GenomeNet

Database: RefSeq
Entry: NC_016775
LinkDB: NC_016775
Original site: NC_016775 
LOCUS       NC_016775            1207451 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Brucella suis VBI22 chromosome II, complete sequence.
ACCESSION   NC_016775
VERSION     NC_016775.1  GI:376277991
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN01093721
            Assembly: GCF_000236255.1
KEYWORDS    RefSeq.
SOURCE      Brucella suis VBI22
  ORGANISM  Brucella suis VBI22
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Brucellaceae; Brucella.
REFERENCE   1  (bases 1 to 1207451)
  AUTHORS   Tae,H., Shallom,S., Settlage,R., Hawkins,G.N., Adams,L.G. and
            Garner,H.R.
  TITLE     Complete genome sequence of Brucella suis VBI22, isolated from
            bovine milk
  JOURNAL   J. Bacteriol. 194 (4), 910 (2012)
   PUBMED   22275106
REFERENCE   2  (bases 1 to 1207451)
  AUTHORS   Tae,H., Shallom,S., Settlage,R., Hawkins,G.N., Adams,L.G. and
            Garner,H.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-NOV-2011) Virginia Bioinformatics Institute, Virginia
            Tech, Washington Street, MC 0477, Blacksburg, VA 24061, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            DNA material is available from Dr. Gregory Hawkins at Texas Animal
            Health Commission.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 01/10/2015 14:54:07
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 455327)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 3,147
            CDS                          :: 3,030
            Pseudo Genes                 :: 52
            rRNAs                        :: 9 ( 5S, 16S, 23S )
            tRNAs                        :: 55
            ncRNA                        :: 1
            Frameshifted Genes           :: 38
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1207451
                     /organism="Brucella suis VBI22"
                     /mol_type="genomic DNA"
                     /strain="VBI22"
                     /db_xref="taxon:1112912"
                     /chromosome="II"
     gene            155..1348
                     /locus_tag="BSVBI22_RS10080"
                     /old_locus_tag="BSVBI22_B0001"
     CDS             155..1348
                     /locus_tag="BSVBI22_RS10080"
                     /old_locus_tag="BSVBI22_B0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006090962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="WP_002966577.1"
                     /db_xref="GI:489056440"
                     /translation="MEIQLASTPFGSRRMSFALLAAQKKARQIPQGAAADKWQLHRWL
                     CEAKTILGINDRSLAVLSALLSFYPEVTLTGEGNLVVFPSNKQLALRAHGMADATLRR
                     HLAALVEAGLIARQDSPNGKRYARRAKGGELQIAFGFSLAPLLARAPEFEAAAEEIKT
                     AKAQLREMREQLTLLRRDIAKLIEFALIEGLEGPWAHLNQRFRDIVEAIPRRADVQEL
                     AMLVEQMREIRENVDKLLKTNKKAENLSGNESQNERQLNESKPDSHFDETALSHEDQR
                     VFENSQVQKEPSISLDMVLRACPEIETYASGSIRIWQDLIETAGKVRIFLGIDNKLYD
                     MATKTLGIHNAAITIAYILQRYDHIRSAGGYLRILSEKAASGAFSIKPLMMSAMCNRK
                     QPARC"
     gene            complement(1581..1781)
                     /locus_tag="BSVBI22_RS10085"
     CDS             complement(1581..1781)
                     /locus_tag="BSVBI22_RS10085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966575.1"
                     /db_xref="GI:489056438"
                     /translation="MINDLTDEIFWVFTIGCCILFFLRLLSPPGAEKFKLKAGDIPEP
                     RRRFRRRTFKSRLHARRRLEMK"
     gene            2092..3033
                     /locus_tag="BSVBI22_RS10090"
                     /old_locus_tag="BSVBI22_B0005"
     CDS             2092..3033
                     /locus_tag="BSVBI22_RS10090"
                     /old_locus_tag="BSVBI22_B0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="WP_004688787.1"
                     /db_xref="GI:490826697"
                     /translation="MSHGEAPLKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLG
                     GKGANQAVAVAKLGGAIRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAI
                     IQVEETGQNTIAVCAGANARWSSADIDAYGADIAKARITLLQREVPHEANLAVAKAVR
                     AAGGTVLLDPAPVGDASQMADLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLL
                     ERGPKIVILKLGSRGALLVTADEVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPL
                     HDCVRYGSAAGAIAVTRVGAGAAAPTAREVEELIGRA"
     gene            complement(3110..4045)
                     /locus_tag="BSVBI22_RS10095"
                     /old_locus_tag="BSVBI22_B0006"
     CDS             complement(3110..4045)
                     /locus_tag="BSVBI22_RS10095"
                     /old_locus_tag="BSVBI22_B0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006107699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004688788.1"
                     /db_xref="GI:490826698"
                     /translation="MARKIIIDTDPGQDDAVAILLALASPELDILGITAVAGNGPLAR
                     TEVNARTVCEVAKKPDTKVFAGSIRPLVRPLVTAENVHGKTGLDGYDLPAPTMPLQAQ
                     HGVDFIIETLMKEEPGTVTLCPIGPLTNIASALIREPKIAGRVKEIVLMGGGYFEGGN
                     ITPSAEFNIYVDPHAASVVFSSGIKITMLPLDVTHKVLTTEKRIAAIRNIGSHVGEVV
                     AAWLEFFERYDEAKYGTDGAPLHDPNVIAYLIKPELYSGRACNVEIEINSELTIGETV
                     VDWWEVTDRPKNAFFIKDVDADGFFSLLTERLATL"
     gene            complement(4131..5042)
                     /locus_tag="BSVBI22_RS10100"
                     /old_locus_tag="BSVBI22_B0007"
     CDS             complement(4131..5042)
                     /locus_tag="BSVBI22_RS10100"
                     /old_locus_tag="BSVBI22_B0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002966572.1"
                     /db_xref="GI:489056435"
                     /translation="MTTVLAQILDPHFIGTILRVATPLLLAALGVMISDRAGVLNIGM
                     EGMMLVAALIAVLASAATGSPAVGLLAALVVGALLGWLMSLSVNRLGTDLIMTGIALN
                     IAAAAATTLGLYLATGDKGMSGALKSGALPSLAVPFIGNIHVLTFAALLAVPAVSLLM
                     MRTRFGLHLRATGVDPKSARAAGIQTGRVQMMALILSGLFGGAAGAYLSLGYVTWFAQ
                     NMTAGRGFIAIAAEVMGQGTAWGTLVASLVLAAAESIAITLQSLGLPFELMQMIPYLV
                     PVIVLTVHAARRQRRARRQITPETQET"
     gene            complement(5039..6118)
                     /locus_tag="BSVBI22_RS10105"
                     /old_locus_tag="BSVBI22_B0008"
     CDS             complement(5039..6118)
                     /locus_tag="BSVBI22_RS10105"
                     /old_locus_tag="BSVBI22_B0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002966571.1"
                     /db_xref="GI:489056434"
                     /translation="MRRFIAYLIPFFLTVLVIGVIMAVLLVPLALMQDNPAAILKTFF
                     LGPFGSIRHMGNVVEAATPIMLTGLAITILFRSGLFNLGAESGFFLGALGAVAGAVLL
                     PSLGWFSLPVAILCGAVAGSFACTIPAALRLRFGASEMVTSLVLNYAFLFLGLFVLNY
                     VIRDPNAGGMMSLRIPADAKLDRLLAGTRLNSGSIIAVLACIAGGIWLYWTRSGLNIR
                     IAGSSPGFANHLGLPLKGIIMRAQIVGGLVAGMAGALEVLGLHARFAWLDLPGYGWTG
                     LVVAILARENPFLLIPSALFLGFVQVGGDLLARNMNIPTEVVGLVTAAIMVGATASVI
                     HNHPTVLRLIRSLRNRDGEQAGVQA"
     gene            complement(6180..7751)
                     /locus_tag="BSVBI22_RS10110"
                     /old_locus_tag="BSVBI22_B0009"
     CDS             complement(6180..7751)
                     /locus_tag="BSVBI22_RS10110"
                     /old_locus_tag="BSVBI22_B0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_006191556.1"
                     /db_xref="GI:493203393"
                     /translation="MEKQAETSEGGDAIVAFRPIVAFRDVSKIYPNGTVALRDVSFSI
                     RAGSIHAICGENGAGKSTLMKILFGIENATAGEIVVDGKHIASWSPEDAAAQGIGMVH
                     QHFSLVPTLTVTENIILGHEPVKAGLIDRAGARKMVETLMQQYDLHADPDAITGTLSV
                     AAQQKVEILKALARRTRLLILDEPTAVLSPPEIEELMRRLKSLRDDGITILFISHKLN
                     EVRELAESVTVLRAGAVAGTEKLADVPDDAIMQMVMGHAVDIPKRAHQRGPGRTVLEM
                     KDVTTAAPDPADRIRNVSLTIGAGEIIGVAGVDGSGQRGLVSVLSGLAVAASGTISLN
                     GVDMLRADTASWRKKGLAYLPADRFSQGGAPGLSLAENAIAGAGSVTADRQIFRGPFL
                     RWSAIKARVSGMIRQYSVRAGAITERLDSLSGGNAQKLIAARELATNPKFLIADQPTR
                     GIDVSAAAFLHRRIDEVAQGGCAVLLVSADLDELLRLSDHIVVLFNGRIATILDNGPE
                     ITPAVLGPYMLGTRA"
     gene            complement(7754..8860)
                     /locus_tag="BSVBI22_RS10115"
                     /old_locus_tag="BSVBI22_B0010"
     CDS             complement(7754..8860)
                     /locus_tag="BSVBI22_RS10115"
                     /old_locus_tag="BSVBI22_B0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine nucleotide translocator 1"
                     /protein_id="WP_006014901.1"
                     /db_xref="GI:492865029"
                     /translation="MIKSTRRGIIHLAFALAASTAIGTFATSAAEAKDKIMLIVNGTL
                     GDKSFFDSAANGMKMIKDKYGDEVETRILEIGDDPTKWEPVLLDASEQDWDLIIAGTY
                     QMAETVGSVAQQYPDKKYILYDASVPYEEGGYDNVYSIQYKQNEGSYLGGLLAASLLK
                     EGKLGDGAKNLGFLGGMDIPVINDFLVGYIAGAQSVIPDAKIAVSYAGSFMDAAKGKE
                     LGLAQYRSGVSLGFVVASQTGLGQLSAAKETGKYVLGVDSDQEAIFKDSDPAIAKQVV
                     SSVLKNIDVSLLQAYERYKAGNLPFGKAEALGLKEGAVGIVQDGNMATMATPDIKDAI
                     KKASDEISEGKITVPTAFGMSTEDLNAIRNKVRP"
     gene            9104..9712
                     /locus_tag="BSVBI22_RS10120"
                     /old_locus_tag="BSVBI22_B0011"
     CDS             9104..9712
                     /locus_tag="BSVBI22_RS10120"
                     /old_locus_tag="BSVBI22_B0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_004687598.1"
                     /db_xref="GI:490825508"
                     /translation="MRKAAVLSVLGFLAASQVMVENGWAEDGWKAVEIVKPYAIAGTT
                     PPELYESIGARGPKIGERRVIAHTSYVLTWDREFDRSNGACTVVSATPRLRITYTLPN
                     PSQTLAPPVKERWDRFYDGIRRHELVHGDHAKAMTREIVRRTVGLSVPNDPKCRKIRK
                     VLAKEITDMVQVQRAQGRDFDHVEMGNGGNVQQLILTFLNGN"
     gene            complement(9684..10424)
                     /locus_tag="BSVBI22_RS10125"
                     /old_locus_tag="BSVBI22_B0012"
     CDS             complement(9684..10424)
                     /locus_tag="BSVBI22_RS10125"
                     /old_locus_tag="BSVBI22_B0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="WP_002967156.1"
                     /db_xref="GI:489057032"
                     /translation="MAEQPLAHETAWLAPGAHGVSVITPWADLAADCCFVMARYSASK
                     PLIDPSIPAPARAAPRRKAEFVAGQACAREALRLAGGPAVMPGRGDDHAPIWPPGMVG
                     SISHSKGCAIAVAARQSRYLGLGIDIERLQTESSARKIAPQILGESELRQLPEAGRAF
                     LVSLAFSAKESLFKALYPAVQQFQSFHAAAFSFDGDRQQACLELAVDWSAQWRRGQRF
                     PIRFFCRDGFILTCTAIAAISCRSEMSG"
     gene            complement(10399..11175)
                     /locus_tag="BSVBI22_RS10130"
                     /old_locus_tag="BSVBI22_B0013"
     CDS             complement(10399..11175)
                     /locus_tag="BSVBI22_RS10130"
                     /old_locus_tag="BSVBI22_B0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-dihydroxybenzoate-2,3-dehydrogenase"
                     /protein_id="WP_004688790.1"
                     /db_xref="GI:490826700"
                     /translation="MVEAKSYPASWRFAGKRVIVTGAAQGIGRRVAERFLAEGATVIG
                     LDRQAGEADAPFRLIRLDITDAAEVRAVSDGLKAEGKPLDILVNVAGVLKLGNSDRLS
                     AEDWKTCMDVNASGPFHLLSQWVPVFRDQRHGAIVNVASNAAHVPRLNMAAYCASKAA
                     LASFSHCVALELAPYGVRCNVVSPGSTRTAMLGAMLNDPSGEAQLVRGLPEQFKLGIP
                     LGKIAMPDDIANVILFLASDQAGHVTMQDIVVDGGATLGA"
     gene            complement(11175..12047)
                     /locus_tag="BSVBI22_RS10135"
                     /old_locus_tag="BSVBI22_B0014"
     CDS             complement(11175..12047)
                     /locus_tag="BSVBI22_RS10135"
                     /old_locus_tag="BSVBI22_B0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006172413.1"
                     /note="2,3 dihydro-2,3 dihydroxybenzoate synthase;
                     catalyzes the formation of 2,3 dihydro-2,3
                     dihydroxybenzoate and pyruvate from isochorismate; with
                     Ent DEF is involved in enterobactin synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase"
                     /protein_id="WP_006191557.1"
                     /db_xref="GI:493203394"
                     /translation="MAIPKIADYPMPQKAGFPANKTNWQPDPARAVLLIHDMQRYFLR
                     FYDANGPLMGDLIGNLVRLRNWAHKNGVPVVYTAQPHEQPAGDRALLNDMWGPGLPAA
                     APEQQLIVDKLTPGATDTVLAKWRYSAFQRSDLLQRMKDWNRDQLIIGGIYAHIGCMV
                     TAIDAFMNDIQPFMVGDAVADFSEEEHRLALKYVATRCGAVIDTASLIRKPATETTRD
                     WLQKRVLELIEDETELDPQENLILYGLDSLQVMKLSAELKERGVAVGFDDLARVPTLA
                     AWGDLIETKQKAAA"
     gene            complement(12099..13718)
                     /gene="entE"
                     /locus_tag="BSVBI22_RS10140"
                     /old_locus_tag="BSVBI22_B0015"
     CDS             complement(12099..13718)
                     /gene="entE"
                     /locus_tag="BSVBI22_RS10140"
                     /old_locus_tag="BSVBI22_B0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005507.1"
                     /note="bifunctional 2,3-dihydroxybenzoate-AMP
                     ligase/S-dihydroxybenzoyltransferase; activates the
                     carboxylate group of 2,3-dihydroxy-benzoate forming
                     (2,3-dihydroxybenzoyl)adenylate then catalyzes the
                     acylation of holo-entB with 2,3-dihydroxy-benzoate
                     adenylate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin synthase subunit E"
                     /protein_id="WP_006191558.1"
                     /db_xref="GI:493203395"
                     /translation="MTIEFTHWPPARERLYREKGYWIDKPLTRALEEQAAMRPDAPTI
                     LCGERRFTYAELDRLSSNLASRLAAAGIGKGDTALVQLPNIAEFYIVFFALMKAGIAP
                     VNALFSHRKLELGAYASQIEPRLLIGSRQHELFMDDAFARDLGKNLSAPLLTLFAGEA
                     DPASSLDHWIATPADKAVPFSPTGAGEVAFFQLSGGSTGTPKLIPRTHNDYDYSVRAS
                     AEICALTPQTRFLCALPTAHNYPMSSPGALGVFHAGGCVVMASNPEPLNCFSIIERHG
                     VNMVALVPPAVALWLQATPDHLAALSSLKLVQVGGASFAEALARQVPQVLGCKLQQVF
                     GMAEGLVNYTRLDDPDEIVFTTQGRPISPDDEIRIVDEDGEPVAEGQPGMLATRGPYT
                     FCGYYRNPEHNAQVFDSEGFYYSGDVVQRTPEGYLRVVGRVKDQINRGGEKVAAEEIE
                     NLILLHPDVTHAALVAMQDELLGEKSCAFIVSRNPDLKPPVLRRHLLALGVAEYKLPD
                     RIRLIETMPLTAVGKIDKKHLRKLSSPSSPG"
     gene            complement(13825..15000)
                     /locus_tag="BSVBI22_RS10145"
                     /old_locus_tag="BSVBI22_B0016"
     CDS             complement(13825..15000)
                     /locus_tag="BSVBI22_RS10145"
                     /old_locus_tag="BSVBI22_B0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase EntC"
                     /protein_id="WP_006191560.1"
                     /db_xref="GI:493203397"
                     /translation="MRTSALKYPTSDADHLIKNNTDFSFASGNLKLAASGMREVIATP
                     AIGGSNPDSTFQRAIAQAFERAARAGQRNPIVVGAIPFDPGEPSCLYVPEEMDWQERE
                     PASGASAAAMPQLAGQRSVPDEAGFKHAVEHAIINFRLSDVRKAVLSVMRELTFADDI
                     DVDAMLANLRAQNHDGYQFRVPLPGGGALVGVSPELLIHKDKGKIVSNPLAGSAKRMA
                     DPEADRKNADRLAKSEKDHYEHRLVIEDIRARLQPICTELDIPERPSLIHTAALWHLS
                     TRIEGRLHDPDMTALQLACLIHPTPAVCGFPTERARRLIRFVEPFERGLFTGMVGWSD
                     AEGNGEWVVTIRCGTVKGNLVRLFAGAGIVEASSPDSEWAEVQTKLGTMLRACGLSA"
     gene            15141..16481
                     /locus_tag="BSVBI22_RS10150"
                     /old_locus_tag="BSVBI22_B0017"
     CDS             15141..16481
                     /locus_tag="BSVBI22_RS10150"
                     /old_locus_tag="BSVBI22_B0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006076672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="condensation protein"
                     /protein_id="WP_002966562.1"
                     /db_xref="GI:489056425"
                     /translation="MARIDFADGWMPLTLPQLDFWEEFSFHPDQPVSTVAHCVEIEGD
                     VDVEKLLRAISQTVREAEVLSIRFSDEKEQGRPVQLCDPAHMPDVDFVDLSAFPDPRA
                     EAGRRMETDLSAPLDLRRDRMSAHALYRIGARQYIWYIRAHHIIIDGYGLALIEQRCG
                     QLYSHFCGQGESGHPFHPFASFIHEEDAYRASPRWEADRKFWQDYLDGPVRLPILDRG
                     AEDYGEAGYHHDVAFRDDISIGLRAMAKATDIGWPDLLVLLSGLYLSRMLPMQGEDEG
                     LTLWLPFMSRWGSVGAHMPGLLVNILPFHLEFDSGETLFSALRRNMDMLKKHRLHGRY
                     RIEQISADRGLVSGSRFFFSPLINVLPFSTPQFAGCRVAREVLANGPGDGFNLTYRAD
                     VDGAGLTLKIEAASNMMDAQTFARIAAGLPAFLKASLAPHLIERPVSDLRRRLP"
     gene            complement(16529..17317)
                     /locus_tag="BSVBI22_RS10155"
                     /old_locus_tag="BSVBI22_B0018"
     CDS             complement(16529..17317)
                     /locus_tag="BSVBI22_RS10155"
                     /old_locus_tag="BSVBI22_B0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_004688792.1"
                     /db_xref="GI:490826702"
                     /translation="MTGPRLSRRRFLTFTGMAGSAVLLSGCDAFDYLGSDDNAVRQVL
                     EKANDLSYTVQRKLEGPGALAREYGESEIRQGQKPNGETNPSTEEYDRLRENAFADYR
                     LEVHGLVEKPLSFSLNELHNMPARTQITRHDCVEGWSTIAKWTGVPLGHILALAKPKA
                     GAHYVVFHCFDEVDTPQGPDLFYGSIDLIDAQHPQTILAYGLNGSALPVANGAPLRVR
                     VERQLGYKMSKYVKSIELVSSFAAIQGGRGGYWEDQGYDWYGGI"
     gene            complement(17314..18123)
                     /locus_tag="BSVBI22_RS10160"
                     /old_locus_tag="BSVBI22_B0019"
     CDS             complement(17314..18123)
                     /locus_tag="BSVBI22_RS10160"
                     /old_locus_tag="BSVBI22_B0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HupC"
                     /protein_id="WP_002968213.1"
                     /db_xref="GI:489058113"
                     /translation="MGQLIYRQRLLTRLTHWIWAASIFFLLLSGLQIFNAHPTLYLGN
                     ESGFEYENAVLSIYAVPGDNGPQGRLDILGKTFDTTGVLGVSGTMETPRRQAFPPALT
                     IPSYRDLATGRVVHFFFAWVLVATLLLWFTSSLFNGHLKDISPSFTDIRSLPRDFVEH
                     LKFRFQHGKSYNPLQKLSYFLVLFGLFPLIVATGLAMSPGADSILPLSEWLGGRQTAR
                     TLHFVAMLLLVAFFIVHIAMVLAAGPFNELRSMISGWYRIDRTDEKTEKQS"
     gene            complement(18184..18405)
                     /locus_tag="BSVBI22_RS10165"
                     /old_locus_tag="BSVBI22_B0020"
     CDS             complement(18184..18405)
                     /locus_tag="BSVBI22_RS10165"
                     /old_locus_tag="BSVBI22_B0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006105287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014298099.1"
                     /db_xref="GI:504064105"
                     /translation="MTIKHNIIAFSALALIAGFSLTPAAFAEDAMKTDHMKPDAMKSD
                     NMSKDAMHKDSKKMKKHDAMKGDAMKSGQ"
     gene            18602..19114
                     /locus_tag="BSVBI22_RS10170"
                     /old_locus_tag="BSVBI22_B0021"
     CDS             18602..19114
                     /locus_tag="BSVBI22_RS10170"
                     /old_locus_tag="BSVBI22_B0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006151701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-24"
                     /protein_id="WP_002972219.1"
                     /db_xref="GI:489062192"
                     /translation="MLLALDGNSAAYRTLLEELSRLLKAYFVRRLFGGRVSEAEDLVQ
                     ETLLAIHTRRMTYDREMTFLPWVNAIARHKLVDHLRRQGRHDTDVLDEDIAIPGEAAN
                     VEARMDVDRMLGGVSERTAGLIRKVKIEGQSIDEAARAGDMSQSAVKVAIHRGLATLA
                     QRFGGKKDDR"
     gene            19104..19739
                     /locus_tag="BSVBI22_RS10175"
                     /old_locus_tag="BSVBI22_B0022"
     CDS             19104..19739
                     /locus_tag="BSVBI22_RS10175"
                     /old_locus_tag="BSVBI22_B0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006238014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracytoplasmic function alternative sigma
                     factor"
                     /protein_id="WP_006191564.1"
                     /db_xref="GI:493203401"
                     /translation="MTDDLINRLTGELKPVSRHAMQRLLLGHALLGMVAGVVIMLAFL
                     GARHDLAAAMAPPAFWSKLCYAALLLAVLLPALFALSRPLRQNLPWPALLLIFSCLGA
                     AAIYQWEEASPEVRPVLVWGYTALVCPWLIGLISLPTLASLLLAIRKLAPARPTLAGF
                     AAGLVSGGIGVLVYAFHCPESGLPFIALWYTLGIVGTGVLGALGGRFCLRW"
     gene            complement(19785..20525)
                     /locus_tag="BSVBI22_RS10180"
                     /old_locus_tag="BSVBI22_B0023"
     CDS             complement(19785..20525)
                     /locus_tag="BSVBI22_RS10180"
                     /old_locus_tag="BSVBI22_B0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002968215.1"
                     /db_xref="GI:489058115"
                     /translation="MKEIATRAAGRATGHLPEEIARQIEKRILDGEFSVGSKLPSERE
                     LSVEYGVSRPVVREALSQLKLDGLVEARAGSGVFVIDESNQKAFRIQPLVVEEAQSLE
                     QLMELLVAIEVAATRIAAVNRTPEDLKQIKRALIGLEYAIISDKLGDEEDYAFHDAIV
                     IATHNPHFIALCKHLEYGARHVIRQARTNTRSNLKDMLDAVQDEHKAIYEAIELGDPE
                     QAGIAAERHLRNATQRMKVYLSADNRTN"
     gene            20808..22058
                     /locus_tag="BSVBI22_RS10185"
                     /old_locus_tag="BSVBI22_B0024"
     CDS             20808..22058
                     /locus_tag="BSVBI22_RS10185"
                     /old_locus_tag="BSVBI22_B0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006014926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Leu/Ile/Val-binding protein homolog 4"
                     /protein_id="WP_002966556.1"
                     /db_xref="GI:489056419"
                     /translation="MSLKVFLQAGVACAALSLAGAAGASAEPLKIALVETLSGPQAST
                     GLLYRAAVLYQLGKINEAGGFNGEKIQILEYDNQGGPVGAADRVKAAIADGAQIIVQG
                     SSSAVAGQITEDVRKYNLRNKGKEVLYLNLGAEALELTGSKCHFYHFRFSPNAAIRFK
                     TVAQGMKDKGILGERAYSINQNYSWGVDVENTVVANAKEIGYEVVDKTLHEVNKIQDF
                     SPYVAKIQAANVDTVFTGNWSNDLLLLMKAASGAGLKAKFATSFLDQPGNIGNAGAIA
                     EGHIVSTPFNPEANGEASMAFAEDYKKVTGHYPSYVEPAAVFGLQLFGEALKNVKPGE
                     GKINTTDIALAIENASVKTPMGDYSMRSDDHQAKFPMVVQEVSKKARIKADGTEYGFL
                     PFKTFTGDESIDPVQESCSMKRPG"
     gene            22148..23089
                     /locus_tag="BSVBI22_RS10190"
                     /old_locus_tag="BSVBI22_B0025"
     CDS             22148..23089
                     /locus_tag="BSVBI22_RS10190"
                     /old_locus_tag="BSVBI22_B0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006196133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002966555.1"
                     /db_xref="GI:489056418"
                     /translation="MDQILFAVLNGAIYGLLLFMVSAGLTLIFGMMGVLNFAHASFYM
                     MGAYFAYTLQPLTGFWLAILIAPVIVGIVGVLVERFILRRVHAFGHAHELLVTFGLSV
                     VIAEVIKIFYGNFAVEYRIPAALQFSAFDLGGVSYPFYRLFIGAVALVMFLLIYLLLT
                     RTRIGIVVRSAIYRPRMVEALGHNVPLVFMGVFGVGAFLAGLAGSVAGAFYTTNPNMA
                     LELGVMVFVVVVVGGLGSLGGAMFASLLIGILSSVAVGVKVSIASLLDYVGLGDYARE
                     IGGVLTLEVSSIAATLPFFLMLIVLLVRPSGLFGAKE"
     gene            23093..24313
                     /locus_tag="BSVBI22_RS10195"
                     /old_locus_tag="BSVBI22_B0026"
     CDS             23093..24313
                     /locus_tag="BSVBI22_RS10195"
                     /old_locus_tag="BSVBI22_B0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_006191566.1"
                     /db_xref="GI:493203403"
                     /translation="MTIKQSVVALLVVALLVALPYLVSESMTNAAIQMLIAALFATAF
                     SLLCGQAGMLPFGHAAYFGLGSFAAVHAMNAFGGEGLLPTPLLPLAGAGVGLLSGLVA
                     GWFSTKRTGVYFAMITLALAELLHALAPHLKGTFGGEAGVSSFRMPAWGFDFGSTTEV
                     YYLALAWVVGSILLLFLLTLTPFGRVTVGLRENTHRLRFLGYNVHVLGTLVFAISAMF
                     AGIAGALQAINIEAANYVVFEAGISTAVVLNSFIGGVGTFFGPAIGAAAMTFFGHVTS
                     DVTRSWLLYQGLIFVLVMMFLPRGLVGEAVECFRNPKGTGISLGHALGRLVALLVTAA
                     GTIMIVELVQRFFSGDYKALASAGNWPPVTFLGREWLPFAVSTWLIPLALFAAGIALL
                     TIVNRHRAKAKGEA"
     gene            24313..25065
                     /locus_tag="BSVBI22_RS10200"
                     /old_locus_tag="BSVBI22_B0027"
     CDS             24313..25065
                     /locus_tag="BSVBI22_RS10200"
                     /old_locus_tag="BSVBI22_B0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006640898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_006073174.1"
                     /db_xref="GI:492971122"
                     /translation="MTKDILVLDQLNKSFGPAHIIRGVNLAVRDGERHAVIGPNGAGK
                     STLFHLISGNFTPSSGSIRFQGEEIGGLTPAAVNRKGLARSFQITNIFPGLTVFENIR
                     LAVMRRYKVQFTFWRPVSSMRKVTAEVESLLEQVRLTARAYTLASQLSYSEQRSLEIG
                     MTLASDPRLIILDEPMAGMSQEETDYTVGLIREITQNRTLMIVEHDMDVVFTLADRIS
                     VLVYGEIIATGTPKEIRENARVREAYLGEEAH"
     gene            25065..25781
                     /locus_tag="BSVBI22_RS10205"
                     /old_locus_tag="BSVBI22_B0028"
     CDS             25065..25781
                     /locus_tag="BSVBI22_RS10205"
                     /old_locus_tag="BSVBI22_B0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannosyltransferase"
                     /protein_id="WP_004689947.1"
                     /db_xref="GI:490827857"
                     /translation="MAAENILDVRELHAHYGKSHILQGVTFDLKKGEAISLLGRNGSG
                     RSTTMKAIMGLVPPTSGEVLLNGKNLAGERSFKICRAGIGFVPEERETFLNLTVDENL
                     QMGIQRGAEGATRWTVEQMFDYFPRLKERRNTRAGSFSGGEQQMLTMCRTLLGNPLVM
                     LIDEPTEGLAPKIVAVVGEMIKDINRQGVSVVLVEQKLTIALKVSSRVCVMGHGRIVF
                     EGTPDELTADEKLMEEWLAV"
     gene            25833..26315
                     /locus_tag="BSVBI22_RS10210"
                     /old_locus_tag="BSVBI22_B0029"
     CDS             25833..26315
                     /locus_tag="BSVBI22_RS10210"
                     /old_locus_tag="BSVBI22_B0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bleomycin resistance protein"
                     /protein_id="WP_004681171.1"
                     /db_xref="GI:490819073"
                     /translation="MTQMTAPLEVGLAVRDLKRMRAFYEGALGLSFVSEIHVGGEKAK
                     VAAMSPDGYTVVRLQTAKGERIKLLQPDRLPQAGQAETGLILERAGASYLTFIVDDLK
                     ALVERLIEHGAQPLTGRDPIEVRPGTWLAFLHDPEGHIVEIVQYDDIAAYRPDLAEEK
                     "
     gene            26319..27056
                     /locus_tag="BSVBI22_RS10215"
                     /old_locus_tag="BSVBI22_B0030"
     CDS             26319..27056
                     /locus_tag="BSVBI22_RS10215"
                     /old_locus_tag="BSVBI22_B0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_004689948.1"
                     /db_xref="GI:490827858"
                     /translation="MKFEFENRTLVLTGANGGIGRAIAELFHASGANLVLTDLDREGL
                     DAFAASLGSPERIATIKADASSADDAEKTVALAMERFGGIDFLVPSAGIYQAKPFAEM
                     SDADWYRTISINLDGVFYLCKRALPALKEDSSIVTLASLAAYRGAYVNAHYGATKGAM
                     VSMTRALSRELAPKTRVNGVAPGIIETPMTSELLKTRMDETMTQTPLKRLGKPSEIAS
                     VIAFLCSPAASFVTGETIQVNGGIYMA"
     gene            27074..27826
                     /locus_tag="BSVBI22_RS10220"
                     /old_locus_tag="BSVBI22_B0031"
     CDS             27074..27826
                     /locus_tag="BSVBI22_RS10220"
                     /old_locus_tag="BSVBI22_B0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008937091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_004687586.1"
                     /db_xref="GI:490825496"
                     /translation="MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAK
                     AQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQP
                     EAVEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKG
                     AIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGET
                     SEVVDPVVFLASPMASYITGTILPVDGGFLAA"
     gene            27936..30125
                     /locus_tag="BSVBI22_RS10225"
                     /old_locus_tag="BSVBI22_B0032"
     CDS             27936..30125
                     /locus_tag="BSVBI22_RS10225"
                     /old_locus_tag="BSVBI22_B0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_006191567.1"
                     /db_xref="GI:493203404"
                     /translation="MPKYKDLVPHSFWREIVPTTEDRAAFDLALGGTMLSQMHLIRAF
                     EEKVLELAGQGLVHGPAHSAIGQEGGAVGSAVSMRPSDQINGSHRAHHQFLAKALGYV
                     AQKGIDPKAAFDQDIRTLAQRTLAEILGLSQGFCRGRGGSMHLRWAESGNLGTNAIVG
                     GGVPMAAGAAWAHRRAGKGDVVYTYFGDGATNIGSVLETMNLAAAWKLPICFFIENNR
                     YAVSTHVEEVTAEPRLSSRGLAFGIPSFKVDGMDPIAVWLASEEANAIMRAGNGPTII
                     EADVYRYFHQNGPLPGSAFGYRSKDEEAEWRGRDPLDALAKTLLERQALGEDAIKALR
                     ERCVSLMDEVAGQLIEMHDGKRRIIPSLWPEESFRDFGLRGDLSEFDGVRFEEQESFS
                     GKLVEDARFIDTVADVMARRMETDERVVVLGEDVHRLKGGTNGATRGLSADYPDRVLG
                     TPISENAFTGIAGGMAADGRVLPVIEFMYPDFMWVAADQVFNQIGKARHMFGGDSDMP
                     VVLRTKVAMGTGYGSQHSMDPAGIFATAPGWRIVAPSTPFDYVGLMNSALLCRDPVLV
                     LEHVDLYASKGAAPAEDFDYFIPLGEAKVVRPGSRVTVLTYLAMVAKTQAVVEALGVD
                     AEIIDLRSLDRAGVDWETIEASVRKTGNVLIVEQGASGTSYGGWLADELQRRCFDWLD
                     QPIARVHGAEASPSISKVLEAAAAARPQDIEAGLRAVMAAQGLPIEN"
     gene            30144..31409
                     /locus_tag="BSVBI22_RS10230"
                     /old_locus_tag="BSVBI22_B0033"
     CDS             30144..31409
                     /locus_tag="BSVBI22_RS10230"
                     /old_locus_tag="BSVBI22_B0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain alpha-keto acid dehydrogenase
                     subunit E2"
                     /protein_id="WP_006191568.1"
                     /db_xref="GI:493203405"
                     /translation="MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKA
                     TMELEAEVDGRIGQLLVKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAE
                     TPVAASPVPAAPAVSAPASGEVRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDV
                     ERAAASKPVPVAAAAAPVAAPAEASSKAIPVGIGEYEAVPHTSMRRTIARRLLEAKIT
                     VPHFYLNVDCEIDALLALRSQINEKREGSARISVNDFVIKASAAALRRVPDANVIWTD
                     EALLKLKDVDIAVAVATEGGLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEF
                     QGGGFSISNLGMYGVKSFSAIINPPQSAILAVGAGERRPIERNGELAFATMMSVTLSV
                     DHRAVDGALGAQLLAAFKAGIEDPMSLLV"
     gene            31510..32295
                     /locus_tag="BSVBI22_RS10235"
                     /old_locus_tag="BSVBI22_B0034"
     CDS             31510..32295
                     /locus_tag="BSVBI22_RS10235"
                     /old_locus_tag="BSVBI22_B0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shkimate dehydrogenase"
                     /protein_id="WP_002966545.1"
                     /db_xref="GI:489056408"
                     /translation="MTVTGHTRVFAIIADPVHHVRTPQALNALFAARGYDGIVVPAAV
                     PASGLKYAAAALRAFGNWGGFIVTVPHKTEMPAFCDRLTPRAQAAGAVNVIRREADGS
                     LTGELLDGVGFVRGLANAGHDVKGRSVYLAGAGGAASAIAFALAEAGVVRLTVVNRSS
                     EKAGQLVARLKEHFPAGMFVSQGTPAGHDIIVNGTSLGLKEGDALPVDPQYLRPEMLV
                     AEVIMSPEVTPLLQIAKDSGCSIHPGKAMLDGQLAEMFDFFTR"
     gene            32575..32868
                     /locus_tag="BSVBI22_RS10240"
                     /old_locus_tag="BSVBI22_B0035"
     CDS             32575..32868
                     /locus_tag="BSVBI22_RS10240"
                     /old_locus_tag="BSVBI22_B0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004689951.1"
                     /db_xref="GI:490827861"
                     /translation="MKFTAIALLGARVLARRHPKYSQMSARPASCVPGAEHGTIRPRP
                     VAIWKADPSTGRIECHWTTDPNEVSAWLARSCFEQAGLIMAAVQQGRFGMPAH"
     gene            33221..35938
                     /locus_tag="BSVBI22_RS10245"
                     /old_locus_tag="BSVBI22_B0037"
     CDS             33221..35938
                     /locus_tag="BSVBI22_RS10245"
                     /old_locus_tag="BSVBI22_B0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073184.1"
                     /note="P-type; involved in magnesium transport into the
                     cytoplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-transporting ATPase"
                     /protein_id="WP_002971302.1"
                     /db_xref="GI:489061264"
                     /translation="MNVAVRTANNKNFKKDERRLSMRAVREASNEIELTLANVGSRRD
                     GLTEGDAITRLYRDGPNEVARERRIPALVQFALAFKNPFIMVLVVLGAISAFTDIWLP
                     LETGEEADPTKVIIIAVMVLASALMRFIQEYRSGRAAEALKAMVRTTATVWRRVSAGT
                     SSAPREIPMRELVVGDIVQLSAGDMIPADLRLIESRDLFISQAVLTGEALPVEKYDTL
                     GAISEKSAMATASQDADMLDLPSICFMGTNVVSGTATAVVVATGQRTYFGSLAKAIVG
                     SRAQTSFDRGINSVSWLLIRFMLIMVPVVFLINGFTKGNWVEAMLFGLAVAVGLTPEM
                     LPMIVSSNLAKGAVAMARRKVVVKRLNAIQNFGAMDVLCTDKTGTLTQDKIILEHHID
                     VSGKADDKVLRLAWLNSYHQSGVKNLMDQAVVSFANRVPEEVMRTARLYRKVDELPFD
                     FIRRRLSVVVEGVGGEHLLVCKGAVEEMLAICTTVRDGETVRALDAVTREKLIATARA
                     YNADGFRVLVVATREIPGAETSAQYRIADEAGLTVQGFLTFLDPPKETAGPAIAALAE
                     HGVCVKVLTGDNEIVTRKICREVGLEAGIPILGSEIEKLDDEALRVVAEERTVFAKLT
                     PLQKSRVLQALQANGHTVGFLGDGINDAPALRDADVGISVDSGADIAKESADIILLEK
                     SLIVLEEGVVTGRETFGNILKYLNMCASSNFGNVFSVLVASAFIPFLPMLAIHLLIQN
                     LMYDISQLALPWDKMDKEFLAKPRKWDARNIGRFMIWIGPTSSIFDITTFALMWYVFS
                     ANSPQMQSLFQSGWFIEGLLSQTLVVHMLRTQKIPFFQSTAALPVMLMSALIIALGIY
                     IPFSPIGEMVGLVPLPWAYFPWLAATLVSYCLVAQGMKVIYVRRFGQWF"
     gene            36504..36707
                     /locus_tag="BSVBI22_RS10250"
                     /old_locus_tag="BSVBI22_B0039"
     CDS             36504..36707
                     /locus_tag="BSVBI22_RS10250"
                     /old_locus_tag="BSVBI22_B0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968224.1"
                     /db_xref="GI:489058124"
                     /translation="MYHFRFSGGYKALPTAVPHRGTLVGSIAVATYLILFALVVLFVV
                     PASQANGPLDGDTQWQGAQAGGK"
     gene            36709..37425
                     /locus_tag="BSVBI22_RS10255"
                     /old_locus_tag="BSVBI22_B0040"
     CDS             36709..37425
                     /locus_tag="BSVBI22_RS10255"
                     /old_locus_tag="BSVBI22_B0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q57A43.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein MgtC"
                     /protein_id="WP_002966539.1"
                     /db_xref="GI:489056402"
                     /translation="MVWKPLAHTAACLAGAFLLGGLIGFERQFRHRLAGLRTNTLVAV
                     GAATFVVFSSLVSGDSSPTRVAAQIVSGIGFLGAGIIFKEGFNVRGLNTAATLWCSAA
                     VGVLCGAGLISHAAVATVFIIAVNALLRPLVQVLEFQAMRRGAFQPTYAIDIICHGDA
                     EAQVRALLLRDIGDHLHIHELESSNIEGTNRVEVSATVRADQRQDRLLEQIVGHLSLE
                     PRITSARWRIEDDSGGLSGL"
     gene            37500..38570
                     /locus_tag="BSVBI22_RS10260"
                     /old_locus_tag="BSVBI22_B0041"
     CDS             37500..38570
                     /locus_tag="BSVBI22_RS10260"
                     /old_locus_tag="BSVBI22_B0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_002966538.1"
                     /db_xref="GI:489056401"
                     /translation="MLKTIIRRNVTGSTPKILLLACLTAAIFIVDTVTDYAIAAAVFY
                     TVVILLSARLLTGKAVTGLASTCIALSVISFAFTSKGAFYEGLINTGISIIAIIATTY
                     LGLKLVSAEIDVRESRERLLRLARMTTLGQLTSSIAHEVSQPLVAIEISASAGRRWLA
                     QSPPNNERAAAAIERISADSHRAIEILDRVRRLSRGEKPHVAPFDINEVVRDIVELAH
                     NEITRHDIALDLDLTPGLPMALADRVQIQQVIGNLVLNAIEAIQEKDPPVRSLKINTA
                     LTEGARLQVAVRDSGGGIAPADQERLFDAFWTTKKGGFGLGLTISRTIVESSGGTIAL
                     GSTTPHGTTILFEVPTTQETEI"
     gene            38567..39205
                     /locus_tag="BSVBI22_RS10265"
                     /old_locus_tag="BSVBI22_B0042"
     CDS             38567..39205
                     /locus_tag="BSVBI22_RS10265"
                     /old_locus_tag="BSVBI22_B0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_002966537.1"
                     /db_xref="GI:489056400"
                     /translation="MNCAYERDPVVFIVDDDHSVRLGLVDLFASIGLKALCFASVNEF
                     LKHAREEVPACLILDVRMPGESGTEFHARMKGLDIRLPVIFITGHGDIAMGVKAIKDG
                     AIDFLAKPFRNQDLLDAVQQAIRTDRKRLREEHNQHRIIARYQTLNQGERAVFKLVVQ
                     GLMNKQIAAELDVAEVTVKVRRSHLMHKMRAKSLADLVRMATELNAQPVKEL"
     gene            complement(39403..39477)
                     /locus_tag="BSVBI22_RS10270"
                     /old_locus_tag="BSVBI22_Bt01"
     tRNA            complement(39403..39477)
                     /locus_tag="BSVBI22_RS10270"
                     /old_locus_tag="BSVBI22_Bt01"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(39443..39445),aa:Val,seq:gac)
     gene            complement(39591..39953)
                     /locus_tag="BSVBI22_RS10275"
                     /old_locus_tag="BSVBI22_B0043"
     CDS             complement(39591..39953)
                     /locus_tag="BSVBI22_RS10275"
                     /old_locus_tag="BSVBI22_B0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002966536.1"
                     /db_xref="GI:489056399"
                     /translation="MKRILLAEDDNDMRRFLVKALEKAGYHVTHFDNGASAYERLQEE
                     PFSLLLTDIVMPEMDGIELARRATEIDPDLKIMFITGFAAVALNPDSDAPRDAKVLSK
                     PFHLRDLVNEIEKMLIAA"
     gene            40272..41162
                     /locus_tag="BSVBI22_RS10280"
                     /old_locus_tag="BSVBI22_B0044"
     CDS             40272..41162
                     /locus_tag="BSVBI22_RS10280"
                     /old_locus_tag="BSVBI22_B0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006172423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="WP_002967161.1"
                     /db_xref="GI:489057037"
                     /translation="MSLERDFGSVPPFEVSAPAQQRIPFVFNSPHSGRHYPLSFVQAS
                     RLDAISIRNSEDCYVDELFASVMRLGAPLLKANFPRAFLDVNREPYELDPRMFAEPLP
                     PFANSHSARVAGGLGTVPRLVAEGQLIYPGRIPLAEALYRIEDLYKPYHAALDALLEA
                     TRQQFGYAVLIDCHSMPGGTSAGEIGSRPDFIVGDRFGRSCSERLTQAAIELLQDLGY
                     TVAHNKPYAGGFITEHYGRPAMACHALQIEVNRSLYVNEQNLHKLEGFEALCVALHHF
                     VSDLTSLPDDLFIAPPLAAE"
     gene            41324..42100
                     /locus_tag="BSVBI22_RS10285"
                     /old_locus_tag="BSVBI22_B0045"
     CDS             41324..42100
                     /locus_tag="BSVBI22_RS10285"
                     /old_locus_tag="BSVBI22_B0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_004685146.1"
                     /db_xref="GI:490823056"
                     /translation="MLIDKAFFSEVAAAAAAQTLPRFRQLTEVDNKYSVGFDPVTEAD
                     RAAERAIRAVIGRTFPDHGILGEEYGAENTDRSHVWIIDPVDGTRAFISGLPVWGTLV
                     GLTVDGDARAGMMSQPFTGELFYSDGDGAYLQRGDGAPRRLCVRKNAVLEDATLFTTT
                     PALFKGDDRKAFDRLESAVRLSRYGVDCYAFAMLAGGFVDIVVEAGLQTYDIAALIPI
                     IEQAGGVVTRRDGGPAEQGGDIVAAATPALHQAALDLLHI"
     gene            complement(42151..43146)
                     /locus_tag="BSVBI22_RS10290"
                     /old_locus_tag="BSVBI22_B0046"
     CDS             complement(42151..43146)
                     /locus_tag="BSVBI22_RS10290"
                     /old_locus_tag="BSVBI22_B0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005974752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase"
                     /protein_id="WP_002966533.1"
                     /db_xref="GI:489056396"
                     /translation="MSELLFETDANPIPSRIRGGLFHAPDGKALRYALLKAESRPCRG
                     TVIVLQGRNEFIENYYETMSDLAGRGFTVATFDWRGQGGSHRLLRDRLRGYVRSFNDY
                     ADDLDHFLTGIVLPDCPPPFFILAHSAGALVALSSLERLSSRITRMVLCAPLMGLGGQ
                     KISDDNVRRITAALRWIGLGRIYAAGGRTLSAARAFADNPLTSDPLRFMRNVEITRTY
                     TDLALGGPTVRWVWSALETAWRINQPDFYKSPIAPVLIIAAGADRVVSTAVIERFVAR
                     TRNISLAVIDGARHEMLQEADFYREQVLAAFDAFIPGSSPVESMPQSLEPDLSQI"
     gene            complement(43496..43894)
                     /locus_tag="BSVBI22_RS10295"
                     /old_locus_tag="BSVBI22_B0048"
     CDS             complement(43496..43894)
                     /locus_tag="BSVBI22_RS10295"
                     /old_locus_tag="BSVBI22_B0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966530.1"
                     /db_xref="GI:489056393"
                     /translation="MKKAALALAALATAATGIATPTLAADNGLRVQIQYYDDDGYRVP
                     RQGFDGPGRHDRRPNWGDGYIRREVMNPRRVARSLERRGYDVGDMRLERDTYFVRATR
                     PSGRRVVVMVDAYNGNIIGERRAGPRPSGY"
     gene            44458..44928
                     /locus_tag="BSVBI22_RS10300"
                     /old_locus_tag="BSVBI22_B0051"
     CDS             44458..44928
                     /locus_tag="BSVBI22_RS10300"
                     /old_locus_tag="BSVBI22_B0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein IbpA"
                     /protein_id="WP_006191573.1"
                     /db_xref="GI:493203410"
                     /translation="MRHVDFSPLYRSTVGFDRLFTMLDSLASPEGNQSYPPYNIERTG
                     ENAYRITMAVAGFSENELEIEAHRNQLTVKDQKADETASDVGEVLYRGIASRAFERRF
                     QLADFVEVSGASLKNGLLHIDLKREIPEQMKPRKIEVTKAGSGTAQPIEAKTAH"
     gene            complement(45066..46115)
                     /locus_tag="BSVBI22_RS10305"
                     /old_locus_tag="BSVBI22_B0052"
     CDS             complement(45066..46115)
                     /locus_tag="BSVBI22_RS10305"
                     /old_locus_tag="BSVBI22_B0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008937075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine aldolase"
                     /protein_id="WP_004689955.1"
                     /db_xref="GI:490827865"
                     /translation="MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFN
                     ELFEREVAVFFVGTGTAANSLALASVNRPGGVSLVHREAHVIEDECGAPEYFTGGARL
                     HPIDGALGRIDPELLKRELKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQI
                     CRDAGLPLHMDGARFANALVSLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDP
                     ARAKDLPFIRKRAAQLFSKTRFVAAQFDAYLRDDLWRDLARHSNALAARLANHIHASS
                     QMRLAWKPEANEVFAIMKQSVYDRLRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTGF
                     ANTEEEVDRFGDMIA"
     gene            46758..51509
                     /locus_tag="BSVBI22_RS10310"
                     /old_locus_tag="BSVBI22_B0054"
     CDS             46758..51509
                     /locus_tag="BSVBI22_RS10310"
                     /old_locus_tag="BSVBI22_B0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase"
                     /protein_id="WP_006191576.1"
                     /db_xref="GI:493203413"
                     /translation="MTHLTPSVSNVVSHNVQNEAVKAATTASTRTTRKTKAAGVPPAQ
                     GLYDPRNEHDACGVGFIAHMKGRKSHVVVENGLKMLENLTHRGAVGADPLMGDGAGIL
                     VQIPDRFFREEMARQGIDLPQPGHYGVGYIFMPRDPDLRAHAEEIVREVIAAEGQTFI
                     GFREVPVDNSSLSKAPHIAATEPFHMQVFIGRSPMLETDDDFERRLFVLRKVISNRIY
                     QENDGDDKGFYVVSMSARTVVYKGMFLAYQVGAYYLDLKDPRFESAVALVHQRFSTNT
                     FPSWRLAHPYRMVAHNGEINTLRGNVNWMAARQASVDSELFGNDISKLWPISYEGQSD
                     TACFDNALEFLHQGGYSLAHAMMMLIPEAWSGNKLMSDERRAFYEYHAALMEPWDGPA
                     AVAFTDGRQIGAMLDRNGLRPARYIVTEDDFVILASEAGVLPVDEKKIVRKWRLQPGR
                     MLLIDMEEGRIISDEEIKSQIAQKHPYKQWLANTQLILEDLNPVEPRALHKDVSLLDR
                     QQAFGYTQEDTKFLMAPMATTGQEAIGSMGTDTPISAMSDKSKLLYTYFKQNFAQVTN
                     PPIDPIREELVMSLVSFIGPRPNIFDLVGTSRRKRLEVRQPILTNGDLEKIRSIGHTE
                     DRFDTKTLDITYNTGEGATGMHGAIERLCDRAEAAVHGGYNIVILSDRQVGPDRIPIP
                     ALLATAAVHHHLIRKGLRTSVGLVVESGEPREVHHFACLAGYGAEAINPYLAFDTLLD
                     MHRRREFPPEVDEHEVVKRYIKSIGKGILKVMSKMGISTYQSYCGAQIFDAVGVRTDF
                     VDKFFFGTATTIEGVGLDEIAEETVRRHTDAFGNDPVLLNALEVGGEYAYRMRGEAHM
                     WSPDAVAKLQHAVRTSNPDTFTEYTRMLDAKSSQAKTIRGLFNIRFAEERGLKPVSID
                     EVEPATDIVKRFSTGAMSFGSISREAHTTLARAMNAIGGKSNTGEGGEEPDRFYPLPD
                     GTANPERSAIKQVASGRFGVTTEYLVNSDLIQIKVAQGAKPGEGGQLPGHKVDATIAK
                     TRHSTPGVGLISPPPHHDIYSIEDLAQLIYDLKNVNPAADISVKLVSEVGVGTVAAGV
                     AKARADHITVSGYDGGTGASPLTSLKHAGSPWEIGLAETHQTLVLNGLRSRVALQVDG
                     GLRTGRDVVIGALLGADEFGFSTAPLIAAGCIMMRKCHLNTCPVGVATQDPVLRKRFK
                     GTPEHVINFFFYLAEEVRALLAQMGFTRLEQIIGETELLEKQAMIDHWKAKGLDFSRI
                     FYKPEAEKHEIYWTERQHHPIDDILDRKLIELAAPALEERQPVKIDVEIKNVDRSAGA
                     MLSGEVAKRFRHKGLPEDTISVTLRGTAGQSFGAFLARGISFELIGDGNDYIGKGLSG
                     GRIVVRPPEDTRIVAEDSIIVGNTVLYGALEGECYFRGVAGERFAVRNSGAVTVVEGV
                     GDHGCEYMTGGVVVVIGQTGRNFAAGMSGGVAYVLDEEGDFAQRCNMAMVELEPVPEE
                     DDILEKLHHHGGDLMHKGRVDVSANMTHHDEERLVQLIANHLHYTGSTRAKDILDNWE
                     SYRPKFVKVMPVEYRRALEEMERMQIGVAAE"
     gene            51591..53045
                     /gene="gltD"
                     /locus_tag="BSVBI22_RS10315"
                     /old_locus_tag="BSVBI22_B0055"
     CDS             51591..53045
                     /gene="gltD"
                     /locus_tag="BSVBI22_RS10315"
                     /old_locus_tag="BSVBI22_B0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006234465.1"
                     /note="glutamate synthase is composed of subunits alpha
                     and beta; beta subunit is a flavin adenine
                     dinucleotide-NADPH dependent oxidoreductase; provides
                     electrons to the alpha subunit, which binds L-glutamine
                     and 2-oxoglutarate and forms L-glutamate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropyrimidine dehydrogenase subunit A"
                     /protein_id="WP_002972210.1"
                     /db_xref="GI:489062183"
                     /translation="MGKVTGFLEIDRQVAKYQPASDRIRHFREFTIPMTDGEVQKQAA
                     RCMDCGIPYCHGPTGCPVHNQIPDWNDLVYNNNWDQAIRNLHLTNNFPEFTGRICPAP
                     CEEACTLNLEDMPVAIKTVEQALGDKAYELGYIVPQPAASKTGKLVAIIGSGPAGLAA
                     AQQLARAGHMVDVYERESRPGGLLRYGIPDFKMEKHLIDRRVAQMEGEGVRFHCGVNI
                     GVDKPLRGLLDTYDAVLYCGGSETPRPAGIPGADLDGVHDAMPYLVQQNRRVGRENIE
                     SVAWASVPILAGGKHVVVVGGGDTASDCVGTAFRQGAVNVTQLDIRPQPPEKEDKLSV
