLAPLQVAQVRD
                     IAVKRGDRVEAGEPIATVEDTDARIAVAQAEAALAQAQAQLANLQVGKRPEEIAVLEA
                     AVRSARAQADDAQRTLLRTRDLARRGVATQAQLDDAATQLEVAEAAIGQSTANLAVGK
                     LPARPEEIKAAENAVKSAKAQLQTAKWQRAQRTIEAPAAGRITDVVRNPGDIAGPSAP
                     VLTMLPDGAVKLKVYIPEERFSDVAVGSVLSVHCDGCAPGLQARVSYVSPDPEFTPPV
                     IYSLETRQKLVYLVEAHPVNPASPLQPGQIVDVDLGAK"
     misc_feature    <449500..>449562
                     /locus_tag="BSVBI22_B0459"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     misc_feature    449665..>449913
                     /locus_tag="BSVBI22_B0459"
                     /note="Protein of unknown function (DUF2894); Region:
                     DUF2894; pfam11445"
                     /db_xref="CDD:256461"
     misc_feature    449944..450279
                     /locus_tag="BSVBI22_B0459"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            450323..451230
                     /locus_tag="BSVBI22_B0460"
                     /note="This region contains an authentic frame shift and
                     is not the result of a sequencing artifact; ABC
                     transporter, ATP-binding protein, authentic frameshift"
                     /db_xref="GeneID:11686604"
     gene            451233..452366
                     /locus_tag="BSVBI22_B0461"
                     /db_xref="GeneID:11686605"
     CDS             451233..452366
                     /locus_tag="BSVBI22_B0461"
                     /note="similar to GP:17427173; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, permease protein"
                     /protein_id="YP_005108469.1"
                     /db_xref="GI:376278436"
                     /db_xref="GeneID:11686605"
                     /translation="MQWFSLARLRAMLMKEFIQMWRDHITFAMMLIVPLMQLLLFGFA
                     INNDPKSLPSALVALSNDHYTRAMISALETTNYYRFDHVVHSAAEADALLANGSVSFV
                     VTIPSDFARRVDAGDRPQLLIEADATDPSVASGAISTLSTVASQALLREQGRQAEAEN
                     ASRSQLEVVVHRRYNPEGISQYNIVPGLLGVILQMTMVMMTAMALTRETERGTMENLL
                     AMPATPAEIMLGKILPYLAVGGVQMVVVLVAAKLIFGVPFVGSLTLLLSSVLIFVLSL
                     VLLGYTISTVSRTQMQAMQLTFFFFLPSLMLSGFMFPFRGMPDWAQALGNIFPLTYFL
                     RIVRAVMLKGAGLADIAGEVMALILFVFLFAGLALLRFQRTLD"
     misc_feature    451305..451742
                     /locus_tag="BSVBI22_B0461"
                     /note="YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm;
                     cl19580"
                     /db_xref="CDD:267933"
     misc_feature    451458..452354
                     /locus_tag="BSVBI22_B0461"
                     /note="ABC-type multidrug transport system, permease
                     component [Defense mechanisms]; Region: COG0842"
                     /db_xref="CDD:223912"
     misc_feature    451752..452258
                     /locus_tag="BSVBI22_B0461"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     pfam01061"
                     /db_xref="CDD:250332"
     gene            452404..452802
                     /locus_tag="BSVBI22_B0462"
                     /db_xref="GeneID:11686606"
     CDS             452404..452802
                     /locus_tag="BSVBI22_B0462"
                     /note="similar to GP:15158870, and GP:15074195; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108470.1"
                     /db_xref="GI:376278437"
                     /db_xref="GeneID:11686606"
                     /translation="MVEITRNGSQASRKGPAEWFTGNVRIDPLFVANEARRAEASTVT
                     FEPGARTAWHTHPLGQTLVVTAGLGLVQREGGPIEKIRPGDVVWFEPGEKHWHGASPS
                     TVMTHIAIQEKLDSKVVDWLEHVTDEQYGG"
     misc_feature    452404..452781
                     /locus_tag="BSVBI22_B0462"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            complement(452809..453627)
                     /locus_tag="BSVBI22_B0463"
                     /db_xref="GeneID:11686607"
     CDS             complement(452809..453627)