                     WPYWATKMRTSSSQAEGASREFQVATLEFIGEDGRLTHVKCCQVDEKRRPIAGTEFFI
                     KADLAFIAIGFAGPVEDSVVKEMDGKLEIATDRRGSKSVKANDRDYRTNVDKLYAAGD
                     IRRGQSLVVWAIREGRQAAHAIDADLMGSSVLPR"
     gene            complement(53090..54493)
                     /locus_tag="BSVBI22_RS10320"
                     /old_locus_tag="BSVBI22_B0056"
     CDS             complement(53090..54493)
                     /locus_tag="BSVBI22_RS10320"
                     /old_locus_tag="BSVBI22_B0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine glycine permease"
                     /protein_id="WP_006191579.1"
                     /db_xref="GI:493203416"
                     /translation="MNTISKPSVDLHREEEPHLARNLSNRHLQLIAIGGTIGTGLFMG
                     SGKAVSLAGPSILLIYAITGFMLFFVMRALGEILLSNLQYRSFADFAGDYLGPCAQFF
                     TGWTYWLCWIVTAVAEVVAVSGYVSFWFPHLAPWIPALGLITILLILNLPTVRNFGEI
                     EFWFALIKIITIIGLIITGIYMLMTGFVLPNGTQASIAHLWNHGGFFPNGSLGFIAGF
                     QISVFAFVGIELVGTAAAEAENPMRNLPKAINNIPIRIVLFYIGALFVIITVTPWNQV
                     DPNSSPFVAMFSLAGIGIAAHFINFVVLTSASSSSNSGIYSTSRMVYGLATVGLAPKA
                     FSKLSNRKVPVHALIFSCIFLLSSVVLLYAGQSMIQVFTLVTTISALLFIFIWSIILV
                     SYLQYRRKHPERHEKSTFKMPGRRASVVMVFIFFAFVLWALTQEPDTLAAMKVTPLWF
                     VLLGIAYRVMKLKQKQS"
     gene            complement(54715..55866)
                     /locus_tag="BSVBI22_RS10325"
                     /old_locus_tag="BSVBI22_B0057"
     CDS             complement(54715..55866)
                     /locus_tag="BSVBI22_RS10325"
                     /old_locus_tag="BSVBI22_B0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006105264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968227.1"
                     /db_xref="GI:489058127"
                     /translation="MREALTSGKFLKLAGMMLAAAALLLTSLAAATAQERPRTLFDLL
                     FGSRQAQPQRQYERPAPQRVKPKPKRPRASSPAARAAAPSAAAPAVEIATKKPDAKKI
                     LVVGDFIGNGLAEGLDAAFATDPDLTVATRVNGSSGFVRDDYFNWPDNIGKILDEEKP
                     AAVVVMIGANDRQAITANGNSLQPRSPEWNAEYQKRVAAFTKVISDRHYPLVWVGQPP
                     FRPKGMSQDMLALNEIYRNAAEKAGGKFADVWDGFVDEEGNFTQTGFDINGQTARLRA
                     NDGINITSTGKRKLAFYAEKPLHAYLGVSREEGNSLPATHSLDPSKPVDRVAPVSLRD
                     INKDDSGILLGGTPAMQAKPLKTEQKKANPSPGRADDFSWPRNGKAPRK"
     gene            complement(56117..56635)
                     /locus_tag="BSVBI22_RS10330"
                     /old_locus_tag="BSVBI22_B0058"
     CDS             complement(56117..56635)
                     /locus_tag="BSVBI22_RS10330"
                     /old_locus_tag="BSVBI22_B0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q2YJ83.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Type IV secretion system putative outer membrane
                     lipoprotein BRA0058/BS1330_II0058"
                     /protein_id="WP_004689960.1"
                     /db_xref="GI:490827870"
                     /translation="MRTLVMVACAVSLAACSSPPKPPTVSGRHRIPINSPAAQEELRL
                     QVFPQEPTAQATMWPARPPKQTVSVYFPQDVTVFRPTSAQINQLHTLLWPVPKHINVR
                     GLTDNNCPPPGDTQVARVRALAIYNWLINQGVSASRITISYAPVKDYASNAPLSPGRV
                     LNRRVDIEILRK"
     gene            complement(56784..57866)
                     /locus_tag="BSVBI22_RS10335"
                     /old_locus_tag="BSVBI22_B0059"
     CDS             complement(56784..57866)
                     /locus_tag="BSVBI22_RS10335"
                     /old_locus_tag="BSVBI22_B0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8FXK7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB11"
                     /protein_id="WP_006133590.1"
                     /db_xref="GI:493096492"
                     /translation="MSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNR
                     PGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERIQ
                     IVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEA
                     GDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPDH
                     PNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGEAYDFINVAASGH
                     GGSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDG
                     TGRHISEVWYDPNTKRALSLQHSEKT"
     gene            complement(57850..59025)
                     /locus_tag="BSVBI22_RS10340"
                     /old_locus_tag="BSVBI22_B0060"
     CDS             complement(57850..59025)
                     /locus_tag="BSVBI22_RS10340"
                     /old_locus_tag="BSVBI22_B0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB10"
                     /protein_id="WP_004689962.1"
                     /db_xref="GI:490827872"
                     /translation="MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIV
                     VLLLLLVFHMRGNAENNHHSDKTMVQTSTVPMRTFKLPPPPPPPPPAPPEPPAPPPAP
                     AMPIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTT
                     NARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTR
                     LDSTVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTP
                     NGVVIDLDSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSN
                     QINLNTGGGESTSNLASTALKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK"
     gene            complement(59022..59891)
                     /locus_tag="BSVBI22_RS10345"
                     /old_locus_tag="BSVBI22_B0061"
     CDS             complement(59022..59891)
                     /locus_tag="BSVBI22_RS10345"
                     /old_locus_tag="BSVBI22_B0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YDZ1.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB9"
                     /protein_id="WP_002966518.1"
                     /db_xref="GI:489056381"
                     /translation="MKRFLLACILITLASPSWATKIPSGSKYDSRIQYVDYNSGDVVL
                     VRALPGVGARIVFAPGENIEDVASGFTQGWEFKASHNILYLKARSMTLSHSNQSIDMA
                     PEPGKWDTNLMVTTDQRMYDFDLRLMPGRNNQRVAYRVQFRYPAAAAAAAVAAAQKRV
                     VQARMNARPSPVNWNYTMQVGTNSASIAPTLAYDDGRFTYLRFPNNRDFPAAFLVAED
                     KSESIVNSHIDPSAPDILVLHRVAKQMVLRLGNKVIGIYNESFNPDGVPARDGTTVPG
                     VKRVIKSPGENLQ"
     gene            complement(59888..60607)
                     /locus_tag="BSVBI22_RS10350"
                     /old_locus_tag="BSVBI22_B0062"
     CDS             complement(59888..60607)
                     /locus_tag="BSVBI22_RS10350"
                     /old_locus_tag="BSVBI22_B0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB8"
                     /protein_id="WP_002966517.1"
                     /db_xref="GI:489056380"
                     /translation="MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRA
                     WKIAGAFGTITVLLGIGIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVM
                     DKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVR
                     TSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARL
                     TNPLGFNVTSYRVDPEMGVVQ"
     gene            complement(60610..60783)
                     /locus_tag="BSVBI22_RS10355"
                     /old_locus_tag="BSVBI22_B0063"
     CDS             complement(60610..60783)
                     /locus_tag="BSVBI22_RS10355"
                     /old_locus_tag="BSVBI22_B0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008508782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system putative lipoprotein
                     virB7"
                     /protein_id="WP_002966516.1"
                     /db_xref="GI:489056379"
                     /translation="MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKP
                     PLAQPNPVDTYED"
     gene            complement(60947..61990)
                     /locus_tag="BSVBI22_RS10360"
                     /old_locus_tag="BSVBI22_B0064"
     CDS             complement(60947..61990)
                     /locus_tag="BSVBI22_RS10360"
                     /old_locus_tag="BSVBI22_B0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB6"
                     /protein_id="WP_002969266.1"
                     /db_xref="GI:489059194"
                     /translation="MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLY
                     YTAMGILMSVGRIEGPFSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADA
                     FAGNHGTPSSTIYQTLDNSLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGS
                     TLILAGPTGAMIVATNAVIAILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVAL
                     LSAVLSISSAIFSRMVAAINLASATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGS
                     SISAATISLGSLAVNTATSGGGAMTSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSP
                     AYRQHVLGQFNRD"
     gene            complement(62174..62890)
                     /locus_tag="BSVBI22_RS10365"
                     /old_locus_tag="BSVBI22_B0065"
     CDS             complement(62174..62890)
                     /locus_tag="BSVBI22_RS10365"
                     /old_locus_tag="BSVBI22_B0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB5"
                     /protein_id="WP_006191582.1"
                     /db_xref="GI:493203419"
                     /translation="MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKF
                     AQQIEQLKQQFEEQKMQFDALTGYRGLGDILRDPTLRSYLPHNWRDLYEAVMSGGYLA
                     AAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEI
                     ESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLHLYQQMAEAQDKLLDERQHEL
                     DAKDNARRGYPQPKALEAAY"
     gene            complement(62895..65390)
                     /locus_tag="BSVBI22_RS10370"
                     /old_locus_tag="BSVBI22_B0066"
     CDS             complement(62895..65390)
                     /locus_tag="BSVBI22_RS10370"
                     /old_locus_tag="BSVBI22_B0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q2YIT8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB4"
                     /protein_id="WP_004688809.1"
                     /db_xref="GI:490826719"
                     /translation="MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWR
                     IAGLAFETQDKEELLIRKDQLNTLFRAIASNNVALWSHNVRRRTWDHLKSFFSNPFCD
                     ALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLFNVAVHRSHAEILQEQQLAIRK
                     LDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALCSQQLEFYNFLLSGEWQKVRVP
                     SCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDYASHTEPGILNGLMYSDYEY
                     VITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDIAIDQLGRGDFVMGEYHY
                     SLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYAQLPCNWRYRPRVAGL
                     TSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHYSKGDEDNFDKKLL
                     GNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAKGTILAIGGKYL
                     AIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRISHAIRTVMRM
                     RPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVLDCPQDQID
                     FNTHSNYGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKWVDDEAFS
                     EFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADYHEYTD
                     GFKVTNEEFDIIRSMSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNNELLD
                     QVIAEVGDDPSVWLPVFQERRKARIASSKSTGR"
     gene            complement(65390..65740)
                     /locus_tag="BSVBI22_RS10375"
                     /old_locus_tag="BSVBI22_B0067"
     CDS             complement(65390..65740)
                     /locus_tag="BSVBI22_RS10375"
                     /old_locus_tag="BSVBI22_B0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB3"
                     /protein_id="WP_002966512.1"
                     /db_xref="GI:489056375"
                     /translation="MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGS
                     IVLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRAS
                     AYSPIAFTKRKRES"
     gene            complement(65754..66071)
                     /locus_tag="BSVBI22_RS10380"
                     /old_locus_tag="BSVBI22_B0068"
     CDS             complement(65754..66071)
                     /locus_tag="BSVBI22_RS10380"
                     /old_locus_tag="BSVBI22_B0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006163924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB2"
                     /protein_id="WP_002967165.1"
                     /db_xref="GI:489057041"
                     /translation="MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVN
                     TSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAAAEIASY
                     LLR"
     gene            complement(66507..67223)
                     /locus_tag="BSVBI22_RS10385"
                     /old_locus_tag="BSVBI22_B0069"
     CDS             complement(66507..67223)
                     /locus_tag="BSVBI22_RS10385"
                     /old_locus_tag="BSVBI22_B0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006178499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB1"
                     /protein_id="WP_004687568.1"
                     /db_xref="GI:490825478"
                     /translation="MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVR
                     QPVSLDEAITTAQSLEAKGWNFSLGIAQVNRYNLPKYGSTYAQAFDPCKNLKMGSKIL
                     EDCYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTKPGSPSYVQKVVASADVTTKP
                     IAVVPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGAANAPVRLKTE
                     QPATTDAPPGKDNTDGVVVF"
     gene            complement(67727..68953)
                     /locus_tag="BSVBI22_RS10390"
                     /old_locus_tag="BSVBI22_B0070"
     CDS             complement(67727..68953)
                     /locus_tag="BSVBI22_RS10390"
                     /old_locus_tag="BSVBI22_B0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006205081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="WP_004689964.1"
                     /db_xref="GI:490827874"
                     /translation="MLRFPFTPEKKLRIKIAATVALAIIGASLSAGTALADAGFRQWI
                     ANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSV
                     AVSQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATL
                     AYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYTVDMD
                     GNGKRDIWNSVPDALGTAANLLHRNGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQI
                     GLVRANGRAFPDPHEKATLKVPDGHQGPAFLMTKNFFVLKRYNNADKYALAVGLLADR
                     IGGYQGLRQDWNRPFTPISMNERLELQTHLKALGYYDGKIGATSRAAIEAFQQRNGLE
                     PDGHPSKEVLSVLRRR"
     gene            69374..70258
                     /locus_tag="BSVBI22_RS10395"
                     /old_locus_tag="BSVBI22_B0071"
     CDS             69374..70258
                     /locus_tag="BSVBI22_RS10395"
                     /old_locus_tag="BSVBI22_B0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="WP_032448386.1"
                     /db_xref="GI:694105474"
                     /translation="MRKIRKAVFPVAGLGTRFLPATKSIPKEMLTVVDKPVIQYVVDE
                     AREAGIEHLIFVTGRNKAVIEDYFDAQVELYSTLAERGKTEELNRLQDLQPQPGTTSF
                     TRQQVPLGLGHAVWCARELVGNEPFALLLPDMVMQSKKGCLAEMVELYEQTGGNIIAV
                     QECDPEEAHKYGIVGKGGAVGNGFEITRMVEKPAKGTAPSNLYINGRYILQPEIFGLL
                     SKQEKGAGNEIQLTDAMLKLADQQKFYGFDYRGLTFDCGSKAGFIEANVAFALWREDI
                     RPSVEGSIGHLLKTIQPA"
     gene            complement(70311..71849)
                     /locus_tag="BSVBI22_RS10400"
                     /old_locus_tag="BSVBI22_B0072"
     CDS             complement(70311..71849)
                     /locus_tag="BSVBI22_RS10400"
                     /old_locus_tag="BSVBI22_B0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004689965.1"
                     /db_xref="GI:490827875"
                     /translation="MFIACAPIGGLAPLARRLRCLLLAGVALALPHFAYAQDADLRGS
                     ISDDIAAAATDADDAGAGADGFYSPEQDNASSGKGDLSQETPAADPVSEDSTFLLDNI
                     RVGAVLPDDDTVRAQRENLRARPGQGRSFTPEADPYAPIGIRAGSFILKPSLEQGIKA
                     TSNGDNSSNGSRAILNETTLRLNALSDWLQHQASLDASGTFSKSISGQDVSEPQANIL
                     GRLRLDLANQTTVNAETSYRLRRESASSPNGVVDALKRPLVHTFAGRLGVERDTGLLF
                     GRVTGGLEHDMYGNAELASGGTVTQKDRNNTYASVAIRGGFSLSPALKPFAEVELGKR
                     MFDERIDSNGYERSGRQYALRGGLIFDRGEKFNGEIAAGYMQADSDDPRLANISGPSI
                     NAMVNWSPLRGTDMRFFARTMVDTSTTPGVAGSLQHFASLDVTRRVRANLSFNGKLDA
                     NIRQNKDGTGTDYTLGAEIGATYWLNRMVAIDARLRHEFQTSQVADREYKSNSIYVGM
                     KFQK"
     gene            71990..72991
                     /locus_tag="BSVBI22_RS10405"
                     /old_locus_tag="BSVBI22_B0073"
     CDS             71990..72991
                     /locus_tag="BSVBI22_RS10405"
                     /old_locus_tag="BSVBI22_B0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="KpsF/GutQ family protein"
                     /protein_id="WP_002966506.1"
                     /db_xref="GI:489056368"
                     /translation="MEKLDITQKLADAEAAITSALRTIKTENAGLVALEEALNNGLSG
                     PFVEAVERIVASRGRLVVTGVGKSGHIGSKLAATFASTGTSAFFVHSGEANHGDLGMI
                     GLEDVILAISWSGETVELKGIVNYSQRFRIPLIAITSRQDSALGRAADVVLLLPKATE
                     ACPHGLAPTTSTMMQLAIGDALAIALLEARGFTPSDFKTFHPGGSLGASLIHIRDIMH
                     RGNRLPLVKTGTPMPDAMKVLAQKSFGCVVVTDDAGELAGIVTDGDISRNLSRNLSAL
                     AVDDIMTRSPRTIDQNMLASAALKTINENHIGALIVVEANRPIGLVHFHDLLRIGAA"
     gene            complement(73122..73589)
                     /locus_tag="BSVBI22_RS10410"
                     /old_locus_tag="BSVBI22_B0074"
     CDS             complement(73122..73589)
                     /locus_tag="BSVBI22_RS10410"
                     /old_locus_tag="BSVBI22_B0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004687565.1"
                     /db_xref="GI:490825475"
                     /translation="MIPEFLFQLGIWNWLVFGLILLILEILAPGFFFIWFGLAALVTG
                     ALAFLLSSTAGFGWQLQTVIFLVLAIVFTLAGRRFFGSKSNDTGEPLLNRRGEQLVGQ
                     RATLTEPIVNGHGRIHINDTTWRVKGPDLPAGTEIRIVAFDPVSLEIEVGLGE"
     gene            complement(73610..74596)
                     /locus_tag="BSVBI22_RS10415"
                     /old_locus_tag="BSVBI22_B0075"
     CDS             complement(73610..74596)
                     /locus_tag="BSVBI22_RS10415"
                     /old_locus_tag="BSVBI22_B0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004681235.1"
                     /db_xref="GI:490819137"
                     /translation="MTGFDITLLILVALVLAALIASIKTVPQGYNYTIERFGRYTRTL
                     NPGLNLIVPFFDRVGARLNMMEQVLDVPTQEVITRDNAIVGVDAVAFYQVLNAAQAAY
                     QVAKLQYAILNLTMTNIRTVMGSMDLDELLSNRDAINDRLLRVVDEAAHPWGIKITRV
                     EIKDINPPADIVTSMARQMKAERDKRAQVLEAEGNRNAQILRAEGQKQSQILEAEGKL
                     EAAKREAEARERLAEAEAKATTMVSQAVANGNVQALNYFVAQKYTEALSNIASAKNQK
                     IVLMPLEASSLIGSLGGIGAIAREVFGDGSQPAGPAPQPPARARSVPPTGRD"
     gene            complement(74729..75787)
                     /gene="hemH"
                     /locus_tag="BSVBI22_RS10420"
                     /old_locus_tag="BSVBI22_B0076"
     CDS             complement(74729..75787)
                     /gene="hemH"
                     /locus_tag="BSVBI22_RS10420"
                     /old_locus_tag="BSVBI22_B0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0A3D6.1"
                     /note="protoheme ferro-lyase; catalyzes the insertion of a
                     ferrous ion into protoporphyrin IX to form protoheme;
                     involved in protoheme biosynthesis; in some organisms this
                     protein is membrane-associated while in others it is
                     cytosolic; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_004681236.1"
                     /db_xref="GI:490819138"
                     /translation="MSGTDKVRVNVSQTAQTPLHTSAKLPKVGVLLVNLGTPDGTSYG
                     PMRRYLAEFLSDRRVIEWSRLIWYPILYGIVLNTRPRRSGRLYDRIWNHENNESPLRT
                     YTRAQGEKLAKALSDQPNVVVDWAMRYGQPSIESITDRLLQQGCERIVIFPLYPQYSA
                     TTTATVNDKFFEALMKKRFMPAIRTVPSYEAEPVYIDALARSVEKHLATLSFKPEVIL
                     TSYHGIPKSYSDKGDPYRQQCLETTRLLRERLGLGEDEMRATFQSRFGPEEWLQPYTD
                     ETVKELAKNGVKSVAVLNPGFVADCLETVDEIGNEAAEEFLENGGENFSHIPCLNDSE
                     EGMKVIETLVRRELLGWV"
     gene            complement(75925..76305)
                     /locus_tag="BSVBI22_RS10425"
                     /old_locus_tag="BSVBI22_B0077"
     CDS             complement(75925..76305)
                     /locus_tag="BSVBI22_RS10425"
                     /old_locus_tag="BSVBI22_B0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008508755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein omp10"
                     /protein_id="WP_002966502.1"
                     /db_xref="GI:489056364"
                     /translation="MKRFRIVAPLALMSLALAACETTGPGSGNAPIIAHTPAGIEGSW
                     VDPNGIASSFNGGIFETRTTDTNEKLAEGNYLYLSPQLVEINMRSIVRGTTSKVNCAL
                     VSPTQLNCTSSAGSRFSLTRRNAG"
     gene            complement(76447..77892)
                     /locus_tag="BSVBI22_RS10430"
                     /old_locus_tag="BSVBI22_B0078"
     CDS             complement(76447..77892)
                     /locus_tag="BSVBI22_RS10430"
                     /old_locus_tag="BSVBI22_B0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homospermidine synthase"
                     /protein_id="WP_006191584.1"
                     /db_xref="GI:493203421"
                     /translation="MAREKWQVYGEITGPIIMIGFGSIGRGTLPLIERHFKFDQSQMV
                     VIDPSEKNRKILDEKNIRFIKQAITRDNYKDVLGPLLKGVKGQPFVVNLSVDTSSLDL
                     MRFVRECGALYIDTVVEPWLGFYFDAQADNAAWTNYALRETVRSEKRKNPGGPTAVSC
                     CGANPGMVSWFVKKALVDLAAELKLDFTEPAPQDRHGWAKLMKKAGVKGIHIAERDTQ
                     RARKPKPFNTFWNTWSVEGFIAEGLQPAELGWGSHEKWKPKNARKQKKGNKAAIFLEQ
                     PGGNTRIRTWCPTLGAQYGLLVTHNEAISIADFFTLRDKKGKLDFRLTCHYAYHPCND
                     AIVSLDEMFGAGGKAQPVQHVLEENEILDGADELGVLLYGHARNAYWYGSQLTVQEAR
                     KLAPYQNATGLQVSSAVLAGMVWALENPQSGIVETDEMDYRRCLEVQMQYLGPVKGYY
                     TDWTPLEGRDGLFEEDVDRKDPWQFRNVLVR"
     gene            complement(78004..78684)
                     /locus_tag="BSVBI22_RS10435"
                     /old_locus_tag="BSVBI22_B0079"
     CDS             complement(78004..78684)
                     /locus_tag="BSVBI22_RS10435"
                     /old_locus_tag="BSVBI22_B0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011069089.1"
                     /db_xref="GI:499381518"
                     /translation="MSSESTVRDGSKAVTSEPDYQLIETMRWEPLAGVLRFDLHMARL
                     ENSARELNFACNMDVIRQKIAESGTGDQALKLRLTLAPDGVATVAALPYEALPQQTVW
                     RITIARTRLDHTDPLLRYKTTRRQAYIAAREEYSPAEVDEVILLNERGEVCEGTITSI
                     FLDIGGTACTTPALSCGLLDGVMRRELLDKGVASEEVVSVDMLKSARNILVGNSLRGM
                     IRAKLIES"
     gene            complement(78618..79787)
                     /locus_tag="BSVBI22_RS10440"
                     /old_locus_tag="BSVBI22_B0080"
     CDS             complement(78618..79787)
                     /locus_tag="BSVBI22_RS10440"
                     /old_locus_tag="BSVBI22_B0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138112.1"
                     /note="catalyzes the formation of
                     4-amino-4-deoxychorismate from chorismate and glutamine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate synthase"
                     /protein_id="WP_004689969.1"
                     /db_xref="GI:490827879"
                     /translation="MTRPGNKPLILFRDDKAGRDVLFAAPSRIIRADTPDEFEPAWEA
                     MQRAHEAGEWLAGYLSYEAGYLLEPKLRPLLPEGRKTPLLCFGVFDGPSDEQLHVRDS
                     ENATYLRNPVAQWSFEDYAPRFERLHRHLREGNCYQGNLTFPVTAQWGGDPLILFNML
                     AKRQPVRYATYCDLGGPVVLSRSPELFFKVDGDGWIETHPMKGTMPRGATPEEDERNR
                     QFLLNDPKNQAENRMIVDLLRNDISLVSEVGSLDVPELFRVESYLTVHQMISRVRARP
                     KSGLHLRAVFAALFPCGSITGAPKISAMKILRRLETGPRDIYCGSLGWIEPGGRMRFN
                     VAIRTISLLGGNRAIFNVGGGVVFDSTAQAEYEECLLKARFATGQKPLPANRIIS"
     gene            complement(79797..81659)
                     /locus_tag="BSVBI22_RS10445"
                     /old_locus_tag="BSVBI22_B0081"
     CDS             complement(79797..81659)
                     /locus_tag="BSVBI22_RS10445"
                     /old_locus_tag="BSVBI22_B0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006196160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="WP_004689970.1"
                     /db_xref="GI:490827880"
                     /translation="MKFMVYRFSSDAILRAPAADAIAAKKHDLGNLPEWNLADLYPAP
                     DSPQLASDLEKAMQDSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGS
                     YAGLYYYGDTTDPKRMKLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAI
                     GHYRPWLTDLRMDKPYQLDDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLA
                     IEPTLNMLQDADGAVRKQASEALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIA
                     DSQHLSNRVEREVVDALAKAVEDAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETP
                     QALIPWDEARETVLSAYGNFAPEMADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSA
                     HPYVLLNYMGKPHNVMTLAHELGHGVHQVLAGSQGALMASTPLTLAETASVFGEMLTF
                     RLLLERTRDKRERKAMLAQKAEDMINTVVRQIAFYQFERRVHTERRAGELTSERIGEI
                     WMDVQRESLGDAVRLNPGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQNSEK
                     GFQQKYFEMLKAGGTKHHKELLAPFGLDASDPGFWNKGLSVIEGIIDELEAMED"
     gene            82007..83497
                     /locus_tag="BSVBI22_RS10450"
                     /old_locus_tag="BSVBI22_B0082"
     CDS             82007..83497
                     /locus_tag="BSVBI22_RS10450"
                     /old_locus_tag="BSVBI22_B0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_004687560.1"
                     /db_xref="GI:490825470"
                     /translation="MATRILIADDDPIQRRNLEAIVMRMGYRTILADGGVSALGFISQ
                     RKDIVLVLLDLTMPDMDGLTVLSRMRAAGVAVPVIVLVHSDDMHRVAQAIRLGAADFM
                     IKPVIFERVQVSVANVLKLDALTHEIQRARSSPRVHLSLSEMVAKSPEMERVMVLARR
                     AAALDAPLLVEGETGSGRQTLARAICGGGSRWRGPFVSLDCRGLTMENADDILFGTAK
                     FCPDDPIVSAGKLAEADGGVLFLDEVGALPHHTQLRLFTAMQSGQYESNGSRVTSNAR
                     IMTSSSQPLVDFVHMGRFHAGLYHLLGSFSIAMPPLRERVEDISILVHQFAVRFASEE
                     RLSHITGIAPHLLERLKAYQWPGNVRELKNAVYRAVLLCDKSELTVEDFAQLNLGAAG
                     FAGAQAMWQKPAAPLSVGRAGTAFSGIDADGEVRTLAAAEEEMIRFAIAHYDGQISEV
                     ARRLGIGRTTLYRKLKEYGIDVASISGKGKESDLENESCSWGRAAI"
     gene            83790..85751
                     /locus_tag="BSVBI22_RS10455"
                     /old_locus_tag="BSVBI22_B0083"
     CDS             83790..85751
                     /locus_tag="BSVBI22_RS10455"
                     /old_locus_tag="BSVBI22_B0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006110371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005974736.1"
                     /db_xref="GI:492817102"
                     /translation="MKKYFSKVWTGACSGVMRARASISAGLAIAAVAMVVLPSQASAE
                     TRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQ
                     VYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR
                     AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWPRMSRRELLALFPDGKTVHIPTDGKP
                     LPGYEQALAMIEKRKAGGGTIMMASNSSSRKRKSLFAALFGGGGADEEEDNGDTAAPA
                     TARPARATAPTRQAPAAVPAAPVEQPRETMVAALPARDAPVPMQAPRPETGLDAQAAA
                     AETPVAAFNVPVPAHKPQMAPQDAVALAAAEDPAAAARAAVDANTAQVADAGMSAALT
                     NGFVPVPSARPHLETDNVQLAAAVIPTARPERPGEHPARGQDAIAALVNSQSDEPAQM
                     AGEMADATGNAVAPQPGKTAAFPLPTQAPRADTKLAMVSRRDEIGELIAPPEDDYDYD
                     AKPVAAAAPKQAPAPVQMASAAPTKPAAVASAAMRKKAAIIGKTADTGVRTTTKGARH
                     MAKAPSRPRPVIRPAVMPSSEIAMSTEPVSSTVPVTSPVLRNDALRSAPTMVYTAGFQ
                     RGDLPSARANQFSGNAVTFLTVAKFTETN"
     gene            complement(85817..86371)
                     /locus_tag="BSVBI22_RS10460"
                     /old_locus_tag="BSVBI22_B0084"
     CDS             complement(85817..86371)
                     /locus_tag="BSVBI22_RS10460"
                     /old_locus_tag="BSVBI22_B0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191607.1"
                     /note="catalyzes the formation of pyruvate and glyoxylate
                     from 4-hydroxy-2-oxoglutarate; or pyruvate and
                     D-glyceraldehyde 3-phosphate from
                     2-dehydro-3-deoxy-D-glyconate 6-phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphogluconate
                     aldolase/4-hydroxy-2-oxoglutarate aldolase"
                     /protein_id="WP_006191607.1"
                     /db_xref="GI:493203444"
                     /translation="MPFHWRALARGGLPAIEITLRTAAALDAIRAVADEVPEAIVGAG
                     TILNAKQYEDAAKAGSRFIVSPGATKYIVAAANDSDVPLLPAAITPGEMLALREEGYT
                     HLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANARTYLPLPNVLCVGGSWVAP
                     KELVEAGNWNAITDLAKDAAALKA"
     gene            complement(86648..87223)
                     /locus_tag="BSVBI22_RS10465"
                     /old_locus_tag="BSVBI22_B0085"
                     /note="peptidoglycan-binding protein; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            87354..88271
                     /locus_tag="BSVBI22_RS10470"
                     /old_locus_tag="BSVBI22_B0086"
     CDS             87354..88271
                     /locus_tag="BSVBI22_RS10470"
                     /old_locus_tag="BSVBI22_B0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q579Z7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004689973.1"
                     /db_xref="GI:490827883"
                     /translation="MSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAA
                     EGINGTVAGSAGAIEKLIAHITAIPGLGEPELKYSHASEMPFHRMKVRLKREIVTMGV
                     EGIDPLKSVGTYIAPKDWNALIADENTVVVDTRNDYEYAIGTFEGAIDPQTRTFREFP
                     EWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVPREQ
                     SVWNGECFVFDERVAVGHGLAESDVELCRACRRPLTPQDKLSQFFEEGVSCAGCYAER
                     TPEDRARYAERQKQVKLAEKRGANKHIGS"
     gene            88552..89307
                     /locus_tag="BSVBI22_RS10475"
                     /old_locus_tag="BSVBI22_B0088"
     CDS             88552..89307
                     /locus_tag="BSVBI22_RS10475"
                     /old_locus_tag="BSVBI22_B0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_004689974.1"
                     /db_xref="GI:490827884"
                     /translation="MKKLIAAFLITIAAGAASVAQAAEKVTVFAAASMKDVIEEAARQ
                     IKARDGTEVVASFASSSALARQIEQGAPAQIFISADLDWMDYVEKAGLIDKASRKIIA
                     GNALVIAAQKDTPKGDARELLSADRFAMGDPSNVPAGKYGKAALEKLDIWKEVEKNAV
                     FTENVRVALRYVSLAEVKTAIVYASDRVAAPELVEAYRFPADSHAPILYPAALLKKNE
                     SDAARTFLAFLESDAGQAIIKDKGFVGAAEAAE"
     gene            89318..90004
                     /locus_tag="BSVBI22_RS10480"
                     /old_locus_tag="BSVBI22_B0089"
     CDS             89318..90004
                     /locus_tag="BSVBI22_RS10480"
                     /old_locus_tag="BSVBI22_B0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter permease"
                     /protein_id="WP_002966489.1"
                     /db_xref="GI:489056351"
                     /translation="MIMESNIWQIVLLSLRVAGIAIIIALPLAFLVGWLLARFHFPGK
                     SLVQAIVTMPLVLPPVVTGYLLLILFGARGPLGAPLQEWLGLSFAFRWTGAALAAGVM
                     AFPLLVRPIRLSIEGLDRGLEEAARTLGASRFTAFFTVILPPLLPGILAGAVLGFAKA
                     LGEFGATITFVSNIPGETQTLSLAIYTLLQTPSGDAEAFRLIAVSATISIAAVVLSEW
                     LQRRLAGGVK"
     gene            90001..91080
                     /locus_tag="BSVBI22_RS10485"
                     /old_locus_tag="BSVBI22_B0090"
     CDS             90001..91080
                     /locus_tag="BSVBI22_RS10485"
                     /old_locus_tag="BSVBI22_B0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006163936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum import ATP-binding protein ModC"
                     /protein_id="WP_004692595.1"
                     /db_xref="GI:490830509"
                     /translation="MSGLTVSIRGRNGAFAIEAGFAAEGGVTALFGHSGAGKTTLLKM
                     IAGTLRPENGRIAVGDFTLFDAQKGINLPPEKRCIGYVFQDARLFAYMSVKRNLTYAR
                     WAGHRQATRSFDEVVALLGIGHLLDRRPSTLSGGERQRVAIGRALLSDPALLLLDEPL
                     SSLDHARRQEILPFIERLRDESHVPIVYVSHEIDEVARLADQIVLLSAGRVTASGAAA
                     DIFPLIDAESEGGGVLLEGIVSAYDERYKLAEIDLGGASFQLSDAGLKQTMHVRLRVR
                     ARDVSIARKIPEAISIRNLLPVTVTGIERGEGPNAHVFLDFRGRRLGARLTRRSVDDL
                     GLSVGDQVVALVKAVSVDRAAIREK"
     gene            91150..91827
                     /locus_tag="BSVBI22_RS10490"
                     /old_locus_tag="BSVBI22_B0091"
     CDS             91150..91827
                     /locus_tag="BSVBI22_RS10490"
                     /old_locus_tag="BSVBI22_B0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase GCN5"
                     /protein_id="WP_004689976.1"
                     /db_xref="GI:490827886"
                     /translation="MTDLQNWTSRPKPERKIFEGRYVRLEPLNAQKHGDELFAASSVE
                     DAEQRFTWLFETPPATRAEFEPWLDKASKSDDPLFFAVIDKASGKVAGRQALMRIDPA
                     NGVIEIGSIYWGPLISRRPAATEAQFLFMQYVFDVLGYRRYEWKCHNENGPSRRAAER
                     FGFRFEGIFRQHMVVKGRNRDTAWFSVLDSEWPALKQAYQAWLAPENFDSAGQQKKTL
                     QEFRDLG"
     gene            91814..92023
                     /locus_tag="BSVBI22_RS10495"
                     /old_locus_tag="BSVBI22_B0092"
     CDS             91814..92023
                     /locus_tag="BSVBI22_RS10495"
                     /old_locus_tag="BSVBI22_B0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966486.1"
                     /db_xref="GI:489056348"
                     /translation="MILAERKESNPAIAAAIILIGFGVLAYFVPSIMLVLGKHSQIAA
                     IIFPIVFVLGFFAIFWLRSKGQNKN"
     gene            complement(92320..92826)
                     /locus_tag="BSVBI22_RS10500"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(92968..94071)
                     /locus_tag="BSVBI22_RS10505"
                     /old_locus_tag="BSVBI22_B0095"
     CDS             complement(92968..94071)
                     /locus_tag="BSVBI22_RS10505"
                     /old_locus_tag="BSVBI22_B0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel/cobalt exporter"
                     /protein_id="WP_002971298.1"
                     /db_xref="GI:489061260"
                     /translation="MRRTAGFMIALCLTMIVAQAYAQSSLGIGANEVAMKPTGPFAHI
                     ILWMNEQQRSFYLAMTTALKAMREDPLQAAWGLVGLSFIYGIFHAVGPGHGKAVISSY
                     MIANETALRRGIFLSFISSLLQAIMAVAVVGLAWLVLRGTGISMNQTAHYMEIASFAL
                     VLFFGLWLLVRKLPQLFRKRDHAGAGPASPLFAAAPQPAIVSGPAWQGSISQATRTAA
                     TSSTVKLNYKPATAATDHIFIGEGDVCAACGNAHIVDPSTLGDDFNWKTAWSAIFSVG
                     LRPCSGALIVLTFALLNGLMVGGLLSVFAMALGTFITVAVLATLAVTAKNTALRFAGS
                     KAMSGRLKAAIEVCAALFITLTGALLLSAALVK"
     gene            complement(94071..94775)
                     /locus_tag="BSVBI22_RS10510"
                     /old_locus_tag="BSVBI22_B0096"
     CDS             complement(94071..94775)
                     /locus_tag="BSVBI22_RS10510"
                     /old_locus_tag="BSVBI22_B0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966482.1"
                     /db_xref="GI:489056344"
                     /translation="MKFSMLVSLWPRRSFVRSAAIALLAGCLPTLAHAHPHVFAEARL
                     ELTIAPDGTVQQLAHVWRFDDVFSSTVLMEFDKKGDLQLDHKELVDLAHVINSSIAEF
                     KYFQSVLADGKDVKMARPTDLAAAFTDNRLLIVFTSKPEKPLKLAPGHKVSFGVYDPT
                     FYTAIDYVKDSDLVVKGLPAGCTSKVIRPDPDEAIAQNQATLTDAFFNDPTGTDMSKI
                     FATRLEIDCAAKGKTG"
     gene            complement(94815..95708)
                     /locus_tag="BSVBI22_RS10515"
                     /old_locus_tag="BSVBI22_B0097"
     CDS             complement(94815..95708)
                     /locus_tag="BSVBI22_RS10515"
                     /old_locus_tag="BSVBI22_B0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006279860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_006191611.1"
                     /db_xref="GI:493203448"
                     /translation="MDTLTRMRAFIDVVEAEGFSAAARKIGRSKALLSKYVRELEDEL
                     GARLLNRTTRQFSLTEAGHTYYHRALEIIREIDALQDAVSETSSDARGRIKLSAPRTF
                     TDAVIGQSLIDFCLAHPEIVLDVRLDDRFVDLVEEGFDLAIRITRLQDSSLIAKRLSP
                     FHSVLCGAPELIARVGKPQRPEDLTDRPCIVDTNARARNNWHFRNMDGSMMTVPVSGP
                     IEINSPVATKNAALAGLGFCMLPAFIAEDEIEQGKLITCLDEFIVRDGGIYAVYPHRR
                     YLPAKIRALVDFMTQWFKERE"
     gene            complement(95712..96917)
                     /locus_tag="BSVBI22_RS10520"
                     /old_locus_tag="BSVBI22_B0098"
     CDS             complement(95712..96917)
                     /locus_tag="BSVBI22_RS10520"
                     /old_locus_tag="BSVBI22_B0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681276.1"
                     /note="catalyzes the hydrolysis of a monocarboxylic acid
                     amid to form a monocarboxylate and ammonia; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_006191620.1"
                     /db_xref="GI:493203457"
                     /translation="MANLDPFNALIAKPEKPLAHAASGPLAGERLAVKDIYDIAGMVT
                     GCGNPQILAESPVARKSAPVVEKLLAAGAEFIGKAQMDEVAFSMMGQNSHYPYPINPA
                     APDRVTGGSSSGSAAAVAGKLADIALGSDTGGSIRTPASFCGLIGLRSTHGRIPLEGI
                     MPLAPSLDTIGWFARDIALYEKVGAVLLGDDAQEFKLTQLLYMPVLEQLLLGQAETDA
                     YRAMFAKVRPHFATLKAASQPTLSIDELYLAFRQIQGAEAWENHGAWISSGNRQLGPG
                     IADRFAYGAEMTADMVKNQRARRARFAEEFEAIIGESAVLALPTVPGAAPLTGEPFEA
                     LQAYREQALRLLCLSGLSGLPQITLPLGSLRPGGTMHDAPFGISFIGPRGSDRTLIAL
                     AQTIISERS"
     gene            97502..98635
                     /locus_tag="BSVBI22_RS10525"
                     /old_locus_tag="BSVBI22_B0099"
     CDS             97502..98635
                     /locus_tag="BSVBI22_RS10525"
                     /old_locus_tag="BSVBI22_B0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine decarboxylase"
                     /protein_id="WP_002966479.1"
                     /db_xref="GI:489056341"
                     /translation="MATQRIIDFLNTRRPEGPCLVVDTDVVRENYQGFEKALPYSRIF
                     YAVKANPAPEILRLLASLGSSFDTASVAEIEMALEAGATPDRISYGNTIKKERDIARA
                     FDLGIRLYAVDCVEEVEKIARVAPGSRVFCRVLTDGEGAEWPLSRKFGCVPAMAKDVL
                     RRAKALGLDAYGVSFHVGSQQTDLTAWDRALADAAAVFRTLADEGIILRMVNMGGGFP
                     TRYLKDVPTAQAYGMAIFDALSRHFGNRIPETIIEPGRGMVGNAGVIKTEVVLVSRKA
                     DNDNVRWVYLDIGKFGGLAETMDEAIRYQIVTPHDGSETEPCVLAGPTCDSADVLYEK
                     TPYPLPVSLTIGDEILIEGTGAYTTTYSAVAFNGFEPLRSYVI"
     gene            complement(98711..100429)
                     /locus_tag="BSVBI22_RS10530"
                     /old_locus_tag="BSVBI22_B0100"
     CDS             complement(98711..100429)
                     /locus_tag="BSVBI22_RS10530"
                     /old_locus_tag="BSVBI22_B0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006172468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chain-length determining protein"
                     /protein_id="WP_004692586.1"
                     /db_xref="GI:490830500"
                     /translation="MDGEDKRKSGSEGKPLLAFSDAPVSDSKKSRSTEDQASPTPPWT
                     PPASPRERAQYYRSHQSASSALTDEEIAELREIGRDAASSEDKASPSDKEQPASDADE
                     NWPRRSNAAQDAEWKPLIDPRIAIDVIRGSRRLLLATTIFGGIVATLYALSLPQTYIA
                     STDILVDPRNIKVVGTELTPGQLPTDASLAVAESQARMIDSSSVLLKVINKAHLIQDP
                     EFNGTLVPTGIVGFFAQLKDLIGKKEQSDSQTMETRVLDNLRKSLTIHRDAKTFIYSI
                     SVTTREANKSASLANEISSVFQDELASLQSDAARRTSEELFQRLADLRASVEGAEKAV
                     ADFRATHDLIDVDGRLISNNELGRLNEQLTNQRAETVRLQARINVLKDATPDSVVAGT
                     LPEDLRSNTLTALRAQYAQARQAANGMATRLGPRHPQLIQLNSQANAVLNDISAELQR
                     VRSSLQVEVQRSQQQETALSARLAQLKARQANDAKDLVKLRELEREAAARRSIYEAFL
                     LRSRETSEQEGLNTVNIRVLSAARPPLEPAGSTRKLIVIAGLIAGFLAGLAITIIRNF
                     GRLLRL"
     gene            complement(100555..101457)
                     /locus_tag="BSVBI22_RS10535"
                     /old_locus_tag="BSVBI22_B0102"
     CDS             complement(100555..101457)
                     /locus_tag="BSVBI22_RS10535"
                     /old_locus_tag="BSVBI22_B0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004689981.1"
                     /db_xref="GI:490827891"
                     /translation="MARRQNMAEGRSPVKTAIVTASWDQDFERCKLLCETVDKYTTGF
                     TKHYILVESKDVALFRQLESSRRIIIDERDLLPSWLHAFWDPTHLWRRRIWLSLKTKP
                     LRGWHVQQLRRIALAGAMEEDGFLYMDSDMAFLRPFDCSTLWHGEKLRLFVRPNALAN
                     PKWPEHPVWAANAAKLLGIQNGKSGLNDYIGQLVSWRRDSVISMCERIEAHTGQHWVA
                     ALGKIRGFSECILYGRYVDDILKGVGHFHDTGDLCRVYWFSPPPTEDEFRAFIAGLEP
                     HQVAIGMQSFIGLSVDDIRRVINI"
     gene            complement(101415..102176)
                     /locus_tag="BSVBI22_RS10540"
                     /old_locus_tag="BSVBI22_B0103"
     CDS             complement(101415..102176)
                     /locus_tag="BSVBI22_RS10540"
                     /old_locus_tag="BSVBI22_B0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-mannosaminuronic acid
                     transferase"
                     /protein_id="WP_006015053.1"
                     /db_xref="GI:492865327"
                     /translation="MDMSDDKVSYRNILGTRVACFTWDSAFAFFEKRIESRSFMKQSW
                     LNAHNANIAYENPVFRKALEDFLILPDGIGVDIASKVFYGERFPANLNGTDFVPGLLQ
                     HMKRPLKIGLLGGLPGVAANAAQLFKKQVSRHDYRVISDGYFKPANLDAILARLKDFH
                     PDILLVAMGVPRQEFFIDAHITGEHCTIASGVGALFDLHTGRVQRAPQWMRKLRMEWV
                     YRLLQEPQRLAKRYLLGNPAFLWRVAKTWLKGDHR"
     gene            complement(102177..103367)
                     /locus_tag="BSVBI22_RS10545"
                     /old_locus_tag="BSVBI22_B0104"
     CDS             complement(102177..103367)
                     /locus_tag="BSVBI22_RS10545"
                     /old_locus_tag="BSVBI22_B0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006163943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_002966475.1"
                     /db_xref="GI:489056337"
                     /translation="MQSFRLLFVTSLVPHAIAATGYEVANAAVIDGLRRAGADVTVLG
                     FTWPGHRAAEDPDTIVLGEVEVRTENAGLKRKVCWVLKSFLTGLTVSSAKLRVIPEQK
                     LRETIRQLGEFDAYVLNGVTLAGAFVDVFKDKPCLFVAHNVEHRSAEENAQNAGGIQK
                     FLFQREAGILKGLETRLCQQASFVFTFAQDDGPALGLDQDHFATLPLVTPGGMQIAQD
                     RPVEYDLALIGTWTWHPNRIGLEWFLHEVKPLLPQDISIAIAGSTPADLIEAWPGVNF
                     VGKVPDATAFVEAGALIPLISRAGTGVQLKTIETFELGMPSVATSHSVRGISQVPANC
                     TIANNPSDFAAAVIKQLEKIRTGDRQKLDGKIFTRSQIKGMDQAIARGLAALRRRLGN
                     TDCI"
     gene            103503..104495
                     /locus_tag="BSVBI22_RS10550"
                     /old_locus_tag="BSVBI22_B0106"
     CDS             103503..104495
                     /locus_tag="BSVBI22_RS10550"
                     /old_locus_tag="BSVBI22_B0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_004686188.1"
                     /db_xref="GI:490824098"
                     /translation="MSALPDHIEVISKTSDLRFEDIDIVVTLPTFRRPDHLIRTLDTL
                     KAQKTEKRFAVIVIENEAEKREGAEVAAPLFADGTYRGMLIVESHRGNCNAYNAGWLT
                     AMTCFPNFKYILVIDDDELADPMWIENMVSAAGRFDASLVGGPQYPVFEKPNSQQWAK
                     HPVFMPPYTKTGAVPIIYSSGNLLIARPVLEAIGYPFLDLMFNFTGGGDSDFVGRSKA
                     KGFRIAWCAEGIVRETIPARRLEGDWIRARGLRNGVLSTLTEQRRRKDEPCGQIRVFL
                     KSLALLAYSPIKALRRGLAAGFAPAGMYFIYVGLGRVLAHFGYLNEQYRNPDKN"
     gene            104464..105789
                     /locus_tag="BSVBI22_RS10555"
                     /old_locus_tag="BSVBI22_B0107"
     CDS             104464..105789
                     /locus_tag="BSVBI22_RS10555"
                     /old_locus_tag="BSVBI22_B0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008937027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin transporter BioY"
                     /protein_id="WP_004681289.1"
                     /db_xref="GI:490819191"
                     /translation="MSNIVTRTRTDARMPDATGPQARIRRIALVIASVIFGVLLISFR
                     PFTPAGGAETETGGDIINQLGFSCVGAVALASMAMFANLRKLAGIIRPGWLVMLVFLF
                     ASIFASSDPATAVRGVLLTTVGIVAIIAVLVLPQDGDGYSALLVSVASVVIVISYAGV
                     VLLPSLGTHGADAIEPQNSFLWRGVFSHKNIAGPVMAVFAFAGLYLWRRGWKTSGLLI
                     GLSALGFVSQTGSKTTMALVPFAMLLVVLPGLMGLRKLTAGLIFAIQLAFATFTFGVV
                     LFEPIRRLVENMDVDATFTGRVSIWKFALEALSKRPWTGYGYESFWSSAYARHAARPY
                     YLDWDVRGIVHGHNSYLDVAMTMGIPALLCAIAVIIVMPLVHYARCRPVRENMLLADF
                     FLMIVLFGTLNAMMESFFFRRMDPVWLTLILAIFGLGMTAKVVIPKRSV"
     gene            105803..106939
                     /locus_tag="BSVBI22_RS10560"
                     /old_locus_tag="BSVBI22_B0108"
     CDS             105803..106939
                     /locus_tag="BSVBI22_RS10560"
                     /old_locus_tag="BSVBI22_B0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011265393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002966472.1"
                     /db_xref="GI:489056334"
                     /translation="MNIAIIGTGFVADYYMTTLRNYPELSLRGVYDRSPERLKAFVAH
                     YNVPAYESYEALLADPDVQIVVNLTTPESHFAVSHAALCAGKHVYSEKPLAMDFDDAK
                     ALLELARQSGLTLAAAPANGLSDAHKLVSSLIKTIGTPRLVYAEMEDGPVFRDKWSTW
                     RSQSGAPWPGLHEFEIGCTLEHAGYALSWLVSLFGPVESVSAFSAITFPDKGPGTEHL
                     HMAPDFSVGCLVFKSGLVARLTSGLAMPKDRSLTVVADKGSIVVDDLWDNRSAVRLER
                     VEEKRRFFARLFANLERRLGKFLSWKPGVGRKIAYPKTGKYALPSFPSQIDFMRGVAD
                     QARSISSGEKAFFSGDVALHITEIALALNNAGQGAAVYRMKSSF"
     gene            complement(106936..107985)
                     /locus_tag="BSVBI22_RS10565"
                     /old_locus_tag="BSVBI22_B0109"
     CDS             complement(106936..107985)
                     /locus_tag="BSVBI22_RS10565"