                     /locus_tag="BSVBI22_B0463"
                     /note="similar to GP:13021750, and SP:Q47539; identified
                     by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="taurine ABC transporter, permease protein,
                     putative"
                     /protein_id="YP_005108471.1"
                     /db_xref="GI:376278438"
                     /db_xref="GeneID:11686607"
                     /translation="MSDADVSKTARPVRPVEFRGGGFAPSPVRGIGLAVFVVLMVAAE
                     IGTRSGFISNLTLPRPSAVLETFGQLWQTGLLWQHLLPSLQRLIIGASLGIAVGISLG
                     VMIGLFSYVRAGLVPLVAALFPIPKIALLPLFVIWFGIDEMSKYMLIAFGTFTPTVVA
                     TYGAVDNVDRSLIRMGQSFGLSWWSIVRKIVLPGAFPAILSGLRVSISIAIILLVAAE
                     MLGAQYGVGSYILEAGSLYDLEKLFAGVAILSVMGLIVNVVIGWVERRFLNWRG"
     misc_feature    complement(452812..453576)
                     /locus_tag="BSVBI22_B0463"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(452842..453390)
                     /locus_tag="BSVBI22_B0463"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(452842..452847,452854..452859,
                     452866..452871,452875..452880,452887..452892,
                     452920..452925,452971..452976,452983..452994,
                     453013..453015,453022..453027,453067..453069,
                     453118..453120,453127..453132,453142..453144,
                     453148..453153,453160..453162,453166..453168,
                     453172..453177,453223..453225,453229..453234,
                     453241..453270,453274..453285,453310..453312,
                     453325..453330,453337..453342))
                     /locus_tag="BSVBI22_B0463"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(452977..452994,453223..453267))
                     /locus_tag="BSVBI22_B0463"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(452890..452892,452920..452922,
                     452929..452931,452974..452976,453223..453225))
                     /locus_tag="BSVBI22_B0463"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(453046..453048,453058..453063,
                     453079..453117))
                     /locus_tag="BSVBI22_B0463"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(453620..454387)
                     /locus_tag="BSVBI22_B0464"
                     /db_xref="GeneID:11686608"
     CDS             complement(453620..454387)
                     /locus_tag="BSVBI22_B0464"
                     /note="similar to SP:P37338, GB:U00096, and PID:1789018;
                     identified by sequence similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="YP_005108472.1"
                     /db_xref="GI:376278439"
                     /db_xref="GeneID:11686608"
                     /translation="MDLKLQNISHFYGKVEVLKDISLDIPQGQIVCLIGPSGCGKSTL
                     LRFLGGLERPGSGQVLQIGDPPPDSLNPLTYVFQHFALLPWRTVEGNIKLVLEDHRLS
                     QREMNDIVTDVLERTRLGDFRTALPKQLSGGMRQRVAISRALAVRPAVMLMDEPLSAL
                     DSQTRALLMDDLVSLWTRQPFTSVYVTHNLAEAVRLGHRVVVLSRRPGRIRQIVDIDI
                     PLSERALGDPALEAKQKMLWDLMREEAMAADKELTDV"
     misc_feature    complement(453656..454381)
                     /locus_tag="BSVBI22_B0464"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    complement(453734..454381)
                     /locus_tag="BSVBI22_B0464"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    complement(454262..454285)
                     /locus_tag="BSVBI22_B0464"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(order(453824..453826,453923..453928,
                     454154..454156,454259..454267,454271..454276))
                     /locus_tag="BSVBI22_B0464"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(454154..454165)
                     /locus_tag="BSVBI22_B0464"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(453971..454000)
                     /locus_tag="BSVBI22_B0464"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(453923..453940)
                     /locus_tag="BSVBI22_B0464"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(453905..453916)
                     /locus_tag="BSVBI22_B0464"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(453818..453838)
                     /locus_tag="BSVBI22_B0464"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            complement(454433..455455)
                     /locus_tag="BSVBI22_B0465"
                     /db_xref="GeneID:11686609"
     CDS             complement(454433..455455)
                     /locus_tag="BSVBI22_B0465"
                     /note="identified by match to PFAM protein family HMM
                     PF00497"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, periplasmic substrate-binding
                     protein"
                     /protein_id="YP_005108473.1"
                     /db_xref="GI:376278440"
                     /db_xref="GeneID:11686609"
                     /translation="MKFSLNRRQALLGMGAAGAAVAFGFPARAATRNLAVLHLASHAP
                     SFIAHERGYFKDAGLDIELKFFEAAQPSAVAIASGDADFGVTAMSGGLISLAQKGAVK
                     VIGGALIEEKGVVGAIILASNKAYDAGLTDPSRLAGKTFGITTAGSSFHFMAHKIAQA
                     NNIDLKQIQLRPLQKLGAVVGALSSGQIDAWAIQPNIAKKLIREGAARQIGLVADYAP
                     NYQVTTAFTSTRNATDERALTEAFVKAYSRAIDDYNAAFVDNKTDDAERDALARIVHK
                     YVESDSPFDTARQNLIDGAMRINPGLALALDSCVEQLDWFKSEGMVKDSITNEQLFDT
                     FYVKTI"
     misc_feature    complement(454442..455335)
                     /locus_tag="BSVBI22_B0465"
                     /note="ABC transporter, substrate-binding protein,
                     aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
                     /db_xref="CDD:130789"
     misc_feature    complement(454700..455332)
                     /locus_tag="BSVBI22_B0465"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            455802..456306
                     /locus_tag="BSVBI22_B0466"
                     /note="This region contains an authentic frame shift and
                     is not the result of a sequencing artifact;
                     transcriptional regulator, MarR family, authentic
                     frameshift; similar to GP:15074064, and GP:15074064;
                     identified by sequence similarity; putative"
                     /db_xref="GeneID:11686610"
     gene            456313..457944
                     /locus_tag="BSVBI22_B0467"
                     /db_xref="GeneID:11686611"
     CDS             456313..457944
                     /locus_tag="BSVBI22_B0467"
                     /note="similar to GP:15074065; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, putative"
                     /protein_id="YP_005108474.1"
                     /db_xref="GI:376278441"
                     /db_xref="GeneID:11686611"
                     /translation="MPDARDDKKEAPEAAPAAPQPAHMPLYMSIIYIAASMLLWSTRG
                     LSMYFISANTQQIQGSLGATLTETTWLVAAYMAPFASLTILLLKIRTQFGLRRFAEVA
                     IAVFLVASLLHLLVYDVWSAIPVRFIAGAAAVPISSVGFLYMLEAFPPDKKRTWGLSL
                     ALTCSGAAGPFARIISPMLFDIGQWQQLYMLEIGLALACFAVVYVLPLTQIPRAKVLH
                     WLDFVAYTFIAIGFGALVVVLVQGKNYWWFEAPWIGVCLAISILSLAIAAAIELNRDQ
                     PLMNLHWLASPEILRFTLILLVFRMVLAEQTSGALGLFQVFGLQDAQSKGLYTLILLA
                     SFAGGITCGALLKVERVPVIFGFALLCIAVGAFLDSHATNLTRPHNVYVSQGLIAFGG
                     ALFLPPAMLAGITKAMKQGPAYMTSFIVVFLFTQNIGGLIGSALFSTFISIREKYHSA
                     HLVEQLVMSDPLVAQRVQALSGTYAKVLADQGLTKAEGLVLLGQQVTKEATILSYNDA
                     FLAISVIAVIALCCQVTYRVYEAFRARRSALAVMS"
     misc_feature    456409..>457134
                     /locus_tag="BSVBI22_B0467"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(456451..456453,456460..456468,456472..456477,
                     456526..456528,456535..456540,456547..456549,
                     456559..456564,456568..456573,456709..456714,
                     456721..456726,456733..456738,456745..456747,