                     /old_locus_tag="BSVBI22_B0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_006191649.1"
                     /db_xref="GI:493203486"
                     /translation="MTQNERIGGDFRWGIWGTDMIASSFAADIAASAGMRVVAVCSHT
                     MQTAQAFCRHIGINKAFGNPHAFLADPEIDAVYIASPNMLHVEQALDAIMAGKACLIE
                     KPLSLDPEGARQIETASKARNIFAMEAMWTRFLPAVQAVKHAIDASRIGTVTHIEADL
                     SYSRAYDPESRFFSPALGGGAAFDLGVYPLSLALYFLGLPEKVDGHCQRAASGVDLRS
                     EFNLGWPSATAWISCGFDRDGENRMLIEGTDGAILIHPPFLKAQRLTFFSRSALHSPF
                     GPKNSKGRIGNIINRLPLPGRTIETHAFAGNGLQFQAQAVRDAIRRGEISTPIMPLAQ
                     SAAVADIISRVLVSG"
     gene            108302..109711
                     /locus_tag="BSVBI22_RS10570"
                     /old_locus_tag="BSVBI22_B0110"
     CDS             108302..109711
                     /locus_tag="BSVBI22_RS10570"
                     /old_locus_tag="BSVBI22_B0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686833.1"
                     /note="catalyzes the formation of D-ribulose 5-phosphate
                     from 6-phospho-D-gluconate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="WP_002967175.1"
                     /db_xref="GI:489057051"
                     /translation="MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIE
                     KAGRLRDKIIPCPTFEELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDA
                     GNSDYRDTVRRLKALGPNDPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLA
                     VAAKYQGEPCCALVGPDGAGHFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGD
                     VFEKWNEGPLNSYLIEITAKVLKSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILG
                     VPATGIEAAVAARSLSSMKGEREEAAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIA
                     AYAQGFAVMEAASREHGWNIPLATTARIWRAGCIIRSQLLDDIAQAFEGNESRNLLMA
                     PAFVPRMETSVKSLRQIVAQAALASLPLPALGSALSYFDSYTQALGTANLIQGQRDFF
                     GSHGFKRIDKEGDFHGPWG"
     gene            complement(109807..110868)
                     /locus_tag="BSVBI22_RS10575"
                     /old_locus_tag="BSVBI22_B0111"
     CDS             complement(109807..110868)
                     /locus_tag="BSVBI22_RS10575"
                     /old_locus_tag="BSVBI22_B0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010660707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter ATPase"
                     /protein_id="WP_004689984.1"
                     /db_xref="GI:490827894"
                     /translation="MAFLNIKNLKKSFGTNTVVHDFNLAVEKGEFVSFLGPSGCGKTT
                     VLRMIAGFETPDNGSIEIDGKDVVNLRPNQRNIGMVFQAYALFPNMTVAQNVSFGLRV
                     SGKSRSEIDATVKEMLSLIRLDHLADRYPYQMSGGQQQRVALARALATKPQVLLLDEP
                     LSALDAKIRISLREEIRAIQQKLGITTVFVTHDQEEALSISDRIVVMHEGRADQIGSP
                     FDIYNRPASRFVASFVGTLNMLEASVSEPAQNSIDLDGRQITVQETLAHHPKGKPLTL
                     ALRPEAVSLEARKSHDTSLEATIDDVHFLGSVIRTRVILGKNRLSFDTFNDPTHPPPQ
                     RGYKVTVHFASHDLLVLAD"
     gene            complement(110874..111692)
                     /locus_tag="BSVBI22_RS10580"
                     /old_locus_tag="BSVBI22_B0112"
     CDS             complement(110874..111692)
                     /locus_tag="BSVBI22_RS10580"
                     /old_locus_tag="BSVBI22_B0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="WP_004689985.1"
                     /db_xref="GI:490827895"
                     /translation="MKSKGSNLRKISAQKIGAWIAFFVGAIYFLVPLIGTFEFSLRMR
                     RGEYSFDAYRVVFADANFQATFTYSIVLGLLTIIFGVLLVVPTAYWVRLRLPQLRPVM
                     EFITLMPLVIPAIVIVFGYLRIYNSSSWLPFTASTRATDVLLMFGYMTLSLPYMYRAV
                     DTAMRTIDVNTLTEAAQSLGAGWGRIMFKVIFPNVISGVMSGAFITFAIVIGEFTLAS
                     LLNRPAFGPYLQLVGANRAYEPSALAIISFGITWLSIIMLQLVSRLNKFKTTAG"
     gene            complement(111698..112582)
                     /locus_tag="BSVBI22_RS10585"
                     /old_locus_tag="BSVBI22_B0113"
     CDS             complement(111698..112582)
                     /locus_tag="BSVBI22_RS10585"
                     /old_locus_tag="BSVBI22_B0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="WP_004692576.1"
                     /db_xref="GI:490830490"
                     /translation="MSSVAETTAPTSGVRKRQLPLSWLGVAPFFLFAILFLIWPTMYL
                     IIGAFQDPAGNFTLQNIHDLFQPQIMSAYWISIKVSFASAVGGAIIGFFLAWAVVLGN
                     LPSWLRPTVLTFSGVASNFAGVPLAFAFLATLGRTGFVTILLREWFGFNLYSTGFNLL
                     SFFGLTLTYLFFQIPLMVLILTPALDGLKKEWREASSILGATHMQYWRMVAFPILWPS
                     LLGTTLLLFANAFGAIATAYALTGSSLNIVPILLYAQIRGDVLHNQNLGYALALGMIV
                     ITGVSNLLYIWLRIRAER"
     gene            complement(112791..113894)
                     /locus_tag="BSVBI22_RS10590"
                     /old_locus_tag="BSVBI22_B0114"
     CDS             complement(112791..113894)
                     /locus_tag="BSVBI22_RS10590"
                     /old_locus_tag="BSVBI22_B0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006172475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_006191658.1"
                     /db_xref="GI:493203495"
                     /translation="MLSYTARLLSLSTAIAVAGVSIATAEPSAELIAAAKAEGELTTI
                     ALPHDWCGYGDIIKSFKDKYGIKVNELNPDAGSGDEVEAIKANKNNKGPQAPDVIDVG
                     FAFGTSAKKDGLTQAYKVSTWDEIPDSAKDPEGHWYGDYYGVLAFEVNKDIVKDAPQD
                     WEDLLKSDYANAVALAGDPRVSAQAILGVHAAGIARGAEPGEAAGKKGLEFYKELNAN
                     GNFVPVIGKAASLAQGSTPIVIRWDYNSLADRDTLNGNPEVETIIPKSGVIAGVYVQA
                     ISAYAPHPNAAKLWMEHIYSDEGQLGYLKGYCHPIRFNAMAKAGKIPQELLDKLPPAA
                     AYEKAIFPTIEQIEATQATITKDWDSVVGANVQ"
     gene            complement(114303..115892)
                     /locus_tag="BSVBI22_RS10595"
                     /old_locus_tag="BSVBI22_B0115"
     CDS             complement(114303..115892)
                     /locus_tag="BSVBI22_RS10595"
                     /old_locus_tag="BSVBI22_B0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_004692573.1"
                     /db_xref="GI:490830487"
                     /translation="MAADTTIGTVGGKNPADDRIDPKKTIGFMAMVFGMFMAILDIQI
                     VSASLSEIQAGLGASTDEISWVQTSYLIAEVIMIPLSGFLGRLLSTRVLFTISAAGFT
                     LASMLCATATNIEQMIVYRAIQGFIGGGMIPSVFAAAFTIFPPSKRSIVSPMIGLVAT
                     LAPTIGPTIGGYLSHAFSWHWLFLVNVGPGILVTIAAWNLIDFDEGDLSLLDKFDWWG
                     LFGMAAFLGSLEYVLEEGPRNDWLQDHTIFIMSIIPTVGAIVFFYRVFTAEQPIVDFR
                     AFRNMNFAFGSLFSFVMGVGLYGLTYLYPLYLSMIRGYDALMIGEALFVSGLAMFFTA
                     PVAGFLSNRMDPRLMMMIGFVGFAIGTWLVTGLTADWDFNELLMPQILRGCSLMLCMV
                     PINNLALGTLPPSLMKNASGLFNLTRNLGGAVGLAVINTILTRRGDMHYARLAEHVRN
                     GNAEAENMIANLTAKYNAAGMDGASIAIAKLSGMVRQQATLLSFIDVFFILTMMFCSL
                     AICAMLLRKPSPAAGGGGGGH"
     gene            complement(115985..116938)
                     /locus_tag="BSVBI22_RS10600"
     CDS             complement(115985..116938)
                     /locus_tag="BSVBI22_RS10600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005974706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="WP_004692571.1"
                     /db_xref="GI:490830485"
                     /translation="MVSTDDAYVQGDIASIAPKVTGYIENIPVAANQQVKAGDVIFQL
                     DAGDYQIALDEANAKLATQKETLIRIQAQTDAAKAALLQANADQQAAKAVLLNAQSTM
                     ARVQKLHETRFVAQSELDNAQSALDQARARLAGADAQIASAKANISVLEAQYNEAASS
                     TKSLELARDKAARDLSFTSLRAPFDGVIGNLSGKKGDLVAPGQKIAALVPVDQLYIDA
                     NFKETQLAHIKVGETAHIYVDAIDGTKFDGKVASIAPASGAVFSLLPPENATGNFTKV
                     VQRVPVRITIPKEAFESGKIRAGLSVIVDVDTRTAPDQTAN"
     gene            117327..118070
                     /locus_tag="BSVBI22_RS10605"
                     /old_locus_tag="BSVBI22_B0117"
     CDS             117327..118070
                     /locus_tag="BSVBI22_RS10605"
                     /old_locus_tag="BSVBI22_B0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_002966461.1"
                     /db_xref="GI:489056323"
                     /translation="MKPARNTSRIGDISDDKKGELRSAPDKAELSASCLPETECGRTR
                     LAAGQDPAKRSQILEGAQSVFLRMGFDAASMNDITREAGVSKGTIYVYFNSKEDLFVA
                     LCEHYRQTLFSSFIGQLEKGFSNRQELIDFGVALTTLITSSIAIRAQRIVVGVSERKP
                     ELAARFYERGPKRSHAIMAQSLQAMIDAGVLEQHDVTRTAYQLSDLFFAGLYRPRLFG
                     ALAEAPSEQAIRDNVESAVDFFFRAYGKK"
     gene            118344..119123
                     /locus_tag="BSVBI22_RS10610"
                     /old_locus_tag="BSVBI22_B0118"
     CDS             118344..119123
                     /locus_tag="BSVBI22_RS10610"
                     /old_locus_tag="BSVBI22_B0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006128260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type quorum sensing-dependent
                     transcriptional regulator VjbR"
                     /protein_id="WP_002966460.1"
                     /db_xref="GI:489056322"
                     /translation="MSLDLVHFPNYKKTFFGSSFQSDTLALLTRIRDEIGCRYVTHTY
                     RGRVGDCTKVNSADLTVLMTLPATWVARYSSKNYFAIDPVFQEDAPYYRNDTSAIARD
                     LKEDADICPAVAELLHDAEKHGLGNLFIAVSARNPKGVAGCTVFTFEVEDEDRTQFLA
                     RMRPRLLSLAGIIHGTVCGCKDANSVASLLTPREVDCLRWAANGKTDGEIAEILSIAR
                     WTVVTYLQNAKIKLNCSNRTSAVATALSLGIIDMPEVQHLV"
     gene            complement(119192..119620)
                     /locus_tag="BSVBI22_RS10615"
                     /old_locus_tag="BSVBI22_B0119"
     CDS             complement(119192..119620)
                     /locus_tag="BSVBI22_RS10615"
                     /old_locus_tag="BSVBI22_B0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004685118.1"
                     /db_xref="GI:490823028"
                     /translation="MKSLQFSKERETIIAENIREVVSDLRLVDPADYIAFIRCELFAN
                     IADLVSSAAELYFYPGTLGLGHGGEFHCDWQSPPSITLDMEFRHQGVYAYFRITLTDR
                     TAGVELNHIAFEDADGDPSANTVRLAKAFEDARLPLRKRA"
     gene            complement(119731..120801)
                     /gene="flhB"
                     /locus_tag="BSVBI22_RS10620"
                     /old_locus_tag="BSVBI22_B0120"
     CDS             complement(119731..120801)
                     /gene="flhB"
                     /locus_tag="BSVBI22_RS10620"
                     /old_locus_tag="BSVBI22_B0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444205.1"
                     /note="membrane protein responsible for substrate
                     specificity switching from rod/hook-type export to
                     filament-type export; Bradyrhizobium has one thick
                     flagellum and several thin flagella; the Bradyrhizobium
                     protein in this cluster is associated with the thin
                     flagella; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="WP_004689992.1"
                     /db_xref="GI:490827902"
                     /translation="MADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIASFL
                     VIAVFVAAPAATRLAVFLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIII
                     PLAGIAASAFQNAPRFVGERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASV
                     IVFLVFFKGNSLFTDAVATDPGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHW
                     RQELRMTRQEVKDELKQSEGDPLVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFS
                     VALRYKPNEDAAPVVVAKGQDLIALKIREIAASHSIPVFEDVQLARALYKQVNVDHMI
                     APEFYKAVAELIRIINTRRAIS"
     gene            complement(120818..121468)
                     /locus_tag="BSVBI22_RS10625"
     CDS             complement(120818..121468)
                     /locus_tag="BSVBI22_RS10625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006196178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073269.1"
                     /db_xref="GI:492971305"
                     /translation="MESLQAYLGNQHPQIIAYIVSRLPSDLAARLFVALPPQLRNAVV
                     QRSLHIGNVAPAAAELLEDVLRRDLLGRSDAGPLKAHHGQIANIFNQLDRSEMEELMA
                     SLQDLNRDDLNRIKAKLFTFEDIERLSQRARLLLFDEVQTEQIATALREADPKLQELV
                     LSSLSARGRRMVESELSAEQGNITSQNIAEARRIIARIAIDLSERGIITLDATPET"
     gene            complement(121484..121873)
                     /locus_tag="BSVBI22_RS10630"
     CDS             complement(121484..121873)
                     /locus_tag="BSVBI22_RS10630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073270.1"
                     /db_xref="GI:492971306"
                     /translation="MSDTEQHILAETGAAGPGNSIVDTLTGPQKAAAILVAIGRPAAA
                     RLLKHFNAEDLRKLAGHARTLEPISPLDFEQLVKQFEDLFAEGAPVSEAAQRFEGLLR
                     DTLPQEEVDAVLEDRVQPQLVQESVWI"
     gene            complement(121890..122237)
                     /locus_tag="BSVBI22_RS10635"
                     /old_locus_tag="BSVBI22_B0122"
     CDS             complement(121890..122237)
                     /locus_tag="BSVBI22_RS10635"
                     /old_locus_tag="BSVBI22_B0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliN"
                     /protein_id="WP_006191659.1"
                     /db_xref="GI:493203496"
                     /translation="MSAETKDRNMQQELNEAIEELREEKPRSAQKSASKPNLDLIMGI
                     PVDVQVVLGGTTMPVSSLMKLGCGAVITLDKQIGDPVDIVVNGRVIARGEVIVLEDDS
                     SRFGVSLTEIIGK"
     gene            complement(122234..122695)
                     /locus_tag="BSVBI22_RS10640"
                     /old_locus_tag="BSVBI22_B0123"
     CDS             complement(122234..122695)
                     /locus_tag="BSVBI22_RS10640"
                     /old_locus_tag="BSVBI22_B0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966455.1"
                     /db_xref="GI:489056317"
                     /translation="MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAA
                     ASNGLERAVKAIRNERTDLTDASAKLDARLAETQRVRREMDEAIEELNRLRKALSRDM
                     RQARILAETPPPRQEKTPSAAEQPLPADKNALPVFVRRAVKKATVELAGQA"
     gene            complement(122676..123626)
                     /locus_tag="BSVBI22_RS10645"
                     /old_locus_tag="BSVBI22_B0124"
     CDS             complement(122676..123626)
                     /locus_tag="BSVBI22_RS10645"
                     /old_locus_tag="BSVBI22_B0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM"
                     /protein_id="WP_004689995.1"
                     /db_xref="GI:490827905"
                     /translation="MDDATTLEHNRKNDALAENLLRAAGLSGDDLKSLAHVFKDASSH
                     FCARLKQGSAAAFDAETGSVESTDKTAFNDIFDKAAIITPLKAERWGCSLYLALDAVL
                     VFSVIEAMFGAQGNLGPVDADRPFGMVEQKIANLLAGHLAGALDRVFNTSSSQPLFAP
                     GDCIDTADFDRENFELSRLFTCRIAVTAAGKTGQMHLLLPRSTHKPMQDAVAAFLRRP
                     MDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDALSRLEIGQVLKLPVDAMEQVRL
                     RAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELVAG"
     gene            complement(123628..124500)
                     /locus_tag="BSVBI22_RS10650"
                     /old_locus_tag="BSVBI22_B0125"
     CDS             complement(123628..124500)
                     /locus_tag="BSVBI22_RS10650"
                     /old_locus_tag="BSVBI22_B0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="WP_011069096.1"
                     /db_xref="GI:499381525"
                     /translation="MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGT
                     FFVANPFSLVKDTGRACMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHID
                     NPKESPIFLAYPSVLKKEDLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLK
                     PYQAMITISEALPALGIVAAVLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYG
                     VIGPIANKIKSTREKNNRLYIVVKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVV
                     EQETMASVPTQQAA"
     gene            124646..125434
                     /locus_tag="BSVBI22_RS10655"
                     /old_locus_tag="BSVBI22_B0126"
     CDS             124646..125434
                     /locus_tag="BSVBI22_RS10655"
                     /old_locus_tag="BSVBI22_B0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgF"
                     /protein_id="WP_004689997.1"
                     /db_xref="GI:490827907"
                     /translation="MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKS
                     VDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFAT
                     VFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAY
                     EILGDKALLTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPDYVLKFISRFTA
                     MHEMNNPTASSPASIASFLLGGTSSIGISMNILATLQNFKPGGR"
     gene            125434..126165
                     /gene="flgF"
                     /locus_tag="BSVBI22_RS10660"
                     /old_locus_tag="BSVBI22_B0127"
     CDS             125434..126165
                     /gene="flgF"
                     /locus_tag="BSVBI22_RS10660"
                     /old_locus_tag="BSVBI22_B0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006236266.1"
                     /note="FlgF, with FlgB and C, makes up the proximal
                     portion of the flagellar basal body rod; Bradyrhizobium
                     have one thick flagellum and several thin flagella; the
                     protein in this cluster is associated with the thin
                     flagella; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgF"
                     /protein_id="WP_004688834.1"
                     /db_xref="GI:490826744"
                     /translation="MQNNSIYVGLSSLITLERRMDAIAHNVANASTVGFRGEGTKFDT
                     IVSDKASDDVSFATAGKSYIRTEAGPLIKTDNPLDVAVKGDAWMSFSTPQGQVYSRDG
                     RMKMLSTGDLVSVTGNAILDVGGAPIVLNPGGGAPRISSDGAIYQNGVQVGAIGLYTI
                     PADADLAYAGTSGVIPSKPAQPVVDDNSVGVVQGMIEGSNVDAMTEMTRLISISRAFE
                     QVNNLLSQQEATVSEAIKTLGSKNG"
     gene            126162..127430
                     /gene="fliI"
                     /locus_tag="BSVBI22_RS10665"
                     /old_locus_tag="BSVBI22_B0128"
     CDS             126162..127430
                     /gene="fliI"
                     /locus_tag="BSVBI22_RS10665"
                     /old_locus_tag="BSVBI22_B0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191660.1"
                     /note="involved in type III protein export during
                     flagellum assembly; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase"
                     /protein_id="WP_006191660.1"
                     /db_xref="GI:493203497"
                     /translation="MTPDLPLTRLAAFVRQQTIAPEPLTGIGGTVSDVSRSSIAVRGL
                     SRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMPSLGAAVFEEGPLRIR
                     PAPEWRGRVINALGNAIDGKGALKLGTRPMAAESLAPAALRRARVDRGLRTGVNVIDI
                     FTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGREVREMLEETMAG
                     HLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTRFAHAAREVA
                     IAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSIAGIYSVLVDGDDHNDPASVS
                     RLAKHNWTPEQRKLVMQLRSMVARFEETRDLRAIGAYQKGHDGLLDQAVDFVPRIYEA
                     LQQSPETGLSDDPYNDLAAALRGDRQAQNA"
     gene            127427..128032
                     /locus_tag="BSVBI22_RS10670"
                     /old_locus_tag="BSVBI22_B0129"
     CDS             127427..128032
                     /locus_tag="BSVBI22_RS10670"
                     /old_locus_tag="BSVBI22_B0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004681340.1"
                     /db_xref="GI:490819242"
                     /translation="MMTGFRKPKEDKNLTRLTAAVAAAARKEGMKKPLSKGDRYLMIA
                     VIALAAASALLPIVTYLQRVDFNPANKAERKIIDPLDRSEQKTVRRFPSFRPSEQVAP
                     ASEVDKTMTGSVMSNGKGLPGAGKGEGEIGDGRGQPFPKPVFALRDVVGGMAMIEDAS
                     GYWFVEKGSLLPDGSRLVSIGRGAGTWQLTTSSGDIIDMRR"
     gene            complement(128057..129034)
                     /locus_tag="BSVBI22_RS10675"
                     /old_locus_tag="BSVBI22_B0130"
     CDS             complement(128057..129034)
                     /locus_tag="BSVBI22_RS10675"
                     /old_locus_tag="BSVBI22_B0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_002966447.1"
                     /db_xref="GI:489056309"
                     /translation="MKQAHGPDDNRSMWMLMGIGIVCVFGFFIQILVLSRYLDRPLAL
                     FMASQKGTALVDIAAHITKFGKAYWFLVPAAALFVFYRFINRSPQKSFNCFFIIASIA
                     VSGIVIKILKIIFGRARPGVLIDDGFYGFTFFRLDREFNSFPSAHTGVAIAAGVALAL
                     IMQKHRWVPIILGIVIASSRIIINAHYLSDVVASSLISTVTVLLLYDILGYFGYRAGE
                     PDRHSPDMQGSLKLMSNVIGAPVAEHENGQRPQDGLTTRIIGVMNIAAILILIGLIFD
                     FVLIEWFEWQYQPAELIPGWWLPAAITLCALGVGASLYVGRAGRGCARR"
     gene            129578..129973
                     /locus_tag="BSVBI22_RS10680"
                     /old_locus_tag="BSVBI22_B0133"
     CDS             129578..129973
                     /locus_tag="BSVBI22_RS10680"
                     /old_locus_tag="BSVBI22_B0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968260.1"
                     /db_xref="GI:489058160"
                     /translation="MAPRAMFKRFPIFVGGSAIGAVIDYVVTLSASNYINLYPPVALA
                     LAMLISGSVVFFFHIRITFQYSTHKIFRQYALFMGWTCAIYFLRAAMLQICLYAGLPL
                     AVALILAIGLASVINFVISSVIIFAKSPS"
     gene            129970..130950
                     /locus_tag="BSVBI22_RS10685"
                     /old_locus_tag="BSVBI22_B0134"
     CDS             129970..130950
                     /locus_tag="BSVBI22_RS10685"
                     /old_locus_tag="BSVBI22_B0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bactoprenol glucosyl transferase"
                     /protein_id="WP_004688837.1"
                     /db_xref="GI:490826747"
                     /translation="MNAKTLCIIVPVYNEAEGLSDLLDRLHSAADSIASQFTLNIEFI
                     FIDDGSSDGSFALLKAHDFGSRPVRLLRFSRNFGKEAALSAGIDAAEGADAAILMDAD
                     LQHPPEMIADFVRIWQEEDADSVYAYKASRLASEGPVKAALSRAFFWVINRDQRYKIP
                     PGAGDFRLVNRRFMAALRSLPESDRFMKGLYGWVGFNQVGLPLQPPPRMRGTSYYNPL
                     QLLLMSLGAMTSFSTTPLRLMALAGIVVAGLSAAYGLYVLSEYFFFPGVPVGLTSILA
                     LTAFFGGIQLMFLGLLGEYIGKSVLEAKKRPIYILAEDIRRKESDDADRG"
     gene            130931..131683
                     /locus_tag="BSVBI22_RS10690"
                     /old_locus_tag="BSVBI22_B0135"
     CDS             130931..131683
                     /locus_tag="BSVBI22_RS10690"
                     /old_locus_tag="BSVBI22_B0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191663.1"
                     /db_xref="GI:493203500"
                     /translation="MMRIADDFGLGRGHDRVILSLLETGRLDGTSVMMNDAMNPEDIA
                     RLRKLRAGGAKVGLHLNLTQALPGGGPIWPLGELIRPLLGAPFLGAITASLVRQVDAF
                     VTQFGSLPDYYDGHQHCHCFPAIAPLVARLPYGPATWVRVPLPATWEGRWLNIRAGGA
                     KVLLILALAARARAIFVRAGLKTNHDFSGFLRLGDPASVRRWLPELLARATPDCLIML
                     HPGDGADPVQCAGHAAGSRAIEARILFESPIK"
     gene            131680..133116
                     /locus_tag="BSVBI22_RS10695"
                     /old_locus_tag="BSVBI22_B0136"
     CDS             131680..133116
                     /locus_tag="BSVBI22_RS10695"
                     /old_locus_tag="BSVBI22_B0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /protein_id="WP_004687530.1"
                     /db_xref="GI:490825440"
                     /translation="MMKNRAIVWGLFLLLFVRLLAMIWVPLTDPTEARYAEIARKMVE
                     TGNWITPQFDYGVPFWAKPPLHTWLSAAGIAIFGTTAFTARLGILLASLATLTILWQW
                     ACTLTDRRTATIAVLVAASSGLFYVSAAFVQTDMVLTLGVTASMAGFYNGLAGSRRWG
                     WLFFLGLAIGLLAKGPVAVVLSATPIAVWMLWRGNWRDLKHLPWAGGLTLCAVLVIPW
                     YAAAEIATPGFLKYFLIGEHIQRFLQPGWSGDLYGAGREHARGSIWLFWIVATLPWSP
                     LLPVLIWRLRKNGMPDGKGLHLYLLLFALTPLVFFTPAANILLAYVLPGVPAAALLAV
                     ILWTRTGPAGAGWLKLGVVEVLLIFLVITIGSFFGLGRSFLPTQAPLIASYSGPGRLA
                     ILGGRSFSAEFYTQDKIVRFQTLNELAAWLKPGDGVLVPKSAYDAFAARFGNAVKPIS
                     EDRKYLLFIPIPAASVAKGTGAAAGAVI"
     gene            133317..134315
                     /locus_tag="BSVBI22_RS10700"
                     /old_locus_tag="BSVBI22_B0138"
     CDS             133317..134315
                     /locus_tag="BSVBI22_RS10700"
                     /old_locus_tag="BSVBI22_B0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191666.1"
                     /db_xref="GI:493203503"
                     /translation="MVESRFRNDLVRAAMKPMYEIIMDPNDRSYELSGSAKLYASGLI
                     TIGTTTFNTQSYARTPKIIAQGGLDFYVLQLLTGGHLLGDFDGTDVAAKPGDIVIIDM
                     AKTLVSRAFKGSRTTVFIPRAELEEVVGGRNLHGLVLSGTRPITRLLFSYIQELNAVV
                     PDLSMDEAIAAQKVMLTFLRTGITGLEEDLVGFLPVNLPVKKRILSFIDQNLSDPLLG
                     PRTIIQNFHVSRSHLYRAFENDGGVAKTIRDKRLDRAFRILAEERNRTVYSKEVAYRC
                     GFNDPAQFASAFKNRFGMSPRDVQASGATLLSLDVDGFSFPKYISQEIEKVVPPSS"
     gene            134671..135108
                     /locus_tag="BSVBI22_RS10705"
                     /old_locus_tag="BSVBI22_B0140"
     CDS             134671..135108
                     /locus_tag="BSVBI22_RS10705"
                     /old_locus_tag="BSVBI22_B0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002966440.1"
                     /db_xref="GI:489056302"
                     /translation="MATEFEHGPDMYTPEDVIKNFKDHSSQSRSRGTKTLENEKHTAN
                     GRMVKRYTPEERRKVFSEIATSVKSGQSSLKDALATAGISEQTYYNWKKIFTGNGPAS
                     STTLGKDLQELIELEAENQRLRQELADKLRMENAELRRRLGKV"
     gene            complement(135302..136603)
                     /locus_tag="BSVBI22_RS10710"
                     /old_locus_tag="BSVBI22_B0142"
     CDS             complement(135302..136603)
                     /locus_tag="BSVBI22_RS10710"
                     /old_locus_tag="BSVBI22_B0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002972182.1"
                     /db_xref="GI:489062155"
                     /translation="MKNSNTAITSPEVVENMTYRKVAFRIIPLLMICYIIAYLDRVNV
                     GFAKLQMSEELGFSEAIYGLGAGLFFIGYFFFEIPSNILLHKLGARLWIARIMITWGL
                     LSALFAFVQTEWQFYILRFLLGAAEAGFYPGVILYLTYWFPSHRRGKMFALFQAGSPA
                     AGIFGNPLSGWIMDQFHDTAGWQGWQWMFVLEAIPAVVLGVVILLYLDNSVKAAKWLT
                     EEEKAIISRDIEADSKGKAASHSLMSLVKNPMLWVMTLIYFCFVMGQYGLTLWMPTLI
                     RASGVTSNVTIGLLGAIPFICAIIAMVIFSRSADHYRERRWHLVVPALLGAVGFVVAA
                     SATNTTVSIIFLSMAAAGVLACAPLFWSLPTAILSGAAAAAGIALINSVANLAGFISP
                     YMVGIIRDATHSSELGMYVLAGFLILGAAIVLCIPASKVNR"
     gene            complement(136629..137261)
                     /locus_tag="BSVBI22_RS10715"
                     /old_locus_tag="BSVBI22_B0143"
     CDS             complement(136629..137261)
                     /locus_tag="BSVBI22_RS10715"
                     /old_locus_tag="BSVBI22_B0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_002966437.1"
                     /db_xref="GI:489056299"
                     /translation="MTEQEIRELIVELGASLFARGYCVGSAGNISVRLADGYLMTPTN
                     SCLGRLRADRLSKLDKGWNHIGGDRPSKEVFMHRAVLGARPQAGAVVHLHSTYATAIS
                     CLSSPADTMPITPLTPYFVMRIGKHLPTIPYYRPGDPAMEREIHDAAQNASAMLLANH
                     GPVVSGNSLVDAVYAAEELEESARLSIMLQGLPARKLTDEQIEDLLHTFK"
     gene            complement(137287..138252)
                     /locus_tag="BSVBI22_RS10720"
                     /old_locus_tag="BSVBI22_B0144"
     CDS             complement(137287..138252)
                     /locus_tag="BSVBI22_RS10720"
                     /old_locus_tag="BSVBI22_B0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006105221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966436.1"
                     /db_xref="GI:489056298"
                     /translation="MAKIVVTGGAGFLGSRLIRGLLASRGQNGVPSFDSIVSVDLVAC
                     SIDDPRITSVTGDIADPAFARSVITKGTVGVYHMAAALSGQSEAEFDVGMRVNIDGTR
                     ALLEAARATQEAPKFIFTSSLAVFGGEMPDVVPENLALLPQSSYGAEKAIGEFLVGDY
                     SRRGFIDGRICRLPTIVVRPGKPNSAASSFASGIIREPLAGIASNNPVPPATRMWLSS
                     PDIAARNLVHAITVEGSALGINRVLNLPGICVTVADMLDSLERIAGKDVRALVSAEPE
                     QRVIDIVCSWPGEFDIARPLALGFTRDADFDAVVRQYRDEFAHSS"
     gene            complement(138252..139043)
                     /locus_tag="BSVBI22_RS10725"
                     /old_locus_tag="BSVBI22_B0145"
     CDS             complement(138252..139043)
                     /locus_tag="BSVBI22_RS10725"
                     /old_locus_tag="BSVBI22_B0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_014298100.1"
                     /db_xref="GI:504064106"
                     /translation="MIPAERQALIVSRLSARGILSIAELAEMLGVSPMTVRRDIHSLE
                     EQGRALSVAGGVQLPERIFSEPSHIVKAALYHNEKAAIGQLAAQMIRPGTVIYLDAGT
                     TTLEIAYRLTDRQDLTVFTNDFVIAAFLSQESNCKLFHTGGEVERENQSCVGSAAGEA
                     IRRFNFDLAFISTSSFGARGVSTPSENKIAVKRAVVESAVRRVLVTDSSKYGLIGTFN
                     AIPLDVLSAVVTDAGLPENARETITQRGVELHLVEAGTGKVEGKI"
     gene            complement(139040..139825)
                     /locus_tag="BSVBI22_RS10730"
                     /old_locus_tag="BSVBI22_B0146"
     CDS             complement(139040..139825)
                     /locus_tag="BSVBI22_RS10730"
                     /old_locus_tag="BSVBI22_B0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate isomerase"
                     /protein_id="WP_004687526.1"
                     /db_xref="GI:490825436"
                     /translation="MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDADV
                     IARELKQHNLTQVLFNMPPGDWAAGERGMAAIPGREQEFRDNVDIALHYALALDCRTL
                     HAMSGITEGLDRKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEA
                     VGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDEGEL
                     NYPYLFSVLESVGYRGWVGCEYNPRGKTESGLAWFAPYRDQSA"
     gene            complement(139825..141099)
                     /locus_tag="BSVBI22_RS10735"
                     /old_locus_tag="BSVBI22_B0147"
     CDS             complement(139825..141099)
                     /locus_tag="BSVBI22_RS10735"
                     /old_locus_tag="BSVBI22_B0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004690004.1"
                     /db_xref="GI:490827914"
                     /translation="MRLGVIADDFTGATDIAGFLVGNGLRTIQLNGVPADDLAVDADA
                     VVISLKTRSCPTGQAIAESLAALKWLQKNNCQQFFFKYCSTFDSTPKGNIGPVTDALL
                     EALGEEFTVICPALPVNGRTIYNGYLFVNGVLLSETGMRNHPVTPMTDSNIMRVMESQ
                     SRGRAGNISSTIVDQGSDAVRDALRKLQSEGIRYAVLDALNDQHIETLGRAVSQMKLV
                     TGGSGLADGMARAWTQLRGKNVAAAEAAGAPVKGRTVILSGSCSQMTNAQVAAYKAKA
                     PALAMDVEKAINDAAYIDVLAEWVLAQSGDALAPLVYATMPPEALKAVQERFGGERAS
                     AAIEDLFGQLAKRLEAEGFTRFIVAGGETSGAVTQALAIDGFTIRPQIAPGVPWVRGI
                     GKPLSLALKSGNFGTEAFFFEAQKIANQEGDK"
     gene            complement(141101..142002)
                     /locus_tag="BSVBI22_RS10740"
                     /note="oxidoreductase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            142372..142752
                     /gene="flgB"
                     /locus_tag="BSVBI22_RS10745"
                     /old_locus_tag="BSVBI22_B0149"
     CDS             142372..142752
                     /gene="flgB"
                     /locus_tag="BSVBI22_RS10745"
                     /old_locus_tag="BSVBI22_B0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073289.1"
                     /note="with FlgF and C makes up the proximal portion of
                     the flagellar basal body rod; Bradyrhizobium have one
                     thick flagellum and several thin flagella; the proteins in
                     this cluster are associated with the thin flagella;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgB"
                     /protein_id="WP_004681368.1"
                     /db_xref="GI:490819270"
                     /translation="MSSIHLFDLAARQAQWLSVRQATVAGNVANANTPDFRARDVQPF
                     ADVLDKTQLTMTATSPLHLEAEADGIAATRLRPDDVTEQTHSGNTVDVEQEMMKAGEI
                     AREYSLNTSIVKAFHRMMLSVAKG"
     gene            142755..143177
                     /gene="flgC"
                     /locus_tag="BSVBI22_RS10750"
                     /old_locus_tag="BSVBI22_B0150"
     CDS             142755..143177
                     /gene="flgC"
                     /locus_tag="BSVBI22_RS10750"
                     /old_locus_tag="BSVBI22_B0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006469416.1"
                     /note="with FlgF and B makes up the proximal portion of
                     the flagellar basal body rod; Bradyrhizobium have one
                     thick flagellum and several thin flagella; the protein in
                     this cluster is associated with the thin flagella; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="WP_006191675.1"
                     /db_xref="GI:493203512"
                     /translation="MSSDALQSTLKIAASGLSAQSTRLCIVSENIANAQSTAKTADTD
                     PYRRKTVSFRTELEQGTGAAEVRVAEVGKDTSPFIEQYDPSHPAADARGYVKYPNVNM
                     VVEMADMREANRSYEANLQVVRQARELISMTIDLLRST"
     gene            143177..143512
                     /gene="fliE"
                     /locus_tag="BSVBI22_RS10755"
                     /old_locus_tag="BSVBI22_B0151"
     CDS             143177..143512
                     /gene="fliE"
                     /locus_tag="BSVBI22_RS10755"
                     /old_locus_tag="BSVBI22_B0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363836.1"
                     /note="forms a junction between the M-ring and FlgB during
                     flagella biosynthesis; Bradyrhizobium has one thick
                     flagellum and several thin flagella; the protein in this
                     cluster is associated with the thin flagella; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body complex protein FliE"
                     /protein_id="WP_002966429.1"
                     /db_xref="GI:489056291"
                     /translation="MYDSIMSVSARNALSRLSETVAEKGVGSASAPQAVPAAPGASFG
                     EVLSQMTGSVSQKLQAAEATSIQGIKGDAPVRDVVSSVMEAEQSLQTAIAIRDKIVQA
                     YLEISRMPI"
     gene            143598..144386
                     /locus_tag="BSVBI22_RS10760"
                     /old_locus_tag="BSVBI22_B0152"
     CDS             143598..144386
                     /locus_tag="BSVBI22_RS10760"
                     /old_locus_tag="BSVBI22_B0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgG"
                     /protein_id="WP_002966428.1"
                     /db_xref="GI:489056290"
                     /translation="MKALTIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFTDLL
                     YQSERTAGVPNQANQAIVPEGALVGLGVQTAAVRNLHIQGSFNQTGNPYDVALTGRGW
                     FQIQSPTGETLYTRAGAFNKNADGQLVTLDGNPVEPAITIPPDAIEVTITDTGQVFAK
                     LQDQINQVDLGQLTLANFTNEAGLEPLGGNLYRETEASGGPLVGVPGDPGYGSIKQGY
                     LEASNVDPVKEITDLITAQRAYEMNSKVIQAADEMAATVSKNLR"
     gene            144398..144880
                     /gene="flgA"
                     /locus_tag="BSVBI22_RS10765"
                     /old_locus_tag="BSVBI22_B0153"
     CDS             144398..144880
                     /gene="flgA"
                     /locus_tag="BSVBI22_RS10765"
                     /old_locus_tag="BSVBI22_B0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006256599.1"
                     /note="required for the assembly of the flagellar basal
                     body P-ring; Bradyrhizobium japonicum has two types of
                     flagella, a single thick flagella and a few thin flagella;
                     the protein in this cluster is associated with the thin
                     flagella; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring biosynthesis protein
                     FlgA"
                     /protein_id="WP_002966427.1"
                     /db_xref="GI:489056289"
                     /translation="MDRVKAIFQTARLALAGGFLLAAMAGAGAADRIAFVVPSATVYP
                     GQIVSDTALLEKQFFINAPAATQYVLSLDQAVGKVARKTLLPGKPILVSALGEPSLVT
                     RGIPAPLVFTAGTLTITAMGTPLESGVAGDFIKVRNVDSGIIVSGTVLANGRIQVGMQ
                     "
     gene            145021..146250
                     /locus_tag="BSVBI22_RS10770"
                     /old_locus_tag="BSVBI22_B0154"
     CDS             145021..146250
                     /locus_tag="BSVBI22_RS10770"
                     /old_locus_tag="BSVBI22_B0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar P-ring protein FlgI"
                     /protein_id="WP_032448788.1"
                     /db_xref="GI:694106093"
                     /translation="MRKTCATLITASALIFQPAAGFADKSARNVREFGSAVDADADWL
                     GAGGDPSKMTYAELGRGSAVARLKDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPF
                     TEQSMRAMLDNLGISAPRNSTRSKNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSL
                     QGGTLVMTQLMGADNQIYAVAQGNMIVSGFSAEGEAASVTQGVPTSGRIPNGALVERE
                     VAGSFGKDREMIVELRDPDFTTAVRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKN
                     VPAARFLAELEGLPITTDEVARVVVDERTGTVVIGEKVRISKVAISHGSLTVRVTETP
                     MVVQPEPFSDGETAVEPNTDIAVNQQNAKIGILSGANLENLVKGLNQIGVKPTGIIAI
                     LQAIKTSGALHAELVVQ"
     gene            146247..146819
                     /locus_tag="BSVBI22_RS10775"
                     /old_locus_tag="BSVBI22_B0155"
     CDS             146247..146819
                     /locus_tag="BSVBI22_RS10775"
                     /old_locus_tag="BSVBI22_B0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073294.1"
                     /db_xref="GI:492971330"
                     /translation="MIMAHKMIRYGSAVALFLAASVPAFADPPALGNLDEIRKFCGNI
                     DDQAADARYALQAKQLTELKADVEERMRALEEKRREYELWLKRRDEFVSKAQDALVDI
                     ISKMKPDAAAAQMALIGDEAAAALILKLNPRVSSIILNEMPPEKAAKLARVIVGSQRT
                     SSAAQPVKDQSGRDQRAAAQTGNTVQRKTA"
     gene            146816..147532
                     /locus_tag="BSVBI22_RS10780"
                     /old_locus_tag="BSVBI22_B0156"
     CDS             146816..147532
                     /locus_tag="BSVBI22_RS10780"
                     /old_locus_tag="BSVBI22_B0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar L-ring protein"
                     /protein_id="WP_004690008.1"
                     /db_xref="GI:490827918"
                     /translation="MNKAILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQNNPQ
                     FNGYPARPGKASYSLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDRERVS
                     KGIYGGGGSFATSSITGAAAGGDMDASINTHSDSKSKGKGTIERSEDIRLQIAAIVTD
                     TLPNGNLIIRGSQEVRVNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYGGRGR
                     LSEIQQPPYGQQILDQFSPF"
     gene            147545..148036
                     /locus_tag="BSVBI22_RS10785"
                     /old_locus_tag="BSVBI22_B0157"
     CDS             147545..148036
                     /locus_tag="BSVBI22_RS10785"
                     /old_locus_tag="BSVBI22_B0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body protein FliL"
                     /protein_id="WP_002966423.1"
                     /db_xref="GI:489056285"
                     /translation="MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMISAG
                     QQASAKPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHE
                     IPPAMAANVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISAL
                     VVE"
     gene            148033..148773
                     /locus_tag="BSVBI22_RS10790"
                     /old_locus_tag="BSVBI22_B0158"
     CDS             148033..148773
                     /locus_tag="BSVBI22_RS10790"
                     /old_locus_tag="BSVBI22_B0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliP"
                     /protein_id="WP_002968269.1"
                     /db_xref="GI:489058170"
                     /translation="MKHSLGLGVILTLALTVSAQAQQALPLDKLLPAGSGAASGQIVQ
                     LFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALFMTFYVM
                     APAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLRLFEDLADPSFR
                     TSDDGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTV
                     ISLPFKILFFVLIDGWNILVGSLIRSFS"
     gene            148976..149362
                     /locus_tag="BSVBI22_RS10795"
     CDS             148976..149362
                     /locus_tag="BSVBI22_RS10795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005971939.1"
                     /db_xref="GI:492811032"
                     /translation="MDFPAWTWWAVAIGLFLLIEALMAIWYIRRLSRQRVETTAALKE
                     VQHTGEPGSALVLEATDTGKRLGAYSFLVVRLRLRVTRANGEEFETAIDAHISPVRIA
                     DFAEGKHIKVSIDPHARTVVLNQPVQ"
     gene            149375..149791
                     /locus_tag="BSVBI22_RS10800"
                     /old_locus_tag="BSVBI22_B0160"
     CDS             149375..149791
                     /locus_tag="BSVBI22_RS10800"
                     /old_locus_tag="BSVBI22_B0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966420.1"
                     /db_xref="GI:489056282"
                     /translation="MLAACGKPMNIMALISILHLSSGGVALAADTGRIIIRNDLAACV
                     DMRVEKPPFEYPNGSNIVAINANFKLRKPIGACGCMSALARYASSVNERESRLFLQQG
                     LFNLKKSDTKTLPLATEPALVKDGNIEITVGCARPR"
     gene            complement(149987..150871)
                     /locus_tag="BSVBI22_RS10805"
                     /old_locus_tag="BSVBI22_B0161"
     CDS             complement(149987..150871)
                     /locus_tag="BSVBI22_RS10805"
                     /old_locus_tag="BSVBI22_B0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006268353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002966419.1"
                     /db_xref="GI:489056281"
                     /translation="MRFDVTDLRLFVSIAETGSITHGAAMVNMALGAASARVRGMEEL
                     AGVALLNRERLGVSITPAGRALLQHGRIVLQQLGRMHSELDEFAHGLKGHVRLFSNTN
                     ALAEFLPVALSSFLMDNPGVNIDLQEHLSDEIVRSVVEGIADIGIVAGTVDVASLETF
                     PFREDYLVVVVPQGHPFARRRRIAFKDTLDYDFIGLSQGAALQNFLSAHAMRMGQRLR
                     LRVQLRSFDSICQMVESRAGIAIVPASAAKRLRRIMAIRIIALDDAWALRRLTICVRS
                     LQDLPAHAARLVEHLRQT"
     gene            151051..152268
                     /locus_tag="BSVBI22_RS10810"
                     /old_locus_tag="BSVBI22_B0162"
     CDS             151051..152268
                     /locus_tag="BSVBI22_RS10810"
                     /old_locus_tag="BSVBI22_B0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_002966418.1"
                     /db_xref="GI:489056280"
                     /translation="MTAPFSVQPPESALRPLDGITVVSLEHAIAAPFATRQLADLGAR
                     VIKVERPGVGDFARAYDDRVNGMASHFVWCNRSKESLAIDLKHPDARGILHDLVSKAD
                     VLVQNLAPGAAARLGLSAEALRADCPHLIVCDISGYGSDGPYRDRKAYDLLIQSEAGF
                     LSVTGTPDEQAKAGISIADIAAGMYAYSGILSALLMRERTGQGSHIEVSMLEALGEWM
                     GFPLYYTYGGKEPPPRTGASHATIFPYGPFPTGDGKTVMLGLQNEREWAIFCEKVLHQ
                     PALAQDERFVSNVLRVRNRDALTEIIVASFAASNAEAITMQLDEAGIANARVRTMAEV
                     WDHPQLQARGRWTEITTPAGQVPALLPPAFPNGMEPRMDPVPALGAHNISILTELGLD
                     EAQIAALREAGAI"
     gene            152336..153172
                     /locus_tag="BSVBI22_RS10815"
                     /old_locus_tag="BSVBI22_B0163"
     CDS             152336..153172
                     /locus_tag="BSVBI22_RS10815"
                     /old_locus_tag="BSVBI22_B0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966417.1"
                     /db_xref="GI:489056278"
                     /translation="MELNIEQLRSWIGREETRHELVTPSLVERFNATFDHEGDTANDA
                     VAPLLIHLCLTQPAALTSRLGPDGHPARGGFLPPVPLPRRMWAGGAFTFRDDIRVGDI
                     VTRTSRIQDVVVKEGRTGTLCFVTVGHEFHSNGRHAVTERQDIVYRGADMSNPAAKTQ
                     PAVPHGPHCRFITPSAPLLFRYSALTFNGHRIHYDAPYVRNVENYPGLIVHGPMQATM
                     LVRFATEIRGKPPVRFDFRSLSPLFDDADFTLNAIDDGEGLKLWTSYANGPVAMEARA
                     LW"
     gene            153166..153990
                     /locus_tag="BSVBI22_RS10820"
                     /old_locus_tag="BSVBI22_B0164"
     CDS             153166..153990
                     /locus_tag="BSVBI22_RS10820"
                     /old_locus_tag="BSVBI22_B0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_002966416.1"
                     /db_xref="GI:489056277"
                     /translation="MVSIASIRAPLFVPADRPDRFSKAAASGTDCVILDLEDAVAPKA
                     KDAARAALDTSFTDLPVMVRINPHGTPWHEADMAAVARLDVAGVILPKAETAERIEAA
                     ARMLDLPLIALVETARGLANARSIAAASGVVRLAFGSIDFCADLACAHMREILLPARV
                     ELVMASRLAGIAAPIDGVTPGFNDPVMCHQDAAHARALGMMGKLCIHPRQISEVLRAF
                     AWSDQEIDWARRVLASGEGAISIDGMMVDEPVRIRARTILEQADIGAAPVLTKPTG"
     gene            154023..154175
                     /locus_tag="BSVBI22_RS10825"
     CDS             154023..154175
                     /locus_tag="BSVBI22_RS10825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966415.1"
                     /db_xref="GI:489056276"
                     /translation="MHGRIGYGADELAPALAIKPEFDAWSRQREQDFLKADFQKIPTQ
                     IETRSR"
     gene            154440..155018
                     /locus_tag="BSVBI22_RS10830"
                     /old_locus_tag="BSVBI22_B0166"
     CDS             154440..155018
                     /locus_tag="BSVBI22_RS10830"
                     /old_locus_tag="BSVBI22_B0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_004687517.1"
                     /db_xref="GI:490825427"
                     /translation="MTQSRAIFDSPIGYGVVSRVLHWAMALMFAWQFTSAILHYFAKG
                     SAIFKFFWAAHFQLGFALLLLVLLRGVWGLINCNRRPRAESSGGRIVALGHGLIYILM
                     IAVPTVAMLRSYNSGRGFSFLGMEIFAKTAVQNPAGGAPAAAVNAGLSLHGLLGWILL
                     AVVIAHILLALAHHFIMQDNTLRYMTGRRAVS"
     gene            155809..156216
                     /locus_tag="BSVBI22_RS10835"
                     /old_locus_tag="BSVBI22_B0168"
     CDS             155809..156216
                     /locus_tag="BSVBI22_RS10835"
                     /old_locus_tag="BSVBI22_B0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004690010.1"
                     /db_xref="GI:490827920"
                     /translation="MDGFASCGVWFSERKHIDMRSVRTIIRPGAAFIAMLYATVSVHA
                     GGQGGYGGLNMNPYGYPGGNGNSATGMGGDGGQGYNNPDPTGAGGTVGNLITSPTTII
                     SNITGGLVDAPLTRTDLEAMPVVVVRVLQQLRT"
     gene            156423..159602
                     /locus_tag="BSVBI22_RS10840"
                     /old_locus_tag="BSVBI22_B0169"
     CDS             156423..159602
                     /locus_tag="BSVBI22_RS10840"
                     /old_locus_tag="BSVBI22_B0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006125740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032449063.1"
                     /db_xref="GI:694106424"
                     /translation="MYVVGNSTLVTITNNGTITGGAGGLNSAWPVYYGATGGAGEGGA
                     AGSIRTGGSQGTSSQGGAGIIGANIAVINNGTITGGIGGTGGLNAGVQNDAVTFQSGT
                     NSLTLTTKSVISGVVSANGNDDTLTLQNTLSKIDGGQSDGANISATQYKGFEHLVVNG
                     GRWTVGGSAIVSGETTLNGGALVVTGPAALGVQAITAQGGAIEASGDQVLNQSFVLKN
                     NPYGASTSGLVVQGADNLVLSGVLSDVGRLTKNGSGTLTLTADNTYTGGTVFAGGVVS
                     VDKEVRLGGGDLTFNGGTLQVMGTSWTSTNRAVSLQAGGGTFDIEDAANNFAVTQGVA
                     GAGGLTKSGSGTLTLSGANSYTGATTVSAGTLVVANDNTGGGTTTVDVGAGLQIGTGG
                     VSGSLAGDIVNNGTLVVDRSNAFDLANVISGTGSLTKNGAGTLTLSGVNSYTGGTTVS
                     AGILTLTGDNTGGGTTTVDAGAVLQIGTGGTSGNLAGDIANNGALVVNRSDALNLANA
                     ISGAGSLMKSGAGTLTLSGANSYTGATTVSAGTLTQGAAGGFSTASSRYDVDTDGTLD
                     LGGFDTMLAALYNAGTINMNVGAAGSTLMVNGDYVGHDGTIVFNTVLGDDNSKTDKLM
                     VGGDTAGNTNVQVVNRDGLGAQTVKGIEIITVGGQSNGVFSLVSDYRTKDGRKAVVGG
                     AYAYTLHQGPARGANDGNWYLISQLEDIKPDNPATRRVSDTPDAPDTPAPRYSANVPV
                     YEGYVQTMQALNKPSTLQERVGKRYMTGENGDGRTSGGMVDAHGIWARIQGAHDRLEP
                     TTLTGMKQEINTFILQAGVDGQFYEDENGKLIAGITGQYGTARSNIVARDGDGRISTN
                     AWSLGATATWIGNDGFYVDTQGQVTWFESDLNSDTADVGLASGRKATGYALSVETGKR
                     IALNGNWALTPQAQLIWSSINADDFEDVWQANISVARGNSFAARFGLAASYDSSWQGS
                     DGRVVNTSVYGITNLYQEFLGGTRVNISGVDFSTDNDRTWAGIGAGGTYAWAGGKYLI
                     FGQGTINTSLDHFADSYAIKGDVGFKVKW"
     gene            159838..160233
                     /locus_tag="BSVBI22_RS10845"
                     /old_locus_tag="BSVBI22_B0170"
     CDS             159838..160233
                     /locus_tag="BSVBI22_RS10845"
                     /old_locus_tag="BSVBI22_B0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_002966407.1"
                     /db_xref="GI:489056268"
                     /translation="MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGE
                     GAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKM
                     VYAGLKDEGKIDDLIAFLKQYDLGGKIKE"
     gene            complement(160457..160696)
                     /locus_tag="BSVBI22_RS10850"
                     /old_locus_tag="BSVBI22_B0171"
     CDS             complement(160457..160696)
                     /locus_tag="BSVBI22_RS10850"
                     /old_locus_tag="BSVBI22_B0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004687513.1"
                     /db_xref="GI:490825423"
                     /translation="MSNTPHTLGEEFPGQLEAIHALKAKDAHFARILEEYDSVNDLIH
                     RAETNIQPVSQEEETNLRKQRLALKDKIASALAAA"
     gene            161127..161264
                     /locus_tag="BSVBI22_RS10855"
                     /old_locus_tag="BSVBI22_B0172"
     CDS             161127..161264
                     /locus_tag="BSVBI22_RS10855"
                     /old_locus_tag="BSVBI22_B0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966405.1"
                     /db_xref="GI:489056266"
                     /translation="MTAKNATLLTVLMVSAIVFMAVGIFTVDAGNQTAPTDGYGISSA
                     H"
     gene            complement(161342..162154)
                     /locus_tag="BSVBI22_RS10860"
                     /old_locus_tag="BSVBI22_B0173"
     CDS             complement(161342..162154)
                     /locus_tag="BSVBI22_RS10860"
                     /old_locus_tag="BSVBI22_B0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002966404.1"
                     /db_xref="GI:489056265"
                     /translation="MADTVFSRIQASRTADDVVHQIESLILEGVLRGGDRLPGERELA
                     RQFDISRPILRDALKRLETAGLLTSRHGGGTFVADVIGQVFSAPVVKLFADHHKATAD
                     YLEYRREIESVAAEYAALRATPADRALLTEIMNAMEKAHGADDFATEARLDVELHNAI
                     GEAAHNIVLLHTLRSCYQLLKDGVFYNRSVIYNHPGVADVFLSQHRAIYDAVMAGNPQ
                     AAREAVQKHIRFVEQATHDRALNDERERVARLRYRQRAGSKELKEIREDESE"
     gene            complement(162276..163196)
                     /locus_tag="BSVBI22_RS10865"
                     /old_locus_tag="BSVBI22_B0174"
     CDS             complement(162276..163196)
                     /locus_tag="BSVBI22_RS10865"
                     /old_locus_tag="BSVBI22_B0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011949921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_004681414.1"
                     /db_xref="GI:490819316"
                     /translation="MMSSLADMEIFARVVATGSMSAAARDLGLSPAVVSKRLGRLEER
                     LGTRLLQRTTRQIALTEAGQGYHERVLAILANIEEAEAFVARRSADARGTLKISAPTT
                     FGRMHIAPYLVPFMRANADLTVNMQLSDEMVDIVGDGYDLAIRIGELSDSTLVARRLA
                     PVRRIFVAAPRYLKERGTPQTIEDLQDHICLAPHNNDPWRLEGPKGPIVIRPTGPLQT
                     NSSEIVREAVLAGLGIAQRSTWDVGPELAAGKLVQVLPDYAASRNVAIHAVYPSKQFL
                     PAKVRLFIDYLADLYGPVPYWESGTFPEEN"
     gene            163547..165043
                     /locus_tag="BSVBI22_RS10870"
                     /old_locus_tag="BSVBI22_B0176"
     CDS             163547..165043
                     /locus_tag="BSVBI22_RS10870"
                     /old_locus_tag="BSVBI22_B0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding protein"
                     /protein_id="WP_006191685.1"
                     /db_xref="GI:493203522"
                     /translation="MSGLIMPEPDAGVLQRREQIVADLRVIVPGEGVVDTVNAMRVFE
                     TDGLTVHRQLPLVVVLPETVEQVAQVLRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVL
                     LVMSRFNRILEIDYPNRVAVVQPGVTNLGITKAVEHEGFYYAPDPSSQIACSIGGNVA
                     ENAGGVHCLKYGLTANNVLGIEMVLITGEVMRLGGKHLDSEAYDLLGLMTGSEGLLGV
                     VTEITVRILQKPETARAIMVGFPSSEQAGQCVADIIGAGIIPGGMEMMDRPAIKAAED
                     FVRVGYPLDVEALLIVELDGPPVEVDYLLGRVEKIALQNGSTTCTLSQSEEQRLAFWA
                     GRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSGMRALSEKYGLRVANVFHAGDGNLH
                     PLILYDANNPGELEAAEDFGADILRLCVKVGGVLTGEHGVGIEKRDLMPEMFNETDLD
                     QQMRVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVSRGALAFPDLPRF"
     gene            165059..166291
                     /locus_tag="BSVBI22_RS10875"
                     /old_locus_tag="BSVBI22_B0177"
     CDS             165059..166291
                     /locus_tag="BSVBI22_RS10875"
                     /old_locus_tag="BSVBI22_B0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-acid oxidase"
                     /protein_id="WP_004685103.1"
                     /db_xref="GI:490823013"
                     /translation="MSDANILKPQDEAGVLEMVQAALASSTPLEIIGHGSKRGIGRPV
                     EAGHVLDVSGLSGVTLYEPDELVLSARAGTPMAEIQKLLADHNQCFHFEPMDYGPLLG
                     AEPGRGTIGGTLAANLAGPRRLKAGAARDHVLGVRVVSGRGEVFKSGGRVVKNVTGYD
                     LSKGMANSWGTLGVATEVTFKVLPAPETVATLAVRGLDDEQAARVMALAMGSREEVSS
                     AAHLPPTVAWRFLDGKLGGDAATILRLEGFAPSVAHRSRQLQDLLGRTGTIDVLDDSQ
                     SRQLWREVRDVLPYAQAGDGRAVWRVSMAPMQGWRMVDEFRRHAGVDAYYDWQGGLIW
                     MRMEAEPEADVLRKLIARHGGGHATLIRAPERVRGSVDVFQPQPAALAALSARLKQQF
                     DPENILNPGRMYPHQAGA"
     gene            166296..167597
                     /locus_tag="BSVBI22_RS10880"
                     /old_locus_tag="BSVBI22_B0178"
     CDS             166296..167597
                     /locus_tag="BSVBI22_RS10880"
                     /old_locus_tag="BSVBI22_B0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-acid oxidase"
                     /protein_id="WP_004690014.1"
                     /db_xref="GI:490827924"
                     /translation="MQTHFSPEQLRDPGVLEAEKILRKCVHCGFCTATCPTYVTLGNE
                     LDSPRGRIYLIKDMLENGRPADEEIVRHVDRCLSCLACMTTCPSGVNYMHLVDHARAH
                     IEKTYKRPFMNRLLRSVLAQVLPYPARFRLALKLAKLGKPFASLFRKSPVLRPVAAML
                     DLAPQSLPAMPAATNAVRGEKRGRVAILNGCAQPVLNPGINAATLRLLNRFDIEVATP
                     KGEGCCGSLVHHMGREEQALEQARHNVDVWTREIETGGLDAIIVTASGCGTTIKDYGY
                     MLRLDPAYKDKAARVSALAKDITEYLATLELPEPDAPKTLTVAYHSACSMQHGQKIVR
                     EPKDLLVKAGFTVKEPLEGHLCCGSAGTYNIMQPEIATKLRDRKVKNIEATGAALIAT
                     GNIGCMTQIATGSDLPIVHTVELIDWAYGGPTPQALEKAGA"
     gene            complement(167821..168648)
                     /locus_tag="BSVBI22_RS10885"
                     /old_locus_tag="BSVBI22_B0179"
     CDS             complement(167821..168648)
                     /locus_tag="BSVBI22_RS10885"
                     /old_locus_tag="BSVBI22_B0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004692532.1"
                     /db_xref="GI:490830446"
                     /translation="MTVPTVKLNDGNHIPQLGYGVWQISNDEAVSAVSEALKAGYRHI
                     DTATIYGNEKGVGKAINGSGIARADIFLTTKLWNSDQGYESTLKAFDTSLKKLGTDYV
                     DLYLIHWPMPSKDLFMETWRAFIKLKEEGRVKSIGVSNFRTADLERLIKESGVTPVLN
                     QIELHPQFQQDELRLFHGKHDIATEAWSPLGQGKLLEDPTLKSIAEKHAKSVAQIILR
                     WHIETGNIVIPKSITPARIKENFDIFDFTLNGTDHDAITKLDMADGRIGPNPSVFSA"
     gene            complement(168924..169658)
                     /locus_tag="BSVBI22_RS10890"
                     /old_locus_tag="BSVBI22_B0180"
     CDS             complement(168924..169658)
                     /locus_tag="BSVBI22_RS10890"
                     /old_locus_tag="BSVBI22_B0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966398.1"
                     /db_xref="GI:489056259"
                     /translation="MKPRHLLLIGSLTAIAVSIVSTGMAFADDRYSDLPPVRVSQAIS
                     APWVAQLQDAPARPRIARQETRKTKTHYNKVSYQRPATNPATTARKKQFDPIYLPQIV
                     SYSGKEKPGTIVIDTASRFLYLVQADGKARRYGVGVGKQGFSWKGTQRISRKAEWPTW
                     TPPSEMIARERKKGRFLPARMDGGINNPLGARALYLGSTLYRIHGTNQPWTIGKAMSS
                     GCIRMRNEDVTDLYERTPVGTRVVVR"
     gene            169898..170554
                     /locus_tag="BSVBI22_RS10895"
                     /old_locus_tag="BSVBI22_B0181"
     CDS             169898..170554
                     /locus_tag="BSVBI22_RS10895"
                     /old_locus_tag="BSVBI22_B0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="WP_002967189.1"
                     /db_xref="GI:489057066"
                     /translation="MSDMAEARAGLVVGADGRTRCFWPGELPDYLAYHDNEWGVPVAD
                     DFRLFEKICLEGFQSGLSWLTILRKRENFRAAFDGFNFHRIATYDESDVERLLADKGI
                     VRHRGKIVSVINNAGRAIELIEEKGSLAAYFWSFEPGAENRPAVVDYPTLVANPITAT
                     STRISKDLKKRGWSFVGPTTVYAFMQAMGLVNDHIEGCHCRATIEKLRQNFKRPGKKL
                     "
     gene            170673..171290
                     /locus_tag="BSVBI22_RS10900"
                     /old_locus_tag="BSVBI22_B0182"
     CDS             170673..171290
                     /locus_tag="BSVBI22_RS10900"
                     /old_locus_tag="BSVBI22_B0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_004681424.1"
                     /db_xref="GI:490819326"
                     /translation="MDLMSLVAFAGILVVAAGTPGPNVGALVARVISRGHKGVFPFMF
                     GLWLGDAVWLSLAVWGLSALAHTFQTAFLVLKYAGVAYLIYLSWKMWFAPVDEEADEN
                     TIPRQGEGKRLFLSALGVTLGNPKIMVFYLAILPTVVDITHVSLTGWVELLLVMFMVL
                     AAVDTAWVVLAAQARKFLRSPRMMRLANRTSAGMMAGAAVAIAAR"
     gene            171401..172909
                     /locus_tag="BSVBI22_RS10905"
                     /old_locus_tag="BSVBI22_B0183"
     CDS             171401..172909
                     /locus_tag="BSVBI22_RS10905"
                     /old_locus_tag="BSVBI22_B0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5VTT4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine--tRNA ligase"
                     /protein_id="WP_004690017.1"
                     /db_xref="GI:490827927"
                     /translation="MADKADKMKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFE
                     PVETPLVEYTDALGKFLPDQDRPNEGVFSFQDDDEQWLSLRYDLTAPLARYVAENFET
                     LPKPYRSYRNGWVFRNEKPGPGRFRQFMQFDADTVGAPNVSADAEMCMMMADTLERLG
                     IQRGDYAIRVNNRKVLDGVLDAIGLEGEGNAAKRLNVLRAIDKLDKFGPEGVRLLLGK
                     GRLDESGDFTKGAQLPEAAIEKVLAFTAAGGADGAQTIANLQAVVAGNAEGEEGVQEL
                     ADMQALFFAGGYEGRVKIDPSVVRGLEYYTGPVFEAELLFDVTNEDGQKVVFGSVGGG
                     GRYDGLVSRFRGEPVPATGFSIGVSRLMTALKNLGKLDVSDTVGPVVVLVMDKDTQNL
                     GRYQKMVSDLRKAGIRAEMYVGGSGMKAQMKYADRRAAPCVVIQGSQEREAGEVQIKD
                     LVEGKRLSAEIEDNVTWRESRPAQITVREDGLVDAVREILDAQARDRAEQSK"
     gene            172918..174048
                     /gene="hisZ"
                     /locus_tag="BSVBI22_RS10910"
                     /old_locus_tag="BSVBI22_B0184"
     CDS             172918..174048
                     /gene="hisZ"
                     /locus_tag="BSVBI22_RS10910"
                     /old_locus_tag="BSVBI22_B0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363020.1"
                     /note="May allow the feedback regulation of ATP
                     phosphoribosyltransferase activity by histidine; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase regulatory
                     subunit"
                     /protein_id="WP_005971898.1"
                     /db_xref="GI:492810952"
                     /translation="MVGSRTSPIFNALRVELNAREAELVEIPLIQPADPFLDMAGEDL
                     RRRIFLTENENGDSLCLRPEFTIPVCRNHIALNAATPKRYAYLGEVFRQRRDGAAEFL
                     QAGIEDLGAADEAASDARSLADALSCVKAIAPDAPLEIVLGDQSVFAGMLKALGLPQG
                     WRKKLLRSFGDAHSMDLALAELTGTQRRDPLPESLAVLVAEGDEIGLARMLEAEMLEA
                     GISPGAGRTPVEIARRLIEKEDLAATHFPAAALDLLRQFLAIRVSLDTAAVTLRAFAA
                     DNALDLGAVLQKFEARADAIAQAGIEMKDIIYDASFGRPLDYYTGLVYEIRDASNRQD
                     GVLAGGGRYDRLLTMLGACEAIPGVGFSIWLDRLQALAGEKQ"
     gene            174045..174740
                     /gene="hisG"
                     /locus_tag="BSVBI22_RS10915"
                     /old_locus_tag="BSVBI22_B0185"
     CDS             174045..174740
                     /gene="hisG"
                     /locus_tag="BSVBI22_RS10915"
                     /old_locus_tag="BSVBI22_B0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509512.1"
                     /note="short form of enzyme; requires HisZ for function;
                     catalyzes the formation of N'-5'-phosphoribosyl-ATP from
                     phosphoribosyl pyrophosphate; crucial role in histidine
                     biosynthesis; forms heteromultimer of HisG and HisZ;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="WP_004690018.1"
                     /db_xref="GI:490827928"
                     /translation="MSVTLALPSKGRLKEKTLAVLEKAGYKVVLPDDDRNYRARVEGE
                     DDLDILFLSASEIARELGYGSVDLGVTGEDLARETLAHADERVAIEAQLGFGHADVVV
                     AVPEVWRDVTTMADLDDVAADFRQRHGRRLRIATKYWRLTQQFFSQKHGIQVYRIVES
                     LGATEGAPAAGSADMIVDITSTGSTLRANRLKVLEDGIILRSQACLVSARRSHTSRRV
                     EEIAARIRAGLEI"
     gene            complement(174813..176051)
                     /locus_tag="BSVBI22_RS10920"
                     /old_locus_tag="BSVBI22_B0186"
                     /note="major facilitator transporter; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            176038..176277
                     /locus_tag="BSVBI22_RS10925"
     CDS             176038..176277
                     /locus_tag="BSVBI22_RS10925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014517351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014517351.1"
                     /db_xref="GI:504330249"
                     /translation="MEVAIFLYKLNYYKMRRWAGACVKSGGCLISQDIAMQSFRTLSA
                     GFPPIVGIRRIANIFFVVPPLQLRKISMEKQVAVM"
     gene            complement(176337..176738)
                     /locus_tag="BSVBI22_RS10930"
                     /old_locus_tag="BSVBI22_B0187"
     CDS             complement(176337..176738)
                     /locus_tag="BSVBI22_RS10930"
                     /old_locus_tag="BSVBI22_B0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002966391.1"
                     /db_xref="GI:489056252"
                     /translation="MSSITPKANGAATLIIRVFLSVLFIIAGYNKLTALDGTADYFAS
                     IGLPMPIVTAVVVGLIEFVGGLAILFGFKTRIAAVIVGLFTLGATLVAHMDFAEGMNL
                     LIAQKNLAIAGGLFLLFLHGAGSLSIDARRG"
     gene            complement(176841..178232)
                     /gene="fumC"
                     /locus_tag="BSVBI22_RS10935"
                     /old_locus_tag="BSVBI22_B0188"
     CDS             complement(176841..178232)
                     /gene="fumC"
                     /locus_tag="BSVBI22_RS10935"
                     /old_locus_tag="BSVBI22_B0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936400.1"
                     /note="class II family (does not require metal);
                     tetrameric enzyme; fumarase C; reversibly converts
                     (S)-malate to fumarate and water; functions in the TCA
                     cycle; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase class II"
                     /protein_id="WP_002966390.1"
                     /db_xref="GI:489056251"
                     /translation="MAATRTETDTFGPIDVPADRYWGAQTQRSLQNFRIGGERMPLPL
                     VHALGVVKRAAAETNIALGKLDPVLGQVIAVAASEVIEGKLDDHFPLVVWQTGSGTQS
                     NMNANEVISNRAIELLGGEMGSKKPIHPNDHVNMSQSSNDSFPTAIHIATAVETVNRL
                     YPALEHLTKALKVKEEAFKDIIKIGRTHTQDATPVTLGQEFSGYRAALEYARHRLEQS
                     LADVFLLAQGGTAVGTGLNAPVGFDKGFAEAVSEITGLSFKTAPNKFEALASHGAVLN
                     FHGSLNALAADLFKIANDIRFLGSGPRSGLGELSLPENEPGSSIMPGKVNPTQAEAMT
                     MVATQVFGNQTAVTVAASQGHFELNVFKPVIAYNVLQSIRLLSDTMVSFADHCVEGIE
                     PNTARIKELLERSLMLVTALAPAIGYDNAARIAKTAHKNGTTLREEALASGLVSEEDY
                     DRLVRAERMIAPQ"
     gene            complement(178382..178636)
                     /locus_tag="BSVBI22_RS10940"
                     /old_locus_tag="BSVBI22_B0189"
     CDS             complement(178382..178636)
                     /locus_tag="BSVBI22_RS10940"
                     /old_locus_tag="BSVBI22_B0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006015192.1"
                     /db_xref="GI:492865609"
                     /translation="MRKELPIETAPKDGRKITVIWIDDDDQRNESIAQYRTLEQLRAG
                     GGQWDEADTGWWTFTDSKTQRKIEPTAWIRETDDDESQED"
     gene            complement(179389..181029)
                     /gene="groEL"
                     /locus_tag="BSVBI22_RS10945"
                     /old_locus_tag="BSVBI22_B0191"
     CDS             complement(179389..181029)
                     /gene="groEL"
                     /locus_tag="BSVBI22_RS10945"
                     /old_locus_tag="BSVBI22_B0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643166.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_004688851.1"
                     /db_xref="GI:490826761"
                     /translation="MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSF
                     GAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQE
                     GAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGK
                     MIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDA
                     YILLHEKKLSNLQALLPVLEAVVQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAV
                     KAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVD
                     GAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEK
                     KDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKGVNADQEAGINIVRRAIQAPA
                     RQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAA
                     SVAGLLITTEAMIAELPKKDAAPAGMPGGMGGMGGMDF"
     gene            complement(181120..181416)
                     /locus_tag="BSVBI22_RS10950"
                     /old_locus_tag="BSVBI22_B0192"
     CDS             complement(181120..181416)
                     /locus_tag="BSVBI22_RS10950"
                     /old_locus_tag="BSVBI22_B0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_002966386.1"
                     /db_xref="GI:489056247"
                     /translation="MADIKFRPLHDRVVVRRVESEAKTAGGIIIPDTAKEKPQEGEVV
                     AAGAGARDEAGKLVPLDVKAGDRVLFGKWSGTEVKIGGEDLLIMKESDILGIVG"
     gene            181897..182745
                     /locus_tag="BSVBI22_RS10955"
                     /old_locus_tag="BSVBI22_B0195"
     CDS             181897..182745
                     /locus_tag="BSVBI22_RS10955"
                     /old_locus_tag="BSVBI22_B0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR01459 family HAD hydrolase"
                     /protein_id="WP_006073322.1"
                     /db_xref="GI:492971358"
                     /translation="MILPERLDDLTDRYDAIFCDVWGVVHNGETSFAPAIAALQRARA
                     KGVTIILVTNSPRPHPGVVAQMSLLGVPENAYDRVVTSGDVTRDLIAEGPRRIFHIGC
                     ERELAIYDGLDVELVEEFEAAGVVCTGLYDDEVETPEDYRELLQRLRSRNLPFICANP
                     DIMVERGPRLIWCAGALAREYGQLGGRTLIAGKPHRPIYEAALRAVESIRGGSVDKSR
                     ILGIGDGVLTDVKGAADFGLDVLYISGGVHAADYAVNGDLDMAKMEAFLEKHGHRPIA
                     SLHALV"
     gene            182833..183822
                     /locus_tag="BSVBI22_RS10960"
                     /old_locus_tag="BSVBI22_B0197"
     CDS             182833..183822
                     /locus_tag="BSVBI22_RS10960"
                     /old_locus_tag="BSVBI22_B0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin kinase"
                     /protein_id="WP_002966383.1"
                     /db_xref="GI:489056244"
                     /translation="MKKSSFQRLTGTEGLPPALHDCVVAIGNFDGVHRGHQAVLERAL
                     ELAERESRPAVVLTFEPHPRSFFKQDQPVDRLTDAAEKAEILRLMGFDAVMEQPFTAE
                     FSQRSAEDFVQHILVEKLRASRVVTGYDFHFGKGRRGTPEFLCEAGKKAGFSVTLVDA
                     FTDEGGMLVSSTRIRNLLSEGEVAEAAGLLGYRYRICGEVIHGKKLGRTLGFPTANMA
                     LAPQTSLKHGIYAVRFRLDDAMLYDGVASFGRRPTVDDEGAPLLETFLFDFSGDLYGK
                     TAAVSFFGFLRGEVKFDGLDPLIDQMKQDEAQARALLADVRPISGLDRMLSFN"
     gene            184166..187084
                     /gene="ileS"
                     /locus_tag="BSVBI22_RS10965"
                     /old_locus_tag="BSVBI22_B0198"
     CDS             184166..187084
                     /gene="ileS"
                     /locus_tag="BSVBI22_RS10965"
                     /old_locus_tag="BSVBI22_B0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006108284.1"
                     /note="IleRS; catalyzes the formation of
                     isoleucyl-tRNA(Ile) from isoleucine and tRNA(Ile); since
                     isoleucine and other amino acids such as valine are
                     similar, there are additional editing function in this
                     enzyme; one is involved in hydrolysis of activated
                     valine-AMP and the other is involved in deacylation of
                     mischarged Val-tRNA(Ile); there are two active sites, one
                     for aminoacylation and one for editing; class-I
                     aminoacyl-tRNA synthetase family; some organisms carry two
                     different copies of this enzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_006191694.1"
                     /db_xref="GI:493203531"
                     /translation="MTDTTKIDYSKTLYLPQTEFPIRAGLPQREPLFVQRWEEMNLYK
                     KLREQAKDRPLYVLHDGPPYANGNIHIGHALNKILKDVITRSFQMRGYNSNYVPGWDC
                     HGLPIEWKIEEKYRAAGKNKDEVPINEFRKECRELASNWIKVQTEEFKRLAILGDFEN
                     PYTTMNFHAEARIAGELLKFAASGQLYRGSKPVMWSVVERTALAEAEVEYHDIESDMI
                     WVKFPVAGEVATENDLSGSAVVIWTTTPWTIPGNRAVSYSSRIEYGLFEITEAENDFG
                     PRPGERLVFADKLVEECCAKAKLQFKRLRSVSAEELGKIVLDHPLKGFGGGYEFVVPM
                     LDGDHVTDDAGTGFVHTAPSHGREDFEAWMDNARQLEARGIDPNIPFPVGDDGFYTKD
                     APGFGPDREGGPARVIDDNGKKGDANKVVIEQLIAADKLFARGRLKHSYPHSWRSKKP
                     VIFRNTPQWFVYMDKNLGDGTTLRSRALKAIDETRFVPAAGQTRLRSMIEGRPDWVLS
                     RQRAWGVPICVFVDEEGNILQDDAVNKRIMDAFEKEGADAWFADGARERFLGARAGEG
                     WTQVRDILDVWFDSGSTHTFTLEDRPDLKWPADVYLEGSDQHRGWFHSSLLESCGTRG
                     RAPYNAVVTHGFTMDEHGKKMSKSLGNTVTPQDVIKESGADILRLWVMTTDYWEDQRL
                     GKSIIQTNIDAYRKLRNTIRWMLGTLAHDEGENVAYADLPELERLMLHRLTELDELVR
                     SGYDTFDFKRIARALVDFMNVELSAFYFDIRKDALYCDAPSSIRRKAALQTVREIFVR
                     LTTWLAPMLPFTMEEAWLDRYPQSVSIHAEQFRPTPAEWRDDVLAEKWRKVRAVRRVV
                     TGALELERADKRIGSSLEAAPVVYIADKSLSDSLEGLDFAEICITSGISVSDAAAPEG
                     AFTLGDVKGVAVVPERAKGEKCARSWRYTTDVGADPEFPEVSARDAAALRELQALGKL
                     "
     gene            187276..187947
                     /locus_tag="BSVBI22_RS10970"
                     /old_locus_tag="BSVBI22_B0199"
     CDS             187276..187947
                     /locus_tag="BSVBI22_RS10970"
                     /old_locus_tag="BSVBI22_B0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002971287.1"
                     /db_xref="GI:489061249"
                     /translation="MKIEGRVLVLMTALAGLSLSGCVSSPTYGTDKSAGAQLLDDVSN
                     MASFGQGKKKERIDYKPRPDLVRPAPGDKGYLPAPQQSLASSSDPNWPESPEQRRKRV
                     RDEITAHRDDPNYVSPVLQDAPVADNIRTALPRGNSRREDYASRTPTSDPAKVAALKA
                     ARAQQNQGSATTRRYLSEPPLAYRQPASTAAVGELGPDEAQKERERKKAASGSRGWRD
                     YLPWN"
     gene            188292..188852
                     /locus_tag="BSVBI22_RS10975"
                     /old_locus_tag="BSVBI22_B0200"
     CDS             188292..188852
                     /locus_tag="BSVBI22_RS10975"
                     /old_locus_tag="BSVBI22_B0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_002966380.1"
                     /db_xref="GI:489056241"
                     /translation="MSSKTYIWDDRSGYGLVSRGFHWLMALLFLWQFASAILRVFAKD
                     TPIYSFFWSAHFQLGFALLVLALLRGVWGLMNIHRRPHKDGAIGKLAVLGHLAIYVLM
                     ITIPSLALLRAYGSGRGFSFLGMPIFAKTDIQNAMLTAPANALHGPLGWVLLAAIVGH
                     VAMALVHHFALRDDTLRYMTGHGTPN"
     gene            complement(188906..189379)
                     /locus_tag="BSVBI22_RS10980"
                     /old_locus_tag="BSVBI22_B0201"
     CDS             complement(188906..189379)
                     /locus_tag="BSVBI22_RS10980"
                     /old_locus_tag="BSVBI22_B0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine deaminase"
                     /protein_id="WP_006191697.1"
                     /db_xref="GI:493203534"
                     /translation="MRKAASITKANSATPMDIALEEAHAAGERGEVPIGAVIVRDGEI
                     IARAGNRTREFNDVTAHAEILIIRQAGEMLGSERLIDCDLYVTLEPCAMCAAAISFAR
                     IRRLYYGASDPKGGGIEHGGRFYTQPTCHHAPEIYPGFCEADARKILKDFFREKR"
     gene            189520..191265
                     /locus_tag="BSVBI22_RS10985"
                     /old_locus_tag="BSVBI22_B0202"
     CDS             189520..191265
                     /locus_tag="BSVBI22_RS10985"
                     /old_locus_tag="BSVBI22_B0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014315905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridylate synthase"
                     /protein_id="WP_024768047.1"
                     /db_xref="GI:639960970"
                     /translation="MMAQGDAVTLLKGLYQMTTEDDNKGGKPPHGRKGHSDRPGRPDR
                     DSRPRREGGDRDKPRKFGSRGAPVEEETSERIAKRLARAGIASRREAETMIAAGRIAV
                     NGKVLESPAVNVKRTDIITVDGKPLRQTERTRLWLYHKPAGLVTTNRDPEGRPTVFEA
                     LPPEMPRVLSVGRLDINTEGLLLLTNDGGLSRVLELPSTGWLRRYRVRAHGKVTQQQL
                     DELKNGIAVDGVFYGSVEAELERVQGANVWISIGLREGKNREVKNILGALGLTVGRLI
                     RVSFGPFQLGDLEEGAVREIKGRTLRDQLGDKLIEESGADFDAPVLNEFSNAAVQGRT
                     RREMEEGELPQEGERRRAPREREWISSTGERRRGREEKTEKVEPRRRGNANVWMAPGA
                     RPKGEKEAAKPARVEHQQPHRSAKFSGDLQMRPRRFSEEERGGEESGERRYKRPEGRF
                     EREGGRPDNREKYEKHEGAGKERRPGKRERAELRNAEGQTTERGKGGFEGRKPGKPGG
                     PRSEGRFGGADRDTRSGPRGSGPRGAGDGPRRGHDGKPGGKPGGKPTGRPGGKPGTKP
                     GGGGRSGGGGADRRR"
     gene            191246..191809
                     /locus_tag="BSVBI22_RS10990"
                     /old_locus_tag="BSVBI22_B0203"
     CDS             191246..191809
                     /locus_tag="BSVBI22_RS10990"
                     /old_locus_tag="BSVBI22_B0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_002966377.1"
                     /db_xref="GI:489056238"
                     /translation="MRIVGGKFRGRALVTPSTNAIRPTTDRTRESLFNILAHSFPDKV
                     EGVRVLDLFAGTGALGLEALSRGARYATFVEESAEGRGILRQNIEALGLQGHTKILRR
                     DACQLGIVGTMEPFDLVFADPPYGRRMGEKAFLSALQGGWLNPDALLVLEEDAQAALE
                     LDDRFAVREERNYGGTVIRLIELKAAS"
     gene            191895..193441
                     /locus_tag="BSVBI22_RS10995"
                     /note="zinc protease; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            193441..193752
                     /locus_tag="BSVBI22_RS11000"
     CDS             193441..193752
                     /locus_tag="BSVBI22_RS11000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073333.1"
                     /db_xref="GI:492971369"
                     /translation="MNLSMSNFKRAFPLRGALHDARAVAGLLAASFTMLIVCALPARA
                     IEIQEVVSPKGIHAWLVEDNSVPLVSMRFSFKGGASQDPSGKEGIANLMTGLFDEGAD
                     R"
     gene            193733..194773
                     /locus_tag="BSVBI22_RS11005"
     CDS             193733..194773
                     /locus_tag="BSVBI22_RS11005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_004690026.1"
                     /db_xref="GI:490827936"
                     /translation="MKERIDNLGAEMSFSASQDSVSGGVRMLAENRDAVTDLVALAVN
                     EPRFDQEAIDRIRQQIVAGIEAAQRNPSTIASRKFAEVLYGNHPYARDDEGTVKSLQS
                     ISRDDLANFHRKNFARDKLTVGVVGAINAKDLGVMLDRIFGDLPASAELVPVPDAKLA
                     LGTTTSLNFDMPQTSISFVYPAIPRKDPEFFAAYLMNHILGGGFTSRLYNEVREKRGL
                     AYSVSSSMVMHDHVSELMISTATRPDKAQDSLKIIREQVAAMANDGPTEEELAAAKSF
                     LKGSYAVNNLDSSGAIANTLVSLQEAGLPSDYIDKRSELIDAVTLDQVKAIARKLLQA
                     EPAILIYGPAQS"
     gene            194783..195664
                     /locus_tag="BSVBI22_RS11010"
                     /old_locus_tag="BSVBI22_B0205"
     CDS             194783..195664
                     /locus_tag="BSVBI22_RS11010"
                     /old_locus_tag="BSVBI22_B0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="WP_004690027.1"
                     /db_xref="GI:490827937"
                     /translation="MDKALSSSPRFAVAFGGGGARGIAHIHVVDVLNELGIQPVAIAG
                     SSIGSIIGSSMANGMSGKDIYDYMASIFTNRSEVVRRMWQTRPAHWAELFKGGLRVSQ
                     FNIEKVLDVFLPDSFPSNVEDLKIPMTITAVDFHGAREIHISDGDLRSAIAASCAIPP
                     VFAPVRRNGRILVDGGLFNPVPFDFLFDKADIVIGIDVVGGPVGPDDHMPTTFEAVIG
                     TSQLTMCSIIENKFRYRPPHIFVRPNVERIGLLDFLKFEQVISQSAAVRDELKRAIEQ
                     ALDGKVAPILPEKLPDL"
     gene            complement(195677..197521)
                     /locus_tag="BSVBI22_RS11015"
                     /old_locus_tag="BSVBI22_B0206"
     CDS             complement(195677..197521)
                     /locus_tag="BSVBI22_RS11015"
                     /old_locus_tag="BSVBI22_B0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006153255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter TrkA"
                     /protein_id="WP_004687494.1"
                     /db_xref="GI:490825404"
                     /translation="MVANGGSLYLQSLMILGGAIIAAPLFKRLGLGTVLGYLAAGITI
                     GPVARLIADGEEFLHFSELGVVFLLFIIGLELNPSRLWSLRHSIFGLGTAQVLLCGAA
                     LAALGVYLAGLDTEAAIIIGFGLALSSTAFAMQVLEDRAETNQKHGQRAFAILLFQDL
                     AIVPILAIIPALSPNEPSQASAGFHLATAIASIAALVIAGRYLINPMFRIIANTGARE
                     VMIAAALFVVLGSASLLQYAGLSMAMGAFIAGVLLAESSYRHELEADIEPFRGIFLGL
                     FFVAVGLSLNLSVILEYWAVILAAVPIFMATKIVIIYLLCRIFRSSHNDAVRIAFLLP
                     QGGEFAFVLFSAASAAAIISSALGSELVAAVTVSMALTPLSVAIGSRLLIKDKADDII
                     EENFDGAGSDVLMIGFSRYGQIAAQILLAGGIDVTVIDSSSNRVRAAGKFGFRIYFGD
                     GTRKDVLEAAGIRKAKIVAICTHKKSTTNHIVNLIQSEYPDVRLFVRSYDREHTLQLR
                     AQGVEYELRETFESGLLFGQRTLEGLGLSEANAYAIREDVRQRDEDRLHVQASEGIMA
                     GRHLLFNKPVTPEPLVKPTREGQRIDKSDDGQRAPSPQETAAAPVAAE"
     gene            197723..199066
                     /locus_tag="BSVBI22_RS11020"
                     /old_locus_tag="BSVBI22_B0207"
     CDS             197723..199066
                     /locus_tag="BSVBI22_RS11020"
                     /old_locus_tag="BSVBI22_B0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="modulator protein"
                     /protein_id="WP_006191708.1"
                     /db_xref="GI:493203545"
                     /translation="MISDNSADKLVERAAELVAAAKRAGADEVDAVVMRARSVSVSVR
                     LGKVEGTESSESDDFALRVFVGRRIASVSANAGADPHRLAERAVAMARVAPEDPYERL
                     ADPSLLVKSPRDLDLFDATEIDTARLTEDALAMEAAALAVSGVTNSGGAGASRSLGGM
                     VLVTSTGFSGHYAATRFGRSVSAIAGEGTGMERDYDFSSRLHFADLDAPEAIGRSAGE
                     RAVRRLGARQAKTGPVTVVYDPRLARGIAGHLASAINGASVAHKTSFLRNSLGKPVLK
                     QGINVTDNPLRVRGPSSRPFDGEGIEGQPLTMVEDGVLQHWLLSGSSARELGLQGNGR
                     GVRSGSGVTPASTNFAIEPGTQSPEELIRAVGTGFYVTEVFGQGVDMISGQYSRGASG
                     FWIENGELAYPVSEVTIASNLKDMFLNMTPASDIDRNFGMAAPTLVIEGMTLAGN"
     gene            199053..199862
                     /locus_tag="BSVBI22_RS11025"
                     /old_locus_tag="BSVBI22_B0208"
     CDS             199053..199862
                     /locus_tag="BSVBI22_RS11025"
                     /old_locus_tag="BSVBI22_B0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_004690030.1"
                     /db_xref="GI:490827940"
                     /translation="MPETDKYSDIGTELDLLREAAREAGRIAMHYFGRSPEVWLKDGV
                     SPVSEADLAVDRFLKETLLAARLDYGWISEETVDERAAAERSRAFVVDPIDGTRAYIG
                     GQDQWCVSIAIIENGSPVAGVLECPVREELLEAGKGLGARQNGCRIHTKVPLAGEEIT
                     IAFARNQINALPEQWRGPVRVHPYVPSLAYRIAMVARGDIAGTFIRPNSHDWDLAAAD
                     LILSESGGAILTSKALPLVYGGPTRSHGALVAASGNLLREMLSVVADQPLS"
     gene            199901..200152
                     /locus_tag="BSVBI22_RS11030"
                     /old_locus_tag="BSVBI22_B0209"
     CDS             199901..200152
                     /locus_tag="BSVBI22_RS11030"
                     /old_locus_tag="BSVBI22_B0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966369.1"
                     /db_xref="GI:489056230"
                     /translation="MSDAGDNKQLLHLVFGGELKKLDSLEFRDLQNLDIVGIYPDYES
                     AKTAWKSKAQQTVDNAHMRYFIVHLHRLLDPNNMTLKAE"
     gene            200183..200959
                     /locus_tag="BSVBI22_RS11035"
                     /old_locus_tag="BSVBI22_B0210"
     CDS             200183..200959
                     /locus_tag="BSVBI22_RS11035"
                     /old_locus_tag="BSVBI22_B0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966368.1"
                     /db_xref="GI:489056229"
                     /translation="MKHEDGVTERGMQKKKGGLAKRLWRRIRGPLARSAAVKSILVWL
                     IASYLKLVHATNPRLKDSASSEDIVHDFAPFIVTFWHGQHLMGPFLRPKGLELVAMFS
                     RSADAELNARVAEKLGLLTVRGSGGRGTRANPEKGGARALLTLKNALRKGQSTSMIAD
                     IAHGKAREAGEGIILLAKLSGRPIIPLAYAFSRNHVLEKTWDKTTIPLPFGRSTIVRG
                     DPVWVDADADDVQLEEKRVELTRQLNRATDRAYAALEKAK"
     gene            200956..202296
                     /locus_tag="BSVBI22_RS11040"
                     /old_locus_tag="BSVBI22_B0211"
     CDS             200956..202296
                     /locus_tag="BSVBI22_RS11040"
                     /old_locus_tag="BSVBI22_B0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid transferase"
                     /protein_id="WP_004690031.1"
                     /db_xref="GI:490827941"
                     /translation="MSERWARSILSAYRFLGSAAYPFVGSYIAYRASRGKEDRARRGE
                     RYGKSAIARPQGPVIWAHAASVGETIALVPLVERIVATGIHVVMTTGTVTSAKVVADQ
                     LGSRVIHQYAPLDLQPAVDHFLDHWKPDLVIGCESEVWPATVLSLGSRHIPHVLVNGR
                     MSDRSFAAWQKRPALAEALFENFAHVVAQSELDGERFRALGARPVSVSGNLKVDTPPP
                     PSDPQALSLMQRQVAGRRTWAAISTHDGEEEIAAEVHQMLKMRYPRLITIIVPRHPDR
                     APAIEAMLAAKGLKVARRSTGQPIEADTDVLLGDTIGEMGLYLQLTEIAFIGNSLTKE
                     GGHNPLEPAMMGTAVLTGRNVQNFRESFQRLIKNGGARIVKDRNMLAGAINFLFNNPQ
                     HLRAMINAGVTTVRDMRGALDRTLAALEPFIQPLVLQAQLPGNRNEPAFSLDEH"
     gene            202299..203324
                     /locus_tag="BSVBI22_RS11045"
                     /old_locus_tag="BSVBI22_B0212"
     CDS             202299..203324
                     /locus_tag="BSVBI22_RS11045"
                     /old_locus_tag="BSVBI22_B0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="WP_002966366.1"
                     /db_xref="GI:489056227"
                     /translation="MASEAPPFWWDEPDWRALALAPAAWIYGRVSGRRLIRAVPPRVS
                     LPVLCVGNFTVGGAGKTPTAIAFARGAIARGMKPGIVSRGYGGNYSGLHLVDPGHDGA
                     RHVGDEPLLLARHAAVALSPDRVKAAEYLKSLGCDFIIMDDGFQSARLHADFSLLVVD
                     ASRGIGNGRVIPAGPLRAPLTDQMRKTDALLCIGKGNGADFVIRQAARAGRPIYHAQL
                     RPSSSATVAGRRWLAFAGIGNPDKFYESVRQAGGEVVETHSFADHYSFEPDDIRGLVD
                     MARRQGLGLITTAKDHVRLATMPGVPPEFLSKLAVLDVDLEFDRTDALDHILDTVVER
                     FKSRLHG"
     gene            complement(203338..203574)
                     /locus_tag="BSVBI22_RS11050"
                     /old_locus_tag="BSVBI22_B0213"
     CDS             complement(203338..203574)
                     /locus_tag="BSVBI22_RS11050"
                     /old_locus_tag="BSVBI22_B0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014298101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014298101.1"
                     /db_xref="GI:504064107"
                     /translation="MNRFESPRSSEAVLRYLDGDYEIVKHGSFVSCAVTGAPIPLDEL
                     KYWSVARQEPYASGPISFERELEMNPELRSRKKA"
     gene            complement(203672..205543)
                     /locus_tag="BSVBI22_RS11055"
                     /old_locus_tag="BSVBI22_B0214"
     CDS             complement(203672..205543)
                     /locus_tag="BSVBI22_RS11055"
                     /old_locus_tag="BSVBI22_B0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="WP_002966364.1"
                     /db_xref="GI:489056225"
                     /translation="MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEV
                     VTAGGGKTLLRVTDNGSGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGS
                     VSKLTLKSRPQDADSGFEVCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKT
                     DRAEATAITDVVKRIGIAFPHIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREF
                     GENALAIDAERDGVRLAGFVGIPSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDV
                     IARDRHPVAVLFLTLDPALVDVNVHPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRP
                     ATSGAEAMLQAFRAEGFGAQQSAPRPANSYSPASWRTAPPAPRSEWSPQTAHPAHRPL
                     DLQAAPALRENGQAVLGDVAVPAADARASVAEAPVELMQKPLGAARAQIHENYIVAQT
                     EDSLVIVDQHAAHERLVYEALKNALHARPIAGQMLLIPEIVDLPEEDAQRLAGHAETL
                     ARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIRDLADEIAEHDTADGLKAMLHHVAA
                     TMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCNHGRPTYIELKLTDIERLFGRR"
     gene            complement(205727..207010)
                     /locus_tag="BSVBI22_RS11060"
                     /old_locus_tag="BSVBI22_B0215"
     CDS             complement(205727..207010)
                     /locus_tag="BSVBI22_RS11060"
                     /old_locus_tag="BSVBI22_B0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_006191711.1"
                     /db_xref="GI:493203548"
                     /translation="MRTINENTATKTSRAAVRPEHNRIWILVFIFSFLGLMIDGADLM
                     LLSYSLTSIKAEFGLTSVEAGSLGSITLAGMAIGGIYGGWACDRFGRVKTVSWTIVLF
                     SIGTAVLGLTHSYFQFAVARFVSSLGLGALYVACNTLMAEYVPTKYRTTALGTLQAGW
                     SVGYIVATVLAGAILPVYGWRYLFFVAIVPVIIALLMHKGVPEPESWVRAKAERESGG
                     SKFTTAKRESAFKAIFGNPRVRTLFIFWALTAGFLQFGYYGVNNWLPSYLETEMGMNF
                     KSMTAYMIGSYTAMILGKVLAGVAADWLGRRAVFALGALGTAAFLPIIVLYHSPNTIL
                     WMLVVFGFLYGVPYGVNATYMAESFEAKYRGTAVGGAYNIGRAGAALAPVAIGFFASQ
                     ISIGFGFLVMGGAYFICGVIPALFIREKQFDPEKQ"
     gene            complement(207108..208262)
                     /locus_tag="BSVBI22_RS11065"
                     /old_locus_tag="BSVBI22_B0216"
     CDS             complement(207108..208262)
                     /locus_tag="BSVBI22_RS11065"
                     /old_locus_tag="BSVBI22_B0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_004692509.1"
                     /db_xref="GI:490830423"
                     /translation="MIRDPEILEILRDTVSQFVSETLIPRENEVAETNAIPADIIAQM
                     KELGFFGLTIPEEFGGLGLTMEEEVNVAFELGRASPAFRSYIGTNNGIGSIGILIDGT
                     DEQKRNYLPRLASGELLSSFCLTEPDAGSDAASLKTTAVRDGDFYILNGTKRFITNAP
                     IADIFTVMARTAADVKGADGISAFIVERNSPGLSLGKPDQKMGQKGALTSDVIFENVR
                     VPASQLIGGVEGKGFKTAMKVLDKGRLHIAALSTGAAERMLADTLAYALDRKQFGKPI
                     ADFQLIQAMLADSKAEIYAAKCMVLDAARKRDSGQNVSTEASCAKMFATEMCGRVADR
                     CVQIHGGAGYVSEYAIERFYRDVRLFRIYEGTTQIQQIVIARNMIREARR"
     gene            complement(208319..209173)
                     /locus_tag="BSVBI22_RS11070"
                     /old_locus_tag="BSVBI22_B0217"
     CDS             complement(208319..209173)
                     /locus_tag="BSVBI22_RS11070"
                     /old_locus_tag="BSVBI22_B0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_006073341.1"
                     /db_xref="GI:492971377"
                     /translation="MRSRTGSDASRRQERSAEMRKPTMLTPLEAGVEEEDRQFVTALA
                     RGLEVLRCFTPTENTLGNQEIAHKTGLPKPTVSRLTHTLVRLGYLRQDALSGLYQLDI
                     GILRLGYAMLSNLMIRTVASPLMQVLADYAKAAVAMAARDRLSMVYLDVVQGEGNMTM
                     RRQIGSTLPLAGSSVGRACLAAMPEDERTFILKHIREREPENWPSIRKGLDRALRDFE
                     DYGYCLSIGEWHRDVNSVAVPLVHKQYGVLVFNCGGPSFQLPREKLEDDIGPRLIEMV
                     HNISSAVP"
     gene            209409..210194
                     /locus_tag="BSVBI22_RS11075"
                     /old_locus_tag="BSVBI22_B0218"
     CDS             209409..210194
                     /locus_tag="BSVBI22_RS11075"
                     /old_locus_tag="BSVBI22_B0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_002968290.1"
                     /db_xref="GI:489058191"
                     /translation="MAASEDRFVSVERHADGVATVRINRPEARNALNLTTRQQLAEHF
                     RALSGDESVRAIVLTGGETCFVAGADVREFASAGPIEMYLRHTEYLWDAIASCAKPVI
                     AAVNGYALGGGCELAMHCDIIVAGEGAVFGQPEVKLGLMPGAGGTQRLIRAVGKFQAM
                     RIALTGCMVPAAEALSIGMISEMTANERTLPRAHELAVEIARLPALAVAQIKEVMLVG
                     ADLPLDGALALERKAFQLLFDSKDQKEGAAAFLEKRKPAYNGR"
     gene            210199..211728
                     /locus_tag="BSVBI22_RS11080"
                     /old_locus_tag="BSVBI22_B0219"
     CDS             210199..211728
                     /locus_tag="BSVBI22_RS11080"
                     /old_locus_tag="BSVBI22_B0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687488.1"
                     /note="converts 3-hydroxyadipyl-CoA to beta-ketoadipyl-CoA
                     in phenylacetate degradation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="WP_006191722.1"
                     /db_xref="GI:493203559"
                     /translation="MERSINHIAIVGAGVMGTGIAQIAAQAGLVTQIFDAREGAAAAS
                     RDRLASTLAKLAEKGKISAEDAQTAVSRIEICSSIQELADCDLVVEAIVEKLDAKQAL
                     FLELEAVVSGNCILATNTSSLSVTSIARVCRHPERVAGFHFFNPVPLMKVVEVIDGLT
                     TDPAVGDALLVLAKRMGHHGIRAKDMPGFIINHAGRAYGTEALKIFGECVAPRGDIDR
                     ILRESAGFRMGPLELFDLTGLDVSHPVMESIYNQFYQEPRYRPSALTRQMLEGGYVGR
                     KVGQGFYRYEDGKMVASPVPQPVPAVDIMPSVWISADCDEDKEQLYALLRSLGATVET
                     GALPSAEALCLLAPYGYDATTACELAGSDPARTVCIDMLPGLDRHRTLMMTPATSPAF
                     RDAAHALLARDGVNVTVIRDSVGFVAQRTLAAIVNLACDIAQQGIATADDIDQAVRLG
                     LGYPQGPLAWGDALGASRILKILSRMLELTGDPRYRPSPWLRRRAALGLSLRSAEPDI
                     D"
     gene            211951..213192
                     /locus_tag="BSVBI22_RS11085"
                     /old_locus_tag="BSVBI22_B0220"
     CDS             211951..213192
                     /locus_tag="BSVBI22_RS11085"
                     /old_locus_tag="BSVBI22_B0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cag pathogenicity island protein Cag19"
                     /protein_id="WP_004688863.1"
                     /db_xref="GI:490826773"
                     /translation="MGALTGYRVLDMSRVLAGPWCGQILADLGAEVIKIERPRTGDDT
                     RDWGPPWMKDEQGNPTREASYYQSANRGKFSVALNIASPEGQDLLRKMVAECDVLIEN
                     YKAGSLAKYGLDYETLSAINPGLVYCSVTGFGQTGPRAPEPGYDFIIQGIGGLMSITG
                     ERDDKPGGGPQKVGVAVADLMTGLYSAIAIEAALLSRAKTGKGQHIDMALLDVQVAAL
                     CNQSQNYLASGRPPGRYGNAHANIVPYQVFRASDRDFIIACGNDAQFVSLCDAIGLPD
                     LPKDPRFTRNSDRVIHRDEIIGILAAHFLTGTADEWIGRIHPRGVPVGAINDIARALD
                     EPQVKARNMLVQIPHPLNKDFVTVGSPIKLSGTPVEYKRAAPMLGEHTDTLLQQLAKL
                     DDDRLNDLKSRGIIEQFNSGE"
     gene            complement(213176..214344)
                     /locus_tag="BSVBI22_RS11090"
                     /old_locus_tag="BSVBI22_B0221"
                     /note="2,4-dienoyl-CoA reductase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            214430..214894
                     /locus_tag="BSVBI22_RS11095"
                     /old_locus_tag="BSVBI22_B0222"
     CDS             214430..214894
                     /locus_tag="BSVBI22_RS11095"
                     /old_locus_tag="BSVBI22_B0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_002966356.1"
                     /db_xref="GI:489056217"
                     /translation="MKIGELAKRSGLAASRIRFYESIGLLKTVDRRSNGYRTYPEEAV
                     LVLHLIATAQKAGFSLDEIRTLLPPDLDNWEHDALIEVLRRKVADIEALEARLARSKL
                     QLLGLISDIEAKPDDMACADNARRVLSRLMAEEMEAPASLQDEGRPHRRTTI"
     gene            complement(214940..215647)
                     /locus_tag="BSVBI22_RS11100"
                     /old_locus_tag="BSVBI22_B0223"
     CDS             complement(214940..215647)
                     /locus_tag="BSVBI22_RS11100"
                     /old_locus_tag="BSVBI22_B0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyl sulfoxide reductase subunit C"