                     456784..456789,456796..456801,456817..456819,
                     456985..456987,456994..456999,457006..457011,
                     457018..457020,457060..457062,457072..457074,
                     457084..457086,457093..457095,457105..457107)
                     /locus_tag="BSVBI22_B0467"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    456481..457872
                     /locus_tag="BSVBI22_B0467"
                     /note="drug resistance transporter, EmrB/QacA subfamily;
                     Region: efflux_EmrB; TIGR00711"
                     /db_xref="CDD:129794"
     gene            457969..459018
                     /locus_tag="BSVBI22_B0468"
                     /db_xref="GeneID:11686612"
     CDS             457969..459018
                     /locus_tag="BSVBI22_B0468"
                     /note="similar to GP:15156118; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="YP_005108475.1"
                     /db_xref="GI:376278442"
                     /db_xref="GeneID:11686612"
                     /translation="MSVSKKYIRGGFAILIGLLGVFIILWAWQLPPFKHSVETTDNAY
                     VRGQVTVMSPQVSGYITKVNVTDYEQVKKGDLLFEIDSRSYQQKLDQALAALDSKKAA
                     LANSEQSQRSAEATIKAREAQISGAKAALEVAKANTVRVDALLPRGVTTQSSADTAHG
                     NMLQAQAAVDQAEAALAVAKEDLRTIIVAREGLNADLHNAEAAVALARIDLQNTKILA
                     PRDGKLGEVGVRLGQYVTAGTQLVSLVPAVKWIMANFKETQLYGMKVGQPVTLTVDAL
                     RHAELKGHIEAFSPATGSEFSVIKSDNATGNFTKITQRLSVRISIDEGQPDAELLAPG
                     MSVVVRVDTASTPDK"
     misc_feature    457969..459012
                     /locus_tag="BSVBI22_B0468"
                     /note="Multidrug resistance efflux pump [Defense
                     mechanisms]; Region: EmrA; COG1566"
                     /db_xref="CDD:224482"
     misc_feature    458110..458259
                     /locus_tag="BSVBI22_B0468"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    458611..458868
                     /locus_tag="BSVBI22_B0468"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(459090..460514)
                     /locus_tag="BSVBI22_B0469"
                     /db_xref="GeneID:11686613"
     CDS             complement(459090..460514)
                     /locus_tag="BSVBI22_B0469"
                     /note="identified by match to TIGR protein family HMM
                     TIGR01386"
                     /codon_start=1
                     /transl_table=11
                     /product="osmolarity sensor protein EnvZ, putative"
                     /protein_id="YP_005108476.1"
                     /db_xref="GI:376278443"
                     /db_xref="GeneID:11686613"
                     /translation="MRLPLPHSLPIWLLTILISGLLTTQIATLWIVSQDRADANNALE
                     LFRLSERATYLVKLLHATPPDDWNNLAIRVSGSGEAMNITSEPDVTTALASENDLAEL
                     EDVLVARLTRYGVVDARIRRDTTGYRLPKEETAVHDSTEMGIIEKQIDSLAATTRSGA
                     SPTTSLQFNDGRWLNFITHITPIDPIVTSDTIPLFTLVALCVILGAIWATQRLIAPYR
                     ILEDAIDRIGGDLKSPPLPETGIREYTAAARAVNSMQARLLDYVAEREQLAAALAHDL
                     RTPLTRMKLRMELLDDDALRQSLSRDLNDIEAISRSVIDFATSELAHEKAERLDLWSL
                     LLSVADKYPQVSLDEKGSDYRDAICLCQPISIQRCITNLIDNALAYGGKVRLSLHRDG
                     DDLLLRIKDNGPGISPERIEEMFKPFSRADKSRNRESGGFGLGLTIARNIARKNGGEI
                     SLRNDPAGGLIAELRLPGSRLMPR"
     misc_feature    complement(459114..459998)
                     /locus_tag="BSVBI22_B0469"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(459735..459941)
                     /locus_tag="BSVBI22_B0469"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(<459576..459728)
                     /locus_tag="BSVBI22_B0469"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(459579..459581,459588..459590,
                     459606..459608,459657..459659,459666..459668,
                     459678..459680,459687..459689,459699..459701,
                     459711..459713))
                     /locus_tag="BSVBI22_B0469"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(459693..459695)