                     /protein_id="WP_004686845.1"
                     /db_xref="GI:490824755"
                     /translation="MGKRVLHVVTNVAHYADPSQPTGLWLSELSHAHDVFAAKGYDQH
                     IVSPKGGVSPLEPRALKWPLLDTSAKAWLADPARMALLTTTARPDQIDPADYDAIYFT
                     GGHAVMWDFPDSQGLQNITRAIWEQGGIVSSVCHGYCGLLNTRLSDGSLLAAGKRLTG
                     FSWMEEILAGVSSRMPYNAEQEMKRRGAHYQKAFLPFISYVVADGRLVTGQNPASAKA
                     TAEKVVALMEMRSNPLF"
     gene            complement(215878..217221)
                     /locus_tag="BSVBI22_RS11105"
                     /old_locus_tag="BSVBI22_B0224"
     CDS             complement(215878..217221)
                     /locus_tag="BSVBI22_RS11105"
                     /old_locus_tag="BSVBI22_B0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006218981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_002966355.1"
                     /db_xref="GI:489056216"
                     /translation="MMRPRSLQWRISLWLGLGISMLWAIAALVTASQLSREMNVVFDS
                     ALEETAQRILPLAVLDITERESDDEMNQRMATLRKHDEYFTYVVRNTAGEVLLQSHSA
                     DLSIFPPFTTMGFQTTPTHRIYFDAALQGAVNIAVAEPLGARRGVAMQVLWRLALPLG
                     LVIPLSLIGVWAIVRVSMAPLWAFRSDIEARGSGDLSPVTVNDLPSEVSPIAQAVNRL
                     MDKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHR
                     LSRLSEKLMQLAKAEGGRLHAAEPIDMGVILRMVVRELSQPHGNENRIRLSIPDMAVK
                     IDIDADAFAILARNLIENALKHGPHDEPVEVLLTASGKLVVSNGGPAVPPDILERLSH
                     RFERGATKAEGTGLGLAIAKAIAAGTGGTIDLFSPREGRKDGFEVRFTPGGRVLH"
     gene            complement(217218..217886)
                     /locus_tag="BSVBI22_RS11110"
                     /old_locus_tag="BSVBI22_B0225"
                     /note="transcriptional regulator; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            218150..218422
                     /locus_tag="BSVBI22_RS11115"
                     /old_locus_tag="BSVBI22_B0227"
     CDS             218150..218422
                     /locus_tag="BSVBI22_RS11115"
                     /old_locus_tag="BSVBI22_B0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073355.1"
                     /db_xref="GI:492971391"
                     /translation="MAASLGWNVKRIKIDDGCYEIKGLNEAGKPFKAKINPQSLAIMK
                     LKVKGMDDDRDHRRNRQQHGDAPGPLDGVPANKLIQKGSTPKVQVQ"
     gene            218590..219060
                     /locus_tag="BSVBI22_RS11120"
                     /old_locus_tag="BSVBI22_B0228"
     CDS             218590..219060
                     /locus_tag="BSVBI22_RS11120"
                     /old_locus_tag="BSVBI22_B0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006204531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tat pathway signal protein"
                     /protein_id="WP_002966352.1"
                     /db_xref="GI:489056213"
                     /translation="MKSLLSALAITTALTFPGLALAQPVTLSTTLNNYGGDGAYIALY
                     VTDAQGAYAGSLWMAGGKSKYYQHLSGWYRATGGDTAEIDGITGASVGAGRKLEITLD
                     LADALFDAGYTLHVDAAVEDMQDSPDEIALPLTSKGSGVPVRGRRYIANFTYTK"
     gene            219071..221275
                     /locus_tag="BSVBI22_RS11125"
                     /old_locus_tag="BSVBI22_B0229"
     CDS             219071..221275
                     /locus_tag="BSVBI22_RS11125"
                     /old_locus_tag="BSVBI22_B0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase FAD/NAD(P)-binding subunit"
                     /protein_id="WP_004681497.1"
                     /db_xref="GI:490819399"
                     /translation="MIRWLHRWSGIIAAVLLMVLALSGAALSVFPAMERLSAPQAETG
                     LSVADLMARIQANYPAVEQVRRTPSGKITAYWFDDGAPQAAVIDPATGKSVAPANPNR
                     LEQWLKGLHRSLFLGDSGRIVMAIGALIMLGLSISGAFLIARRTGGWKNWFKPLRGAA
                     SGRLHTEVARIAVLGLLLSSTTAVWMSASTFDLLPKSPVVAEPTGVSGETGMKPALIA
                     KLEETPVSSFKELSFPYPGDATDMFVLKTDRGTGYLDQGTGAVLDWHDYTVWQRISQT
                     VKMLHTGKGAALLGIILGLASLTVPFLGITGIVLWFAGLRGRPRIRDNAAAGKAETIV
                     LVGSEGGSTWGFAATLHAALREAGQSVHVGPMSSFNPARYGKAQRILIFAATYGNGDA
                     PASAKGFLDRLAALPKSPAAPLAVLGFGDRSFPDYCAFAKAIADGARAKGWKELIPFE
                     TVDRQSTQDFARWGRDLGAAIGIKLELVHQPVIPAVAALTLVSRRDYGADVQAPTAIL
                     RFALPKPTFWQQLSGAGFSRFEAGDLLGIVPEGSAVPRFYSLASGSRDGFVEIVVKKH
                     PAGLCSGQLFELQPGDTMRAFLRRNANFHAGKGRTPLILVGAGTGIGPLAGIVRANRQ
                     HRPVHLFFGMRHPESDFFYHEDLQEWQGEGRLQNLTTACSRVHNPSYVQDALRKDAAE
                     IARLVNKGARVMVCGGRDMAAGVSEALADILAPAGLTPAVLKAEGRYVEDVY"
     gene            221256..222233
                     /locus_tag="BSVBI22_RS11130"
                     /old_locus_tag="BSVBI22_B0230"
     CDS             221256..222233
                     /locus_tag="BSVBI22_RS11130"
                     /old_locus_tag="BSVBI22_B0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis lipoprotein ApbE"
                     /protein_id="WP_002966350.1"
                     /db_xref="GI:489056211"
                     /translation="MSKMFTDLKRHGLNGPTMRTRWSAIFYAAADFDIAPLRRALQQA
                     VDEVDMQMSTWKPDSDLMRLNRAPVGVWVEVPARLMEVLRLAIEIGRATGGAFDAAMG
                     DAVKAWGFGPMEADQRLISEALAGPRVAAHDALELDISAMRVRKRAAVTLDLNGIAKG
                     YGVDRLADTLESFGIHSGLVGIDGEMRALELRPDGTPWAIAVEMPDYNRRAPHSVLAL
                     HNGAVATSGDYRHWVVAGGHRLSHTMDPHRGAPLSTPPASVTVVAKTCAQADAFATAL
                     MVLGPIAGSKLAQSLGLDVLFLLRDGETIRPQPVGALFSGHPYPLQKLG"
     gene            complement(222276..223451)
                     /locus_tag="BSVBI22_RS11135"
                     /old_locus_tag="BSVBI22_B0231"
     CDS             complement(222276..223451)
                     /locus_tag="BSVBI22_RS11135"
                     /old_locus_tag="BSVBI22_B0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_004687483.1"
                     /db_xref="GI:490825393"
                     /translation="MTSSQCFLCLILLLLFIGFAAFAIPRILVNRKVHKAIVDLKDYV
                     SHASNQNVRMTGEVDILRAIVKRHPLEQTLTMLCRFVEKQIPGTRCSVLILDPSGKKV
                     GKSIAPSLPTHYNKALIGLEIGPNIGSCGAAMFLRRPVIISDIATHPNWLSFRDLALP
                     CGLRACWSMPAINGAGKVLGAFAIYSDTPRTPAQNELMVGQIAVELSMIAVDTAQTQE
                     RLASQAMHDDLTQLPNRRYIGKLLTQKKSARDGLSRDGFLLLIDLDDFKPVNDTYGHL
                     TGDEVLKEVAQRLLRIVCEEDTVARMGGDEFMIVLNGGTSKEQTDIIASRIIREVSKP
                     IEVSQHKPVKVGCSIGIVSTREWRSNKYIFDCADKAMYSAKSKGKNRFEYFEEKQAA"
     gene            223468..223695
                     /locus_tag="BSVBI22_RS11140"
     CDS             223468..223695
                     /locus_tag="BSVBI22_RS11140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002970776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002975811.1"
                     /db_xref="GI:489065802"
                     /translation="MQTCMIEAIAKKSVFLKAALLSKCHYGSYFGLRKRDKAKASQEN
                     MSYFFMLGILCLVLHRYALMQINHMGNIQFI"
     gene            complement(223734..224627)
                     /locus_tag="BSVBI22_RS11145"
                     /old_locus_tag="BSVBI22_B0232"
     CDS             complement(223734..224627)
                     /locus_tag="BSVBI22_RS11145"
                     /old_locus_tag="BSVBI22_B0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004692492.1"
                     /db_xref="GI:490830406"
                     /translation="MPIYELAALGAATCWALTGLISAWPAGQLGALTFNRIRQVFVTG
                     LLAVYVLATGAWHQMSAENIWPLLLSGFIGIFVGDTLLFATLNRVGPRRSGILFAMNA
                     PMTAILGWFVLGETLSLAAVAGIAITVFGVSLAIFFGKRRTQQHPWESVKGSLWVGIG
                     LGLLAALGQAVGSIIARPVMETGLDPFVGSLLRVGIAACCLTALAQLPLPAVKPRNPL
                     TFKVAAMTALAGFLSLALGMTMLLFALSGGKAGIVSTISATTPVILLPLLWLRTGECP
                     AAGAWIGAFFVVIGMALIFLR"
     gene            224843..225544
                     /locus_tag="BSVBI22_RS11150"
                     /old_locus_tag="BSVBI22_B0234"
     CDS             224843..225544
                     /locus_tag="BSVBI22_RS11150"
                     /old_locus_tag="BSVBI22_B0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_002966347.1"
                     /db_xref="GI:489056207"
                     /translation="MTESEQNPMERKRGSGVRMVYDLLRDEILDLKLAPGSPIDEVQL
                     AERFGMSRTPIREALVRLSSEGLVETLPNRSTMVSNIDFLNMHTFFDALVLMYRVTTR
                     LAAQYHRPEDLRIIHELQAQFTAAVDAQNALGMIATNAAFHAAIADAGRNAYFTGLFN
                     RLLDEGRRIMRLYYQSYDDRLPRRFVEEHEEIIAAIEARDVAQADRLGKIHAEQIVEQ
                     VRKLFERKAVLDIEL"
     gene            225645..226607
                     /locus_tag="BSVBI22_RS11155"
                     /old_locus_tag="BSVBI22_B0235"
     CDS             225645..226607
                     /locus_tag="BSVBI22_RS11155"
                     /old_locus_tag="BSVBI22_B0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_004688868.1"
                     /db_xref="GI:490826778"
                     /translation="MKAEIFSGVIPALMTPCKPDRSPDFDALVRKGQELIGDGMSAVV
                     YCGSMGDWPLLTDAQRMEGVERLVKAGIPVIVGTGAVNTASAVAHAAHAQKVGAKGLM
                     VIPRVLSRGSVIAAQKAHFKAILSAAPDLPAVIYNSPYYGFATRADLFFALRAEHPNL
                     VGFKEFGGPADMRYAAENITSRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPK
                     EVIHLCNLSQAAALGDVDARQRAQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEY
                     TLHFNETDALSESQRGYVETQFRLFNTWYAEWSKLPGAVQRCKA"
     gene            complement(226670..227707)
                     /locus_tag="BSVBI22_RS11160"
                     /old_locus_tag="BSVBI22_B0236"
     CDS             complement(226670..227707)
                     /locus_tag="BSVBI22_RS11160"
                     /old_locus_tag="BSVBI22_B0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004690043.1"
                     /db_xref="GI:490827953"
                     /translation="MTDGTNLTIEKLHARVEEIFRKAGLNAIQAGAVARVIVAGERDH
                     CKSHGIYRIEGALRTVKAGKVKPDAVPELVAQEASAIVRVDAKGGFANPAFELGVPVL
                     AERARSHGLAALVINDCTHFSALWPEVEALTEKGLAGLIMCPSYATVAPTGGSKPLLG
                     TNPFAFGWPRRDNPPYVFDFATSVAARGEIELHRRAGKQLPEGWAIDKDGKPTTDPET
                     ALEGAMLPFGGHKGSAISTMIELLAGIMIGDRTSPEVLDFLGTTTLSPVHGELIIAFS
                     PEAFAAGRPGDPFARAEAFFEAIVGQGARLPSQRRFTARAASQSEGITLNKAEIDYLD
                     QLAEKGLDAVS"
     gene            227944..229212
                     /locus_tag="BSVBI22_RS11165"
                     /old_locus_tag="BSVBI22_B0239"
     CDS             227944..229212
                     /locus_tag="BSVBI22_RS11165"
                     /old_locus_tag="BSVBI22_B0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_004687479.1"
                     /db_xref="GI:490825389"
                     /translation="MLAKALRKFSGDRVALLRDYLSLFSGSAGRLVVSLVYFIALANT
                     LPTSDFGIFATASGTGVMLSRLVSLGFNSPLYRIATVKPRLLGVYTAGYLAALVVSLP
                     LLFLASWLVYLAFFDRDVAFLPFALVVIVAEALFWRSMEIIIIVNNGLNRFLIGAGLV
                     IFGTMTRAVAAVLFMWMTTTHDIAHWAWWYAGANAAGLIVALWFYPRIRLRFKPGLYM
                     RRISDSIAVMGAELLFYLQSELDKLLVLGIGGPATAGLYAIIMRLVDLTALPIRSFNM
                     MLVQKLMRTPDMLSSLRIRTGLEVAVFAISVAGLGALAIFLWIFPNALGSNVAPIVGL
                     LPLVLLVPGFRNLIEYQTEILYARGQSGLRTLNLALMTGAKALLVWQLLSHFGESRDW
                     LLGLNVVFAGLYILSLVFTYTSIRRPAKRI"
     gene            complement(229220..229693)
                     /locus_tag="BSVBI22_RS11170"
                     /old_locus_tag="BSVBI22_B0240"
     CDS             complement(229220..229693)
                     /locus_tag="BSVBI22_RS11170"
                     /old_locus_tag="BSVBI22_B0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-binding protein"
                     /protein_id="WP_002966342.1"
                     /db_xref="GI:489056202"
                     /translation="MENLSELHAADINRLEAHHQTLLDLCLQLEEAAEDVQTPGSPQD
                     YIKLADAIPRLLDETHELEETVLFPDFHRQSGSYFAGVVIERLKAEHRCDRLSAEELS
                     RTLRAVANGQCKLAPDTVAYMVRGFLESLRRHILSEKLMLEALLAAKSEQREVFG"
     gene            complement(229750..229905)
                     /locus_tag="BSVBI22_RS11175"
                     /old_locus_tag="BSVBI22_B0241"
     CDS             complement(229750..229905)
                     /locus_tag="BSVBI22_RS11175"
                     /old_locus_tag="BSVBI22_B0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966341.1"
                     /db_xref="GI:489056201"
                     /translation="MTDAQIGLLVAAPAIICFSLILYRMGALQGAGTISAVTASVIIA
                     AVLFFGQ"
     gene            230009..230578
                     /locus_tag="BSVBI22_RS11180"
                     /old_locus_tag="BSVBI22_B0242"
     CDS             230009..230578
                     /locus_tag="BSVBI22_RS11180"
                     /old_locus_tag="BSVBI22_B0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="WP_004687478.1"
                     /db_xref="GI:490825388"
                     /translation="MLRSEDNAIAALAAGEGQEEEDSLLLWVLVWSELITFAILLVAF
                     MVMSVVDPQGVGLLRAHLSPGLAATNTVILLMSGWQAALAVRRRNNPKAVRRPLLFAA
                     LFGFCFVAVKLLEYSHEARFAGDEAAGSFFELYFLITGFHLLHVLFGSVILMLVAWRP
                     SRSNVLLIATLWHAIDLVWLVMFPILYLA"
     gene            230586..230864
                     /locus_tag="BSVBI22_RS11185"
                     /old_locus_tag="BSVBI22_B0243"
     CDS             230586..230864
                     /locus_tag="BSVBI22_RS11185"
                     /old_locus_tag="BSVBI22_B0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966339.1"
                     /db_xref="GI:489056199"
                     /translation="MTDTTVHGSLNRTLAILLVLAVSGALIASFLGTYLAGIVVVLIL
                     AYAKACFVILDFMEMRGTRGALRPALLTWPAILLTLALARSVAVSLLG"
     gene            231024..231476
                     /locus_tag="BSVBI22_RS11190"
                     /old_locus_tag="BSVBI22_B0244"
     CDS             231024..231476
                     /locus_tag="BSVBI22_RS11190"
                     /old_locus_tag="BSVBI22_B0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_004690045.1"
                     /db_xref="GI:490827955"
                     /translation="MAERLTKTGARNVFYGGSIFFFAIFVGLTAHSHYYMKTTSTDES
                     TLTSGVARGKHVWEKNSCINCHTLLGEGAYFAPELGNVWKRWAGDTDPESARETLKAW
                     MAAQPSGIEGRRQMPQFSLSDQELDDLADFLEWTSRIKTQNWPPNDAG"
     gene            231502..232851
                     /locus_tag="BSVBI22_RS11195"
                     /old_locus_tag="BSVBI22_B0245"
     CDS             231502..232851
                     /locus_tag="BSVBI22_RS11195"
                     /old_locus_tag="BSVBI22_B0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitric oxide reductase"
                     /protein_id="WP_004688871.1"
                     /db_xref="GI:490826781"
                     /translation="MKYQSQKVAMLYFYGALALFVAQVLFGVVAGTIYVLPNTLSVLL
                     PFNIVRMIHTNALIVWLLMGFMGSTYYLLPEETETELYSTKLAVIQFWLFFVAAGVAV
                     AGYLFHIHEGREFLEQPFFIKVGIVVVCLIFLFNITLTALKGRKTTVQHSLLFGLWGL
                     ALFFLFAFYNPINLALDKLYWWYVIHLWVEGVWELIMASILAFLMIKLNGIDREVVEK
                     WLYVIVGLALFSGILGTGHHYYWIGAPGYWQWIGSLFSTLEVAPFFTMVMFTFVMTWR
                     AGRKHPNRAALLWSIGCSVMAFFGAGVWGFLHTLSSVNYYTHGTQLTAAHGHLAFFGA
                     YVMLNLAVMAYAIPEIRGRAPYNQWLSMVSFWMMCTAMSVMTFALTFAGVVQVHLQRV
                     LGENFMEVQDQLALFYWIRLGSGVVVVISALMFVWAVLVPGRQRSQKLSGFAQQPAE"
     gene            232942..233754
                     /locus_tag="BSVBI22_RS11200"
                     /old_locus_tag="BSVBI22_B0246"
     CDS             232942..233754
                     /locus_tag="BSVBI22_RS11200"
                     /old_locus_tag="BSVBI22_B0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_006191741.1"
                     /db_xref="GI:493203578"
                     /translation="MTSLLKNVETASPAIPAYSPSGNECALFEMAWQRKLPLLLKGPT
                     GCGKTRFVSHMVARMGLPLSTVSCHDDLAAADLTGRYLLKGGDTIWMDGPLTRAVRDG
                     GICYLDEIVEARKDVAVVLYPLTDDRRILPLERTGELLDAPDSFMLVVSYNPGYQNLL
                     KSLKPSTRQRFVAIEFDFLPKEQEIAVVSEESGLAESRVAPLVDLAHRLRALKGHDLE
                     EGVSTRLLVYCAALIEAGMSQREAARAAMIEPLTDEPDVKAALLEIADAMLK"
     gene            233766..235667
                     /locus_tag="BSVBI22_RS11205"
                     /old_locus_tag="BSVBI22_B0247"
     CDS             233766..235667
                     /locus_tag="BSVBI22_RS11205"
                     /old_locus_tag="BSVBI22_B0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Protein NorD"
                     /protein_id="WP_006191744.1"
                     /db_xref="GI:493203581"
                     /translation="MLDFLELEETVGRAWHRLIGKTGSWPQYPDHAVQLVDIRQRLAI
                     CFRGFGGDIAVQIAPARARTSTHRLGLRRRMALGEEKLAQPLRDEATLMLPPEIALFP
                     DRQLNYDLYVWLVGYMAVMPMDADALPEDALRRDLAALQIAEQTVERACRAFPGLKPR
                     YKRLCAAILAERPKRPLHRLEQQVEARILSLLKQGADLPDDALPTIFPHRGPAGYLPA
                     LPVPLWPGLMKREEVAPRTGEDEPVRNSQSEGAETGRQIAQRERQDPRHADRSPFILN
                     RFEKILAMAEMVSVDRPSDDSDEQNAKSADELDDLTLGERKGRPAARFRFDLDLPPEA
                     VDRSLLTAELTYPEWDYRKGAYLPDHCAVLAAPVQEKEKPLELDAAAQSLVRRVRRQF
                     EILRPGREVLRAQLDGTDLDLDAVVRSRCDLAAGGQGSDRVHLMSRPQANDLAVTLLV
                     DVSLSTDAWVDNRRVLDVEKEALLVLANGIAACGDRCSILTFTSRRRSWVRVETVKDF
                     DESFGPTVEHRIAALKPGFYTRMGAAMRHATAKLAEQPNRKKLLLLLTDGKPNDVDHY
                     EGRFALEDSRRAAGEARAKGVNVFAVTVDREASAHLPALFGRGGYALVANLAKLPVAL
                     PAIYRMLAG"
     gene            235847..236131
                     /locus_tag="BSVBI22_RS11210"
                     /old_locus_tag="BSVBI22_B0248"
     CDS             235847..236131
                     /locus_tag="BSVBI22_RS11210"
                     /old_locus_tag="BSVBI22_B0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004687476.1"
                     /db_xref="GI:490825386"
                     /translation="MSSQPVSTIPVIDVRTIPPITRHATIFSMIDTLEPGEVLEIVND
                     HDPVPLRNQLEHRNPGAFSWVYKETGPLWRVEIGRRKVHASDHECTCGNH"
     gene            236167..237534
                     /locus_tag="BSVBI22_RS11215"
                     /old_locus_tag="BSVBI22_B0249"
     CDS             236167..237534
                     /locus_tag="BSVBI22_RS11215"
                     /old_locus_tag="BSVBI22_B0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004688872.1"
                     /db_xref="GI:490826782"
                     /translation="MFGATLSRWTLSYFASSLAFLIAGVGLMVEGFGYPFHGIRAPET
                     LILVHIIAIGWLALLMGGALLQFVPVLVARPLWGSGGGLPALLLLLAGLVGLLCGFAG
                     MAGFGEPPAWLLPFSGLLLIAGFSILVLMLAMTIWQARPIALPARFVAVGLACLLAVA
                     FLGGIFTLAFSGMSENDMLLNIAGLSAPIHAALGLGGWMTFTAMGVSYRLLTMFLLSP
                     DDERRTTRLVWWAGAAALTVLGAGVAAFAFGQDRADVVLLAALLPGVASVVLYAFDMR
                     AVYRQRKRKAIELNSAASIPAFAAMVLAILLALALPWTGPSDPMIGALVYLFVFGWLT
                     GLSLAQLYKIVPFLTWLECYGPVMGRVPTPRVQDIVSEKPARRWFCIYYTGVALATLA
                     LGAGYPVAFQLASALNLIAILALTVHFFRARRLMDVPEAVRLPNGVAIPHLIYAGGPV
                     PRRSK"
     gene            237531..238058
                     /locus_tag="BSVBI22_RS11220"
                     /old_locus_tag="BSVBI22_B0250"
     CDS             237531..238058
                     /locus_tag="BSVBI22_RS11220"
                     /old_locus_tag="BSVBI22_B0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_002966332.1"
                     /db_xref="GI:489056192"
                     /translation="MTVQELAPYELDVRPLLKSGVEPFQAIMGAVDSLAPGQGLLLIA
                     PFKPVPLFAVLERKGFEAKPEPIGEGDWQVLFSPVVEPLAEVQLSKNVGSPDIWPDPL
                     QYLDCTDMDPPEPLVRILAEVENMSAGEVLFALLHREPLFLFPELENRGHQWVGNFDE
                     TGKTYRIMIRVGGGG"
     gene            238065..238391
                     /locus_tag="BSVBI22_RS11225"
                     /old_locus_tag="BSVBI22_B0251"
     CDS             238065..238391
                     /locus_tag="BSVBI22_RS11225"
                     /old_locus_tag="BSVBI22_B0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966331.1"
                     /db_xref="GI:489056191"
                     /translation="MEPKQLERIKACVREALRAVQDPELAVNLVDLGMIYAVEISDDG
                     MVHVKMTTTTRGCPAAGFLTQAVQACIEEIEGVTGARVELTYEPEWKPEMAIPEVQAI
                     FAAPSF"
     gene            238515..239690
                     /locus_tag="BSVBI22_RS11230"
                     /old_locus_tag="BSVBI22_B0252"
     CDS             238515..239690
                     /locus_tag="BSVBI22_RS11230"
                     /old_locus_tag="BSVBI22_B0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006210331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="WP_006133663.1"
                     /db_xref="GI:493096622"
                     /translation="MQHPVRRRAIFFIGGYDPKTPEAFFNRLLREIARFGALWDVKTQ
                     VSPVSENASSEIGSVTIETRSAEGWSTQTDFNFLVLDKIVLADFARPLPVRLWKYLVA
                     FADFVLSGTAFRFFARAWRFALYFLYPFLALVLFALAGWLAARLTAPWLGLAGWIVGL
                     FVFFLALATLGNRWSTNHLMDLWSFSRNFMRGQRPDAEALMQRFAEEIDRRVAAGHYD
                     EVIVIAHSTGGMLMLDVAARCLAADRAFATRAPNVVLLTLGSTALKAGYHPAAGKFRQ
                     DVQRLVDEPALEWCEMQCLTDVINFYKTDPVAEMKLKRPADRAFPLVRQVRIKDMLQP
                     DIYRRIKRNFFRVHYQYVFGNTKAYWYDFFQICCGPASLSERMRDMLVGTAKESAQQ"
     gene            239687..240271
                     /locus_tag="BSVBI22_RS11235"
                     /old_locus_tag="BSVBI22_B0253"
     CDS             239687..240271
                     /locus_tag="BSVBI22_RS11235"
                     /old_locus_tag="BSVBI22_B0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="farnesyl cysteine carboxyl-methyltransferase"
                     /protein_id="WP_004681542.1"
                     /db_xref="GI:490819444"
                     /translation="MMPLIALIVWSIGLVAWVVIRIPHQRRARKIKVARTARTLADRL
                     ALGAATVGLSVVPLVYVATGFPKFADYTFQPWMGWIGTLIELLFLWLFYASHKQLGKN
                     WSVSLDIRREHKLVTDGLYRYVRHPMYLSFWLWAIAQFFLLPNWIAGLAGLLGVAILY
                     FYRIEHEEAMMREAFGSAYDEYSSRIGRIIPKPW"
     gene            240297..240920
                     /locus_tag="BSVBI22_RS11240"
                     /old_locus_tag="BSVBI22_B0254"
     CDS             240297..240920
                     /locus_tag="BSVBI22_RS11240"
                     /old_locus_tag="BSVBI22_B0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006119388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191747.1"
                     /db_xref="GI:493203584"
                     /translation="MNRRSPFLGLLAGAALVLPSLPAEAKTQQAAMPPNATSPHQADV
                     YLLRGFADIFSTGIDEIGAELQAAGVNAHVQGHAAWRLVLNRIVADQQKNGHLPVVLI
                     GHSLGANAAIYIAEELERRGIAVDYMATFAATGPDPLPGNVRRVVNFYFKQHGWGLPL
                     VPGPRSHGHLENRDFSNAKDVGHFNIEKQRPLQAEVVRDVLAVVNAD"
     gene            241276..242406
                     /locus_tag="BSVBI22_RS11245"
                     /old_locus_tag="BSVBI22_B0256"
     CDS             241276..242406
                     /locus_tag="BSVBI22_RS11245"
                     /old_locus_tag="BSVBI22_B0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006079079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite reductase"
                     /protein_id="WP_006191750.1"
                     /db_xref="GI:493203587"
                     /translation="MADQIQVNRRTILAGAALAGALGPVLSATSAWGQGTMRKASAEE
                     IAALPRQKVELVDPPFVHAHTQVAEGGPKVVQFTMVIEEKKIVIDDAGTEVHAMTFNG
                     TVPGPLVVVHQDDYLELTLINPETNTLLHNIDFHAATGALGGGGLTEINPGEKTVLRF
                     KATKPGVFVYHCAPPGMVPWHVVSGMNGAVMVLPREGLHDGKGNKLTYDKVYYVGEQD
                     FYVPRDENGNYKTYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKALTAKSGEK
                     VLIIHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAAAAFYTFRQP
                     GIYAYVNHNLIEAFELGAVAHFKVTGEWNDDLMTSILAPSGM"
     gene            242539..243459
                     /locus_tag="BSVBI22_RS11250"
                     /old_locus_tag="BSVBI22_B0257"
     CDS             242539..243459
                     /locus_tag="BSVBI22_RS11250"
                     /old_locus_tag="BSVBI22_B0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_011069112.1"
                     /db_xref="GI:499381541"
                     /translation="MAKVAGKQRLRDWAVAVPAVLLAVASGLFVVDATGGTERSKTEM
                     KVALPQTVTIKPRTMTYRADGDFQKNNYPVDAPLTTRKLRRSFEIMKYQVTGAEYRRC
                     VDDGACQPPEDLPHNRNWASADKPVVGVSYTDAEDYAAWLSKKTGSVWHLPTDERWAF
                     AAGTRFADDAVGIEGDESKNPALRWLRDYEQQSARKQDRNQTVRPLGAFGENEYGLAD
                     IGGNVWEWTQTCHRRVNIDAYGKVASETTVCGVYVVNGKHRAAMSSFIRNPKTGGCSV
                     GVPPDNLGFRLVRDGRWYAPVLMRLKDFTS"
     gene            243560..244255
                     /locus_tag="BSVBI22_RS11255"
                     /old_locus_tag="BSVBI22_B0258"
     CDS             243560..244255
                     /locus_tag="BSVBI22_RS11255"
                     /old_locus_tag="BSVBI22_B0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_004681550.1"
                     /db_xref="GI:490819452"
                     /translation="MAMIDRGLVRKLSLFAKMRDDELDRLVSYATSRRVPQGESIFEQ
                     GDEASCFYLLLHGRLKVNQVTPDGQQIIVRMVHPGDLFGFARALQRNDYPGTATAVME
                     SIVLAWPTELWDYFVEQNPGLAMNAIQTIGKRLEEAHTRIREMSTEEVERRVAHAVLR
                     LSRQAGKKEETGIRIDFPISRQDIAEMTGTTLHTVSRILSNWETKGLVQGGRQKLLVL
                     DSAGLRRLAEGED"
     gene            244338..245393
                     /locus_tag="BSVBI22_RS11260"
                     /old_locus_tag="BSVBI22_B0259"
     CDS             244338..245393
                     /locus_tag="BSVBI22_RS11260"
                     /old_locus_tag="BSVBI22_B0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcription regulator"
                     /protein_id="WP_006191752.1"
                     /db_xref="GI:493203589"
                     /translation="MHISRKKATIYDLSVLSGSSPSTVSAVLNGTWRKRRISQATAEA
                     ILQLADQHAYTANRQAQGLRHSRSGLVGLLLPLHDNRFFSAMAQIFEAHVRARSLCPV
                     MVSASRDPEEERETAETLISYAIDELFICGATDPDGLHELCEKAALPHVNIDLPGSRA
                     PSVTTDNFAGGKMLTAAIIEYFGEEAPLQPEDLCLFGGRNDESTRQRICGFHQVKQTV
                     LGADPEGCVFKTGYSPANTLVVLNDYRARHGRLPRGLFVNSSINLEGLLRFMAEHPGE
                     PLNDIVIGCYDYDPFASFLPFPVISILQDVEGMIAKAFDLMERRVTEPELHLIMPKLI
                     APRSAITGPLDSLKDIK"
     gene            complement(245574..245795)
                     /locus_tag="BSVBI22_RS11265"
                     /old_locus_tag="BSVBI22_B0260"
     CDS             complement(245574..245795)
                     /locus_tag="BSVBI22_RS11265"
                     /old_locus_tag="BSVBI22_B0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012243385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966321.1"
                     /db_xref="GI:489056181"
                     /translation="MTLLLMIVYSCAGMRFKKFVNEPAPQVLKRATAKEAVIPSTPLR
                     ILRFIVPPLPLTAFAILRHSIQWAGGDHN"
     gene            245794..246846
                     /locus_tag="BSVBI22_RS11270"
                     /old_locus_tag="BSVBI22_B0261"
     CDS             245794..246846
                     /locus_tag="BSVBI22_RS11270"
                     /old_locus_tag="BSVBI22_B0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006119385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_002967363.1"
                     /db_xref="GI:489057244"
                     /translation="MKGLKMTGALAGVLMMAATTAHAEVKDAVVGFLMPDQASTRYEE
                     RDYPGFAAQMKTLCESCKVLYLNADGDATKQQQQFNSVISQGAKVIVLDAVDTAAAAS
                     LVKLAQSQGIKVIAYDRPIPDAKSDFYVSFDNEAIGKSIAESLVKHLKDKGVPTDKGG
                     VLQINGSPTDAAAGLIKNGIHAGLKDSGYKTLAEYDTPEWAPSKAQQWASGQITRFGD
                     QIVGVVAANDGTAGGAIAAMKAAGVDPLPPVTGNDATIAALQLIISGDQYNTINKPSE
                     IVASEAARVAVQLLGDKAPKAETTLYNTPSKLFVPVVVTAENLKAEIIDKKVVPAATL
                     CVDRYAEGCKKLGITN"
     gene            247190..248011
                     /locus_tag="BSVBI22_RS11275"
                     /old_locus_tag="BSVBI22_B0262"
     CDS             247190..248011
                     /locus_tag="BSVBI22_RS11275"
                     /old_locus_tag="BSVBI22_B0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006253315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191753.1"
                     /db_xref="GI:493203590"
                     /translation="MSQDHKAAATSSQPVLRLSGISKNFGAVSALTDIDLEVFPGEVV
                     ALVGDNGAGKSTLVKTLAGVHQPTSGTIEFNGEKVVLSSPGVALDLGIATVFQDLALC
                     ENLDVVANIFLGREISPYRLDEVSMEIKAWKLLNELSARIPSVREPVASLSGGQRQTV
                     AISRSLLLDPKLIMLDEPTAALGVAQTAEVLDLIERVRDRGVIMISHNMEDVRAVADR
                     IVVLRLGCNNGIFYPDSSNEELVAAITGATSNSVSRRAERRLAQHDNAHGRGEVR"
     gene            248008..249246
                     /locus_tag="BSVBI22_RS11280"
                     /old_locus_tag="BSVBI22_B0263"
     CDS             248008..249246
                     /locus_tag="BSVBI22_RS11280"
                     /old_locus_tag="BSVBI22_B0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006049055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004690056.1"
                     /db_xref="GI:490827966"
                     /translation="MNDINTLLDRQDVRVRHDKGVSGAIRTFIDRVKSGDLGSLPVIV
                     GLLIIWTVFQTLNPVFLSSNNLVNLLFDCSTIGVISLGIVCVLMLGEIDLSVGSISGL
                     SSAIIGVLWVNNGWPVGVAIIAALCAGALAGFLYALLYNRFSMPSFISTLAGLLAALG
                     LQLYLLGNTGSINLPYGSWLVSFGQLLVMPRPLSYALALVAGLAIFFTGFRAAQRRRT
                     AGLSAPSAAGIALKALVITLIIGCGVFYLNQSRGVPWMFALFVALVIAMNYALTRTRW
                     GRCVQAVGGNREAARRAGINVNFIYVSAFMACSTLAAAGGIMAAARLASSSQQAGTGD
                     VNLNAIAAAVIGGTSLFGGRGSAWSALLGIIVIQSIASGLTLLDLSSSLRYMITGAVL
                     AIAVIVDSLARRSRQSHGRA"
     gene            249533..250261
                     /locus_tag="BSVBI22_RS11285"
                     /old_locus_tag="BSVBI22_B0264"
     CDS             249533..250261
                     /locus_tag="BSVBI22_RS11285"
                     /old_locus_tag="BSVBI22_B0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose dehydrogenase"
                     /protein_id="WP_004690057.1"
                     /db_xref="GI:490827967"
                     /translation="MAQDLNGRVAAVTGAASGIGFECAKHMIGAGITVFLVDRDENAL
                     AEKCVELGDKAKPLVVDLLDPASVATMMPQILEQAGQLDIFHANAGSYIGEPLWEGDP
                     DAWDRMLNLNINAAFRTVHAVLPHMMERKTGDIIMTSSVAGVVPVIWEPIYTASKHAV
                     QAFVHTVRRQVAPHGIRVGGVLPGPVVTALISDWPQAKLDEALAAGSLMEPKEVAESV
                     MFMLTRPRNITIRDLVILPQSLDL"
     gene            250274..251878
                     /locus_tag="BSVBI22_RS11290"
                     /old_locus_tag="BSVBI22_B0265"
     CDS             250274..251878
                     /locus_tag="BSVBI22_RS11290"
                     /old_locus_tag="BSVBI22_B0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005974615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulokinase"
                     /protein_id="WP_006191754.1"
                     /db_xref="GI:493203591"
                     /translation="MTNYYLGVDVGTGSARAGLFDAGGTILASARRDIAIWREAGGIV
                     EQSSDDIWQAVCESVREVVRVAGVDPAAVAGIGYDATCSLVVLGEGGKPLAVGPSNDR
                     ARNIIVWMDHRAGEQAERINTTKADVLGYVGGAISPEMETPKLLWLKEHKPETFAAAW
                     QFFDLTDFLTWKSCGSLARSACTVTCKWTYLSHEKRWDETYFRAVGLGELADESFVRI
                     GTDVRAGGENLGGLSKQAAAELGLRPGTAIAAGLIDAHAGGIGTVGARGSEGRILSRM
                     AYVFGTSACTMTTTEQPVFVDGVWGPYFSAMVPGLWLNEGGQSAAGAAIDHLIHMHPF
                     AAEAEKAAADQGKGLADSLAAEVEARGGPEKTAMIVGDIHVVPEFLGNRAPFADPDAR
                     AVIAGLDLDTGMDSLAALYLAGLCGLGYGVRQIIEAQRAKGIVTDTIVVSGGAARSNL
                     VRQVLADATGLVVTASTSPEPVLLGSAMLGAVASGAYPDLVTAMQVMSELGARNRPDA
                     RRAKWHDHRFEAFMLLQATARKIRYL"
     gene            complement(252010..252675)
                     /locus_tag="BSVBI22_RS11295"
                     /old_locus_tag="BSVBI22_B0266"
     CDS             complement(252010..252675)
                     /locus_tag="BSVBI22_RS11295"
                     /old_locus_tag="BSVBI22_B0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004690059.1"
                     /db_xref="GI:490827969"
                     /translation="MRRAPAPQPSYRLIPSCFPPIGLFDTVATAADLEAVMELAGWTN
                     DRLVEERLYRLARTEWVFGRTNSSIVMASFLHVAPGGMRFNGSELGAWYSAAKLTTAI
                     IEVAHHMRREAVATGIARLARTFRTYTARLEGSFVDISGEKETMADIYDHTSYAASQR
                     FGEEMRATGETSILFDSLRHEGGINAVAFRPSRILEVTQADHYEITVEASSRRIEARK
                     LPA"
     gene            complement(252672..253199)
                     /locus_tag="BSVBI22_RS11300"
                     /old_locus_tag="BSVBI22_B0267"
     CDS             complement(252672..253199)
                     /locus_tag="BSVBI22_RS11300"
                     /old_locus_tag="BSVBI22_B0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967360.1"
                     /db_xref="GI:489057241"
                     /translation="MATNSAAMKPVISKGPDMLDARRFTPASRKRLSAPGLRTFLAIA
                     DLWKLDEQQRLLVLGLPSRSTYYNWVKAVREHRDITLDVDVLMRLSAVLGIHQALGVL
                     YPGEAAGRKWLHTPNGASLFGGQPPLQLVASGTQDGLMAVRRFLDAARGGLYMEPNAL
                     DRAFHPYHDEDVVFS"
     gene            complement(253217..255145)
                     /locus_tag="BSVBI22_RS11305"
                     /old_locus_tag="BSVBI22_B0268"
     CDS             complement(253217..255145)
                     /locus_tag="BSVBI22_RS11305"
                     /old_locus_tag="BSVBI22_B0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191755.1"
                     /db_xref="GI:493203592"
                     /translation="MSRMTSFWGLLRAYWVSDRWKEAWALTAAIFLITAFISKTTVWV
                     AEASGHLMNSIVNVNTAPVQSPLAAVVTNAGVLIILILAKDVLLVGFRHLLSTTLHRK
                     WRKWLNDSFSDALLDRNHIHFHLQQGNGAHLPDNVDQRVQESIKGMTGGAIGLVMGIV
                     GVVLSAFFVGQKLLEISTEVHGLEFLGSYGGALLALAVILLYVPLGTLIAIKIGKRLE
                     RLNLGMQKAEGSYRGEWTTLLRRSFQISASEGENVQRTVNNRLYREVDGTWDKLNRFD
                     AAYLAFSQAYGFLSLRIVAYIPGFLPYMSGAVNFRNYVTGAELVAAMINDCSWFIQVM
                     PAIANLRANAGRVIGLAQSIESVQEPAEFYARSGVNRFAFTHQHPRFGLSVRNLTLMQ
                     GPASETPFLRSGVINMRAGDWIYMRGESCSGKTSFIKALNGLWPYGTGNIIYPQGANS
                     LYVPQEAKFPSVSLKQLVALPRDEGDFNDLAVAAVLHEAGLGEFIERMKDADAGNSPW
                     DMVLSSGQKQKVMLARILLHKPSIIFLDEATGALDPASKLRFHTALKPAARTPSSSAS
                     CMRKSCPRSKAAKASSLMCWISPMAMFRSSPPISRPPRMRNPQCRLSQPNKPSFTTDI
                     SCQDIHGCKSLKLDYIPI"
     gene            255491..255682
                     /locus_tag="BSVBI22_RS11310"
     CDS             255491..255682
                     /locus_tag="BSVBI22_RS11310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966313.1"
                     /db_xref="GI:489056173"
                     /translation="MVLDASAKLCCWPVEFRFSFQGALECRFLPAGESRLSLRHINMA
                     PIYEGSFRLKDTSAASGGM"
     gene            255800..258058
                     /locus_tag="BSVBI22_RS11315"
                     /old_locus_tag="BSVBI22_B0270"
     CDS             255800..258058
                     /locus_tag="BSVBI22_RS11315"
                     /old_locus_tag="BSVBI22_B0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding protein"
                     /protein_id="WP_004690064.1"
                     /db_xref="GI:490827974"
                     /translation="MGQLGLLLFLAMLAVAPARAADIGKYLPSLDPQVLFQGADSIGE
                     PQGEPPIAPVKKGNELLGYAYLNSDFTNATGYSGKPIRIVVGIDTKGVIRGFKLVDHK
                     EPIVLIGIPEPKVVAALNSLVNSDMTAVAAGQIKPPQVEIVSGATVTVLVMGDSVVRS
                     AVGLIRSGRLGNAPVQAVVADAPRAVNMDLVEEKDWQTLIGDGSVRSLKLTVGEVTQA
                     FRDAKHDEAAANPETADPEDEFIELYVAPASVPSIGISLLGKEGYERLRKQLKPGQQA
                     ILVAGDGAYSFKGSGYVRGGIFDRIELMQDGQGVRFRDKNHTRIGDLMADGAPSLREI
                     ALFRVPEGFAFDVTRPWDMQLLVQRGFGARDKANVSYDVGYNLPEQYMLKQPEPAPAK
                     PVATADAPRQPQPVGEATAADILGENSPLWVKMWEMNRVNVVIAGISILILVAIFFFQ
                     DSLVRHPRFFTWLRRGYLLFILVWLGFYNNAQLSVVNVLTFTNSLITGFNWEFFLTSP
                     LIFILWGATAAGLLFWGRGPFCGWLCPFGALQELTNNLAQWLKVPQVKLPWGLHERLW
                     PLKYIIFLGLFALSLYSMALAELFAEVEPFKTSIILKFARDWPFVIYALTLLAVGLFV
                     ERFYCRYLCPLGAALAIPGRIRMFEWLKRWQECGSPCQRCAKECPVEAIHPEGQINVN
                     ECIYCMHCQELYHDDQRCPHMIQVRVKREKFAARNAPLAAAAERGGGPARPIISVKGK
                     PVETPVNPGPAA"
     gene            258079..259998
                     /locus_tag="BSVBI22_RS11320"
                     /old_locus_tag="BSVBI22_B0271"
     CDS             258079..259998
                     /locus_tag="BSVBI22_RS11320"
                     /old_locus_tag="BSVBI22_B0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936459.1"
                     /note="reduces nitrous oxide to nitrogen; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrous-oxide reductase"
                     /protein_id="WP_002967358.1"
                     /db_xref="GI:489057239"
                     /translation="MTEETRKSQLSRRQLLGTSAFVAAAGASGLGGALLAGSSETALA
                     AGAAKGGMSPEVKPGELDEYYVFFSSGQCGEVRIVGLPSMRELMRIPVFNRDSATGWG
                     LTNESRKVLTEGLLPQDREFLKDRGDIFLNGDLHHPHPSFTDGTYDGRYLYANDKANT
                     RVCRIRLDVMKCDKIIQLPNQHTVHGLRVQKYPKTGYVFCNGEDRVPIPNDGSHLNDV
                     KQYHAIFTAVDGETMKVAWQVMVDGNLDNVDCDYQGKYAFSTCYNSEEGTTLAEMMSS
                     EQDWIVVFNLKRIEEAVANGDFKEMNGVPVIDGRHGSKYTRYIPVPNSPHGINTAPDG
                     IHVVANGKLSPTVTVFDVRKFDDLFDDKIKPRDAVVAEPELGLGPLHTAYDDKGNAYT
                     TLFIDSQICKWNIEDAKRAFKGEKVDPIRQKLDVHYQPGHNHSSMGQTKEVDGKWLIS
                     LNKFSKDRYLNVGPLKPENDQLIDISGDKMVIVHDGPSFAEPHDATIVHRSKINPVSF
                     WSREDPFFADAVAQAKADGLDLMEANEVVRDGNKVRVYMTSSAPAFGLTEFTVQQDDE
                     VTVYVTNIDEIEDLTHGFAIVNYGVNMEVAPQATASVTFKASKPGVWWYYCSWFCHAM
                     HMEMQGRMLVEPKKA"
     gene            260004..261398
                     /locus_tag="BSVBI22_RS11325"
                     /old_locus_tag="BSVBI22_B0272"
     CDS             260004..261398
                     /locus_tag="BSVBI22_RS11325"
                     /old_locus_tag="BSVBI22_B0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate-binding protein"
                     /protein_id="WP_002966309.1"
                     /db_xref="GI:489056169"
                     /translation="MVLPRLFRTAGIMSLLAAALCAGAQARQIDVAVGESVQAAIEKA
                     EPGDVVRLRAGRHEGAVVIDRAIELTGEPGAVLDGLGTGNAITVNAPNAIVRGLEVHG
                     SGDNLPDLHSGIFVSRTATGARVENNRLIGNTYGIYLHGAADSIAIGNEVLGRRGVRM
                     AETGSGVSVWNAPGAQVVGNTIRYGRDGIYTNASRKNIFRDNVMEDVRFAVHYMYTDD
                     SAVIGNVSRNNSVGFAIMYTNRLKILNNVSEGDRDHGLLLNYANSSIITGNRVVGRMQ
                     PIERWLEAGLQKGEHGVPGEEKVEASAGETARLGPEKCVFIYNANKNKFSENSFENCS
                     IGIHFTAGSEGNAMSGNSFINNRNQVKYVGTRNLDWSVDGRGNYWSDNPAFDLDGDGI
                     ADSPYRPNDLIDRVLWTVPQAKILINSPAVDTIRWAQTQFPALLPGGVVDSHPLMKPL
                     LKPTAQLKESKHND"
     gene            261436..262386
                     /locus_tag="BSVBI22_RS11330"
                     /old_locus_tag="BSVBI22_B0273"
     CDS             261436..262386
                     /locus_tag="BSVBI22_RS11330"
                     /old_locus_tag="BSVBI22_B0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011265426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011069115.1"
                     /db_xref="GI:499381544"
                     /translation="MATFGTGSETVVLDKVTKSYGGFNAISDASFRLMAGENIALVGH
                     NGAGKTTMIKLMLGLIRPTKGAVRVLGEHPAAGAFAARLRLGYLPEHVSFNMALTGAE
                     TLGFYARLKQVPFGQADALLERVGLAHAAHRRVGTYSKGMRQRLGLAQALLGQPAVLL
                     LDEPTTGLDPALRQSFYEILESLRQEGTTILMSSHALTELETKVGRVIIANKGKVIAD
                     GSIDALRRISRLPMRIRVEVNDVSCLPVETGNLLLRWHRLGPDLYETEAPAEGKMELV
                     RRIVAMNDKLNELDIIPPTLDELYAHFLNMGDMAVQEAAE"
     gene            262383..263213
                     /locus_tag="BSVBI22_RS11335"
                     /old_locus_tag="BSVBI22_B0274"
     CDS             262383..263213
                     /locus_tag="BSVBI22_RS11335"
                     /old_locus_tag="BSVBI22_B0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191761.1"
                     /db_xref="GI:493203598"
                     /translation="MNNIAIIATKEIQEGLRNRWVLATTLLLAALALSMTFLGSAPTG
                     SSVAASKLDVVIVSLSSLTIFLIPLIALLISHDAIVGEMERGTMLLLLSYPLSRIQVV
                     LGKFIGQLAILAFATLFGYGVAALALAATGTGVDAASWISFLKLIGSSILLGAVFIAI
                     GFLASTLVRERSTAAGIAIGVWLFFVLIYDAALLALLVFDQGQTIGSAALNALLLLNP
                     ADSYRLLNFGTGQAGALTGMGGMAGNATLSAPALALALGLWAVLPLSLSMLGLLRKEL
                     "
     gene            263210..263749
                     /locus_tag="BSVBI22_RS11340"
                     /old_locus_tag="BSVBI22_B0275"
     CDS             263210..263749
                     /locus_tag="BSVBI22_RS11340"
                     /old_locus_tag="BSVBI22_B0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006108251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer-membrane lipoprotein nosL"
                     /protein_id="WP_002966306.1"
                     /db_xref="GI:489056166"
                     /translation="MKRALFLAPFFFALLAGCSPAEKQEPATPFALTENAMGRYCGMN
                     VLEHPGPKGQIILRPTNEPIWFSSARDTLAFTMLPEEPKNIAAIYVSDMAKAPNWDEP
                     GANNWIDAHKAFFVIESGAVGGMGAKEAVPFSDRAAAERFTADNGGRIVSFDEMPRDY
                     VLGEQTAQHVEPDGESHMH"
     gene            263761..264753
                     /locus_tag="BSVBI22_RS11345"
                     /old_locus_tag="BSVBI22_B0276"
     CDS             263761..264753
                     /locus_tag="BSVBI22_RS11345"
                     /old_locus_tag="BSVBI22_B0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006179452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis lipoprotein ApbE"
                     /protein_id="WP_004692457.1"
                     /db_xref="GI:490830371"
                     /translation="MSITRRRVLVGGAVAATFSMLPRFAFAQGEQQPVIWQGQALGAP
                     AKIIFYHPGRKVAERLVGESAREAERLENIFSLYRPDSEIVRLNHTGALASPAPEMVE
                     LLGICRTCWQLSDGLFDPTVQPLWQCLRKHFSQANPAPEGPSRAEWDAALAKIGFDHV
                     LFNAERIAFTKPGMALTLNGIAQGYVTDRVVGLLRDAGVSEALVDMGEYRAIGGQPDG
                     KPWRIGIADLEAGAAPEEFIDIMDQALATSSFAGFQFEESGRFNHLLNPKTGYSAALY
                     RRVTVVAPDTAMADALATAFSLMEPAQIKETLKKLPGIFAYTVSRDGEKRRFGA"
     gene            264868..265566
                     /locus_tag="BSVBI22_RS11350"
                     /old_locus_tag="BSVBI22_B0277"
     CDS             264868..265566
                     /locus_tag="BSVBI22_RS11350"
                     /old_locus_tag="BSVBI22_B0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_004690070.1"
                     /db_xref="GI:490827980"
                     /translation="MAAIIDWALVRSLPVFSGMDDAAFEQLMGLAMPRAVPKGSAVFK
                     QGEEARLFYLLVQGRLKVMQVTADGQQLIVRVVNPGEFFGFAMALGREDYPGTPLAVV
                     DCSVIAWSMEMMTAFMASNPALAVNTMQMIGRRLDAAHSRIREISTQEVEQHVAHAVL
                     RLVRETGIQEDTGLRIDFPVSRQDIAELTGTTLHTVSRIVSQWQSKGWVEGGRQSLLV
                     RDLRRLRQIAEGEI"
     gene            265704..266144
                     /locus_tag="BSVBI22_RS11355"
                     /old_locus_tag="BSVBI22_B0278"
     CDS             265704..266144
                     /locus_tag="BSVBI22_RS11355"
                     /old_locus_tag="BSVBI22_B0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudoazurin"
                     /protein_id="WP_002966303.1"
                     /db_xref="GI:489056163"
                     /translation="MRNTAIKFAAAGLFALLAAPALAENIEVHMLNKGAEGAMVFEPS
                     YIKANAGDTITFIPMDKGHNVETVKDMIPDGAEKFKSKINEHYTVTVNQPGAYLIKCT
                     PHYAMGMVALIAVGDKPENLEKIVSAKKPKVVQERLDKILAEVK"
     gene            266195..267436
                     /locus_tag="BSVBI22_RS11360"
                     /old_locus_tag="BSVBI22_B0279"
     CDS             266195..267436
                     /locus_tag="BSVBI22_RS11360"
                     /old_locus_tag="BSVBI22_B0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_002968319.1"
                     /db_xref="GI:489058220"
                     /translation="MTTQQGLQASPATMPSERKGGIPRGLKMTGPVILSYGFRPFFLG
                     GAIWAVMAMLLWILSLTIGLPLGGSYGALNWHAHEMVFGFSSAVLAGFLLTAVPNWTG
                     RLPVSGGPLAVLCGVWLAGRLAFLAPDLVHIDVAVAIESLFLPFLLFIAAREIIAGHQ
                     WRNLKVLGGIAGVMIANFAFHYLVLTDGDVTFANRIGVSAYVLLVTLIGGRIIPSFTR
                     NWLNRMGKTRFPVPFNRYDALTLIVGVVACLSWIFLPESSLTAVLALIAAAFHLVRLY
                     RWRGWTVAREKLLVILHVAYLFVPGGFVAIALSALDRLNPFSALHVMTVGAIGAMMLA
                     VMTRATRGHTGRELVASPMTQIAYVCIIAAAVIRPFAEIMPNFFHTLLAASALLWMLA
                     FGLFVVEYGPMLLRKRRSRMG"
     gene            complement(267510..268550)
                     /locus_tag="BSVBI22_RS11365"
                     /old_locus_tag="BSVBI22_B0280"
     CDS             complement(267510..268550)
                     /locus_tag="BSVBI22_RS11365"
                     /old_locus_tag="BSVBI22_B0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_004690072.1"
                     /db_xref="GI:490827982"
                     /translation="MTTTRRDILLGAAAFGLASIATRLPAYAQDASAAPEKPELMFGV
                     GGKPLFYYLPLTIAERKGFFEEEGIKATINDFGGGAKSLQALIGGSVDVVTGAYEHTI
                     RMQNRGQDIKAVCELGRFPGICIGVRKDLAGDIKTIADLKGQNVGVTAPGSSTSLLLQ
                     YALIKNGLSPDAASIIGIGGGASAVAAIKKGEIAALVHLDPVITRLEVDGDITLLLDT
                     HTEEGTRQLFDGTNPAATVYVQQSFIDANPVTTQRVVNAFVKSLKWIHNASADEVADT
                     VPEEYLLGDRALYKTGFEKSRAMYSQKGPIAEDGFKSLFEMLKTLDPELAGANITFAQ
                     TFDPRFVEAARA"
     gene            complement(268576..269367)
                     /locus_tag="BSVBI22_RS11370"
                     /old_locus_tag="BSVBI22_B0281"
     CDS             complement(268576..269367)
                     /locus_tag="BSVBI22_RS11370"
                     /old_locus_tag="BSVBI22_B0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004690073.1"
                     /db_xref="GI:490827983"
                     /translation="MKKPMLFLAQLGIAVAVILVWHLFTATHLFGNPAKAQFFFATPG
                     DVALRTYKWFVDGTIWYHLGITLLEAMLAFAIGAVGGVLIGFWFARKPLLAAIFDPYV
                     KAANSLPRVVLAPIFALWLGLGIWSKVALGVSLVFFIVFFNVYQGVKEVNQTVLSNAR
                     MLGMNERQLLRNVYLPSALSWMFSSLHTAVGFAVVGAVVGKYLGSSAGLGYLIHQAEG
                     VFDVTGVFAGMLVLTAFVLLIDWGVSIIEQRLLVWRPKAAGQNGA"
     gene            complement(269364..270209)
                     /locus_tag="BSVBI22_RS11375"
                     /old_locus_tag="BSVBI22_B0282"
     CDS             complement(269364..270209)
                     /locus_tag="BSVBI22_RS11375"
                     /old_locus_tag="BSVBI22_B0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ABC transporter ATP-binding protein"
                     /protein_id="WP_002966297.1"
                     /db_xref="GI:489056156"
                     /translation="MSAYPKLVQSNEPHPTAIELKDVQISFRLADGGRFDAVAESNLA
                     VAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQGLNRKAGYLFQQDAL
                     MPWKTVLENVAIGLEIAGTPKAKAREQAREWLNKVGLGTFGDRYPHMLSGGQRKRVGL
                     AQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLWSQDKKAVMFVTHDLEEAIALAD
                     RVVIMSAGPRARIMAEYRIPLARPREISEIRLDNQFHEIHREIWSALKEEVLKGYQQT
                     SGERS"
     gene            complement(270636..271568)
                     /locus_tag="BSVBI22_RS11380"
                     /old_locus_tag="BSVBI22_B0285"
     CDS             complement(270636..271568)
                     /locus_tag="BSVBI22_RS11380"
                     /old_locus_tag="BSVBI22_B0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_004690074.1"
                     /db_xref="GI:490827984"
                     /translation="MATNATPSLSMGPVLFLWDGPKWRDFYFRIADEAPVSHVTVGEI
                     VCSKRFHFVDPYMEAVIERLQQAGKTVSLGSLALVMLEREAKQVRQTIEKATLPVEAN
                     DLSALGLLSGKPHTVGPLVNVYNAATAKVLAERSATSICLPPELPLASIREIVKGAPD
                     IAFEVFSFGRVPLAISARCAHARSKGHIKDNCQFVCGEEPDGLPVKTLDSQPFLALNG
                     VQTLSHTCQAFLEDMPELKAAGVSRFRLSPQVCDMVAVAQIHEDVLLEKIDPDEGVAR
                     LKEVYPAVPLSNGFLHGGIGAAWVSRQRSMAAGH"
     gene            complement(271571..272548)
                     /locus_tag="BSVBI22_RS11385"
                     /old_locus_tag="BSVBI22_B0286"
     CDS             complement(271571..272548)
                     /locus_tag="BSVBI22_RS11385"
                     /old_locus_tag="BSVBI22_B0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_004692455.1"
                     /db_xref="GI:490830369"
                     /translation="MELICPAGTPSALREAVQAGADAVYCGFRDETNARNFPGLNFSR
                     DELRDAIGFAHARNCQVFVAINTFMRAGDEHIWYKAVDDAAALGADAVILADFGLMAY
                     TAERHPNQRLHVSVQASASNADAISFLIDTFKAKRVVLPRVLTIADIAKLGRKIPCEM
                     EVFVFGGLCVMAEGRCSLSSYATGKSPNMNGVCSPASHVRYRHDGSELVSELGDYTIN
                     RFPAGEAAGYPTLCKGRFNIGDEEGYAFEDPVSLDVMDHIDELRAAGVSALKIEGRQR
                     GKAYVAEVVSTLRQTLAAGPEKRAALLSRLRALSEGQQTTSGAYEKRWR"
     gene            complement(272539..273063)
                     /locus_tag="BSVBI22_RS11390"
                     /old_locus_tag="BSVBI22_B0287"
     CDS             complement(272539..273063)
                     /locus_tag="BSVBI22_RS11390"
                     /old_locus_tag="BSVBI22_B0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004687455.1"
                     /db_xref="GI:490825365"
                     /translation="MMKIPQAVAAPARLVPPFLLNPLVSRVFHQVIRAHPGLFERLGE
                     HVNKRFGFRPSDLPFAFLVEPGKPRISVFRQDAAFEADAAIEGPLVMLLALLEGKLDG
                     DALFFSRDITVTGDMEAMLALRNALDDCNVDLPADLGNGAGPFGPVVRSIAGYIREKA
                     LGADAHDREAHSWN"
     gene            273177..274691
                     /locus_tag="BSVBI22_RS11395"
                     /old_locus_tag="BSVBI22_B0288"
     CDS             273177..274691
                     /locus_tag="BSVBI22_RS11395"
                     /old_locus_tag="BSVBI22_B0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006196217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="WP_004688885.1"
                     /db_xref="GI:490826795"
                     /translation="MKSSSSLPTHYDCLQSFLTELEKRGDLVRIARPVSLVHEVTEIH
                     RRVLEADGPALLFENPVDAEGRTQTIPLLANLFGSERRIAWGLGRLPEELPLLAEMLA
                     ELRAPKPPRSAGEIWEKLPMAKAALNMRPRQVSRAPVHGLVMEGASVNLDTLPIQWCW
                     PGEPAPLITWPLVITRAPDDPSDVNVGIYRMQKLGENRLIMRWLAHRGGARHHRMWQK
                     RGEDMPVAIAIGVDPATILAAVMPLPEGMSELAFSGLLGGRRPCVTQGRTVPLMVPAN
                     AEIVLEGRVSATQTAPEGPYGDHTGYYNSVEAFPVMQVTAITMRKKPVYLSTYTGRPP
                     DEPSRLGEVMNQLFVPVVRKQFPEIADLWLPPAACSYRAMVVSIDKRYPGQARRVMMG
                     LWSMLPQFSYTKLIIAVDPDIDVHNWDDVMWALATRFDASRDVVTLSDTPVDYLDFAS
                     PRSGLGGKLGLDATNKIGPETDREWGKVLAMNEETIARVDAIWDELGLDRDKRI"
     gene            274688..275278
                     /locus_tag="BSVBI22_RS11400"
                     /old_locus_tag="BSVBI22_B0289"
     CDS             274688..275278
                     /locus_tag="BSVBI22_RS11400"
                     /old_locus_tag="BSVBI22_B0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006214440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="WP_002966292.1"
                     /db_xref="GI:489056151"
                     /translation="MKRIVIGVSGASGSLIPLKLLERLAVMEEVETHLVISDAAQQTL
                     RYELGANGYSLLYRLAARTYAVEDVGAAIASGSVPTAGMIIAPCSMRTLSAIANGYSD
                     SLLTRAADVHLKERRKLVLIARETPLHLVHLRNMCTVTEMGAIVMPPVPAFYLQPQTV
                     EDVASQVAARAIDLIGVGTPQAQSWNPEEKPRRKAG"
     gene            complement(275288..275824)
                     /locus_tag="BSVBI22_RS11405"
                     /old_locus_tag="BSVBI22_B0290"
     CDS             complement(275288..275824)
                     /locus_tag="BSVBI22_RS11405"
                     /old_locus_tag="BSVBI22_B0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966291.1"
                     /db_xref="GI:489056150"
                     /translation="MKAAPILAAIHAAKDVPVDPLLAEIAARGKQDGLRVAGFFQHRG
                     KDTEECCRDIEIEHIATGITQIISQPLGTGSRGCRLDPAALADVAGALLGELEAGAQL
                     LILNRFGKGETEGHGFRSVIEAAYARQIPVLTVVRETYIDGWRDFAGPCGTLLAPNSE
                     SVTDWFNAVMAPPLRAAI"
     gene            complement(275821..276756)
                     /locus_tag="BSVBI22_RS11410"
                     /old_locus_tag="BSVBI22_B0291"
     CDS             complement(275821..276756)
                     /locus_tag="BSVBI22_RS11410"
                     /old_locus_tag="BSVBI22_B0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_004690078.1"
                     /db_xref="GI:490827988"
                     /translation="MVTLFDRKNAGGQPAGDNPAGHHGHQHQSGYTTYQEPDTRVPPK
                     PRPVFDAVSVNGVTIDEADILTEAQNHPAENPGAALLSAARALAVRELLLQRAREIGI
                     EPEHEKDAEGRAETDEDALVRMVIEREVDVPSASRDEAQRYYENNRHRFTSAPILEAS
                     HILIAADPADQETRDAARQTATRLAAAVIAEPATFASVALEYSSCPSGAQGGNLGQLT
                     RGSTVPEFERALERMTPGETTANPIESRFGYHIVRLDRRVEGEELPFDYVVDKIAGWL
                     EASTWSKAVSQYIAILAAEAEITGIDLLSGEDGGE"
     gene            complement(276762..277487)
                     /locus_tag="BSVBI22_RS11415"
                     /old_locus_tag="BSVBI22_B0292"
     CDS             complement(276762..277487)
                     /locus_tag="BSVBI22_RS11415"
                     /old_locus_tag="BSVBI22_B0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_006191772.1"
                     /db_xref="GI:493203609"
                     /translation="MASYFNTFLFGIYPYIALSVLALGSIVRYDREPYTWRSGSSQLL
                     RRRQLMWGSVLFHLGVLVIFAGHFVGLLTPIWIFDTLGISHEAKQILAIVAGGIAGLM
                     AIIGASMLVHRRLFDPRVRASSRPSDTLIIILLWVQLLLGLSSIPVSLQHIDGGEMVK
                     FMNWAQGIFTFNPAASSYVADASIMFKMHIFLGLTIFILFPFTRLVHMLSAPVRYIWR
                     PGYQVVRERNHTAAPSHLRAPAE"
     gene            complement(277498..278205)
                     /locus_tag="BSVBI22_RS11420"
                     /old_locus_tag="BSVBI22_B0293"
     CDS             complement(277498..278205)
                     /locus_tag="BSVBI22_RS11420"
                     /old_locus_tag="BSVBI22_B0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase subunit delta"
                     /protein_id="WP_004688887.1"
                     /db_xref="GI:490826797"
                     /translation="MNRTLKIISLLLSYPSPELQAGRAELKAALEGEKNLSPGVRRLL
                     DKLVDYICTADLYEAQERYVHLFDRTRSLSLHLFEHVHGESRDRGQAMVDLGQMYEDN
                     GFDIDAKELPDYLPLFLEFLSTRSTEEIHDLLTQTGHITAAIGERLRKRQSPYAGAFA
                     ALLHLANAKPDEKLVGELLRQEEDDPDDLAALDRIWEEEAVTFGANAGENACGPDRLR
                     MQMRAAHRKPASPSTQI"
     gene            complement(278205..279743)
                     /gene="narH"
                     /locus_tag="BSVBI22_RS11425"
                     /old_locus_tag="BSVBI22_B0294"
     CDS             complement(278205..279743)
                     /gene="narH"
                     /locus_tag="BSVBI22_RS11425"
                     /old_locus_tag="BSVBI22_B0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014489568.1"
                     /note="with NarGJI catalyzes the reduction of nitrate; the
                     beta subunit is an iron sulfur cluster containing electron
                     transfer subunit; one of 3 nitrate reductases in E. coli
                     and in E. coli is expressed when nitrate levels are high;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase A subunit beta"
                     /protein_id="WP_004690079.1"
                     /db_xref="GI:490827989"
                     /translation="MKIRAQIGMVLNLDKCIGCHTCSITCKNVWTNREGVEYAWFNNV
                     ETKPGVGFPKEWENQKKWNGGWVRKKNGKIEPKMGAKWRILAKIFANPDLPEIDDYYE
                     PFDFDYGHLQTAGESRTMPTARPRSLISGERMEKIEWGPNWEEILGGEFAKRSKDYNF
                     EGVEKEIYGQFENTFMMYLPRLCEHCLNPTCVAACPSGAIYKREDDGIVLIDQEKCRG
                     WRMCVSGCPYKKIYYNWSSGKSEKCIFCYPRIESGQPTVCSETCVGRIRYLGVMLYDA
                     DRISEAASTANEQDLYQEQLNIFLDPNDPAVIEQARKDGVPDAWLEAAKHSPVYKMAM
                     DWKIAFPLHPEYRTLPMVWYVPPLSPLQSAAQAGKLGMDGPLPDVRSMRIPVRYLANL
                     LTAGKEKPVISALERMLAMRAYMRAKTIDGVIDEAIADRVGMSGAMIEEMYNIMAIAN
                     YEDRFVIPTSHREITEDAYDVRGSCGFTFGNGCSGGTSTEDLFGAKRQKVVQTPTDIF
                     REQV"
     gene            complement(279740..283504)
                     /gene="narZ"
                     /locus_tag="BSVBI22_RS11430"
                     /old_locus_tag="BSVBI22_B0295"
     CDS             complement(279740..283504)
                     /gene="narZ"
                     /locus_tag="BSVBI22_RS11430"
                     /old_locus_tag="BSVBI22_B0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363708.1"
                     /note="with NarYV catalyzes the reduction of nitrate; the
                     beta subunit is an iron sulfur cluster containing electron
                     transfer subunit; one of 3 nitrate reductases in E. coli;
                     expression of nitrate reductase Z is not dependent on
                     nitrate levels; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase A subunit alpha"
                     /protein_id="WP_006191775.1"
                     /db_xref="GI:493203612"
                     /translation="MSLLLDRLNFLARRNVGTFSEGHGVTTNESRDWEDAYRKRWQHD
                     KIVRSTHGVNCTGSCSWKIYVKGGIITWETQQTDYPRTRADLPNHEPRGCPRGASYSW
                     YIYSANRVKYPLIRSRLLKLWRKERAVKTPVAAWAAIQQDPAKRSDYMKVRGLGGFVR
                     ATWDEVNEIIAAANAYTTKTYGPDRVVGFSPIPAMSMVSYAAGSRYLSLLGGVCMSFY
                     DWYCDLPPASPMTWGEQTDVPESADWYNAGFLMLWGSNVPQTRTPDAHFYTEARYKDA
                     KSVVVCPDYSEAAKFSDLWLHPKQGTDAALAMAFGHVMLREYHLDRQVPYFEDYCRKY
                     SDFPMLVMLTKKDGHYVPGRFVRASDFADNLGEGNNPDWKTVGFDTKSGAYVAPQGSI
                     GFRWGDDGKWNLEEKDGKGKDVELAKSFIDKDAHDAVADVAFPYFGNLDHEHFEGTDH
                     DSILVRKVPARTLKLKEGDVMVATVFDLFAANYGLDRGLGDENCAKSYDDGLPYTPAW
                     AEKITGVPRAQIIAVAREFATNAEKTNGRSMVIVGAGLNHWYHMDMNYRGIINMLVMC
                     GCVGQSGGGWSHYVGQEKLRPQTGWTALAFALDWTRPPRHMNSTSFFYAHTDQWRYET
                     VKVQDILSPTAPEGNWDGTMMDYNIRAERMGWLPSAPQLQVNPLEVAKQAAESGKDAK
                     DFVAGALKNGSITMSCEDPDHEANWPRNMFVWRSNLLGSSGKGHEYFLKHLLGTSNGL
                     LGKDLGQEGAQESREAVWHEHAPEGKLDLLVTLDFRMSTTCVYSDIVLPTATWYEKND
                     LNTSDMHPFIHPLSSAADPAWEARSDWEIFKGIAKKFSDVAPEVLGVEKDVVLVPALH
                     DTAGELAQPKDVLDWKRGEVEPIPGKTMPSVVVVERDYPNLYKRYTSVGPLLDKLGNG
                     GKGISWNTQHEVDLLAKLNGKVGEPGTSEGRPRIDTDIDATEVILSLAPETNGEVAVK
                     AWAALSKFTGRDHTHLAIPKEDEKIRYRDIVAQPRKIISSPTWSGLESESVCYNAGYT
                     NVHELIPWRTLTGRQQLYQDHLWMRAFGEGFCVYRPPIDTRTVSSAIRAKTDGQPHLV
                     LNFITPHQKWGIHSTYSDNLLMLTLNRGGPVVWIAEPDAARAGIADNDWVEIYNSNGA
                     IVARAVVSQRMREGTTFMYHAQEKIVNTPGSPLTGQRGGIHNSVTRVITKPTHMIGGY
                     AHQAYGFNYYGTVGSNRDEFVVVRTLDKVDWMEGPLEEGNKSSQVKEAAE"
     gene            complement(283528..286266)
                     /locus_tag="BSVBI22_RS11435"
                     /old_locus_tag="BSVBI22_B0296"
     CDS             complement(283528..286266)
                     /locus_tag="BSVBI22_RS11435"
                     /old_locus_tag="BSVBI22_B0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite transporter"
                     /protein_id="WP_006191776.1"
                     /db_xref="GI:493203613"
                     /translation="MQHVAGENPRAQTTALAMSTTAFTVCFAVWTIFAIIGIEIRSEL
                     GLTETQFGLLVGTPILTGSLIRVILGIWADRYGGRAIFTLTMLVSAVATYLLTYATTY
                     PQMLLAALGVGVAGGSFSVGVAYVSRWYPPEKQGVALGIFGAGNVGAAVTKFFAPMVM
                     VAFGWHTVAEVWAAAMVVMALVYYFTTNDDPVLVERRRKGEKPTSTLMELEPLKNIQV
                     WRFSLYYFFVFGAFVALSLWLPQYLIHVYGVDIRFAGIIAAFFSIPASLFRAYGGHLS
                     DVYGARRVMYWTFAVSLVATFILSYPPTDYVIQSDNGPLAFHAEMGVIGFTVTVFILG
                     FFMALGKAAVFKHIPVYYPGNVGAVGGLVGMIGGLGGFILPILFGVLLDQTGLWTSCF
                     MLLFVIVVVSFVWMHVSIRQMEHAAEGKATEELPAFAELQGLKKAEVKPATGESVLTD
                     WRPDDPAFWEQKGRRIAKRNLWLSIPALLLSFAIWQVWSVVVAKLPLVGYQFTTDQLF
                     WLAALPGISGATLRIFYSFMVPIFGGRLWTTLTTWSLVIPAIGIGYAVQNPDTPYFIF
                     LLLALFCGFGGGNFASSMSNISFFFPKTEKGNAAALNAGLGNLGVSVVQFVVPLVITA
                     GIFGKLGGNPAMVATAAGEAPLWLQNAGFIFVPFIIVTAFANWFGMNDIASAKASFAD
                     QAVIFRRRHNWIMCWLYIGTFGSFIGYSAGFPLLTNILFPEVNALQFAFLGPLVGALS
                     RSGSGWLADKYGGGRVTIWAFILMMVGVAGVLYFVGIKDEPNAFWGFFAAFILLFFAT
                     GIGNASTFQMIPAIMAKDMERLMPMASAEERRRQADKESAAITGFTSAIAAFGAFFIP
                     KGYGTSISLTGGPEMALWAFLIFYVTCLIITWGVYTRKGGLLYDVERRLKPAAAAA"
     gene            286505..287215
                     /gene="ftrB"
                     /locus_tag="BSVBI22_RS11440"
                     /old_locus_tag="BSVBI22_B0297"
     CDS             286505..287215
                     /gene="ftrB"
                     /locus_tag="BSVBI22_RS11440"
                     /old_locus_tag="BSVBI22_B0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005770.1"
                     /note="upregulated by FixLJ/FixK under oxygen limitation;
                     involved in regulation of genes involved in carbon and
                     amino acid metabolism; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002966284.1"
                     /db_xref="GI:489056143"
                     /translation="MRRDDKIALKNQPLFADMADATFERIMRPSFVQSFPPRTMLLTE
                     NEPADFLFAVLDGLVLMSASSQDGDTALEILRPGDVFILAAVLNNDVCLQSAQTLTAT
                     RVLMVPAELVREQMSEDPAFMHAVVFELARAYRRLVKELKAQKLRSCAQRLANWIVKE
                     SLANDGADVVTIPYEKRILAAYLGMTPENLSRSFANLASHGVHVQASAIRITDKAGLL
                     QFAAPSSLIDQEEPTRPA"
     gene            complement(287270..288286)
                     /locus_tag="BSVBI22_RS11445"
                     /old_locus_tag="BSVBI22_B0298"
     CDS             complement(287270..288286)
                     /locus_tag="BSVBI22_RS11445"
                     /old_locus_tag="BSVBI22_B0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002966283.1"
                     /db_xref="GI:489056142"
                     /translation="MKLREFAKHMGLSATTVSRALSGYPEVAESTRKRVMEEAIRLGY
                     RPNVNAVRLVTGRAGAIGVVMGRNSEFHFAEFMRGMAERLGQDEVDILVSPTSPTGND
                     DEVQLCHRLATSGRVDAVIVTSPRPNDERIRMLHKLGMPFLVHGRSQIDIPHAWLDID
                     NESAVYHSTAHLLDLGHKRIAMINGRHGFTFSLHRDAGYRKALESRGIDFDPDLVEHG
                     DFTDEIGYCLARKLLERNPRPTAFVAGSMMTALGIYRAARSFGLTIGKDISVIAHDDV
                     ISFLSAGNMVPSLTATRSSMRAAGKRCADLLMDILDGRAPTEIHELWPVELILRESAT
                     RVPE"
     gene            288637..289902
                     /locus_tag="BSVBI22_RS11450"
                     /old_locus_tag="BSVBI22_B0300"
     CDS             288637..289902
                     /locus_tag="BSVBI22_RS11450"
                     /old_locus_tag="BSVBI22_B0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_002966282.1"
                     /db_xref="GI:489056141"
                     /translation="MRVLTGALVACAAFGFATGWAQAVEISIAANSTGDNIKFLQEQV
                     AKFEKDTGNKVNIISMPSSSSEQFSQYRLWLAAGNSDVDVYQTDIVWAPQLSDQFIDL
                     TEATKDVTDAHFPSIIASQTVNGKLVALPFYTDAPALFYRKDLLEKYNKPVPKTWDEM
                     AATAKDIMEKERADGKADLWGFVFQGNAYEGLTCNALEWIKSSGGGQIVEPDGEISVN
                     NEKAAAAIDRARGWIGTISPQGVLGYQEEESRGVWQTGNAVFMRNWPYVYALSNSADS
                     AVKGKFDVAPLPAMAEGEPPASALGGWNLAVSKYSTKQDAAIALVKFLASPEVQKAEA
                     VELSRLPTIEALYDDKDVIAAQPFMANWKPIFQNAVPRPSAATKVKYNEVSSKFWTAV
                     HKTLAGSGTAAENLELLEVELTELKGSGW"
     gene            289979..290956
                     /locus_tag="BSVBI22_RS11455"
                     /old_locus_tag="BSVBI22_B0301"
     CDS             289979..290956
                     /locus_tag="BSVBI22_RS11455"
                     /old_locus_tag="BSVBI22_B0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_004685057.1"
                     /db_xref="GI:490822967"
                     /translation="MTETSLDASRSLRVRAHSDLGAQRIRSAWIFLAPTLIVLAIVAG
                     WPLLRTVYFSLTNASLTNLAGAEFVGFKNYFSWVTLKSGRTVYSGLLTDMAWWRAVWN
                     TIRFTLLSVSLETIFGLVVALVLNANFRGRGLVRAAILIPWAIPTIVSAKMWGWMLND
                     QFGILNHILLNLGIISHKIAWTANPDTAMIAILIVDVWKTTPFMALLILAGLQMVPSD
                     IYEAARIDGVHPLKVFWRVTLPLIRPALMVAIIFRMLDALRIFDLIYVLTPNNAQTKT
                     MSVYARENLFDFDKFAYGAAASTMLFLIIAGITVLYMFFGRVNIGGRGE"
     gene            290959..291786
                     /locus_tag="BSVBI22_RS11460"
                     /old_locus_tag="BSVBI22_B0302"
     CDS             290959..291786
                     /locus_tag="BSVBI22_RS11460"
                     /old_locus_tag="BSVBI22_B0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_004687446.1"
                     /db_xref="GI:490825356"
                     /translation="MMRFVKRSAFYLLVALIILVAVFPFYYAIITSFKSGTALFQVDY
                     WPKSLSLDNYTGVLTQGSFVRSLGNSLLVATVVVAISLLLAVTAAYALARVRFRGRGL
                     LLLTILSVSMFPQIAVLAGLFELIRFLGIFNTPLALIFSYMIFTLPFTVWVLTTFMRD
                     LPVEIEEAAIVDGASPWVIITRVFMPLMWPALVTTGLLAFISAWNEFLFALTFTSSGS
                     QRTVPVAIALLSGSSQFEIPWGNIMAASVIVTVPLVILVLIFQRRIVSGLTAGGVKG"
     gene            291793..292794
                     /locus_tag="BSVBI22_RS11465"
                     /old_locus_tag="BSVBI22_B0303"
     CDS             291793..292794
                     /locus_tag="BSVBI22_RS11465"
                     /old_locus_tag="BSVBI22_B0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphatase"
                     /protein_id="WP_004687445.1"
                     /db_xref="GI:490825355"
                     /translation="MAELQLRDVRKSFGSFEVIKGVDMDIRPGEFMVFVGPSGCGKST
                     LLRLIAGLEEITSGTLSIDGTVVNSFNPSRRGIAMVFQSYALYPHMTVYENMAFGMQL
                     AGKSRQECKARIHAAAEMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEP
                     LSNLDAALRVATRLEIARLHQSMEDTTMIYVTHDQVEAMTLADRICVLRDGRVEQIGT
                     PLELYEKPNSLFVAGFIGSPKMNFLTGPHAEPFGAHTVGLRSEHLAIVPERGHWSGQV
                     VHTEILGSDTYVYIDLGLEEPLVVRESGVSARKPGETLSISPTGDHVHRFDEKGRAV"
     gene            292857..293642
                     /locus_tag="BSVBI22_RS11470"
                     /old_locus_tag="BSVBI22_B0304"
     CDS             292857..293642
                     /locus_tag="BSVBI22_RS11470"
                     /old_locus_tag="BSVBI22_B0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006193296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_006133687.1"
                     /db_xref="GI:493096675"
                     /translation="MPIRTIVWGENIHEQINEIVRSIYPEGMHNTIAGALNEDGAIEA
                     TTATLQEPEHGLLTERLAQTDVLVWWGHMDHGGVSDDVVERVARRVFEGMGLIVLHSG
                     HFSKIFKRLMGTPCALKWREAGERERVWVVNRGHPIAQGLEETFVLENEEMYGEQFSV
                     PEPLETVFISWFAGGEVFRSGMTWRRGAGNVFYFRPGHETYPTYHDANVRTVLRNAVK
                     WAYNPQPAWTGIHTAPNVPVEKALEPIVERGPKLHKAGEAGYR"
     gene            293651..294697
                     /locus_tag="BSVBI22_RS11475"
                     /old_locus_tag="BSVBI22_B0305"
     CDS             293651..294697
                     /locus_tag="BSVBI22_RS11475"
                     /old_locus_tag="BSVBI22_B0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004692444.1"
                     /db_xref="GI:490830358"
                     /translation="MRLLILGTGGMAENHAEAFKAIEGVEVVAACDVSAVRVDAFSEN
                     HDIHNRFTRLEDALAWNRFDAVANVTPDAVHHPTTLALVGAGKHVFCEKPLAESYEKA
                     AEMADAAQQAGVVNMVNLTYRNVAPLQKAREMVMAGEIGQVRHFEASYLQSWLVSKAW
                     GDWKTESKWLWRLSTRHGSNGVLGDVGIHILDFATYAIGSDVERASAHLKTFEKAENN
                     HIGEYVLDANDSFVMMAEYANGALGVIHASRWATGHLNELRLRIHGDKGALEILHTPT
                     GSSLRGSIGEDIETPVWRDIDAGTVETNYQRFARAVADGTELEPSFCHAANLQRVLDH
                     AMHVDKPLPEVATG"
     gene            295126..295431
                     /locus_tag="BSVBI22_RS11480"
     CDS             295126..295431
                     /locus_tag="BSVBI22_RS11480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002969367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004692442.1"
                     /db_xref="GI:490830356"
                     /translation="MKYTKPDIILQSVTRLEEQNAWEIKMRVIFRNIGSHILTLPIPM
                     EKILDGGVRHTLTMSEAADEAQRIVITDLLATAALNADWLDENVRAAIYNAFPNARP"
     gene            295745..297373
                     /locus_tag="BSVBI22_RS11485"
                     /old_locus_tag="BSVBI22_B0307"
     CDS             295745..297373
                     /locus_tag="BSVBI22_RS11485"
                     /old_locus_tag="BSVBI22_B0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004687443.1"
                     /db_xref="GI:490825353"
                     /translation="MPQRVSPLAPFQNKTFRALWSATLVSNLGGLVQTVGAGWMMATI
                     ARSDDMVALVQASTTLPVMIFSVAAGALADNFDRRRIMLVAQILLLGISVILAACAYF
                     NVLTPWMLLSFTFLIGCGGALHNPSWQASMGDIVPRHDLPAAVALNSMSFNLMRSIGP
                     AIGGLIVAAAGAAFAFIFNAFSYCALILALWQWKPQTAKSTLPREKFGGAMVAGLRYV
                     SMSPNLLKVMFRGFLFGLSAIVILALLPLVARDLVKGTALTYGIMLGFFGLGAIGGAI
                     LSARLRELMGNEWLVRGSFVAFAASCVLLSLSRQMWLSCLFLLPAGVAWVLALSLFNV
                     TVQLSTPRWVVGRALALYQTATFGGMAAGSWLWGALADTFGVPNALLVSAAVLLFGAL
                     IGLLLPQPEFESLNLDPLNRFSEPQLRLDLRSRSGPIMIMVDYKIAQDDVPAFLAAMT
                     LRRRIRIRDGARQWALLRDLENPELWTESYHVPTWVEYVRHNQRRTQADAEVSERLLA
                     LHCGTTPPVVHRMIERQTVPVHDDMPLKTHLDLT"
     misc_binding    297485..297698
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            298050..298271
                     /locus_tag="BSVBI22_RS11490"
                     /old_locus_tag="BSVBI22_B0310"
     CDS             298050..298271
                     /locus_tag="BSVBI22_RS11490"
                     /old_locus_tag="BSVBI22_B0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_002966274.1"
                     /db_xref="GI:489056133"
                     /translation="MNVTVYSKPACVQCTATTRALDRQGIDYKVIDISADANAFDLVQ
                     GMGYRQVPVVVAGENHWAGFRPDMISSLA"
     gene            298285..298692
                     /gene="nrdI"
                     /locus_tag="BSVBI22_RS11495"
                     /old_locus_tag="BSVBI22_B0311"
     CDS             298285..298692
                     /gene="nrdI"
                     /locus_tag="BSVBI22_RS11495"
                     /old_locus_tag="BSVBI22_B0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P65547.1"
                     /note="in Salmonella NrdI has a stimulatory effect on the
                     ribonucleotide reductase activity of NrdH with NrdEF;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein NrdI"
                     /protein_id="WP_002966273.1"
                     /db_xref="GI:489056132"
                     /translation="MSLIVYFSSRSGNTHRFVERLGVRSSRIPLEASGALQVREPFVL
                     VTPTYGGGSTKGAVPNPVIRFLNDADNRALIRGVIAAGNSNFGEAFCIAGNIISAKCG
                     VPYLYRFELLGTAEDVGNVRNGMEQFWTRQTQA"
     gene            298803..300884
                     /locus_tag="BSVBI22_RS11500"
                     /old_locus_tag="BSVBI22_B0312"
     CDS             298803..300884
                     /locus_tag="BSVBI22_RS11500"
                     /old_locus_tag="BSVBI22_B0312"
                     /EC_number="1.17.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687442.1"
                     /note="Catalyzes the rate-limiting step in dNTP synthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     alpha"
                     /protein_id="WP_032448593.1"
                     /db_xref="GI:694105711"
                     /translation="MLNLYDEDGKIQLDCDRQAARQYFLQHVNQNTVFFHNLREKLDY
                     LVAEGYYEQTVLDQYSFNFVRDLFDEAYARKFRFPTFLGAFKYYTSYTLKTFDGKRYL
                     ERYEDRVCMVALTLARGDEQLARDLVEEIISGRYQPATPTFLNAGKKQRGELVSCFLL
                     RVEDNMESIGRSINSALQLSKRGGGVALCLTNLREAGAPIKQIENQSSGIIPVMKLLE
                     DSFSYANQLGARQGAGAVYLHAHHPDIMRFLDTKRENADEKIRIKTLSLGVVIPDITF
                     ELARNNEDMYLFSPYDVQRVYGVPLTEISVTEKYREMVNDAQIAKKKINAREFFQVLA
                     EIQFESGYPYIMFEDTVNRANPIDGRITMSNLCSEILQVSEASLFHEDLSYEYLGKDI
                     SCNLGSLNIAAAMDAPDFGKTIETSIRALTAVSDMSHIGCVPSVARGNAESHAIGLGQ
                     MNLHGYLARERIFYGSEEGVDFTNIYFYTVAYHAVRASNRIAVETGKSFKGFEKSKYA
                     SGEYFDKYTDQAWAPATEKVRRIFEDAGIAIPTQDDWCALKKAVMEGGLYNQNLQAVP
                     PTGSISYINHSTSSIHPIVSKIEIRKEGKIGRVYYPAAFMTNDNLEYYQDAYEIGPEK
                     IIDTYAAATQHVDQGLSLTLFFRDTATTRDINRAQIYAWKKGIKTIYYIRLRQMALEG
                     TQVQGCVSCAL"
     gene            300899..301888
                     /locus_tag="BSVBI22_RS11505"
                     /old_locus_tag="BSVBI22_B0313"
     CDS             300899..301888
                     /locus_tag="BSVBI22_RS11505"
                     /old_locus_tag="BSVBI22_B0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006270726.1"
                     /note="B2 or R2 protein; type 1b enzyme; catalyzes the
                     rate-limiting step in dNTP synthesis; converts nucleotides
                     to deoxynucleotides; forms a homodimer and then a
                     multimeric complex with NrdE; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     beta"
                     /protein_id="WP_002966271.1"
                     /db_xref="GI:489056130"
                     /translation="MNMQYKTATKGRPASVRAINWNRIEDDKDLEVWNRLTGNFWLPE
                     KVPLSNDIQSWETLKPQEKQLTIRVFTGLTLLDTIQNAVGAVKLMDDALTPHEEAVLS
                     NISFMEAVHARSYSSIFSTLCLTPDVDDAYRWSEENEFLQRKSTLILDQYHADDPLKK
                     KIASVFLESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRALE
                     VLSEEKRQEIKDFAFELLLELYDNEVRYTEALYDGVGLTEDVKKFLHYNANKALMNLG
                     YEALFPAEACKVNPAILSALSPNADENHDFFSGSGSSYVIGKAVATEDEDWAF"
     gene            302769..303515
                     /gene="minC"
                     /locus_tag="BSVBI22_RS11510"
                     /old_locus_tag="BSVBI22_B0317"
     CDS             302769..303515
                     /gene="minC"
                     /locus_tag="BSVBI22_RS11510"
                     /old_locus_tag="BSVBI22_B0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006234416.1"
                     /note="blocks the formation of polar Z-ring septums;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinC"
                     /protein_id="WP_004692436.1"
                     /db_xref="GI:490830350"
                     /translation="MNQVLTETRPIRLKGRSFLAMVLSPELPLDGWLELLDDLARRSS
                     GFFLGRPVVLDMENLAIERAQLVYLLQALNDRGVWIMGVEGARPSLLGPGMPPAMRGG
                     QPAADFEAPAGEPQANPGAPEPQISQAVRAPGHAVHAMPSMVITEPVRSGQSVYFPEG
                     DVTIVGSVASGAEVVAGGSIHIYGTLRGRALAGTAGNTSARIFCRKLEAELVAIDGLY
                     KTAEDLEPRFRGQAVQLWLDGDYMMIDTLS"
     gene            303543..304358
                     /locus_tag="BSVBI22_RS11515"
                     /old_locus_tag="BSVBI22_B0318"
     CDS             303543..304358
                     /locus_tag="BSVBI22_RS11515"
                     /old_locus_tag="BSVBI22_B0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073438.1"
                     /note="ATPase; with MinC inhibits cell division by
                     blocking formation of the polar Z ring septums; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinD"
                     /protein_id="WP_006073438.1"
                     /db_xref="GI:492971474"
                     /translation="MGKVIVVTSGKGGVGKTTSTAALGAALAQRNEKVVVVDFDVGLR
                     NLDLVMGAERRVVYDFVNVIQGDAKLTQALIRDKRLETLYLLPASQTRDKDTLTEEGV
                     DLVIDQLKKSFDWVICDSPAGIERGATLAMRHADVAVVVTNPEVSSVRDSDRIIGLLD
                     SKTLKAERGEKMDKHLLLTRYDPSRAERGDMLKVEDVLEILSIPLLGIIPESQDVLRA
                     SNVGSPVTLADQRSAPAMAYLDAARRLAGEDVPMNVPSEKRGLLGKLFGRRAA"
     gene            304355..304627
                     /locus_tag="BSVBI22_RS11520"
                     /old_locus_tag="BSVBI22_B0319"
     CDS             304355..304627
                     /locus_tag="BSVBI22_RS11520"
                     /old_locus_tag="BSVBI22_B0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division topological specificity factor"
                     /protein_id="WP_002966267.1"
                     /db_xref="GI:489056126"
                     /translation="MSIFRFFTRQQASAPQARERLQVLLAHERASYGGQSDLVAVLRE
                     EILAVIAKHIKVDREKVSVKMDRGDQVSTLEVDIELPLTAKKGRAA"
     gene            304671..304838
                     /locus_tag="BSVBI22_RS11525"
                     /old_locus_tag="BSVBI22_B0320"
     CDS             304671..304838
                     /locus_tag="BSVBI22_RS11525"
                     /old_locus_tag="BSVBI22_B0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966266.1"
                     /db_xref="GI:489056125"
                     /translation="MNRGTLLARLRELQALPKFQKRDICSISSFLSLDALAEHVRVCE
                     EAAGVASAAQS"
     gene            complement(304955..305031)
                     /locus_tag="BSVBI22_RS11530"
                     /old_locus_tag="BSVBI22_Bt02"
     tRNA            complement(304955..305031)
                     /locus_tag="BSVBI22_RS11530"
                     /old_locus_tag="BSVBI22_Bt02"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(304995..304997),aa:Asp,seq:gtc)
     gene            complement(305167..305559)
                     /locus_tag="BSVBI22_RS11535"
                     /old_locus_tag="BSVBI22_B0321"
     CDS             complement(305167..305559)
                     /locus_tag="BSVBI22_RS11535"
                     /old_locus_tag="BSVBI22_B0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase"
                     /protein_id="WP_004690090.1"
                     /db_xref="GI:490828000"
                     /translation="MGIFDKIKNAIWGEAQAATPTAETPAATPSTPAAPVPAAGSAAP
                     ASGSVDVGAILDAAVKKSGQALNWKTFIVDLMKALGLDSSLQHRKELAQELGYTGDIN
                     DSATMNVWLHKQVIQKLKDSGGKLPAGL"
     gene            305935..306981
                     /locus_tag="BSVBI22_RS11540"
                     /old_locus_tag="BSVBI22_B0322"
     CDS             305935..306981
                     /locus_tag="BSVBI22_RS11540"
                     /old_locus_tag="BSVBI22_B0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006641607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_002967344.1"
                     /db_xref="GI:489057224"
                     /translation="MKFARLALMGGIFATVAFTVGPAFARDLTVASWGGNYQDAQREI
                     YFKPFAEKTGKPLLDESWDGGYGVIQSKVKAGSPNWDVVQVEAEELALGCADGLYEKI
                     DWDKVGGKDKFLDSAVNDCGVGAIVWSTAIAYNGDKLKDGPKSWADFWDVKKFPGKRS
                     LRKSAKYTLEFALMADGVDKDDVYDVLSTPEGVDRAFKKLDELKPHIVWWEAGAQPLQ
                     LLASDEVVMASAYNGRITGINRSEGKNFKVVWPGSIYAVDSWVILKGAENKDAGLDFI
                     AFASEPEHQVKLPKYVAYGLPNKEAAAKVPEEYAADLPTAKANMKDALALDVDFWIDH
                     SEELTKRFNAWLAQ"
     gene            307055..308122
                     /locus_tag="BSVBI22_RS11545"
                     /old_locus_tag="BSVBI22_B0323"
     CDS             307055..308122
                     /locus_tag="BSVBI22_RS11545"
                     /old_locus_tag="BSVBI22_B0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter ATPase"
                     /protein_id="WP_004690091.1"
                     /db_xref="GI:490828001"
                     /translation="MTDYRIRFENISKSYGDFKVIDGLNLDIERGEFVSLLGPSGSGK
                     TTLLMMLAGFENPSSGTIHVDGKSINSVPSYKRNMGVVFQNYALFPHMTVAENIAFPL
                     QMRGVGKAQAAEKVARVLDMVQLSAMSERKPSQLSGGQQQRVALARALVFEPHVVLMD
                     EPLGALDKQLREQMQLDIRALHNRLGLTIVFVTHDQSEALTMSDRIAVFNKGKIEQIG
                     SPRAIYDEPQTRFVAEFIGETNLAEGTVESVEGSRILIRLKDGAAIAASSASRPISGQ
                     NVLLSIRPERIELGEADGAENRLAARVMDSVYQGDHLRIQLEAKAHNFVVRLDRKARE
                     WQPGADVAASFKAADCWTILV"
     gene            308119..309294
                     /locus_tag="BSVBI22_RS11550"
                     /old_locus_tag="BSVBI22_B0324"
     CDS             308119..309294
                     /locus_tag="BSVBI22_RS11550"
                     /old_locus_tag="BSVBI22_B0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005971707.1"
                     /db_xref="GI:492810549"
                     /translation="MTAPSSRTLRAGLLVTPLLIFIVVFFLSPLGVMMKQAVSDTAVL
                     HVLPQTAEAISQWDGQSGPTPAMKEALVADLKGSSDQQAIGDMVRRLNSAQAGFRTLM
                     SKTLRAIDKEGPPPDLEAVDKRWSRPEFWLAIANALSPLTDRNLLAAVDMERDTSGEI
                     VSMAPGSSANRAIMIRTFWIAALVTLACVAIGYPYAVLLVSSSGWVRNVLFAAVLLPL
                     WTSLLVRTAAWFILLQDKGLINDSLIWLGITDRPFPLIFNRTGVVIAMTHVLLPFMVL
                     PIYSVLVSIPGNLMPAAASLGAPPWRAFLRVLLPLSMRGILSGMLLVFMSAIGYYITP
                     ALIGGPGDQMISSIIAYYATGSANWGMAGALGLVLLVACLILYAVYGRLTADDEGRA"
     gene            309297..310073
                     /locus_tag="BSVBI22_RS11555"
                     /old_locus_tag="BSVBI22_B0325"
     CDS             309297..310073
                     /locus_tag="BSVBI22_RS11555"
                     /old_locus_tag="BSVBI22_B0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006077714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter permease"
                     /protein_id="WP_005971705.1"
                     /db_xref="GI:492810545"
                     /translation="MGRVAKILFGVAAVVFLVAPLFAILPLAFTSSVFLTYPVPGWSV
                     RWFEELTTAEVWRRAIVNSLIIGFGTMALATVLGTMAALGLRTRGLFLSGPIRTLFLL
                     PMVVPAVVLGVGMQLFFVRLDIANSYFGVIVAHTVVSIPFVLVSVSGALAGIDRRLEL
                     AAESLGAAPLTVFRKITLPLAMPGIASGGVLAFATSLDEVVLTLFVAGPNQRTLARQM
                     FSTIRENISPAIAAAAFLFISGTVLIGLAAVLFKGRASPQ"
     gene            310385..310564
                     /locus_tag="BSVBI22_RS11560"
                     /old_locus_tag="BSVBI22_B0326"
     CDS             310385..310564
                     /locus_tag="BSVBI22_RS11560"
                     /old_locus_tag="BSVBI22_B0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006641734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966260.1"
                     /db_xref="GI:489056119"
                     /translation="MQAGSLRERFRCGLSIMIELQVFHFGTAILYSQAPSKFWGIEIY
                     ISKIAHINFIKLTFL"
     gene            310570..310785
                     /locus_tag="BSVBI22_RS11565"
                     /old_locus_tag="BSVBI22_B0327"
     CDS             310570..310785
                     /locus_tag="BSVBI22_RS11565"
                     /old_locus_tag="BSVBI22_B0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002971982.1"
                     /db_xref="GI:489061953"
                     /translation="MFNKFLNKTELSFETYWKLALIDAPALHLLSGGVRYRILRASLK
                     RCFSFRFVQAAVLVKKFMFCNEIARVR"
     gene            311022..311549
                     /locus_tag="BSVBI22_RS11570"
                     /old_locus_tag="BSVBI22_B0328"
     CDS             311022..311549
                     /locus_tag="BSVBI22_RS11570"
                     /old_locus_tag="BSVBI22_B0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004686129.1"
                     /db_xref="GI:490824039"
                     /translation="MSDPFYMNNLCNLDTPKGRAHSYINTYNVERAFRDNYTRYEYSF
                     IEFYAEHLCDLSRAFKGDMQMVLLLATVAQVALRADMIVENSGGRVQELPPSRRGITT
                     YRLADVTGIPRETTRRKLTAMEKMGWLTRENNFWCLAYEGDDAKIHQDLADVIDRSFR
                     RAARFYVAVTPLVNS"
     gene            complement(311691..312191)
                     /locus_tag="BSVBI22_RS11575"
                     /old_locus_tag="BSVBI22_B0329"
     CDS             complement(311691..312191)
                     /locus_tag="BSVBI22_RS11575"
                     /old_locus_tag="BSVBI22_B0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006171823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutelin"
                     /protein_id="WP_002966257.1"
                     /db_xref="GI:489056116"
                     /translation="MKTLITALFLAGIALSAASAPAAAAGFECAYKKAPGDMKHVPDI
                     KYLEGGLTPAMFHQRLAEMVQKLVADKVPPALIVDHFVWAYCPSVAADKSLNDKQKTE
                     HVRRFAADVAALAYTAPSADELDVLVTLPLTQNLLDQIDSAAKDKKISRDDWMLNALQ
                     HAIPTP"
     gene            complement(312188..315412)
                     /locus_tag="BSVBI22_RS11580"
                     /old_locus_tag="BSVBI22_B0330"
     CDS             complement(312188..315412)
                     /locus_tag="BSVBI22_RS11580"
                     /old_locus_tag="BSVBI22_B0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="WP_006191785.1"
                     /db_xref="GI:493203622"
                     /translation="MLSSVFINRPRLAIVIAIVITLAGLIAVTRIPVAQFPDIVPPQV
                     SVTATYPGASAETVEAAIAQPIEAQVNGVDDMIYMSSTSGNNGTYTLTVTFKVGSDPN
                     LNTVNVQNRVRLAEANLPQEVTRLGVTVKKQSSSFLQIITLLSPDSRYDELFLNNYGV
                     INVVDRLARVPGVGQAQSFGTFNYSMRIWFNTDALTSLNLTPNDIVNAISSQNVQAAV
                     GRLGAPPMTDQQQIQLTLTTQGRLTDAKQFENIIIRANPDGSSVRLKDVARVELAAQS
                     YDTIGRLNGKPASVIAVYQAPGSNAVAAAEGVRNVMEQLKQSFPAGLDYKITYDTTVF
                     VSSTIHEVIKTLLEAFVLVVVVVFIFLGNFRATLIPTLAVPVSLIGTFAVLLVLGFSA
                     NTISLFAMILAIGIVVDDAIVVVENVERVMAETGLPPKEAAKQAMQEITAPIIAITLV
                     LLSVFVPVAFIPGITGALYAQFALTVSVAMLISAINALTLSPALCGVFLKPHQGRKKS
                     LYGRTMDKLSSGIEKISDGYAHIVRRLVRMAFLSIVLVAGLGAGAYFLNTIVPTGFLP
                     EEDQGLFFVQVNLPPAASQSRTAAVVSEIEADITKMAGVADVTSVTGFSFIDGLAVSN
                     AGLMIVTLKPLEERLKDNITVFDVIAEVNRRTAAIPSAVAITMNLPPILGLGSSGGFQ
                     YQLEDQEGQSPQQLASVAQGLVMAANQNPKLSRVFTTFATDTPQLNLNIDRQKALSLG
                     VSPNNIIQALQSTLGGYFVNNFNTLGRTWQVIIQGEQQDRKTVEDIYRINVRSSHGDM
                     VPLRSLVSVEERLGPLYITRYNNYRSASIQGNAAPGVSSGEALAAMAQVSKTTLPSGY
                     GYEWTGTALQELQAAGQTSMILALAVLFAYLFLVALYESWTIPVGVLLSVTAGLAGAM
                     LALWITGLSNDIYAQIGIVVLIALASKNGILIVEFAKERREEGVPLEQAAIIGARQRF
                     RPVMMTSFAFILGLVPLVIAVGAAAASRRAVGTSVFGGMIAASAVGIFLIPMLYVVLE
                     RVREWGHARILRKPLYEEEKQEKADGDASGPTVPPTQPEDRGLS"
     gene            complement(315416..316651)
                     /locus_tag="BSVBI22_RS11585"
                     /old_locus_tag="BSVBI22_B0331"
     CDS             complement(315416..316651)
                     /locus_tag="BSVBI22_RS11585"
                     /old_locus_tag="BSVBI22_B0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006171821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MexE family multidrug efflux RND transporter
                     periplasmic adaptor subunit"
                     /protein_id="WP_004690093.1"
                     /db_xref="GI:490828003"
                     /translation="MVAFWTCRNAWFQHLPFAKRGDENAPSGPRRLRPWFLVLALGLA
                     ACSEDKSAPQQAAPLPPIPVGVIKITERPTHPQLSFVGRVEATDSVDLIARVDGFLDK
                     RTFTEGQAVKTGDLLFVLQKDALQAALDAAQANLAKAQADADNLKLQTERARSLYKQK
                     TVSQAMLDDRVAAEKQALAVVQQAQASLEQAQINLGYTDIRAPFSGRIGMANFSVGAL
                     VGPSSGPLATIVSQDPIYVTFPVSDKTILDLTEGGRTATDRSNVAVSLTLSNGMTYPQ
                     TGAIDFTGIKINPNTDTLMVRAQFPNPNNVLIDGQYVQVTAASKHPVEALLVPQKAIM
                     TDQSGNYVLAVGEDNKVIQRQITQGSTFGSNVVVKSGLAVGDQVVVDGLQRIRPGQKV
                     DPQIVDATTPAQKAMSVGN"
     gene            complement(316837..317370)
                     /locus_tag="BSVBI22_RS11590"
                     /old_locus_tag="BSVBI22_B0332"
     CDS             complement(316837..317370)
                     /locus_tag="BSVBI22_RS11590"
                     /old_locus_tag="BSVBI22_B0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006108059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004688905.1"
                     /db_xref="GI:490826815"
                     /translation="MSDLVFIAFPDEQKAEEVRQRVLELQREYLIELGDAVVVVKDSD
                     GRVKLNQLVNSTAAGAVSGALWGTLIGFIFFMPLVGTALGAATGAIGGKLTDVGIDDN
                     FMKDAASVLQPGSAGLFLLIRKMTTDKVLADLKGIGGTVVRTSLDEKAENALRKAIAE
                     HVVSSATQTAPTGTSGA"
     gene            complement(317627..317851)
                     /locus_tag="BSVBI22_RS11595"
     CDS             complement(317627..317851)
                     /locus_tag="BSVBI22_RS11595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006643196.1"
                     /db_xref="GI:493693296"
                     /translation="MQLTAQIGSFFHNCCFRAQATLRESAISTPYKYRRILQAIFDQP
                     RQIKPKMGTDFVYRTEFLTEDKRPGVILAQ"
     gene            318068..319462
                     /locus_tag="BSVBI22_RS11600"
                     /note="glutamate decarboxylase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            319535..321068
                     /locus_tag="BSVBI22_RS11605"
                     /note="amino acid transporter; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            321104..322057
                     /locus_tag="BSVBI22_RS11610"
                     /old_locus_tag="BSVBI22_B0336"
     CDS             321104..322057
                     /locus_tag="BSVBI22_RS11610"
                     /old_locus_tag="BSVBI22_B0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8FWV5.1"
                     /note="catalyzes the formation of glutamate from
                     glutamine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaminase"
                     /protein_id="WP_004687431.1"
                     /db_xref="GI:490825341"
                     /translation="MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGL
                     AVVTADGQTFKTGDADFAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSV
                     IALELHNGKSLSPLVNAGAIATASLVPGDTADARWNNILECQCGFAGRRLKLSNEVNQ
                     SEQTTNFHNRAIAWLLYSAGTCYSDPMEAVDIYTRQCSTLVTATDLATMGATLAAGGV
                     NPISGKRMVSAGNVAPILAEMTMEGLYTASGDWAYTVGLPGKSGVGGGIMAVVPGELA
                     IAAFSPPLDPAGNSVKAMAAVAAVADSLGHNLYTTRGKVSS"
     gene            322205..322549
                     /locus_tag="BSVBI22_RS11615"
                     /old_locus_tag="BSVBI22_B0337"
     CDS             322205..322549
                     /locus_tag="BSVBI22_RS11615"
                     /old_locus_tag="BSVBI22_B0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006119370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid stress chaperone HdeA"
                     /protein_id="WP_006191791.1"
                     /db_xref="GI:493203628"
                     /translation="MIKALFNKNTALAAVTILALSGGAMAESAKTHKTDMAKKKVSEL
                     TCEDFNGLEESFKPTVVGWVVGFNKKGKEEDAVIDVDGIETVTPAIIEACKQEPKASF
                     WKKAEAELKKVF"
     gene            323062..323313
                     /locus_tag="BSVBI22_RS11620"
                     /old_locus_tag="BSVBI22_B0339"
     CDS             323062..323313
                     /locus_tag="BSVBI22_RS11620"
                     /old_locus_tag="BSVBI22_B0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966247.1"
                     /db_xref="GI:489056106"
                     /translation="MQHPWEASGANVIFARMKNYKAYWQEEQIMQFLNDYAAFIDVVA
                     LLCLIILAVAGAIRQKSIGLIILALAVTFWALVRFFKLI"
     gene            complement(323390..324982)
                     /locus_tag="BSVBI22_RS11625"
                     /old_locus_tag="BSVBI22_B0340"
     CDS             complement(323390..324982)
                     /locus_tag="BSVBI22_RS11625"
                     /old_locus_tag="BSVBI22_B0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_006191802.1"
                     /db_xref="GI:493203639"
                     /translation="MKRHHWLIATFACIVFAIIAPALAAVYTSSVVAAHREQIQLTLF
                     ATYAIERTDTTFSGVSQALMQTQMLTDKPCSKEHMDDLKRIAIETRPITEIGYFDDGL
                     LKCTSWGMAGMRVAAGTPAFTTRNGVKVVLNMTASIPTTANMLGLQRGAYCILIDPKW
                     FVDEIVPKGVQIAVASPDGTVVAALNHPDPAVIRQFLKPSDTKPPSRYLGAVVRGSDW
                     TAIAITPRASIWTSMQEELLVFLPIAGVISTGMVILTIWLSRRRLSLRGELAIAIRRR
                     EFTVVYQPLIELKTGICVGAEALVRWRRPDGAMVMPDLFIPIAENSKMISQITEQVVA
                     NTVRDLGDVLAADEALHVAINMADDDLAQGRILTVVQRAIRGTGIRTEQIWLEATERG
                     FMDPKSTRTIIEKARELGHFIAIDDFGTGYSSLHYLQELPVDTLKIDKSFISTLGTDS
                     ATSPIAAHIIAMAKSLDLIIVAEGIERQEQADYLIAHGVQFGQGWLYSPPLPAQEFIE
                     FYKAQKATKGAGPAIIRKKKHA"
     gene            325772..326659
                     /locus_tag="BSVBI22_RS11630"
                     /old_locus_tag="BSVBI22_B0342"
     CDS             325772..326659
                     /locus_tag="BSVBI22_RS11630"
                     /old_locus_tag="BSVBI22_B0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_004690098.1"
                     /db_xref="GI:490828008"
                     /translation="MRFNLRALQAFEAVSRHLSVLKAAEELGITSSAVSHQLRILTED
                     LGYNLIEREGRNIVLTERGLQFARHLQDAFRHVQLAMVEGRSVQNDRVRIAACSSFCQ
                     GFLIDLVADTIAQEGGYEIDMRMYANDPQLASVVADIFVTSDDIPHGYWATDLFTEQL
                     VAVCTPACRDEELKTRSVPFIKNEALELTGECRWLLYKQELPETELPVENRLILRTSH
                     FILALEMANRGLGMALVPDFLARAGLQSGELVQLYPAVIPSGRKYKICCRSSLRTKPP
                     YSQAIRQIILATSPEARSA"
     gene            complement(326780..328195)