                     /locus_tag="BSVBI22_B0469"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(459117..459419)
                     /locus_tag="BSVBI22_B0469"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(459129..459131,459135..459140,
                     459153..459155,459159..459161,459207..459218,
                     459297..459302,459306..459308,459312..459314,
                     459318..459320,459387..459389,459399..459401))
                     /locus_tag="BSVBI22_B0469"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(459387..459389)
                     /locus_tag="BSVBI22_B0469"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(459210..459212,459216..459218,
                     459300..459302,459306..459308))
                     /locus_tag="BSVBI22_B0469"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(460511..461227)
                     /locus_tag="BSVBI22_B0470"
                     /db_xref="GeneID:11686614"
     CDS             complement(460511..461227)
                     /locus_tag="BSVBI22_B0470"
                     /note="similar to GP:14023190; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulatory protein OmpR,
                     putative"
                     /protein_id="YP_005108477.1"
                     /db_xref="GI:376278444"
                     /db_xref="GeneID:11686614"
                     /translation="MKEDAHILIVDDDKDIRDLLHEFLKRRGMHVSIACNGDEMLDVL
                     SRTPIDLVILDVMLPGKSGIEICQDVRRTSRVPIIMLTAIADAADKILGLEIGADDYI
                     AKPFDPRELLARIRAVLRRFEGNRSPQRALTQIYRFAGWTLDCARRRLTSPHDVRVEL
                     TTAEFNLLEAFVKSSQHILSRDQLMEMAGHQAVYGYDRSVDILISRLRKKLEDDPCAP
                     KLILTIRGGGYQFGHEVEIA"
     misc_feature    complement(460526..461212)
                     /locus_tag="BSVBI22_B0470"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(460871..461206)
                     /locus_tag="BSVBI22_B0470"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(460913..460918,460925..460927,
                     460982..460984,461039..461041,461063..461065,
                     461192..461197))
                     /locus_tag="BSVBI22_B0470"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(461063..461065)
                     /locus_tag="BSVBI22_B0470"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(461039..461047,461051..461056))
                     /locus_tag="BSVBI22_B0470"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(460910..460918)
                     /locus_tag="BSVBI22_B0470"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(460535..460819)
                     /locus_tag="BSVBI22_B0470"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(460544..460546,460559..460561,
                     460595..460600,460622..460624,460631..460633,
                     460685..460690,460745..460747))
                     /locus_tag="BSVBI22_B0470"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(461421..461567)
                     /locus_tag="BSVBI22_B0471"
                     /db_xref="GeneID:11686615"
     CDS             complement(461421..461567)
                     /locus_tag="BSVBI22_B0471"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108478.1"
                     /db_xref="GI:376278445"
                     /db_xref="GeneID:11686615"
                     /translation="MIELNMRSLRYWVRFQFLKQTLYDIASLLVFFANVAFCFSIVAQ
                     ANAA"
     gene            461551..461916
                     /locus_tag="BSVBI22_B0472"
                     /db_xref="GeneID:11686616"
     CDS             461551..461916
                     /locus_tag="BSVBI22_B0472"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108479.1"
                     /db_xref="GI:376278446"
                     /db_xref="GeneID:11686616"
                     /translation="MFNSINTSKAAAGFVFWVLCAASITLPSLPHEAGAAPLVTRSQR
                     CERLKHQLQTALSGHVKIGRVHQVEVLQRRRARFCASKRQAQGLRAYAEALKLLGVKP