                     /gene="cpsB"
                     /locus_tag="BSVBI22_RS11635"
                     /old_locus_tag="BSVBI22_B0343"
     CDS             complement(326780..328195)
                     /gene="cpsB"
                     /locus_tag="BSVBI22_RS11635"
                     /old_locus_tag="BSVBI22_B0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006277584.1"
                     /note="capsular polysaccharide colanic acid biosynthesis
                     protein; catalyzes the formation of GDP-mannose from GTP
                     and alpha-D-mannose 1-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="WP_006191807.1"
                     /db_xref="GI:493203644"
                     /translation="MSFIPVIISGGSGSRLWPLSRDAHPKPFIKLPDGETLIGKTYAR
                     ASRLVNAEQILTVTNRDFLFLTLDAYAAAGAAQMENTFLLEPLGRDTAPAVALAALHA
                     AEAYGPDATLLVMPADHLIEDEQAFAEAVAKARALAEAGRIVTFGIVPDRPETGFGYI
                     EVQGTDVQRFVEKPDEATAQTYVESGRYFWNSGMFCFKALSMIDAMQRYAPQVLAGAR
                     AALAQARRGNNGETKTLEIARDEFAATPAISIDYAVMEKADNMACVPVSCGWSDIGSW
                     AAMADLVTPDENGNRLRGETILEDTTNSFVLSETRLVSLVGVHDLLVVDTPDALLVAH
                     RDKAQEVRSVFNKLRKQGHEAAKLHRTAHRPWGTYTVLEEGDGFKIKRIEVKPGRRLS
                     LQAHHHRSEHWIVVSGTAKVTNGDREILLTTNQSTYIPCGFRHRLENPGILPLVLIEV
                     QSGEYLGEDDIVRYDDVYGRV"
     gene            complement(328192..329625)
                     /locus_tag="BSVBI22_RS11640"
                     /old_locus_tag="BSVBI22_B0344"
     CDS             complement(328192..329625)
                     /locus_tag="BSVBI22_RS11640"
                     /old_locus_tag="BSVBI22_B0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase"
                     /protein_id="WP_004690100.1"
                     /db_xref="GI:490828010"
                     /translation="MSSNSLKFGTSGLRGLAVELNGLPAYAYTMAFVQMLAAKGQLQK
                     GDKVFIGRDLRPSSPDIAALAMGAIEDAGFTPVNCGVLPTPALSYYAMGAKAPSIMVT
                     GSHIPDDRNGLKFYRRDGEIDKDDEAAISAAYRKLPAILAARKHVGSTETDAALQAYA
                     DRYAGFLGKGSLNGLRVGVYQHSSVARDLLMYLLTTLGVEPVALGRSDIFVPVDTEAL
                     RPEDIALLAQWGKSDRLDAIVSTDGDADRPLIADEHGQFVRGDLAGAITATWVGADTL
                     VTPVTSNTALESRFPKVLRTRVGSPYVIASMAQASTGNSGPVIGFEANGGVLLGSTVE
                     RNGRSLTALPTRDALLPILACLATVHEKKTPLSTIARSYGFRVALSDRLQNIPQEAST
                     AFLALLEDADKRASLFPAGDAIVRVETIDGVKLFFQSGNAVHYRASGNAPELRCYVES
                     SDDTQAAKLQALGLEIARKALKDATRP"
     gene            complement(329745..330851)
                     /locus_tag="BSVBI22_RS11645"
                     /old_locus_tag="BSVBI22_B0345"
     CDS             complement(329745..330851)
                     /locus_tag="BSVBI22_RS11645"
                     /old_locus_tag="BSVBI22_B0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S58"
                     /protein_id="WP_002968345.1"
                     /db_xref="GI:489058247"
                     /translation="MDRRTFAKSLAGLGAMPFAVNTASAGAAKEGKTMLELMGGSITD
                     VPGIKLGHHTLTRRPTGCSVLLCEEGATAGVDVRGSAPGTRETDLLDPINFVQKVQAI
                     LLSGGSAYGLAAATGVMRYLEENNLGFEIGKGVVPIVPAAILMDLGVGDFSVRPDEEA
                     GYLACKAATAAPSGEGNIGAGAGATVGKMFGMDYAMKGGLGTASYKVPGTEIVVGAIV
                     AVNAVGDVRAPNSHRILAGARTEDGKGFRNTMAAIMQGHGVVKSGGANTTIGAIATNA
                     PFGKAELKKIAGMAHDGFARTINPVHTMWDGDTIFALSTGKAKDGQADVTAIGAIAAS
                     VMADAVARAVVQAESLPHLNLPAHRDYMIAESTR"
     gene            complement(330875..332230)
                     /locus_tag="BSVBI22_RS11650"
                     /old_locus_tag="BSVBI22_B0346"
     CDS             complement(330875..332230)
                     /locus_tag="BSVBI22_RS11650"
                     /old_locus_tag="BSVBI22_B0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005974538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chloride channel protein"
                     /protein_id="WP_002966239.1"
                     /db_xref="GI:489056097"
                     /translation="MRKSYKRVPVIRRSHAMWMSPRVWKPRLVFWCGALAIGIISVGF
                     AEAADIAQDWFHSLTSGSPLRAWLPLLITPLGFMFCSWVALVWFPNSGGSGIPQAIAA
                     RHLNDHEDRSLLLSIRVATGKIVLTIIGLFCGASIGREGPTVQIGASIMLQAARFGGM
                     EKARGLILAGSAAGIAAAFNTPLAGIVFAIEEMGRAYAARTNGLVLSAVILAGLASLG
                     LVGNYNYFGFTTVTASTGKDWILTIACGIFGGAFGAAFSALALNMGRRVRRRVQKAPL
                     RNMVIFAGICGLLVALIGIASGGMTFGAGYDQARSAVEGATLPPFYFVEKFTVGLLSM
                     ISGIPGGIFAPSLSVGAGLGSTIGLLLGTSASLAAVLGMAGYFAGAVQAPMTAFVIIL
                     EMTGNHSNVIPLMCASMLGYGTARLISHEPLYHALSRIFVADILRQRRAREKTIQPEL
                     T"
     gene            332425..333918
                     /locus_tag="BSVBI22_RS11655"
                     /old_locus_tag="BSVBI22_B0348"
     CDS             332425..333918
                     /locus_tag="BSVBI22_RS11655"
                     /old_locus_tag="BSVBI22_B0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006199854.1"
                     /note="catalyzes the synthesis of xanthosine monophosphate
                     by the NAD+ dependent oxidation of inosine monophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-5`-monophosphate dehydrogenase"
                     /protein_id="WP_006191810.1"
                     /db_xref="GI:493203647"
                     /translation="MAKIVESPTGALALTFDDVLLQPGHSEVMPGQVDLRTRIAKDIE
                     LNLPLLSAAMDTVTESRLAIAMAQAGGIGVIHRNLSPERQAEEVRQVKKFESGMVVNP
                     VTIGPDATLADAQALMKAHGISGIPVVENATKGPGRLVGILTNRDVRFASDPKQKIYE
                     LMTRENLITVHENVNQDEAKRLLHSHRIEKLLVVDDKGRCVGLVTVKDIEKSQLNPNA
                     AKDAQGRLRAAAATSVGADGFERAERLIDAGVDLLVVDTAHGHSQRVLDAVARIKKAY
                     PNVAVLAGNVATTAGTQALIDVGADAVKVGIGPGSICTTRIVAGVGVPQLSAIMSAVE
                     AAQKQNIPVIADGGIKFSGDFAKALAAGAVAAMAGSLLAGTEESPGEVYLHQGRSFKA
                     YRGMGSVGAMARGSADRYFQAEVRDELKLVPEGIEGQVAYKGPISAVLHQLAGGLRAS
                     MGYVGAKTLEEFRETATFVRISNAGLRESHSHGVAITRESPNYPGGM"
     gene            complement(334123..335196)
                     /locus_tag="BSVBI22_RS11660"
                     /old_locus_tag="BSVBI22_B0349"
     CDS             complement(334123..335196)
                     /locus_tag="BSVBI22_RS11660"
                     /old_locus_tag="BSVBI22_B0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_006191813.1"
                     /db_xref="GI:493203650"
                     /translation="MRWSDVGIYGVVFCLSLGYFAATSDSSRSKPASARPHASNVAEN
                     STKAAPQNAAAAAAVADKEKEKAPAAKAVEPEQAAWDIADPDTLPDNAWGKIVRQGRD
                     LITETYAHIGPEVADEAKRFAGNNLSCQNCHLEAGTKQYGLPLVGVYGDFPQYRSREG
                     QIGTIEDRINGCMTRSLNGEPLPLDSAEMKAMVAYIKYVSAGTVVGEETKGRGSGKMP
                     ELKRAADPVHGEKLYAEICAACHGADGQGKRTGVVGDAKGYEFPPLWGPDSFNDGAGM
                     NRLISAANFIHANMPNGVSLEEPQLEPEDAWDIAAFFQSKPRPAKANLQNDFPNRLEK
                     PVDASYGPYADSFPAQVHKVGPF"
     gene            complement(335265..336218)
                     /locus_tag="BSVBI22_RS11665"
                     /old_locus_tag="BSVBI22_B0350"
     CDS             complement(335265..336218)
                     /locus_tag="BSVBI22_RS11665"
                     /old_locus_tag="BSVBI22_B0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006171807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_004690103.1"
                     /db_xref="GI:490828013"
                     /translation="MFTVRQIRYFDALASTLHFRKAAELAHVSQPALSAQIAEMEAIA
                     GAPLFERSQRQVIMTELGKHLYPGIKAILRELQKLEEIAAQSRGVLQTGIKLGIIPTV
                     APYLVPVLIPLLHEQHPSFRLQLRESVTAKLLEELHAGDLDAIVAALPIDDEKLSHQK
                     LFDDRFLIATSTNDHTVLASPMTQNHAALERLLLLEEGHCMRDQALAVCTLPSQRQLV
                     KYGATSMSTLLQMVSHGMGLTLIPEIAVRAEARSNHMRIVPFEGEQPKREIALFWRRQ
                     SMRGKGFRALAECIAESANKLKIDPSKIDTLLDNPSTPSYS"
     gene            336388..337887
                     /locus_tag="BSVBI22_RS11670"
                     /old_locus_tag="BSVBI22_B0351"
     CDS             336388..337887
                     /locus_tag="BSVBI22_RS11670"
                     /old_locus_tag="BSVBI22_B0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014517371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="WP_004690104.1"
                     /db_xref="GI:490828014"
                     /translation="MTDRPIMTTSAGAPIPDNQNSLTAGERGPILMQDYQLIEKLSHQ
                     NRERIPERAVHAKGWGAYGTLTITGDISRYTKAKVLQPGAQTPMLARFSTVAGELGAA
                     DAERDVRGFALKFYTQEGNWDLVGNNTPVFFVRDPLKFPDFIHTQKRHPRTHLRSATA
                     MWDFWSLSPESLHQVTILMSDRGLPTDVRHINGYGSHTYSFWNDAGERYWVKFHFKTM
                     QGHKHWTNAEAEQVIGRTRESTQEDLFSAIENGEFPKWKVQVQIMPELDADKTPYNPF
                     DLTKVWPHADYPPIDIGVMELNRNPENYFTEVENAAFSPSNIVPGIGFSPDKMLQARI
                     FSYADAHRHRLGTHYESIPVNQPKCLVHHYHRDGQMNVYGGIKTGNPDAYYEPNSFNG
                     PVEQPSAKEPPLCISGNADRYNHRIGNDDYSQPRALFNLFDAAQKQRLFSNIAAAMKG
                     VPGFIVERQLGHFKLIHPEYEAGVRKALKDAHGYDANTIALNEKITAAE"
     gene            338018..338191
                     /locus_tag="BSVBI22_RS11675"
                     /old_locus_tag="BSVBI22_B0352"
     CDS             338018..338191
                     /locus_tag="BSVBI22_RS11675"
                     /old_locus_tag="BSVBI22_B0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002969359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969359.1"
                     /db_xref="GI:489059288"
                     /translation="MMLAIFIFMTIAMWFCWFGRLSIALVCMFLCLALATKEFLWEIH
                     SADYGYSMPWVQL"
     gene            338220..338846
                     /locus_tag="BSVBI22_RS11680"
                     /old_locus_tag="BSVBI22_B0353"
     CDS             338220..338846
                     /locus_tag="BSVBI22_RS11680"
                     /old_locus_tag="BSVBI22_B0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006133716.1"
                     /db_xref="GI:493096724"
                     /translation="MNAVNMHEPGLSASRQSGNLFAPLQFLYLIAMLFVLAGILTAAM
                     VLQYGAGEVPCPLCLLQRMAMFGVCFGVMLQLRYGPSFRFSGIGLLFAIVLLIISVRQ
                     TLLDIYPRPGHEYIGSTVFGLHMPVWSILIALALIAAFAVQMMFWGGRHGQTIAQIKN
                     HPVINGLGTILALYVLAVATINMASVFVQCGVGQCHTMGYALLGYPGK"
     gene            339023..340312
                     /locus_tag="BSVBI22_RS11685"
                     /old_locus_tag="BSVBI22_B0354"
     CDS             339023..340312
                     /locus_tag="BSVBI22_RS11685"
                     /old_locus_tag="BSVBI22_B0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_006191817.1"
                     /db_xref="GI:493203654"
                     /translation="MRLGGRLQAAIEVLGEIEAGKRPASDVLKEWGAAHRFAGAGDRA
                     VIGNIVYDALRRKLSILWRMDADDARALAFGGLLADDGMDIEMVDAALHGDRFAPEGL
                     DAARRAAWQSRDLATAPAHIQADVPEWCIPSLEELFGERWVSEGKALATRPPVDLRVN
                     SLKATPEKTLAALEKAGAAPAPFLAQALRIPPIEALGRHPNVQGEQAFLDGWFEVQDL
                     GSQLAALFAGVKPGEQVLDYCAGAGGKTLALAAAMGNSGQIHAYDAERARLSPMHERL
                     QRAGVRNTQVYGGLDELGPLAGKMDLVLTDAPCTGSGTWRRRPDAKWRLNEQQLERRV
                     QDQQDVLDSARRFVKPGGRLAYVTCSLFAEENTRQVARFLGENPDFKEIAPQTLWGTV
                     VQDDSAGKPVFLSHGSVFSPLSTGTDGFYVSILQRQN"
     gene            340603..341058
                     /locus_tag="BSVBI22_RS11690"
                     /old_locus_tag="BSVBI22_B0355"
     CDS             340603..341058
                     /locus_tag="BSVBI22_RS11690"
                     /old_locus_tag="BSVBI22_B0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010661020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase superfamily protein"
                     /protein_id="WP_002966230.1"
                     /db_xref="GI:489056088"
                     /translation="MSAQRIAEPDFKERVEESFGRQAAMKLIGAELTRCEPGIVEVEM
                     PFREELTQQHGILHAGMISAALDSACGYAALTLMPADAAVLTIEFKVNLLAPGKGERF
                     LFRGEVTKPGRTIMVSDGQAFAVTDTEVRLIATMTGTMMVVQDRKGLQG"
     gene            341055..341687
                     /locus_tag="BSVBI22_RS11695"
                     /old_locus_tag="BSVBI22_B0356"
     CDS             341055..341687
                     /locus_tag="BSVBI22_RS11695"
                     /old_locus_tag="BSVBI22_B0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005749.1"
                     /note="Enables the cleavage of the glycosidic bond in both
                     5'-methylthioadenosine and S-adenosylhomocysteine; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylhomocysteine nucleosidase"
                     /protein_id="WP_004687422.1"
                     /db_xref="GI:490825332"
                     /translation="MMKTVAGKRLLYVMAADAEYGRHLAKLFTPLMIGVGPVEAAVNL
                     ASALAHLKLAGDMPDLVISLGSAGSAKLPQAEVYQVSSVSYRDMDASPIGFEKGVTPF
                     LDLPETVELPFRVAGIDTASLSTGGNIVSGKAYERIEADMVDMETYACLRACQAVGVP
                     LLGLRGISDGASELKHVGDWTQYLHVIDEKLAGAVARVERAVADGLLSPS"
     gene            341796..343358
                     /gene="guaA"
                     /locus_tag="BSVBI22_RS11700"
                     /old_locus_tag="BSVBI22_B0357"
     CDS             341796..343358
                     /gene="guaA"
                     /locus_tag="BSVBI22_RS11700"
                     /old_locus_tag="BSVBI22_B0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443373.1"
                     /note="contains glutamine-hydrolyzing domain and glutamine
                     amidotransferase; GMP-binding domain; functions to produce
                     GMP from XMP in the IMP pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase [glutamine-hydrolyzing]"
                     /protein_id="WP_004690106.1"
                     /db_xref="GI:490828016"
                     /translation="MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADE
                     AFKRLQPKGVILSGSPHSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVES
                     GHDREFGRAFLDVQEDSPLFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPY
                     AVIADEKRKYYGVQFHPEVVHTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRK
                     QVGSGKVICALSGGVDSSVAALLAHEAVGDQLTCILVDHGLMRKDEAQQVVEMFREHY
                     NLPLILVDASDRFIGALEGESDPEKKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYP
                     DVIESVSFTGGPSVTIKSHHNVGGLPERMKMQLVEPLRELFKDEVRLLGKELGLPDSF
                     IGRHPFPGPGLAIRCPGGVTRGKLEILREADAIYLDEIRKAGLYDAIWQAFAVLLPVQ
                     TVGVMGDGRTYEFVCALRAVTSVDGMTADFYHYDMNFLGNAATRIINEVRGINRVVYD
                     VTSKPPGTIEWE"
     gene            343667..344875
                     /locus_tag="BSVBI22_RS11705"
                     /old_locus_tag="BSVBI22_B0358"
     CDS             343667..344875
                     /locus_tag="BSVBI22_RS11705"
                     /old_locus_tag="BSVBI22_B0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000954582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_004690107.1"
                     /db_xref="GI:490828017"
                     /translation="MLTDTKLRNLKPKDKLYKVNDRDGLYVAITPAGSISFRYNYSIH
                     GRQETITFGRYGVGGITLAEARERLGEAKKMIAAGKSPAKEKARDKARVKDAETFGAW
                     AEKWLRGYQMSETTRNMRRGTYERDLKPKFGNRKLIEITHEDLRALTDAIVEQGRPST
                     AVVCREIMMLVFRWAIERGQKVENPADLVRPSTIAKFEPRDRALTPEEIGLMYQYMER
                     IGTPPSIRAAAKLLLLTMVRKSELTNATWSEINFIDALWTIPKERMKRRNPHLVFLSR
                     QVLEIFTALKTFAGGSEYVLPSRYDSDLPMSSATLNQVLTLTYRLAQKEGQSLGKFGP
                     HDLRRTASTLLHEAGYNTDWIEKCLAHEQKGVRAVYNKAEYRDQRRAMLQDWADMIDE
                     WTIRKIRPKD"
     gene            345160..345390
                     /locus_tag="BSVBI22_RS11710"
                     /old_locus_tag="BSVBI22_B0359"
     CDS             345160..345390
                     /locus_tag="BSVBI22_RS11710"
                     /old_locus_tag="BSVBI22_B0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_006191822.1"
                     /db_xref="GI:493203659"
                     /translation="MEKELRRASKVLISKKQLLEMNPLCERTIYNFEKQGKFPQRIAL
                     SSRKVVWDLAEVEAWIDACKHSSPAPRPGMGA"
     gene            345471..346529
                     /locus_tag="BSVBI22_RS11715"
                     /old_locus_tag="BSVBI22_B0360"
     CDS             345471..346529
                     /locus_tag="BSVBI22_RS11715"
                     /old_locus_tag="BSVBI22_B0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000098744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein RepA"
                     /protein_id="WP_006073479.1"
                     /db_xref="GI:492971552"
                     /translation="MSSRNSGLKPIGAVIGDSGGLLERLENIRKRNSDRTPAAERGRP
                     SNVSTVHEQMERAKERDKALSLVRKPPQGDAQPDFFAPSLYDVGGRDNRSVMDVAVFR
                     LSKKDKRAGELIRYDLPDGYVEVSAGAHGMASVWDYDIVLMMVSHLTEAMNRYREGKG
                     GKPGRVFRLHVSDILRFARRGNGSSQVKGVEAALDRLRGTTIKTVRESGRFRATEAEG
                     LIARYRVLSRTDTKKISSVEIEAPEWIYREVTGGKRPEVLTVHRDYFLIEPGIGRFIY
                     RLARRAAGRDSAKWAFKTLYERSGSGGSFKKFCFFLRGIIKADDLPEYALCEEAGKDG
                     PLLVMRHRNSSSEPLGGS"
     gene            complement(347578..347904)
                     /locus_tag="BSVBI22_RS11720"
                     /old_locus_tag="BSVBI22_B0361"
     CDS             complement(347578..347904)
                     /locus_tag="BSVBI22_RS11720"
                     /old_locus_tag="BSVBI22_B0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000980635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004687419.1"
                     /db_xref="GI:490825329"
                     /translation="MMNDIFFGLMMLGGFFVLGIGMWALGQWLRRKGFGPQLDALDKQ
                     YTALQHRVNRLALPAAAHFYGGMGMLNRMPLFGSKNQVVLVERVRMAILQMEEEERQR
                     GRGINR"
     gene            complement(347907..349550)
                     /locus_tag="BSVBI22_RS11725"
                     /old_locus_tag="BSVBI22_B0362"
     CDS             complement(347907..349550)
                     /locus_tag="BSVBI22_RS11725"
                     /old_locus_tag="BSVBI22_B0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer protein TrbL"
                     /protein_id="WP_006191824.1"
                     /db_xref="GI:493203661"
                     /translation="MQRTTVFALVGAVLLLSATSAMAAGVDLAQSNTSMNSLLRLIQN
                     ASNQWAPRLHDYALWLLGCLAVIQLVWTFAPLVMRGAELGDLLHELVKYILVIGFFYA
                     MLDHATEWGGAIVNSFRQAGAHAAGLGSAELMPGDMFSTAVDFSRQVLTAGVSMFSPI
                     TSVVVAVSALIVPMCFTFIAALVFVTLVEAYVIINAAVLFMGFGGSQWTREYALAPIR
                     YAVAVGAKLFVLTLIVGLIMQVSAEWSAAYTNDEASLMTLVGLSLVCAYLTKTIPELI
                     GGMISGTSMGGGSAIGGMAAAGAAGAAAAIATVATSGAAAPAAGALGAAGTGGGAASA
                     AGGGLASALNASMAGGSTTGGIGGATGVGSAGIGASTGGGSGATAKAAGSRVGGGAAS
                     GSANPVSAAASPASQESGSGLKQAAKQAGKAAKGGDDDMDQQAVAQQRQMTPKEGTGG
                     NGKTVAQGAEVATRALGVLGAISVPGMESSHGLSLGGTGSPPPVPGSDSPASDDGAES
                     TAQAESNIIRPASDTTSTGDVGALNVPGMASSVNSQSET"
     gene            complement(349553..349735)
                     /locus_tag="BSVBI22_RS11730"
                     /old_locus_tag="BSVBI22_B0363"
     CDS             complement(349553..349735)
                     /locus_tag="BSVBI22_RS11730"
                     /old_locus_tag="BSVBI22_B0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000973506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004690111.1"
                     /db_xref="GI:490828021"
                     /translation="MMISKALIAALCLVSALGGSALTAVVVTNAAAPECAAVGNGHQD
                     DQFRSRPNTRGPSEGF"
     gene            complement(349738..350529)
                     /locus_tag="BSVBI22_RS11735"
                     /old_locus_tag="BSVBI22_B0364"
     CDS             complement(349738..350529)
                     /locus_tag="BSVBI22_RS11735"
                     /old_locus_tag="BSVBI22_B0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer protein TrbJ"
                     /protein_id="WP_006191826.1"
                     /db_xref="GI:493203663"
                     /translation="MEMESQKTSAYAARKFGRDAALALAMASAGLGVSLYMAPAPAYA
                     IYCSNCSTFYQQMYEYAEAVNTQLNTAQQLQTQIQQYDNMIKQGMSLPSRMFNTITGD
                     LQRVASVYNSAQSLGRNISNLDEQFRQQFKGYDSYLNSIGQGQNNMPQRYRDWAQSGF
                     DNARTAMQAAGVNTSTFEDENALLDQLASRSQSAIGRQQAIQAGNEIAAQNVQQLQKL
                     RDLVATQITLQGNYMAQQNERQSVSDASEQQFRSRENTRGPSEGF"
     gene            complement(350797..351021)
                     /locus_tag="BSVBI22_RS11740"
                     /old_locus_tag="BSVBI22_B0366"
     CDS             complement(350797..351021)
                     /locus_tag="BSVBI22_RS11740"
                     /old_locus_tag="BSVBI22_B0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000844753.1"
                     /db_xref="GI:446767497"
                     /translation="MKTAHRISALANQLNELQACLGRASGRPSKSVMEAQRIAAELAS
                     LLEEWHLETLHIPETERDLYRVQNPYYAAH"
     gene            complement(351024..351233)
                     /locus_tag="BSVBI22_RS11745"
                     /old_locus_tag="BSVBI22_B0367"
     CDS             complement(351024..351233)
                     /locus_tag="BSVBI22_RS11745"
                     /old_locus_tag="BSVBI22_B0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001749831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000101796.1"
                     /db_xref="GI:446023941"
                     /translation="MARKTLSERRADALSELETAKARLAKLDNEAAERIGRIAIKSGL
                     VNLELTDDQVREEFDRIVERISKGN"
     gene            complement(351325..351567)
                     /locus_tag="BSVBI22_RS11750"
     CDS             complement(351325..351567)
                     /locus_tag="BSVBI22_RS11750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001689909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073487.1"
                     /db_xref="GI:492971571"
                     /translation="MTDHQNANTERRPQRRGRASFVAVLNEVRKEHERGVPLVWIYEA
                     FADQLEIGYTQFTKYVTRYIKQGQPILAPYKHDGKR"
     gene            351912..352292
                     /locus_tag="BSVBI22_RS11755"
                     /old_locus_tag="BSVBI22_B0368"
     CDS             351912..352292
                     /locus_tag="BSVBI22_RS11755"
                     /old_locus_tag="BSVBI22_B0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006199029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraJ"
                     /protein_id="WP_004687414.1"
                     /db_xref="GI:490825324"
                     /translation="MAGENAIEAIKPHSRGTRPRRERIEVWVSIDEKKELAERADQAG
                     LSNAAFLRAVGLNLPIGSRADLEAVRQLAKVNGDLGRVAGLLKLWLAEKRGQGARPID
                     VEAMMMDFRAIQEDMRALMGKISK"
     gene            352289..354241
                     /locus_tag="BSVBI22_RS11760"
                     /old_locus_tag="BSVBI22_B0369"
     CDS             352289..354241
                     /locus_tag="BSVBI22_RS11760"
                     /old_locus_tag="BSVBI22_B0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006279894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraI"
                     /protein_id="WP_006191828.1"
                     /db_xref="GI:493203665"
                     /translation="MIAHRINRERKASSPARLIKYMVAAKGGIDPTSWERTADYILDS
                     ANGTTEGEKVGSYRVTNCGTDDPADAAILIQTTQAANTRSKAEKTYHFVYSFPPGEQP
                     DLETLHAIEDELCAAIGLDEHQRVSAVHIDTDNLHVHVAINKVHPTGLQNIEPYYDQF
                     RLMEACERLEVKHGLQRTFHGLEAKQRYQNRDIELLPAKAPEQRDSLFRKHLRNAYDL
                     SISEPPEAKTLNGLRKLSDTRLQRQSVDKAEPVRIGAKVASVEAQSGIETLTGYAARE
                     LAPAMRQATSWQELHDAAAEHGLEVRQRGAGLVIGEPDLGIWAKASNVGRDLSMKALT
                     DRLGPFQPSERQAEAKANRKRYEPRPRRPDNPTTAGLFNQYQRERQAAILARRQGFDQ
                     IKRESAAFNAQVRQWSQTERMLLKVAGKGPTKRLMYGTIKQQADASRQKNRQSADARR
                     QALFKQTTMPTWADWLTQQAERGNAEALAVLRDRKERTRRWNGELLTADRADKAKAVV
                     LDKLKPRARKDGTMAYSTIDGGMVIDRKTHVQAQKATTGAALVALELASKRFEGQALI
                     VEGTDEFRLEVAQLAGMHGLKVTFTDPAMEQMRRETAEQKEMEKAFQAEVYGQKGIQV
                     REGSKSASVMPQCGKKRPEGRSNDLT"
     gene            354333..354512
                     /locus_tag="BSVBI22_RS11765"
     CDS             354333..354512
                     /locus_tag="BSVBI22_RS11765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073489.1"
                     /db_xref="GI:492971576"
                     /translation="MKDRSHDAAMAEHFRADPSYAAELLAEVRRNGDPAELAILLRLM
                     VTDSVNAVRSEDADT"
     gene            complement(354648..356207)
                     /locus_tag="BSVBI22_RS11770"
                     /old_locus_tag="BSVBI22_B0370"
     CDS             complement(354648..356207)
                     /locus_tag="BSVBI22_RS11770"
                     /old_locus_tag="BSVBI22_B0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004692410.1"
                     /db_xref="GI:490830324"
                     /translation="MPSILDRFYERTAHLNALLDTNPAEAVKQAQEINLHLDTDERFN
                     LMGLRAAILVDGGALTRQQDAIEEGLALFRDLHSSFPTADVTYNLANGLVAATGFPPH
                     NENWLNHQELTRARRAEARQCFWKVAQDQDADSTLRTQAWTNIANQFSNSYRLGEAQD
                     GWLAALEIDPENGVAASSAARNLLWLYERGGCSELTRIEALMLAKIADRHRDRIIQYA
                     GAQAAEQIAAFACELGDPPPRSPHKNPFITWAERERLTLAPVVELIDPTMGKLDWLML
                     PGIVERESGTDGMPPPVFAMFNMLKSDFILARDLLWRAVDESVWPATGRFGDTLDYAT
                     YGPDASALILAHRTALDLLDKVAVAANHYFEFGLPPDKVYFGKLWRGGPDRATGIRPL
                     NAKVEQAIRGGTSALYGLVELADDYDSSAGILRSQKDLRNAGTHRFVVLHDLGDPAHS
                     RQAPEIEHHRREPFTQEALRALRVARSAIQMLVLSISQHEQGLVERTEGLIESLLVPD
                     HDWIRGRDDET"
     gene            complement(356226..357251)
                     /locus_tag="BSVBI22_RS11775"
                     /old_locus_tag="BSVBI22_B0371"
     CDS             complement(356226..357251)
                     /locus_tag="BSVBI22_RS11775"
                     /old_locus_tag="BSVBI22_B0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004692408.1"
                     /db_xref="GI:490830322"
                     /translation="MPFEIRPWEAIVENYGCTILLGNGASISVNPSFSYTSLLQHATE
                     QNLLPDDAQQLFNFFKTNDFELVLRIVWQASNVNRSLRIPDERTHATYVALRDCLIQT
                     VRDIHPEHGAVSAHLPTIYQFLKRFQTVISLNYDLVVYWAITYGLDIDDRHAFKDCFV
                     GGGTFNDDWQRFRQPIRGERSTSLVFYPHGSLVLCRNLVEQERKIHNLQDGLLEAVLQ
                     CWQDGQVVPLFVSEGTWSQKITSIQNSYYLSTVYREVLKSQRDTLVVYGWGFAEQDIH
                     LLQRMNGTGINRVAVSVFRGDQAYCNRVFQIIHDVLGAHVEVEFFNSESPGCWIHPPH
                     QEPRPAG"
     gene            complement(357285..358010)
                     /locus_tag="BSVBI22_RS11780"
                     /old_locus_tag="BSVBI22_B0372"
     CDS             complement(357285..358010)
                     /locus_tag="BSVBI22_RS11780"
                     /old_locus_tag="BSVBI22_B0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004692406.1"
                     /db_xref="GI:490830320"
                     /translation="MISIVLLGKYGVQDLSLPHGQLLYGLLNTLRDLDARTLMLALAE
                     VVATTGDLRARVNPKYRFDERLHDLTQCLLLDGYIIKSKMLVQTDPSITDAAPLEDDL
                     IDALQKSGAPRAQEIIAKINDSAGAFRSTPPDYNASLVNARVALETLAGDVAAHNASQ
                     QPTPPTYNPSKWGEVLVFLRSSGEITVEEEKGLAGVFGFLSPGAHRPMGIPEDQMTRL
                     GRSFALHMCWFLLKNHLLRIQQP"
     gene            complement(358189..359910)
                     /locus_tag="BSVBI22_RS11785"
                     /old_locus_tag="BSVBI22_B0373"
     CDS             complement(358189..359910)
                     /locus_tag="BSVBI22_RS11785"
                     /old_locus_tag="BSVBI22_B0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191832.1"
                     /db_xref="GI:493203669"
                     /translation="MIHNIFSTLPSFKNLGDLKPGLNVLLAQKTEGASTKQTRNRAGK
                     TSFVELVHFLLGADAGPESIFRTPELAEHTFGMDFDLNSERTVVERSGGSKAKIFVTA
                     PPAAKVKFSATEWCTFLGEQMFGLSSLEAAGSKPPSFRSLFAYFVRRQASGAFMTPEK
                     QATMQGTSDMQMALMFLLGLDWQIARDWQAVRDREKTLEELKKAAGNGVFGSIIGKVA
                     DLRTELTIQEARLKKLHAEVGTFQVLPEYRELEVESATLTRELNDLANANTIDFSAIR
                     DLENALASEIPPDHEDLQAVYQEAGIVLPGLVKRRYEDVKSFHDSVVRNRKDYLSSEL
                     EAAKLRIELRDSKKAQLDQRRGEILGILKSHGALEQFLKLQGELGRLESEVESLRQRF
                     EAAEQLEGTRNELDIERNRLTIRLRRDFAEQKDRLAEAIVAFEETSQRLYESAGSMTV
                     DETSNGPIFKFPMQGERSKGIKNMQIFCFDMMLMRLCAKRQMGPGFLIHDSHLFDGVD
                     GRQVISALRLGSEIAQELGFQYIVTMNEDDAFKETIDGFDLNDHVLPTRLTDATEDGG
                     LFGIRFG"
     gene            complement(359907..360155)
                     /locus_tag="BSVBI22_RS11790"
     CDS             complement(359907..360155)
                     /locus_tag="BSVBI22_RS11790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004687408.1"
                     /db_xref="GI:490825318"
                     /translation="MILPSKHLPHDRALLTVGARVLTFLARPKTVSALWEELNRHDTG
                     LTVTPRRITYDWFLLSLDLLYALGTIELESGLVARRTA"
     gene            complement(360152..361072)
                     /locus_tag="BSVBI22_RS11795"
                     /old_locus_tag="BSVBI22_B0374"
     CDS             complement(360152..361072)
                     /locus_tag="BSVBI22_RS11795"
                     /old_locus_tag="BSVBI22_B0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002971350.1"
                     /db_xref="GI:489061315"
                     /translation="MDRIQQLNYEKDFRIAFLESKGDGFQRLFEKLMLKAHPNDFMAC
                     RPWGNVGDRKNDGYLPSARILFQSYAPNELSATEAIKKINEDFEGAKEHWEDYFDEWT
                     FVHNAPDGRLGPHIIEALAKLAQDNPQLKIGHCGYEEMLTKFRQLSLQDLESWFGPSL
                     TMEANVNLGFGDLTAVLTHISITPVPTASEVKNVSRGKIEANLLSQAVADFLKIGMQK
                     SPLVAQFFNSWKNPTYGEQIAQAFKSEYVKLRDGVSQLHPDEIFGRLEAWAGGTTNTT
                     PAHKAAVLAVLAYLFDKCEIFEDAQAMGAA"
     gene            complement(361121..361315)
                     /locus_tag="BSVBI22_RS11800"
                     /old_locus_tag="BSVBI22_B0375"
     CDS             complement(361121..361315)
                     /locus_tag="BSVBI22_RS11800"
                     /old_locus_tag="BSVBI22_B0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-damage-inducible protein J"
                     /protein_id="WP_004687407.1"
                     /db_xref="GI:490825317"
                     /translation="MASSNDVVRARIDGHIKEEATNVLSGMGLSVSDAIRILLTRIAT
                     DKALPFDINRVQAQPSIKKP"
     gene            362022..362570
                     /locus_tag="BSVBI22_RS11805"
                     /old_locus_tag="BSVBI22_B0377"
     CDS             362022..362570
                     /locus_tag="BSVBI22_RS11805"
                     /old_locus_tag="BSVBI22_B0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966226.1"
                     /db_xref="GI:489056084"
                     /translation="MKNLFRTAALMVPLSLALAYGAQAKEIPIGKPQLLGGMEIAAVY
                     LQPIEMEPEGMMRPAKDSDVHLEADIKAAKDNTNGFAEGDWVPYLVVSYELTHLDNGK
                     VQKGDFMPMVANDGPHYGDNVKLDGPGKYKLKLFVSPPSANQHAHFGRHVDKETGVGP
                     WFKPVTAEYEFVYAGTGKKGAY"
     gene            362574..362972
                     /locus_tag="BSVBI22_RS11810"
                     /old_locus_tag="BSVBI22_B0378"
     CDS             362574..362972
                     /locus_tag="BSVBI22_RS11810"
                     /old_locus_tag="BSVBI22_B0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968354.1"
                     /db_xref="GI:489058256"
                     /translation="MARPLTQTMLHRSCDGFAKFANAFRKAVWGGVVLLAVASSVAWA
                     EEPTFRLEFKDGVITPDRLEVPANTRFRIELVNTGSMPAEFESLELRKEKVIAAQSET
                     VMVIRTLDPGEYPFFDDFHPGGTPAILIAK"
     gene            362979..363815
                     /locus_tag="BSVBI22_RS11815"
                     /old_locus_tag="BSVBI22_B0379"
     CDS             362979..363815
                     /locus_tag="BSVBI22_RS11815"
                     /old_locus_tag="BSVBI22_B0379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006144857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron permease FTR1"
                     /protein_id="WP_002966224.1"
                     /db_xref="GI:489056082"
                     /translation="MNVQDFNILFVIWRECIEALLVVGILNAWLSHRPAQEQRTGRIW
                     LWSGVAAGLAGALVLAFLLLTVGDMLSDDAQDYFQTAIVLLAAGLIVQMVFWMRKHGR
                     TLKKELHASLTDVADKANWLGVFALAALAVMREGSEAAVFLYGTMAGISASNYNALVA
                     ALIGLAAALGTYWLLQLGSRVLSWNAFFRITEVMLLFLAGSLLLTGIDHLISLGVLPP
                     LSARLWNTSAILSDNGMLGGLVSGLTGYRARPVLIEVLVFFAYWTIVLWFLSRPRALQ
                     TA"
     gene            363776..365209
                     /locus_tag="BSVBI22_RS11820"
                     /old_locus_tag="BSVBI22_B0380"
     CDS             363776..365209
                     /locus_tag="BSVBI22_RS11820"
                     /old_locus_tag="BSVBI22_B0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006191838.1"
                     /db_xref="GI:493203675"
                     /translation="MVSVPASRPANRLIAGEEKRLQRALARTGLWLRDHQRAIRAIQW
                     VIIGAYAGLLIIPLMTPMPDRLSHIWSNAVLFAQFMFWGIWWPFVLVSMVLMGRTWCG
                     VFCPEGALAEAASRHGYGRATPRWIKWKGWPFVAFACTTIYGQMVSVYQYPKPVIIVL
                     GGSTLAAMAVGFLYGREKRVWCRYLCPVSGVFAVLAKLAPVYYRVDRETWNDWERKPG
                     TPMPHVNCAPLVPIKTMRGASACHMCGRCAGFKDAIQLSGRSPSYEVVEVAGDAPKPW
                     ESLLIIFGMMGIAAGAFQWASSPIYVDVKQWLAEWLVEHGGIAMIQPQLPWWVLTNYP
                     DLNDMMTPLDGGLMIAYILAVACITSIAVGGLVAIANWALGGWKAARFHHLVQCLIPM
                     AGCGVFLGLSATTVTLLKAEDVPLAFVSDLRILLLLGAVVWSAWLLWSVARRYTSSMA
                     RRLVATAMGALATGVAAFNLVLLFWIW"
     gene            complement(365467..367845)
                     /locus_tag="BSVBI22_RS11825"
                     /old_locus_tag="BSVBI22_B0381"
     CDS             complement(365467..367845)
                     /locus_tag="BSVBI22_RS11825"
                     /old_locus_tag="BSVBI22_B0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YBL8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoketolase"
                     /protein_id="WP_004688915.1"
                     /db_xref="GI:490826825"
                     /translation="MSTVPAKGPLTPQQLSLINRYWRAANYLSVGQIYLMKNPLLREP
                     LQPEHIKPRLLGHWGTTPGLNFIYAHLNRIIQQRNANVIYICGPGHGGPGMVANTYLE
                     GTYSEIYPAISEDEAGMERLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGA
                     AFDNPDLVVACVVGDGEAETGALATSWHSNKFLNPARDGAVLPILHLNGYKIANPTVL
                     ARLSDDDLDNLFRGYGYEPFFVEGSEPADMHQKMAATLDTIFQRIQDIKKNADVHSPE
                     RPRWPMIILRSPKGWTGPKTVDGLVVENYWRAHQVPVANCRENDAHRKILEDWMKSYD
                     PSDLFDEKGALKPELRALAPKGEARIGANPHANGGLLRKELHMPDFRQYAVNVTEPGA
                     IEAQSTKILGDFLRDVMKLNETEKNFRIFGPDETASNRLGSVLEATNRVWMAETLDMD
                     DHLAADGRVMEVLSEHLCQGWLEGYLLSGRHGFFSCYEAFIHIIDSMFNQHAKWLQVA
                     RELEWRKPISSLNYLLTSHVWRQDHNGFSHQDPGFVDLVANKSADIVRVYFPPDANTL
                     LWVGDHCLKTWNRVNVIVAGKQPEPQWLTMAEAEKHCEAGLGIWEWAGTEDGLEPDIV
                     MACAGDVPTMETLAAVDLLRQSLPHLRIRVVNVVDLMVLQSPHQHPHGISDEEFDRMF
                     TTNRPVIFAYHGYPYLIHRLVYKRTNHSNFHVRGFIEQGTTTTPFDMTVLNELDRFHL
                     AMEAVERLPLGESVAKPLIDNFTEKLALHKDYIRQHGEDMPEIRDWKWTWPR"
     gene            complement(367866..369071)
                     /locus_tag="BSVBI22_RS11830"
                     /old_locus_tag="BSVBI22_B0382"
     CDS             complement(367866..369071)
                     /locus_tag="BSVBI22_RS11830"
                     /old_locus_tag="BSVBI22_B0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966221.1"
                     /note="Enables the production of acetyl-CoA by
                     phosphorylating acetate in the presence of ATP and a
                     divalent cation; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate kinase"
                     /protein_id="WP_006191840.1"
                     /db_xref="GI:493203677"
                     /translation="MKKQLVTFNAGSSTVKIGVFECDENAVRKVSKGDIDLTGSPLRF
                     RLRGENGNLDIVLSASGADEITTILGELFDKLAEHIDPSRILAVGHRVVFGGDDFAQA
                     VLIDDDNLEAIERLSIFAPLHQPKSLALIKAVRKIFPHLAQTASFDTAFHQTIPDTVR
                     RFAIPQELHDRGIKRFGFHGLSYKSVIGNFSQRAPELAEGKIIAAHLGSGASLCAMHK
                     RKSLDTSMSFSTLDGIPMATRCGALDPGVLLHLLQQEKMEADALADLLYHRSGLLGLS
                     GLSGDTRDLLESDAPQAHTALDIFALRIAGEICRLASTPNGLDAVIFTAGIGEHQPAI
                     RAAICQRLAWQGVELDPAANDENAFCITSRTSRTAAFVLPTDEEQIIASETFEIIRQM
                     PATARSAFA"
     gene            complement(369140..369268)
                     /locus_tag="BSVBI22_RS11835"
     CDS             complement(369140..369268)
                     /locus_tag="BSVBI22_RS11835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972003.1"
                     /db_xref="GI:489061974"
                     /translation="MFDNFRNFQMKAHRAKWAPAPLPALISEPNFTLRVKSIILSE"
     gene            369514..370677
                     /locus_tag="BSVBI22_RS11840"
                     /old_locus_tag="BSVBI22_B0384"
     CDS             369514..370677
                     /locus_tag="BSVBI22_RS11840"
                     /old_locus_tag="BSVBI22_B0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016149364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_006191842.1"
                     /db_xref="GI:493203679"
                     /translation="MTSPTERPKQDWDPRSEAVLSDQIGAYDAMRHQCPVAHSDYLGW
                     SLFSYDDVVRVLDDHETFSSVVSAHLSVPSGMDPPQHTAFRQLVERYFEPERIKAFEP
                     ICREISKKLVCELPRDAEIDLVTQFAQLYAVRIQCAFLGWPDSLQGPLLDWVNKNHAA
                     TLACDTKAMAAIALEFDEYIRDLLDERRKLGADAPDDVTTRLLRDRIDGRNLTHEEIV
                     SILRNWTVGELGTITACVGILCHYLAKSQQTQALMRGGPDLLPAAIDEILRLHAPLIS
                     NRRVTTRAVVVGGREIPAGEKITLMWASANRDEAVFDKPDELRLNRDPALNLLYGRGI
                     HVCPGAELARAELRILMEELLGQTRKLDLVPGSVPALAVYPASGFSRLPARIS"
     gene            complement(370748..371425)
                     /locus_tag="BSVBI22_RS11845"
                     /old_locus_tag="BSVBI22_B0385"
     CDS             complement(370748..371425)
                     /locus_tag="BSVBI22_RS11845"
                     /old_locus_tag="BSVBI22_B0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006105122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002969358.1"
                     /db_xref="GI:489059287"
                     /translation="MTEASGNEWIKPIQRQNLSELAYTTLREALMEGRLKPGEDLPLR
                     PISRSFGISATPMREALLRLVAEHALEIDARGRISVPHLTRAELLEVRKLRGFLEGNA
                     AREATLNATPEAVDALEQIHFELITAQDAGDFPTAIGFNTKFHLKMCEIAGLPVTHEL
                     VSNLWVRCGPLISHLYDAGIPANWNPHPHVLIVKAIRARDPDMAYKELNRDIEGSGAG
                     LLAHVKD"
     gene            371697..372704
                     /locus_tag="BSVBI22_RS11850"
                     /old_locus_tag="BSVBI22_B0387"
     CDS             371697..372704
                     /locus_tag="BSVBI22_RS11850"
                     /old_locus_tag="BSVBI22_B0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007803615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH quinone oxidoreductase"
                     /protein_id="WP_004692399.1"
                     /db_xref="GI:490830313"
                     /translation="MPKAVLSVIATRPGGPEVLELVPRELPALKRGEMRVRVHAAGVN
                     RPDAMQRAGQYPPPPGVTDVLGLELSGVVLEIAEDVTRFGPGDRIMALVAGGAYSEEA
                     IVQADVCIPVPAGLSMVEAAGIPETYFTVWSNLFQHAGLQPGETVLLHGGTSGIGVTA
                     TLLAKAIGARMITTCGSDDKCRASEALGAIASINYRTTDFVEAGRALTEGRGPEVVID
                     MVGGSYMQRNLQLVAEDGRIAQIAFQQGSEAQMDMGPLLFKRLTLTGSTLRARPLVMK
                     AALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAAHAHLEASAHTGKIILKTAACDA
                     A"
     gene            372788..373999
                     /locus_tag="BSVBI22_RS11855"
                     /old_locus_tag="BSVBI22_B0388"
     CDS             372788..373999
                     /locus_tag="BSVBI22_RS11855"
                     /old_locus_tag="BSVBI22_B0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YBM4.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Leu/Ile/Val-binding protein homolog 8"
                     /protein_id="WP_004688921.1"
                     /db_xref="GI:490826831"
                     /translation="MRLSRLLIGASLGVALSSTAFTAALADVKFGSLYPISGSLALLG
                     EESARGLELAVDEVNAAGGIKGEKVVLERGDAVDNNQATGEARRLISLVGVKAIFGTY
                     SSARVIAASQVSELAGIPYFEMGAVADEVTGRGLQYLFRTNPTAENMAKDSVDMLIKG
                     IAPGLGKDPKDMKIGIIYEDSSYGTSVAGHQEDNAKAAGLTVVLKSGYPSNTVDMSSL
                     VLELREKGADVVMQTSYQNDSVLFLQQANEAGYKPLAIIGGGGGYSMQPTADAVGHDL
                     IDGVFDADYTQYAVNTSATPGLTEFVEAYKAKYGSQPRSGHSLTNYVGAKAIFQALNA
                     GEGFEPDQIVSAVKALDIPDGQTAAGYGVKFGKNNQNERATMMGMQWQDGKLVTVYPE
                     NAAIAKMRFKK"
     gene            374048..374932
                     /locus_tag="BSVBI22_RS11860"
                     /old_locus_tag="BSVBI22_B0389"
     CDS             374048..374932
                     /locus_tag="BSVBI22_RS11860"
                     /old_locus_tag="BSVBI22_B0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_004688922.1"
                     /db_xref="GI:490826832"
                     /translation="MTTFLQILLNGLMLGGLFAIVAVGLTLIFGIVKVVNFAHGEFLM
                     AGMFVTWLITTKLGLHPYAAVIIVLPAMFILGALTQRLLIQPLMASDDGHAQIFATVG
                     LSTAMINLALLIFGADIANTPNFGLRTPIEIGPLRVLTGQVFIFLGAIVLVVALQLFL
                     KNSQTGRAIRAVAQHRSAAELMGVNVSRIYILCFGLGAACVGLAAVLIAPLYPTSSNI
                     GTYFVLTAFVVVVLGGLGSIPGAFVGALIIGVIDTMSGYYIGSDLREAVVFGIFLLIL
                     ILKPSGLFGKQLNLSHLS"
     gene            374942..375277
                     /locus_tag="BSVBI22_RS11865"
     CDS             374942..375277
                     /locus_tag="BSVBI22_RS11865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191844.1"
                     /db_xref="GI:493203681"
                     /translation="MSISDTIDRAGMNKSRLGKGQIAFCVLLASLLLLPLAINNAFVS
                     HIFITICLFAALSTAWNIVGGFAGQMSLGHAVFYGIGGYTGVILFNMGIWGSAHGSAC
                     SSARSSPRW"
     gene            375244..376779
                     /locus_tag="BSVBI22_RS11870"
                     /old_locus_tag="BSVBI22_B0390"
     CDS             375244..376779
                     /locus_tag="BSVBI22_RS11870"
                     /old_locus_tag="BSVBI22_B0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191845.1"
                     /db_xref="GI:493203682"
                     /translation="MFIGAFIAALVGMVISYPCFRLKGPFYSLASIAFLEVFRVLALH
                     FGWLTGGATGLMIQLKLGWVWIVFRERWPSLLIVFGMLLVTLAITWAVRRSRLGFYLV
                     ATRERESAARAAGVRTVRVRLIAVAISSALCAMLGTFHAMYLTFIEPAAMFSLAFSIQ
                     IAMFALIGGLGTVAGPLLGAVLLVPITEWARASLGASALGLHGFVYGLVLILVVLFMP
                     NGIMGAINRFVRKPQDSEETATARTEPIAAVPARAIKAPSPDRAGIGQDILRVQNLNK
                     HFGGLHVTRNVSFTLREGEVLGLIGPNGAGKTTLFNMISGFLAPDEGTVNLCGADGQF
                     HAPKNPADFAALGLGRTFQIVQPFAAMTVEENIMVGAFYRHHHEKDAREAARETAWRM
                     GLGPLLGAEARGLTIGGLKRLEVARVMAMEPRILLLDEVMAGINQTDVRRAIDLMLSI
                     RDSGVSIIAIEHVMQAVMSLSDRVIVLASGEVIAQGRPQDVVRDPQVVEAYLGKEFAH
                     AHA"
     gene            376766..377470
                     /gene="livF"
                     /locus_tag="BSVBI22_RS11875"
                     /old_locus_tag="BSVBI22_B0391"
     CDS             376766..377470
                     /gene="livF"
                     /locus_tag="BSVBI22_RS11875"
                     /old_locus_tag="BSVBI22_B0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966212.1"
                     /note="with LivGHMJ and LivGHMK is part of the
                     high-affinity branched-chain amino acid transport system;
                     LivFGHMK is specific for the transport of leucine, while
                     LivFGHMJ is a transporter for leucine, isoleucine, and
                     valine; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATPase"
                     /protein_id="WP_006191846.1"
                     /db_xref="GI:493203683"
                     /translation="MLTLEHVDAGYGRATILQDVSLEVKEGEIVTIVGANGAGKTTTL
                     RTIVGQIQPRAGKITFLGEDITHLPAHEVVDRGIILIPEGRQLFPDMTVRENLQMGTY
                     RRAARAAQESRMEEVLELFPRVRERLDQTASSLSGGEQQMVAIARGMMANPRILMFDE
                     PSLGLAPIVVSQVFDVVRKIAATGTTVLIVEQNVFTTLKVANRGYVLENGRVVLADSS
                     EALLNNDHVRRAYLGI"
     gene            377473..378270
                     /locus_tag="BSVBI22_RS11880"
                     /old_locus_tag="BSVBI22_B0392"
     CDS             377473..378270
                     /locus_tag="BSVBI22_RS11880"
                     /old_locus_tag="BSVBI22_B0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_004690124.1"
                     /db_xref="GI:490828034"
                     /translation="MELTEITPESLRLRPSHKERNVLITGAARGIGRAIAQAFVERSA
                     TVGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAIDDTGLVFDTVVNNA
                     GISPKHNGVAHKVWEMAPDEWRRLVDVNLTGTFNTIRALTPGMVEARRGWIVNTSSVA
                     GKTYSPIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVN
                     AEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYMA"
     gene            378275..379093
                     /locus_tag="BSVBI22_RS11885"
                     /old_locus_tag="BSVBI22_B0393"
     CDS             378275..379093
                     /locus_tag="BSVBI22_RS11885"
                     /old_locus_tag="BSVBI22_B0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shkimate dehydrogenase"
                     /protein_id="WP_004692392.1"
                     /db_xref="GI:490830306"
                     /translation="MITGHTKLYGIVANPIAHVKTPEEVNKHFAALGHDGVLVPFHVL
                     PENLAQFVNSLRKLENPGGLVVTVPHKTAILSLCDRLEGDAAAIGAANVIRRESDGTL
                     VGVMLDGKGFVSGLVASDIDVTGMNACLFGAGGAASAIAFALAEAGVARLTIVNRSED
                     KARDLAARVSERYPAVQIDAGAPQTASRDLIINATSLGLRAGDPLPLDDLAFHAGQIV
                     AEVIMEPEVTPLLAAARDKGARIHFGRPMLRQQIRLMAEHMGAKANADVQKPTE"
     gene            379098..380732
                     /locus_tag="BSVBI22_RS11890"
                     /old_locus_tag="BSVBI22_B0394"
     CDS             379098..380732
                     /locus_tag="BSVBI22_RS11890"
                     /old_locus_tag="BSVBI22_B0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005974516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase"
                     /protein_id="WP_002966209.1"
                     /db_xref="GI:489056067"