                     DMAEPGTQGRSIPPSGTSK"
     gene            461928..462080
                     /locus_tag="BSVBI22_B0473"
                     /db_xref="GeneID:11686617"
     CDS             461928..462080
                     /locus_tag="BSVBI22_B0473"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108480.1"
                     /db_xref="GI:376278447"
                     /db_xref="GeneID:11686617"
                     /translation="MKKSLISALGLAVVLGLSAPVLAASSDTVPAAVMTPAKNIKQGQ
                     TMTARW"
     gene            462340..462690
                     /locus_tag="BSVBI22_B0474"
                     /db_xref="GeneID:11686618"
     CDS             462340..462690
                     /locus_tag="BSVBI22_B0474"
                     /note="similar to GP:14026911; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108481.1"
                     /db_xref="GI:376278448"
                     /db_xref="GeneID:11686618"
                     /translation="MAEVSLKRIYEEPSPQDGYRVLVDRVWPRGMTKEKARIDVWAKD
                     IAPSTELRKWFGHDPAKWGDFQKKYREELESKLPALKDLLAGAGGRHITLLYGAKDEE
                     HNQAVVLHNFMEKL"
     misc_feature    462340..462687
                     /locus_tag="BSVBI22_B0474"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3189"
                     /db_xref="CDD:225730"
     gene            complement(462813..464087)
                     /locus_tag="BSVBI22_B0475"
                     /db_xref="GeneID:11686619"
     CDS             complement(462813..464087)
                     /locus_tag="BSVBI22_B0475"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="YP_005108482.1"
                     /db_xref="GI:376278449"
                     /db_xref="GeneID:11686619"
                     /translation="MDAANSPHIVVVGAGFGGLQLIRDLDGAKVRITLIDQRNHHLFQ
                     PLLYQVATTILSTSEIAWPIRNLFRDRAEVTTLLGTVIDVDTARKSVFLENGDEVSYD
                     MLVLATGARHAYFGNDQWEKLAPGLKALEDATTIRRRLLLAFERAEREPDMARRQALL
                     TFSIVGGGPTGVELAGIIAELARRTLWPEFRNIDTRQARVLLLEAGPRILSAFPEDLS
                     AYARRALEKLGVEVRLGIPVKDITQEGVTVGDEFIPCHTTVWAAGVAASPAALWLDAE
                     SDRAGRVKVLSNLSVPGHEDIFAIGDTAWVEGDDGRPVPGIAPAAKQQGAYVAKVIRS
                     RVENKTPPLPFRYKHQGNLATIGKGAAVVDMGRIRLKGTIAWWFWGIAHIFFLIGTRS
                     RAAVAWSWLWTYITGQHSARLITQGKPSDEFR"
     misc_feature    complement(462855..464075)
                     /locus_tag="BSVBI22_B0475"
                     /note="NADH dehydrogenase, FAD-containing subunit [Energy
                     production and conversion]; Region: Ndh; COG1252"
                     /db_xref="CDD:224172"
     misc_feature    complement(463332..463598)
                     /locus_tag="BSVBI22_B0475"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            complement(464170..464619)
                     /locus_tag="BSVBI22_B0476"
                     /db_xref="GeneID:11686620"
     CDS             complement(464170..464619)
                     /locus_tag="BSVBI22_B0476"
                     /note="similar to GP:15155841; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_005108483.1"
                     /db_xref="GI:376278450"
                     /db_xref="GeneID:11686620"
                     /translation="MSNGPEIPFETTLFVRDTCLCLHVQRAARALARLFDEALRPAGL
                     TNGQFSLMMSLNRPSPPPMKPVAELLAMDQTTLTAALKPLQRRGWVEILVNPADRRER
                     LLQLTAEGKAVLASAVPIWTATHAQIEARLAGGNGDALRHDLIMLSS"
     misc_feature    complement(464224..464544)
                     /locus_tag="BSVBI22_B0476"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(464224..464511)
                     /locus_tag="BSVBI22_B0476"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            464901..465680
                     /locus_tag="BSVBI22_B0477"
                     /db_xref="GeneID:11686621"
     CDS             464901..465680
                     /locus_tag="BSVBI22_B0477"
                     /note="similar to GP:15075862; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase, putative"
                     /protein_id="YP_005108484.1"
                     /db_xref="GI:376278451"
                     /db_xref="GeneID:11686621"
                     /translation="MKNGGSPFVWYELMTSDAKQAQDFYSKVIGWTAKDAGMPGMKHT
                     LFDALGCTIAGMMALSDLPGEGCMDARPGWLGYIGVADVDAAAEKVMAEGGKILRAAG
                     DIPGVGRFAVAADPQGAMFSLYSPKADMEPPADFGSRKVGHPSWHELYARDGEAVFPF
                     YEKVFGWKLSRDFDMGSMGKYKVFSVDGADMGGIMTAPPGAENGWGFYFMVDGVGAAA
                     ARIKSLGGTVLAGPMEVPNGEWVIKCCDPQNVSFSLVSAKE"
     misc_feature    464922..465275
                     /locus_tag="BSVBI22_B0477"
                     /note="N-terminal domain of Streptomyces griseus SgaA
                     (suppression of growth disturbance caused by A-factor at a
                     high concentration under high osmolality during early
                     growth phase), and similar domains; Region: SgaA_N_like;
                     cd07247"
                     /db_xref="CDD:176671"
     misc_feature    465330..465668
                     /locus_tag="BSVBI22_B0477"
                     /note="N-terminal domain of Streptomyces griseus SgaA
                     (suppression of growth disturbance caused by A-factor at a
                     high concentration under high osmolality during early
                     growth phase), and similar domains; Region: SgaA_N_like;
                     cd07247"
                     /db_xref="CDD:176671"
     gene            complement(465744..465914)
                     /locus_tag="BSVBI22_B0478"
                     /db_xref="GeneID:11686622"
     CDS             complement(465744..465914)
                     /locus_tag="BSVBI22_B0478"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108485.1"
                     /db_xref="GI:376278452"
                     /db_xref="GeneID:11686622"
                     /translation="MQPRVSLHAPPVLRATAGGREASMSNIIFWTALVVVPILVGTAY
                     AYLRHFHHEDDF"
     gene            complement(465961..467394)
                     /locus_tag="BSVBI22_B0479"
                     /db_xref="GeneID:11686623"
     CDS             complement(465961..467394)
                     /locus_tag="BSVBI22_B0479"
                     /note="similar to GP:15074955; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid carrier family protein"
                     /protein_id="YP_005108486.1"
                     /db_xref="GI:376278453"
                     /db_xref="GeneID:11686623"
                     /translation="MATIIDFLNNVFWNYVLVYGLLAVGLFFTIRLKFVQFVHFPELF
                     RVVFAAGRRDEAGISPFQALTISIASRVGTGNITGVAVALYLGGPGAIFWMWIVALVG
                     LATAYSESALAQLYKIRSQDGQYRGGPAFYIARGLGLPWAGALFSICLILSFGLVFNA
                     VQANAIADSMVMAFNMPKLGTGIVLAILSDVVIFGGIRQIARVAEVVVPFMAFAYILM
                     AICILAINFQAVPSTIALIFSSAFGLHEAVGGVTGGITAAMLNGVKRGLFSNEAGMGS
                     APNTAAVATPAPHHPSSQGFVQSLGVFIDTILVCTATAIMILLSGILEPGSGLTGTQL
                     TQMAMTHHIGDVGVYFIAAAIFFFAFTSIIGNYSYAESAMTFLGLGGKVPITILRCAL
                     LAMVVWGAYESIHTVFDAADASMGPMATINLIAIVLLSGTVKKLTVDYFAQRRAGQFL
                     TFHAADYPELQGQIDMEIWSEQNTTNK"
     misc_feature    complement(466051..467394)
                     /locus_tag="BSVBI22_B0479"
                     /note="Na+/alanine symporter [Amino acid transport and
                     metabolism]; Region: AlsT; COG1115"
                     /db_xref="CDD:224040"
     gene            467408..467665
                     /locus_tag="BSVBI22_B0480"
                     /db_xref="GeneID:11686624"
     CDS             467408..467665
                     /locus_tag="BSVBI22_B0480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005108487.1"
                     /db_xref="GI:376278454"
                     /db_xref="GeneID:11686624"
                     /translation="MVGRFNDNHGLLSSPDGNFDFDNVERARWLSTRAEIKSEYKIAG
                     AGYRNACGRSDFAFGKCSQTSMELLLARFCQNTIASHGEFE"
     gene            467822..468742
                     /gene="metA"
                     /locus_tag="BSVBI22_B0481"
                     /db_xref="GeneID:11686625"
     CDS             467822..468742
                     /gene="metA"
                     /locus_tag="BSVBI22_B0481"
                     /note="catalyzes the formation of O-succinyl-L-homoserine
                     from succinyl-CoA and L-homoserine in methionine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-succinyltransferase"
                     /protein_id="YP_005108488.1"
                     /db_xref="GI:376278455"
                     /db_xref="GeneID:11686625"
                     /translation="MPIKIPDDLPATSVLEAEGVMVMREADAVRQDIRPLRIGLLNLM
                     PNKVTTETQIARLLGATPLQVELTLVRMTNHVARHTPADHMLSFYCPWEEVNDQRFDG
                     FVITGAPVERLPFEEVTYWDEMRRVFDWTQSHVHRTLNICWAAQAAVYHFHGMKKYDL
                     PAKASGVFRQRSLVPASPYLRGFSDDFAIPVSRWTEVRKSDIPADSGLKVLVDSTETG
                     LCLLDDPRHRSLHMFNHVEYDTTSLADEYFRDIQVQPEAKVPVNYFPGDDAKRPPENR
                     WRSHAHLLFGNWINEMYQSTPYDIERIGKV"
     misc_feature    467933..468460
                     /gene="metA"
                     /locus_tag="BSVBI22_B0481"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in homoserine trans-succinylase (HTS);
                     Region: GATase1_HTS; cd03131"
                     /db_xref="CDD:153225"
     misc_feature    467960..467962
                     /gene="metA"
                     /locus_tag="BSVBI22_B0481"
                     /note="proposed active site lysine [active]"
                     /db_xref="CDD:153225"
     misc_feature    468245..468247
                     /gene="metA"
                     /locus_tag="BSVBI22_B0481"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153225"
     gene            complement(468810..469799)
                     /locus_tag="BSVBI22_B0482"
                     /db_xref="GeneID:11686626"
     CDS             complement(468810..469799)
                     /locus_tag="BSVBI22_B0482"
                     /note="similar to GP:15140555; identified by sequence
                     similarity; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="glucosyl hydrolase family protein"
                     /protein_id="YP_005108489.1"
                     /db_xref="GI:376278456"
                     /db_xref="GeneID:11686626"
                     /translation="MLQPQPSAETTSSIVWPVPPAPVHELASAPEVSVPQPREEILAW
                     AGPIPDAIPNAGPFKAEPPVPIAPQPEQRPVARISVPKPEIAAYPPVRLSQPQRTKIY
                     SHRFRDAKPINFGRASPRKLAVHGVDVSRWQGDIDWVKLRTQGANFAYIKATDGGDHL
                     DPMFRKNWREAKAAGIKRGAYHFFYWCRVASQQADWFIRNVPNDPDALPPVIDVEWNG
                     DSSCKRRPSRAQVLEKMQIFMDKLERHYGKRPIIYTAPDFYDDNLKGTFTDYPFWLRA
                     VAQHPSKVYPGRRWLFWQYSGSGLSQGVNEKIDLNVFHGSEDEWHRWVGRVTS"
     misc_feature    complement(468825..469553)
                     /locus_tag="BSVBI22_B0482"
                     /note="Lyzozyme M1 (1,4-beta-N-acetylmuramidase) [Cell
                     envelope biogenesis, outer membrane]; Region: Acm;
                     COG3757"
                     /db_xref="CDD:226280"
     misc_feature    complement(468855..469433)
                     /locus_tag="BSVBI22_B0482"
                     /note="Uncharacterized bacterial muramidase containing a
                     glycosyl hydrolase family 25 (GH25) catalytic domain.
                     Endo-N-acetylmuramidases are lysozymes (also referred to
                     as peptidoglycan hydrolases) that degrade bacterial cell
                     walls by catalyzing the hydrolysis...; Region:
                     GH25_muramidase_1; cd06413"
                     /db_xref="CDD:119375"
     misc_feature    complement(order(468873..468875,468918..468920,
                     468981..468983,469041..469043,469155..469157,
                     469161..469163,469