                     /translation="MAYALPQDACFDFIIVGGGTAGCILAEALTRSGRNRVLLCEAGG
                     EARSPWIRIPAGFYKLLVNRRYNWGFWSEEEAATNFRRIAIPRGKGLGGSTLINGMIY
                     VRGQPQDYEGWRERGATGWGWDDVLPYFKAIERWTLPDPDGLRGRSGPLPVNEVVEKT
                     PIGDAFIAAAVAQGQCFNPDYNGRRQDGVGWYQVNQAGGERYSADRAWLEQARKRPNL
                     TVLTGARVMRILLEGRKAAGVALRHKGSEQTVYGAEVILAAGAVQTPQLLELSGIGDP
                     VRLQGIGIEPIHALPGVGENYLDHFCTRMNWRVSQPITLNELTRGPRLVGEVLKYVLK
                     RRGVLTYGTGLNHAFLRSRPELDRPDVQFFFMHASYANAAERKLHRFPGMTLGVTQLR
                     PRSCGSIHAISPDLSVQPAIAPNFLDHEEDRRVMVDGMKLARDIIEQKPMDAFRVAEL
                     SPGSNCNSDEDWLSFARANGQTIYHAAGTCRMGVDPLAVVDPSLCVHGIAGLRVIDAS
                     VMPEMVSGNTQAAVMMLAAKAADIVLEDKGQAPAGR"
     gene            380757..382187
                     /locus_tag="BSVBI22_RS11895"
                     /old_locus_tag="BSVBI22_B0395"
     CDS             380757..382187
                     /locus_tag="BSVBI22_RS11895"
                     /old_locus_tag="BSVBI22_B0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_006073520.1"
                     /db_xref="GI:492971661"
                     /translation="MYPNLTLIVGGEERNKGSAGTLCLTDPADGRELTIAPRAGRAEA
                     LQAAAAEKGFAEWSALSALERSKIMRRAADIMRERADAAARIMSMEQGKPLAEARGEW
                     LGSADLLDWFAEEGRRVYGRIVPSRAPNIQIQVLKHPIGPVAAFTPWNFPAWNTMQKV
                     APALGAGCSVVIKPASDTPGTAWLIGKCLLEAGLPPKAVSVIWGTTSELSDALIKAPE
                     FRKVSLTGSTRVGRIVAAQAGEYLKKVTMELGGHGPVIVAADADLDHLIPLAVQWKFR
                     NCGQVCVSPTRFIVEASIHDEFIRRFSEKARELKVGKGVEEGTQMGPLTSQNQLETVL
                     SMVEDALTKGAKIETGGNRIGDTGNFYEPTILSGMTAEMLAMNEEPFGPLALVMRVHS
                     LDEAIAESNRLPVGLGAYLFTSSMTTAHRVQNHLQAGMLGVNHFALALPETPFGGVRD
                     SGFGSEGGLEGIEAYLTTMTVTTMMV"
     gene            382243..383442
                     /locus_tag="BSVBI22_RS11900"
                     /old_locus_tag="BSVBI22_B0396"
     CDS             382243..383442
                     /locus_tag="BSVBI22_RS11900"
                     /old_locus_tag="BSVBI22_B0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YBN1.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Leu/Ile/Val-binding protein homolog 7"
                     /protein_id="WP_004687393.1"
                     /db_xref="GI:490825303"
                     /translation="MEKHLIALSVAALLAGAAPASADIKMGSLYPFSGPLALLGDESA
                     RGLEIAVEEINAKGGVQGEKIVLVRGDAVDNNQAIGEARRLISVENVAGIFGTFSSGR
                     AVAASQVSELAGVPYFELGAVADEITDRGLENVYRANPYARDFAQMIVEMLQKKIAPK
                     LGKDSKDLKIAVIYEDSSYGTSVAKHEETFLKEAGLNMVLSQSYPGNTVDMSSLVLDL
                     KSAGADVVLQTSYQSDSVLFLQQANEGGYKPSAIVGAGGGYSLQPTADAVGHDVIEAA
                     YDVDFTQFAVNTSFTPGLEEFVEAYKKKYGETPRSGHSLTNYVGAKVILEALNKVKGF
                     DAAAVKQALSAVDIEAGKTAMGYGFKFDQNNQNERASMMGMQWQDGKLVTVYPDAAAI
                     SEIRLPQ"
     gene            383505..384632
                     /locus_tag="BSVBI22_RS11905"
                     /old_locus_tag="BSVBI22_B0397"
     CDS             383505..384632
                     /locus_tag="BSVBI22_RS11905"
                     /old_locus_tag="BSVBI22_B0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014299768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_004690127.1"
                     /db_xref="GI:490828037"
                     /translation="MKFKAAVLDRHGVERPYNQTKPLVIREIELREPKADEVLVKLAA
                     SGLCHSDLSVINGDRSRQIPMVLGHEAAGVVEKIGEGVTDLVPGDHVVCVFVPNCGHC
                     QPCAEGRPALCEPGAAANGKGEMLSGGLRLFCDDGDVYHHCGVSAYAEYAVMSRYSII
                     RIEKDIPLHIAALMGCAVLTGTGSIFNTGLVKPGSRVAIAGLGGVGLAAVMGAVAAGA
                     TEIIALDMFDDKLALAEQLGATKTFNVQSEGVVEAVKEYTKGGVDAAFEYAGSGAALA
                     MCYALTKRGGEVVTAGLPNPKNMLSIPAVSLVAEEKSIRGSYLGSGVPTRDIPLFLDL
                     YRKGKLPVEKLLTHRIKLEEINEGFERLAAGKAIRQVVEFN"
     gene            384837..385832
                     /locus_tag="BSVBI22_RS11910"
                     /old_locus_tag="BSVBI22_B0398"
     CDS             384837..385832
                     /locus_tag="BSVBI22_RS11910"
                     /old_locus_tag="BSVBI22_B0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002966205.1"
                     /db_xref="GI:489056063"
                     /translation="MKLVFFGVGHWHSGMHAQAAEAAGAEIVAAWDNEPEKAAAFVAQ
                     FGGMVSPTIEEALALKPDLAVVMGRPAEMAALARRLILEGVPMLIEKPVGVSGAMMKP
                     LVDLAEQRNAFVSVALPYCFSPLLAEADALRDTNRLGAISHSHFRLINGPPQRYVNDG
                     VAWVLDASISGGGALRNLGIHGINGFVNLCGGQEITVESVSFGRQLFDTSVEDYALVV
                     LRAADGTIGVVEAGYTFASMTQGIFEWRVDARNASLTDHGPCLSVLTLDDGKMRERPA
                     MPVVDRYDDIMVNTISRLCNGGKPAVTLRDLWRAMDLIDRCYALSAKRSAPLCLA"
     gene            385820..>386806
                     /locus_tag="BSVBI22_RS11915"
     CDS             385820..>386806
                     /locus_tag="BSVBI22_RS11915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692383.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-carboxy-3-chloro-3,4-dihydroxycyclo
                     hexa-1,5-diene dehydrogenase"
                     /protein_id="WP_004690128.1"
                     /db_xref="GI:490828038"
                     /translation="MLGVGIIGAGHFGAAHAKALQSVPNARLVAACRNDTQGLGAFIE
                     AFGGAGYLDYRDLLSDPNVDAVVIALPHHLHTDVAIACAEAGKHIMIEKPMAPTVAEC
                     RDILAAAQKAGVTLMPGHTMRFTLPFMAAKRITDEGELGNMRYGSSRMIKLWMEGNRR
                     DWHLDPATGGGMLFTAGIHALDRLVAFSGCRATHVSAIAATSFHHQKADDMALLLLRF
                     GDQAAGQVASIGYRDGAFISGDELVFDNGVLTVDFFNGVTLGRGLKWQPVENSIEPAV
                     SEQGLIRQWNAFVHAVETGTTPPVTGEDGLHVVACIEAAFKASRERREVAVEA"
     gene            complement(386884..387837)
                     /locus_tag="BSVBI22_RS11920"
                     /old_locus_tag="BSVBI22_B0400"
     CDS             complement(386884..387837)
                     /locus_tag="BSVBI22_RS11920"
                     /old_locus_tag="BSVBI22_B0400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006157503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_002966203.1"
                     /db_xref="GI:489056061"
                     /translation="MTETPLLSVRGLAKHYQTRSATLKILDNVSFDIARGEVVGLVGE
                     SGSGKTTIGRSVLRLIEPTAGQIMFDGADVATLSAREMRRQRRRMQYIFQDPFASLSP
                     RMTIGEILMEGLNIQGIGTKAERLERARKALEQVELPPDTINRYAHEFSGGQRQRIGI
                     ARALTLEPDFIVADEPVSALDVSIQAQVVNLLRDLQQRLGLTMLFISHDLAVVEYICD
                     RVIVLYLGRIMEIASSEDLYARPQHPYTRALLSAIPSPDPDARTERQILRGDIPSPAN
                     PPSGCVFRTRCPMAIDACATTVPQLREVRPGHFKACIRDNI"
     gene            complement(387834..388850)
                     /gene="dppD"
                     /locus_tag="BSVBI22_RS11925"
                     /old_locus_tag="BSVBI22_B0401"
     CDS             complement(387834..388850)
                     /gene="dppD"
                     /locus_tag="BSVBI22_RS11925"
                     /old_locus_tag="BSVBI22_B0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509990.1"
                     /note="DppD and DppF are the ATP-binding components of the
                     ABC dipeptide transport system DppABCDF; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_004690129.1"
                     /db_xref="GI:490828039"
                     /translation="MSRQPILDIKGLRTVFRTRAREIVTVNDVDIVVNPGETVALVGE
                     SGSGKSVTSLSIMRLLARKVGFIDAGSIILRGKSGQTVDLAAIDEEAMRRIRGNDIGM
                     VFQEPMTSLNPVYTIGDQIGEPLRVHRGTSRREALEAAVELLDRVGIPDARRRAGQYP
                     HELSGGMRQRATIAMALICNPTLLIADEPTTALDVTIQAQILDLMQKLQSESGMGMLF
                     VTHNLGVVAEIAQRVVVMYAGRIVESGPVKEVFRNPRHPYTMGLLRSMPRLGDATEMK
                     RRGEKLNTIPGMVPGLANLPSGCAFAPRCSFAVEACHAAVPPLASVNEHHGSRCIRWQ
                     EIAA"
     gene            complement(388861..389778)
                     /locus_tag="BSVBI22_RS11930"
                     /old_locus_tag="BSVBI22_B0402"
     CDS             complement(388861..389778)
                     /locus_tag="BSVBI22_RS11930"
                     /old_locus_tag="BSVBI22_B0402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose dehydrogenase"
                     /protein_id="WP_004688927.1"
                     /db_xref="GI:490826837"
                     /translation="MSKFFGVVPPVVTPLNDDHSVDYDSYTRVLEHLIEGGCHGLFAL
                     GSTSEVVFYDEADRRRILEHTVKVANGRVPVIAGVIDPATDRVIAHAKAAKDVGADAV
                     VVTAPFYTITSQPEIIDHFRMVRDAVDIPLIAYDIPVCVHAKLTRQTVVTLANEGTII
                     GLKDSSGDDGNFRYALLDLAKNKNMFLMTGSEIVVDNALLMGAHGVVPGLANVDPAGY
                     VRLWDAAQRGDWVAARKEQERLCRLFEIVWVGAGRVSGGAAGVGAFKTAMRSLGIIST
                     NKMARPRQALNTAEAGRIDAILRSVGLLD"
     gene            complement(389798..390670)
                     /locus_tag="BSVBI22_RS11935"
                     /old_locus_tag="BSVBI22_B0403"
     CDS             complement(389798..390670)
                     /locus_tag="BSVBI22_RS11935"
                     /old_locus_tag="BSVBI22_B0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_004690130.1"
                     /db_xref="GI:490828040"
                     /translation="MGQSIPASTGPMARSANRFLQNRAAIFGLVLLTPLLFAVLTYPL
                     WLPYKPNDIDLMAMNSAPSWKHWFGTDGVGRDVFARTMEGGRISLLVAVSSVVLSTAI
                     GFLIGAISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGIWSTVVVIALLSW
                     PVLSRMIRARLLELREREFVMASRGMGAGLGHLLFRHGLPNSIDILVVYATLQVANAI
                     LLEAGLSFLGLGVPPPAASWGNMLNAARSTAVLEQFPWQWLFPGGALVLAVLAINFIG
                     DGLRDAFDPRAELN"
     gene            complement(390672..391631)
                     /locus_tag="BSVBI22_RS11940"
                     /old_locus_tag="BSVBI22_B0404"
     CDS             complement(390672..391631)
                     /locus_tag="BSVBI22_RS11940"
                     /old_locus_tag="BSVBI22_B0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide permease BMEII0860"
                     /protein_id="WP_006191856.1"
                     /db_xref="GI:493203693"
                     /translation="MLRYCLHRLLIGLGMLLALTILIFVLLQLTPGDPIDAYINPNVA
                     MTQAEMDALRAQLGLDRPLPVQYLAWLGQAVQGNLGHSLQRFNETVSGLIASRIGPTL
                     LLMAAGLAIAIVIGVTTGIISAVRRNSFLDYSFSVLALLGISSPAFLTALLGLYVFSV
                     RLKWAPSGGMLTPATDFSIPDLLRHLALPALVLSIGHAALIMRYMRSSMLETLNQDYV
                     RTARAKGVREFWVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLI
                     NAVETRDYPVIMGATLVIGACVIIVNILTDLAYAVIDPRIKVT"
     gene            complement(391731..393314)
                     /locus_tag="BSVBI22_RS11945"
                     /old_locus_tag="BSVBI22_B0405"
     CDS             complement(391731..393314)
                     /locus_tag="BSVBI22_RS11945"
                     /old_locus_tag="BSVBI22_B0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YBP0.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_002966198.1"
                     /db_xref="GI:489056056"
                     /translation="MRLRNFYSALALSAAVFAGPLYAAAPAMAAGTISGGFDVGPGGF
                     QGNFNPLAATGGFTWLVTYFEPLVIYDDKLENIVGDLAKSFEISPDQLTYTFKLAHAK
                     WHDGEPFTSKDAKFTFDLARNGKTGSVFAARLASIASVETPDEKTVVIKLKEPSPSML
                     DTLTKVMMLPEHALASIPPEQLAKNAWWSSTPIGTGPFKFNKYVADQYVELTANPDYR
                     GGRPQVDKLINRYFADPAAAIAALRSGEIQFTYVDSNDVSTFSSDSAFRVIEGDSFVV
                     NYVGFNQEVPLWKDLKVRQAFMHAINRDAIIQSLYGGAAKPANCVYVADRLVPKAIDA
                     YAYDPQKARQLLDEAGWDKINGSKPITILTYYNSPLVANVLAAMQAMLAQVGINIVPR
                     TVDTPTYNSIVYKQGGTADEFPLIFAGLQNGPDPSSINIGLNEKQIPPAGSNIMRIRM
                     PAVTKALDAALAETNPAKRDARYQDVCKATNANLPWGTMWVANRYGVASSKLENFIWT
                     PAPAGGPYQAHPEKWAILE"
     gene            complement(393311..394060)
                     /locus_tag="BSVBI22_RS11950"
                     /old_locus_tag="BSVBI22_B0406"
     CDS             complement(393311..394060)
                     /locus_tag="BSVBI22_RS11950"
                     /old_locus_tag="BSVBI22_B0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_004692374.1"
                     /db_xref="GI:490830288"
                     /translation="MPKPETKMKNPIKPLKRAPLLHVSVQESLRAYIEDNGLQAGAPL
                     PPEGELAARLGVSRNSVREAIKALESVGVLESRRGIGVFVKAFSFEPLLENLAYGLGG
                     ALRQIEEVIAIRRALEIGLIDKTLERIGEDDIKELRDTLEKMRQRAERGEGFPEEDRH
                     FHQLLFRCQDNEVLLRLIEVFWLAFYKAFDFVNLQNIDPMATWRDHVAIVDAIEARDV
                     VAVRKQLDRHYSGINQVIAQNRTASLTGRKT"
     gene            394238..395776
                     /locus_tag="BSVBI22_RS11955"
                     /old_locus_tag="BSVBI22_B0407"
     CDS             394238..395776
                     /locus_tag="BSVBI22_RS11955"
                     /old_locus_tag="BSVBI22_B0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006236378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmannosamine kinase"
                     /protein_id="WP_004690133.1"
                     /db_xref="GI:490828043"
                     /translation="MIEEIVNRLRGKLIVSCQPVPESPFDNVASVVAYARAAEASGAS
                     GLRIEGAANVAATAQASTLPVIGLIKRDLDDSPVRITPFLEDVAALCDAGAAIVAVDA
                     TDRRRPVPAAELIGEIKRRGRIAMADISTLAEARNALAAGADIIGTTMSGYTGEGPTP
                     KDPDLDLVAHCSRLGSFLIAEGRYNSPQQAGEAIRAGADAVVVGSAITRPEHITGWFR
                     DAVESAAKPSSPVLAFDIGGTKTLAALVRGREILERRVMTTPASVGSESWIGAIASLS
                     ADWQGRYQRAAIAVTGRVDGEIWSSLNPETLAIPPDYPLGRRMGAALGAPVEVINDAQ
                     AAAWGENRFGAARGRDMVFLTISSGIGGGIVLGGRLIRGARGIAGSLGQVLVAGPSGF
                     VRLETLASGFGIAKMALEAGHAGDARSVFSAAAAGEGWARRILLDAASQLAAAVAGLQ
                     AIVDPECIVIGGGVGMADGFLDMLREALGSHSAVMRPDIVAAELGADAGIIGVADLAA
                     TYFS"
     gene            395800..395982
                     /locus_tag="BSVBI22_RS11960"
     CDS             395800..395982
                     /locus_tag="BSVBI22_RS11960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylneuraminate epimerase"
                     /protein_id="WP_006191859.1"
                     /db_xref="GI:493203696"
                     /translation="MFSLIGAKRLAIGIAALAWSTGAVMASEHWPDLPVGIKNGAAAR
                     IGNMAYVGLGSAGTDF"
     gene            396061..396966
                     /locus_tag="BSVBI22_RS11965"
     CDS             396061..396966
                     /locus_tag="BSVBI22_RS11965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylneuraminate epimerase"
                     /protein_id="WP_006191862.1"
                     /db_xref="GI:493203699"
                     /translation="MAAAGGKIFAFSGNGKATPDAKSPIIFDTAYVYDPGSDGWSKLD
                     TQTPVGLSGAKAVGLADGRIAIFGGYNKELFDKYLADVGAIDKDKEPEAYRKLVDSYM
                     GMKPEAYRWNDEVLVYDPAGNNWGSLGANPFLPNCDPAMATMGEGDFLLVSGGIKPGL
                     RTPEAKLVKIRDGAAHWQKVSDLPPLSGSEPQEGVAGAYAGKAGDDVLVAGGANFKGA
                     QANAAAGKWFAHDGLAKSWRDDVYAFDGKDWKVAGKLPRGLAYGAAFDAPGGLLVVGG
                     EDRDGKARKEVFLLKWDGKALSVEN"
     gene            397081..397341
                     /locus_tag="BSVBI22_RS11970"
                     /old_locus_tag="BSVBI22_B0409"
     CDS             397081..397341
                     /locus_tag="BSVBI22_RS11970"
                     /old_locus_tag="BSVBI22_B0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006128591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969352.1"
                     /db_xref="GI:489059281"
                     /translation="MRIYQLLHEAISLKGILKEPFKPKDLRRIVPGWPYAWYFSFLAQ
                     NCADNQPAGSAMFLRVGRGEYCLNQDADFAFDSARAATACGK"
     gene            complement(397342..398100)
                     /locus_tag="BSVBI22_RS11975"
                     /old_locus_tag="BSVBI22_B0410"
     CDS             complement(397342..398100)
                     /locus_tag="BSVBI22_RS11975"
                     /old_locus_tag="BSVBI22_B0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_004685023.1"
                     /db_xref="GI:490822933"
                     /translation="MGISSEDNVLHNIFENQPINSAFNTDDLGTLKSLPVSLKHYPPH
                     TIVSRQGDWTNSILIINSGWSCIYRDLPEGDRQILDFPMKGDFLGFRAGLGFNYYTLF
                     AITDLSVVEISLDILAEKMRKSPPLAMTFMELTARQRTILLEHLINLGRRTSLARIAH
                     LMLELGFRTKANGTGDAHGFYCPLTQGELADALGLTPIHINRMLRELREDNLLVFKNN
                     EVRFLNRPALMQVCSFDENYLSANIFTNIHLIPR"
     gene            398463..399230
                     /locus_tag="BSVBI22_RS11980"
                     /old_locus_tag="BSVBI22_B0411"
     CDS             398463..399230
                     /locus_tag="BSVBI22_RS11980"
                     /old_locus_tag="BSVBI22_B0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014489578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_002966190.1"
                     /db_xref="GI:489056048"
                     /translation="MNISPQFKDESKNPHNIYASKISTEKDQLYEVERPLLVIIDSRA
                     LDRECLAHGLTNNSVDMTIATFSSYEQWQHQRRNRKAAVVLFNVGGQKVSDPAVGNYL
                     KNLVADCAPAPVILLADKEEISQVVRALEHGVKGYIPTSVNVHVCVEALRLAMAGGTF
                     VPASSVLALRHATEAGGQRIQPLGGMFTQRQAEVVNALRRGKANKIIAYELKLRESTV
                     KVHIRNIMKKLKASNRTEVACIINELFPSETAFSDLQ"
     gene            399267..401456
                     /locus_tag="BSVBI22_RS11985"
                     /old_locus_tag="BSVBI22_B0412"
     CDS             399267..401456
                     /locus_tag="BSVBI22_RS11985"
                     /old_locus_tag="BSVBI22_B0412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="WP_006191865.1"
                     /db_xref="GI:493203702"
                     /translation="MIISDVSSANGRQPVADLLETIKRRKLMLTLPIIAGVGVGFAGY
                     LTAPVSYVSESVLVLDMRRLQALPNESAITPLPQDSPVLRSELDIINSRMMAQKVIEL
                     LQAENIAVPMDVHSRTVLSSQPDRITLSKNARDFDPAVRERQQIDLLLSRLRVSNDGR
                     SFTIFISYRAPDPVYAARVANAFATAYLNHQVDVQQSAARRVSEWLGEKLVTLRNDLE
                     TAERVAEDFRQKSRLAGEQGQISFQAQRVMALNTEIVAATGAVSTAQARLQTAQALKN
                     NNEAPAMTEILASPAIQNLRNEEARVQRHLDELKANGALKSAEIPVLMAERESLKQQI
                     TAQVDEIIKSLSNEIRIAVQRRTSLEKELKEAETDLAKANQAQVRVAQLDREANASRV
                     VYETYLTRYKQLIEQDGIAIPEAQLISQAEPAMAKASPRLINWLLVGLGLGGLFAVAG
                     TMLREALDKIRPAQTTALALPGIPAATLLPVSPQLTVPILVNRGVDSASPFGRAIKSV
                     HDRLRALIRGRDSLALSVVSLSEGDGKGLLVTALAQQIAATGVPVAVIDTTCGKSGLG
                     EAFGLPVGNMQSLIGRKLNGAALIHDHGSGIDFITPNRQAQEGEWLGELIAQLRPDHR
                     IILVNLPSYAEDKRSALMTRATDTALLVVNADRRDAKATAAMVQVLASFGRKPALAVV
                     SQMASPYAGWIGKHIVAHGWAERIGAHLRAIRVRGREAPSTPMEEQA"
     gene            401466..402713
                     /locus_tag="BSVBI22_RS11990"
                     /old_locus_tag="BSVBI22_B0413"
     CDS             401466..402713
                     /locus_tag="BSVBI22_RS11990"
                     /old_locus_tag="BSVBI22_B0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006237994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_004690137.1"
                     /db_xref="GI:490828047"
                     /translation="MSKIIVRNSITRHLRAALLSSALLLATGGLAAADGNIYRVGAND
                     VLQVTVYGQPALTGLYPVDVDGNIGYPVVGNISVQGLTTLQISEKIASSLSQHIPGLT
                     VTATINQYAPVFVMGDVKAPGKYEFRPGMVALELMALGGGAGKGEAPSVTAGMQLISA
                     QQEYADLQMQITAQTIRRARFEAELKGTDFTYAVPEQTAANKDMVALTRHMVEGERTL
                     FNVRRNNLAAERRALEAQAASYGDEITTLQQSIKLHDTEIQLLQENVNSSKSLVDRGL
                     AAKSSLRDMERDLSSTRRDALELASFLARARQNQLAVEQRIANLDETRRSEAASSLQE
                     IDLNMARMQRRSNSQLEAMAEIAKSSGQISSADMRRKLIFTISRNVNGAYQEIAANER
                     TEIKPGDILRIELDMSKLGGSPS"
     gene            complement(402818..403798)
                     /locus_tag="BSVBI22_RS11995"
                     /old_locus_tag="BSVBI22_B0414"
     CDS             complement(402818..403798)
                     /locus_tag="BSVBI22_RS11995"
                     /old_locus_tag="BSVBI22_B0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-L-fucose synthase"
                     /protein_id="WP_004688933.1"
                     /db_xref="GI:490826843"
                     /translation="MISTAETGREPVYSLTGKKIFVAGHTGMVGSAILRRLQHEDCDI
                     ITAAHSVLDLTRQGPTENFISGHRPDVIIIAAARVGGILANSRFPADFLYDNLAIGMN
                     LIHAAHQIGVERLLWLGSSCIYPRDAAQPLTEDALLTGPLEPTNEAYAIAKIAGLKYA
                     QSCARQFGDRFITAMPTNLYGPNDNFDPTSSHVLPALIRRVHEARMRGAEEVVLWGSG
                     KPLREFLHVDDLADACLHLLRFYNGIEPVNIGSGEEISIKELALTVARIVGYEGRFEH
                     DLSKPDGTPRKLLDTSRIEALGWQPRIRLEDGLRDVYRNWLEETAGSVAA"
     gene            complement(403782..404852)
                     /locus_tag="BSVBI22_RS12000"
                     /old_locus_tag="BSVBI22_B0415"
     CDS             complement(403782..404852)
                     /locus_tag="BSVBI22_RS12000"
                     /old_locus_tag="BSVBI22_B0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-mannose 4,6-dehydratase"
                     /protein_id="WP_004687379.1"
                     /db_xref="GI:490825289"
                     /translation="MQDKTALIVGVTGQDGAYLSELLLGKGYRVHGLKRRSSSFNTAR
                     IDHLYQDPHEEDIRFRLHFGDLTDATNLCRVIQEVQPDEIYNLGAQSHVQVSFETPEY
                     TANADALGTLRLLESMRILGLGKSCRFYQASTSELFGNSSHHAQNEQTPFAPRSPYAT
                     AKLYAYWTTVNYRDAYGFHASNGILFNHESPLRGETFVTRKITRAVAAIERGLQDRLR
                     LGNLEARRDWGHARDYVEGMWRILQEDTPDDYVLATGETHTVREFIEHAFKAVDKQIV
                     WHGDGVDEVGIDRKTGNCLIEIDPRYFRPNEVDFLMGDASKAKDRLGWQHTTGFENLV
                     AEMVDWDLRNIMREVGRNDFYG"
     gene            405116..405313
                     /locus_tag="BSVBI22_RS12005"
     CDS             405116..405313
                     /locus_tag="BSVBI22_RS12005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191869.1"
                     /db_xref="GI:493203706"
                     /translation="MRVVLANRYFYPDQSATSRMVTSLAHALVREGIETSVLASRSYH
                     DRRKETLAARETIDGIEVHRI"
     gene            405428..406366
                     /locus_tag="BSVBI22_RS12010"
     CDS             405428..406366
                     /locus_tag="BSVBI22_RS12010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191872.1"
                     /db_xref="GI:493203709"
                     /translation="MCTDPPLLSVSAALPIRFRRARLVNWVMDLFPETAMELGLIRPD
                     TVSGRLAMALRDWSMRQSALTICPIDRMAHYLAKRDIPAESLGVVHHWADRNEIVPVE
                     PVENPLRRAWGLGRKFVIGYSGNFGRAHEFRTILDAAEWLRHRKSIVFLMIGEGQQRG
                     FVESEVKRRGLANVMMKPFQPVEKLSESLGAANVHLVSLKPELEHCIVPSKFYGVLAA
                     ARPTIFIGDPDGEIGSVVRDFQCGMALRPGDVDALVGAILHLRHSPVSCTTMGNNARY
                     LMETAYSREYGAAMWQAAIGRLEEKAAPSVMPVLDR"
     gene            406387..407622
                     /locus_tag="BSVBI22_RS12015"
                     /old_locus_tag="BSVBI22_B0417"
     CDS             406387..407622
                     /locus_tag="BSVBI22_RS12015"
                     /old_locus_tag="BSVBI22_B0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006640828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_006191874.1"
                     /db_xref="GI:493203711"
                     /translation="MDGSVVVSQLGARMHYAVPRIFASRERLAHFYTDICALQGWPRF
                     FNGLPPTMLPASVRRLVGRIPQGIPQERMTTFPGFGLHSAVRRLSNQTGPKSTANAIW
                     AGKTFGKLVAESGFHGASGLYAFSGEALELLATAKRQGLWTAVEQMIAPRMVVDQLAL
                     EEEALNPGWQHPVANDAHADVFAAREQAEWRIADVVVCPSAFVAHHLAEMGCAAEKIV
                     VVPYGVDDRFLLAPCPRLPGPLRVLTVGAVGLRKGAPYVGAVARMLKGEAQFRMVGPI
                     EIQAEAQVKLAASVELTGAIPRSEMRAQFKWADVFLLPSLCEGSATAVYEALAAGLPV
                     ICTPNTGSVVRHGIDGYIVPIRDVHETAQILRQLADNPALLARMSESARERGADFTVS
                     RYGERLVAALARHDRRQRA"
     gene            407619..408815
                     /locus_tag="BSVBI22_RS12020"
                     /old_locus_tag="BSVBI22_B0418"
     CDS             407619..408815
                     /locus_tag="BSVBI22_RS12020"
                     /old_locus_tag="BSVBI22_B0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_004688937.1"
                     /db_xref="GI:490826847"
                     /translation="MKIIHVIGSYDPAKGGPQAVVVRLAAAQASLGHRVTIVSYSDDA
                     VSRRAAEATAMIPDFDKVQTLLLPMPDIYETFTGGRTANAVTALIRGADFVHLHGIWE
                     TNLLRASMLCRRFHIPYCVCCCGMLDIWSMQQKSWKKRLALKLGFRRMLDGAAFIHAL
                     NRDEIELMRPLGLKAPSLVIPNGVFLNEVEVGDMDVPGLPARRFILFLSRLHYKKGLD
                     ILADAYCRIAPHFRDVDLVVAGPDGGAEDAFRRKIAEYGLQHRVHMPGGLYGLAKIAA
                     LKRAACFCLPSRQEGFSVAITEALACGAPVVITDACHFPEVGEAGAGVVCALNAEMVG
                     DALAGVLEDLDKAAQMGASGARLVRENYTWPRIARQTIEAYQMYRARKAEPVKGENPF
                     RTIPAA"
     gene            complement(408886..409608)
                     /locus_tag="BSVBI22_RS12025"
                     /old_locus_tag="BSVBI22_B0419"
     CDS             complement(408886..409608)
                     /locus_tag="BSVBI22_RS12025"
                     /old_locus_tag="BSVBI22_B0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004681766.1"
                     /db_xref="GI:490819668"
                     /translation="MKSVILASIAAMFATSAMAADVVVSEPSAPTAAPVDTFSWTGGY
                     IGINAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGA
                     ETDFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGK
                     VKSAFNLGDDASALHTWSDKTKAGWTLGAGAEYAINNNWTLKSEYLYTDLGKRNLVDV
                     DNSFLESKVNFHTVRVGLNYKF"
     gene            complement(410005..410619)
                     /locus_tag="BSVBI22_RS12030"
                     /old_locus_tag="BSVBI22_B0420"
     CDS             complement(410005..410619)
                     /locus_tag="BSVBI22_RS12030"
                     /old_locus_tag="BSVBI22_B0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_004687375.1"
                     /db_xref="GI:490825285"
                     /translation="MTITQSGSPHSIAGRKQTSRPLEGGATFTLKHRLQRLLWQAAWL
                     ALAAWTPSCLWRWRGMVLNAFGADIHKSAIVRASAHIWWPGNLSMGAHSSLGPGAICY
                     NVAPVTLAPFAIVSQRAHLCTAGHDIDQASFPLTAAPIHIAAYGWVAAEAFVGPGVHI
                     GEGAVLGARSVSFRDLDAWAVYTGNPAKPVRQRRKNTDYSIHRF"
     gene            complement(410631..411320)
                     /locus_tag="BSVBI22_RS12035"
     CDS             complement(410631..411320)
                     /locus_tag="BSVBI22_RS12035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006279264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073545.1"
                     /db_xref="GI:492971722"
                     /translation="MFLLAFWFYRRMVVPRIVMFLGILTGTFLMTSMGDYRHVTRAAS
                     GFVLDQILDIDYAANFNETLERGGPEMRNAVQRIDELDRRLEFDYGKFHWNRIVFTFV
                     PAQLVGGGVKASLYLDTPKPSREYNPPTGTTDTGLVDAFASFWYFGALKFLLLAWMIR
                     RLWETAMAGEMLGQLLYMFSIVPAMHAISHQTDWVVPVWIHMALFLIPILSLCVIRNR
                     SVYLPMSPQLS"
     gene            complement(411417..411893)
                     /locus_tag="BSVBI22_RS12040"
     CDS             complement(411417..411893)
                     /locus_tag="BSVBI22_RS12040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006133754.1"
                     /db_xref="GI:493096779"
                     /translation="MNLSLTWIFAGLVLCFLATGFLSRPERMYQFPFLAGVMTFGFIL
                     PQLPALVNDPFFPDGAYAKTMTMGIFSLAMLALGWSLTRKPIRLLSMRFSERRLLRAA
                     AGLSIFGAIFYFLLSRLPGDISIGTQMTGMPVVYLFFAQLMPYGLGIALLCYARKS"
     gene            complement(411890..412507)
                     /locus_tag="BSVBI22_RS12045"
                     /old_locus_tag="BSVBI22_B0422"
     CDS             complement(411890..412507)
                     /locus_tag="BSVBI22_RS12045"
                     /old_locus_tag="BSVBI22_B0422"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin-(acetyl-CoA-carboxylase) ligase"
                     /protein_id="WP_006191877.1"
                     /db_xref="GI:493203714"
                     /translation="MTLYAFPCAILVGLAAMFFSQPLLTLQDDGRPADVIIVPGGDGA
                     PRAAQAAQLWKDGRSPYILATGDGDCLLNKHIMMAKGVPPSAILVECRSGSTWQNARF
                     SAPLLRRLHAKSALIVTNWFHSRRAVASFRTACPQMHFTSSPVADADMPGGFPGTPPV
                     IEHVVKEYAKLGWYLISGRIRPQNLTDSGPAMAFASVYNTTEAGL"
     gene            complement(412504..413385)
                     /locus_tag="BSVBI22_RS12050"
                     /old_locus_tag="BSVBI22_B0423"
     CDS             complement(412504..413385)
                     /locus_tag="BSVBI22_RS12050"
                     /old_locus_tag="BSVBI22_B0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_006191880.1"
                     /db_xref="GI:493203717"
                     /translation="MTVSVLIMTLNEEANLPACLASLDWCDDIVVLDSFSTDRTVEIA
                     RAAGARIYQRAYDTEDRQRMYGLTEIEFRHAWVYTPDADEITPPDLRDEMLAIAADPD
                     RPEVFFKARYKNMFMGRWIRHASLYPTWITRLVRPDRVHFERSVHSRASGGPGGELQA
                     HFIHYSSNKGLAAWYDKHNRYSSVEADLAASKRLERHIDWGGLLSGEPERRRRTLKSL
                     SYNLPFRPSLRFLYMYILRGGFLDGKPGYLYCRLLAAYEFMIVVKTEEHRRKQSAMPQ
                     APARRPLDAKEPERHMV"
     gene            complement(413382..414509)
                     /locus_tag="BSVBI22_RS12055"
                     /old_locus_tag="BSVBI22_B0424"
     CDS             complement(413382..414509)
                     /locus_tag="BSVBI22_RS12055"
                     /old_locus_tag="BSVBI22_B0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="WP_006191882.1"
                     /db_xref="GI:493203719"
                     /translation="MTSLSWITLLAFVLSVAFSFCMAFRGLAREWYLIDLPDYRKRHE
                     GAVPLCGGTAIFLSFFLTASLVKDGAGHADALVMMPGLTIILGTGVLDDRFRLPVTPR
                     FAIQLFAAVLIIAMAGVQQVFLDLNPSFIDDSGNIFAFERLGGPFLLLFAVAFIVGLV
                     NAVNMSDGVDGLAGSASAASFFWLAVISFDIGEHRLGLQSLALVAACLGFLVFNMRHR
                     WRAKASLFLGDGGSTLLGAALAGMVLILSSGRQAIAFPVLLWIVIVPVLDTLSLIVRR
                     LAARRSPFSADRQHLHHLLMDAGLTCGQTAIIVMALNLIAGATAYTAIRLDLPGWLMA
                     LALLAPAMAHLAFILRCTRGPRIADPAQAAKPNITFPGTTT"
     gene            414802..416295
                     /locus_tag="BSVBI22_RS12060"
                     /old_locus_tag="BSVBI22_B0425"
     CDS             414802..416295
                     /locus_tag="BSVBI22_RS12060"
                     /old_locus_tag="BSVBI22_B0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="WP_004687370.1"
                     /db_xref="GI:490825280"
                     /translation="MNRHRKGFIIATLEQYAGLMSNFLTMVAVSRLLGPAETGIGVVG
                     LGIAAIFFSMREFASAEFLIKIDKVEDRDVRTSLTLVMLATLILAAGLYLARDYLATS
                     YRDPSLMLFLNITIVAALVESASFPVVALLRREMAFGVLAWIRTAGSTCGAATTISMA
                     YLGFGHMSFAFGALSAALITTGFAFKAYPMKHLLRPSLASIGTAWQFGLYLGSSAGLN
                     KICETFPQLILGKFMSAASVGIYSRAGAVSGVPDRIFLSSIFTVAFPMLSAQVREGAD
                     IRRSYVQALSYISVVYWPAQAVVALLAYPAVHIILGKGWMEAAPIVALSSLASLFWFP
                     VILTYPLLMALGANRDAFLSNFISRAFSAGILCCAAFYGLMAVVLSQFISLPLQMVVS
                     FVYVHRHVQFSYRLLGLALLRSALVTFLTLLLPLGLVAADGFSLEIHWAKGILIGIVS
                     VLCWLAAVLATRHPFSAEVLPVLGWFGGKVTARLGLQGRRNMAAPAE"
     gene            416311..417324
                     /locus_tag="BSVBI22_RS12065"
                     /old_locus_tag="BSVBI22_B0426"
     CDS             416311..417324
                     /locus_tag="BSVBI22_RS12065"
                     /old_locus_tag="BSVBI22_B0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_004681784.1"
                     /db_xref="GI:490819686"
                     /translation="MSGPSVDVVIPNYNYARYLRVCAESVLSQDMEKLRLLIIDNAST
                     DNSVAVAREIAAADPRVELLLRPVNKGPHASFNDGIDWAGADYFVLLFADDVLTPGAL
                     QRAVSLMQHDRTIAFTYGRDIAIAGDAPMPELPLQPKAPPYRVETGRAFIERFCRLGV
                     FQIPAASLVVRTSAQKAAGHYSEALPHSDDYHMWLRLALRGRVAALDCIQVGLRTHGQ
                     NRSQQLLKDSQLQHILHTAHAGEYFFAHEGRALPDCDVLDGMLQKGIAERAYWSAMSH
                     FLRGDARGMQLFRFAFSRRLQTAFLPPVNYLLHRPDTARRLKRFFGGLPAKAFPVSAR
                     NGG"
     gene            complement(417280..418521)
                     /locus_tag="BSVBI22_RS12070"
                     /old_locus_tag="BSVBI22_B0427"
     CDS             complement(417280..418521)
                     /locus_tag="BSVBI22_RS12070"
                     /old_locus_tag="BSVBI22_B0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="WP_004687368.1"
                     /db_xref="GI:490825278"
                     /translation="MKIGLFGQFGSGNTGNDGSLEAMLQMLARACPDADIVCICSRPE
                     IIAEKFHIAATPVGREPFVNGLLRRIDKALLQLPRRLSGFIAAVSIAQGLDLIIVPGT
                     GILDDFSENPFGWPFVIMRWSLAARLGGAKFAFVSIGAGPVVQPLSRFFVRVASRLAA
                     FRSYRDNVSYEFMQTLGINTRIDTVTADIAFALPVPDAGSKATAGRRCIGLGVMTYRG
                     WKKDSAQAPVIYETYLDKMADMAEGLLASGYRIRLLTGDISDLMAVDDLMARLAAPAR
                     ANIVFEPVTSLNGLMQQIAHTDIVVASRYHNIVCALATGRPAISLGYAAKNDALLHDA
                     GLDRFCHHIEDFDPQTVLMQVRQMFANLEQLREGVEAGVARYRLHLARQEEVLRTSLL
                     AGMPMEELTSVPGRYRESFRR"
     gene            418788..420017
                     /locus_tag="BSVBI22_RS12075"
                     /old_locus_tag="BSVBI22_B0428"
     CDS             418788..420017
                     /locus_tag="BSVBI22_RS12075"
                     /old_locus_tag="BSVBI22_B0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006277600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_004688941.1"
                     /db_xref="GI:490826851"
                     /translation="MKCAYFVRPHIGGTYSVFTRLRASLARSGMDLRWLAAGAPGEAV
                     AVPREQGLEDAMRRGDIIDRMGVLDEETRAKRFVDFLRENRFEAVFVNVLSHRFETNL
                     VRYLPADILRVMIVHSITPGTYAAAQAIRDHVHATVGVSKRCRDDLVRGYGFDPSRTL
                     VIPNGLTPDPHVRCAAPEIEGGRLRLLYLGRIDDSSKGVFWLPAILRRLQCDYHLTVA
                     GDGPDLAALRIKLAPFGNRISFTGWVAPSDVSWLVSQHDVMVMPSRYEGFGSTLIEAM
                     SQGCPVVASRIPGVTDTIVTDGEDGFLFPIGNCRQAAQQIERLAADPRLRVAMGAAGV
                     RKVIAEFDSEIVGRAYAGLLQHLRENRPPITPPLALSQWSMPNALHKNLRSRLPQPVK
                     NWLRRVRERVHTVWSTA"
     gene            420055..421416
                     /locus_tag="BSVBI22_RS12080"
                     /old_locus_tag="BSVBI22_B0429"
     CDS             420055..421416
                     /locus_tag="BSVBI22_RS12080"
                     /old_locus_tag="BSVBI22_B0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687366.1"
                     /note="catalyzes the formation of 5-aminovulinate from
                     (S)-4-amino-5-oxopentanoate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="WP_004692358.1"
                     /db_xref="GI:490830272"
                     /translation="MNLFTSQFRNSQLLASKAHALIPGGCHTYAKGDDQYPVLAPGFI
                     QRGSGAHVFDVDGHEYIEYGMGNRAVGLGHAYPPVVRAVREALQDGCNFTRPSAIELD
                     CAESFLELIEGAEMVKFCKDGSDATSGALRLARAYTGRDMVACCADHPFFSTDDWFIG
                     TTKMSAGIPASVSALTATFRYNDIASVEALFEDYPGRIAAIIMEPARADEPQDNFLHE
                     AMRIAHENGALFILDEMITGFRWHMRGAQKLYGIVPDLSCFGKALGNGFAISALAGKA
                     EYMRLGGLHHTDFPRVFLLSTTHGAETHAMAAAIATMAIYRDEPVIERLYEQGAKLAA
                     GINEAIAGHRLQDHVRLSGRPCCLTYSTLDGNGMPSQAFRILFLQETIRRGVLMPSLV
                     VSYTHSDADIARTIDAVHGALGIYVRALNDGVESCLVGRPSQVVYRRFNEDPASSCPP
                     PRL"
     gene            421395..422729
                     /locus_tag="BSVBI22_RS12085"
                     /old_locus_tag="BSVBI22_B0430"
     CDS             421395..422729
                     /locus_tag="BSVBI22_RS12085"
                     /old_locus_tag="BSVBI22_B0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004690145.1"
                     /db_xref="GI:490828055"
                     /translation="MPTAKIVRGIALFLLAFAMTGGARAIAADTQFPLQVSGDRHRLQ
                     DAAATPCLLMGDAAWSLIAELRRDEAEAYLQDRRRRGFNAVLVNLLEHQFARNAPANT
                     YGDRPFKARAFGALNPQYFDHAAWVIGRAEALGITVFLASAYLGANGGGQGWYMAMEM
                     AGPKRMRAYGEVIARRFAGYRNIIWVLGGDFDAPDKRLVSSLAEGIAAVLPDAIQTVH
                     SSRDTDTARHWAGAGWLALDTVYDYDDVHKAVLARTAGAEMPVILLETLYENEHGTDA
                     GTIRRNAYGALLAGAAGQFFGNSPIWHFSAPGLFDSGGNWRKAPDSPGARSMGVLQNL
                     FSRLDWTKLQPDREKKITDRPGFYAARLPETGLAVIYGENGFALRKGAVDAGDAALWF
                     DPASGKTIVAGAPARENDLLVYHPPASRNADGHSDWVLLIGRMERLAFLQKE"
     gene            422850..423911
                     /locus_tag="BSVBI22_RS12090"
                     /old_locus_tag="BSVBI22_B0431"
     CDS             422850..423911
                     /locus_tag="BSVBI22_RS12090"
                     /old_locus_tag="BSVBI22_B0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006641549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_004692356.1"
                     /db_xref="GI:490830270"
                     /translation="MKVLVTGSQGYIGSVMVPMLIDAGHEVSGYDIGLYEHCLFKEGG
                     TVMNVPTIRKDVRDVSPRDLEGFDAVIHLAALSNDPLGNLNEDLTYAINHHASVAMAK
                     AAKLAGVGRFLFASSCSNYGISDAELIDETGELKPVTAYGRSKVRAEQEIRKLADASF
                     CPVYLRPATAYGVSPFLRFDIVLNNLVAWAVTKGLIYLKSDGTPWRPIVHIHDISRAF
                     MAAMEAPREKVWNEAFNVGSTAHNYRIRDIAGVVADNVPDCRIEYAQDAGPDTRSYRV
                     SFEKLAHVLPEAKPQWDAVAGTRELLAAYSRSTLTVEEFEGPRFQRIAHIRKLIAQGV
                     LDADLRRMDAHSHPLRAMA"
     gene            423908..425263
                     /locus_tag="BSVBI22_RS12095"
                     /old_locus_tag="BSVBI22_B0432"
     CDS             423908..425263
                     /locus_tag="BSVBI22_RS12095"
                     /old_locus_tag="BSVBI22_B0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014489586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_006643223.1"
                     /db_xref="GI:493693326"
                     /translation="MMDSGAPGRAGGAAMAAPQPDGAAIHRLAARLYPICRSLAGDGV
                     RETLAIIGEYLPLHIHEVPTGTPLYDWKAPQEWIIREACIADLAGRRIVDFARHNLHV
                     VNFSMPVRARMSLDALKNHIHTLPDQPDLIPYRTCYHGESWGFCMAHNALLAMEDGEF
                     DVVIDAERRDGSLVFGEFIHRGQTDATFLLSAHLCHPSLANDNCSGLALLALLGEAMK
                     SRRTRLTYRLLFGPATFGALAWLRQNEDNLDHVRHGLVLSCLGDGGGPNYKRSRRGNA
                     EIDRIMDHVLAHCGLSGAAMHDFWPYGYDERQFCSPGFNLPVGMFQRSLYGRFPEYHT
                     SADNLDFIKPEYLEQSFNMVMQTIEIAERNWVPLNMSPKGEPQLGRRGLYGSMGGDSR
                     AAQNAMAMLWVLNLADGGYSILDMAERSKLPFAMLADAADRLRDAGLIKETASQDLFA
                     K"
     gene            complement(425226..425750)
                     /locus_tag="BSVBI22_RS12100"
                     /old_locus_tag="BSVBI22_B0433"
     CDS             complement(425226..425750)
                     /locus_tag="BSVBI22_RS12100"
                     /old_locus_tag="BSVBI22_B0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="WP_004687362.1"
                     /db_xref="GI:490825272"
                     /translation="MHFTPLNINGAWSIEPERLKDERGWFARVYCEAAFAERKLETHF
                     PQHSLSFSREKGTLRGLHYQNEPHSETKLVTCLQGIVWDVLVDLRPHSPTYRRWAGVE
                     LSAENGVQLYIPEGCAHGFQTLTDDVLIRYMISKPYAPDHAAGIRYDDPALDIPWPEK
                     PSVISQKDLGWPFL"
     gene            426071..427372
                     /locus_tag="BSVBI22_RS12105"
                     /old_locus_tag="BSVBI22_B0434"
     CDS             426071..427372
                     /locus_tag="BSVBI22_RS12105"
                     /old_locus_tag="BSVBI22_B0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_006191890.1"
                     /db_xref="GI:493203727"
                     /translation="MTIQAADISRDHSTVQARTGCRLCGKPLRHSFVDLGMSPPCESF
                     VTAERLDHMEPYYPLHAQVCDHCFLVQLKEYFSPADIFTEYAYFSSFATSWVSHAKNY
                     CDEITERLELNDNSFVVEIASNDGYLLQHFLPKNIPILGIEPAANVARTAIAKGVPTL
                     VDFFGSRLALEMIGEGRKADLIIGNNVLAQVPDLNDFVRGMQLLLKPEGVITLEFPHL
                     VNLIEQNQFDTIYHEHFSYFSLLTIRFMAQHHHLKVIDVEELPTHGGSLRVYLAHHGS
                     KRKVGPRVASLLKREESFGLNEISTYEQFAEKTRRTKRDLLSFLIAAKNAGKRICGYG
                     APGKGNTLLNYCGIGTDFLGFTVDRNPYKHGRFTPGMHIPIYDVSAIDNYRPDYILIL
                     PWNFKDEIIRQMQHVVEWGAKFIIPIPHVTLIDPALVTEER"
     gene            427375..428184
                     /locus_tag="BSVBI22_RS12110"
                     /old_locus_tag="BSVBI22_B0435"
     CDS             427375..428184
                     /locus_tag="BSVBI22_RS12110"
                     /old_locus_tag="BSVBI22_B0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate cytidylyltransferase"
                     /protein_id="WP_004687361.1"
                     /db_xref="GI:490825271"
                     /translation="MKVVLFCGGLGTRIREYSENIPKPMIPLGHQPILHHVMEYYSDY
                     GHNDFVLCLGYKANVVKDFFLTIRPQTFADCVVSDGGRNVQLLEEVDRDWSVTLLDTG
                     IWRNIGERLWSARSHVMNEDIFLANYSDGLSDVDLDDMTQRFRASGKVACFLAVRPPL
                     TYHLADIAEGGDVRAFRTSNTSDIWINGGYFLFRKEIFDYMREGEELVLEPFSRLIAE
                     NQLMAYKYDGFWRSMDTLRDWQTLEDMVEKGDMPWKKHKAEQRAANIAIAL"
     gene            428181..428837
                     /locus_tag="BSVBI22_RS12115"
                     /old_locus_tag="BSVBI22_B0436"
     CDS             428181..428837
                     /locus_tag="BSVBI22_RS12115"
                     /old_locus_tag="BSVBI22_B0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GlcNAc-PI de-N-acetylase"
                     /protein_id="WP_004690147.1"
                     /db_xref="GI:490828057"
                     /translation="MIDLCALANPGRPLELLCLGAHSDDIEIGCGGTLLHLIETGTPL
                     HVEWCVLSGNEQRRAEAEASARDFLRGMDRFQLHVASLADSYFPAESRAIKEWLIAQR
                     GRGQPDIVFTHYHGDAHQDHRTVNELTWNLFRDQLILEYEIPKWDGDLGRPNAYSALP
                     ASIMERKIDLLMKHFGTQRSKDWFGPETFRGLARLRGMECRAPETYAEAFHARKLRLF
                     "
     gene            complement(429033..430313)
                     /locus_tag="BSVBI22_RS12120"
                     /old_locus_tag="BSVBI22_B0438"
     CDS             complement(429033..430313)
                     /locus_tag="BSVBI22_RS12120"
                     /old_locus_tag="BSVBI22_B0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_004690148.1"
                     /db_xref="GI:490828058"
                     /translation="MGYFPSWRLTSNAVVLPDERLPAAAAVPMGIQHLLAMSGSTIVA
                     PLLMGFDPNVAVFFSGIGTLLFFLITAGRVPSYLGSSFAFIAVVIAATGYSGSGPNPN
                     IAIALGGIIACGAFYSLIGLIVMFLGTGWVEKLMPPAVTGAIGVSIGLNLAPVAIGQL
                     KGTGAHTSIALLTVLCMAMISAYGPRGTRRLSVLFALLFGYLLVLIAGNGLGIVPGID
                     FTAVKNAAWFGLPHFTTPAFNWQAVTLIAPVAIVLVAENLGHIKALGSITGRNMDGYI
                     GRGFFSDGLATMISGAGGGTGVTTYAENIGVMAMTKVYSTLIFVIAAIMALILGMSPK
                     FGAILQTIPAPVLAGLAVSVFGLIASAMARIWIVNKVDFADSRNLFTVGVALIFGAGD
                     FTLNIGNFALGGIATSTLAALVLYQLLGIGRSDS"
     gene            complement(430430..431926)
                     /locus_tag="BSVBI22_RS12125"
                     /old_locus_tag="BSVBI22_B0439"
     CDS             complement(430430..431926)
                     /locus_tag="BSVBI22_RS12125"
                     /old_locus_tag="BSVBI22_B0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8FWK8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="WP_006191892.1"
                     /db_xref="GI:493203729"
                     /translation="MSGYILAIDQGTTSTRSMLFDRNMRVVGLGQQEFTQHFPSSGWV
                     EHDAEEIWKSVQSTIRIALAQAGISAADVAAIGITNQRETTVVWDRISGKPVHRAIVW
                     QDRRTAQFCDELKRRNLEPLFTEKTGLLLDPYFSGTKLAWLLNHVPGLRERAQKGQVC
                     FGTIDSWLIYKLTGGKAHVTDATNASRTLIYHIGENRWDDELLDILGIPAAMLPEVKD
                     CAADFGMTDPALFGVSIPILGVAGDQQTAVIGNACFEPGMMKSTYGTGCFALLNTGTD
                     RVTSSNRLLTTIAYRLDGVTTYALEGSIFIAGAAVQWLRDEMGFISVVSEVSALAEKA
                     DPNQRIYLVPAFTGLGAPYWDAEARGAIFGLTRGTGRAEFARAALESVAYQTFDLLEA
                     MQGDWKGATNHTVLRVDGGMVASDWTMQRLADILNAPVDRPVFLETTVLGAAWLAASR
                     AGIWPDRKGFSERWQRDCRFEPAMPEKERESAIAGWRDSVSRCLTRPQ"
     gene            complement(432053..433354)
                     /locus_tag="BSVBI22_RS12130"
                     /old_locus_tag="BSVBI22_B0440"
     CDS             complement(432053..433354)
                     /locus_tag="BSVBI22_RS12130"
                     /old_locus_tag="BSVBI22_B0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_006191895.1"
                     /db_xref="GI:493203732"
                     /translation="MSRIEDRSLNGIAAADNGLTLVEMPEEAKTYLTKGMPAYRNASL
                     ALFLSGFATFSLLYCVQPLMPLFAKDFSITPTASSLSLSLSTGFLAFAIFFAAIIAER
                     FGRKSLMFASLLGSALCTIGCAVVPDWHMLLALRSLQGLLLGGVPAVAMSYLAEEIDP
                     RGLGASKGLYIAGNVFGGMAGRVITGTLAEYYSWRPALAVMGLLGLAAAIGFWALLPT
                     SRNFTPRTGLGARFHVSAWLSHLRNPALPMLIAIGFLVMGSFVTIYNYIGFRLIEPPY
                     NLSQTELGFIFTVYLFGIAASWSAGRIGDRLGHFTMLPIALAVEAAGCLLTLSASLPI
                     IVGGIIFLTVGFFMSHSVASALVGRLALEIKGHASSLYLLAYYLGSGIAGSAGGYFWT
                     ADGWWAVADFTFAMLALAFAAALAAAWFAREGQTDKPGLTF"
     gene            433459..434346
                     /locus_tag="BSVBI22_RS12135"
                     /old_locus_tag="BSVBI22_B0441"
     CDS             433459..434346
                     /locus_tag="BSVBI22_RS12135"
                     /old_locus_tag="BSVBI22_B0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002966181.1"
                     /db_xref="GI:489056039"
                     /translation="MELRHLRYFLAVAEEGNFTRAAAKLGIGQPPLSQQIRDLENEIG
                     VMLFHRVPHGAELTAAGAAFLEEATATIASSEKAKLAAQRAARGESGRLSLGFTASSA
                     FNPIVSGAIRHFRAKWPEVELFLTEMNTNLLIERLVRGELDTAFIRPGLEDPANVRMK
                     RLADEPMLVALPSHHRLAVYERLPLSALAGEPFVLFPRIVGLSLYDDIAAACRMAGFE
                     MNVTQEAPQMPSVVNLVAANLGVSIVPAAIAQIRLDGVTYRPIEGEPLVARLALASMK
                     SLRSPVHDNLISLLPRECI"
     gene            434431..434871
                     /locus_tag="BSVBI22_RS12140"
                     /old_locus_tag="BSVBI22_B0442"
     CDS             434431..434871
                     /locus_tag="BSVBI22_RS12140"
                     /old_locus_tag="BSVBI22_B0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P65448.1"
                     /note="this stereospecific enzymes reduces the R isomer of
                     methionine sulfoxide while MsrA reduces the S form;
                     provides protection against oxidative stress; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase MsrB"
                     /protein_id="WP_004681816.1"
                     /db_xref="GI:490819718"
                     /translation="MKYQKSAEAIAKLSAEQYRVTQENGTERPGTGEYLYNKEPGIYV
                     DIVSGEPLFASSDKYESHCGWPSFTKPIERANVTELTDMSHGMVRTEVRSAHGDSHLG
                     HVFPDGPVDRGGLRYCINSASLRFVPKDRMEAEGYGDYLDQVEG"
     gene            complement(434872..435999)
                     /locus_tag="BSVBI22_RS12145"
                     /old_locus_tag="BSVBI22_B0443"
     CDS             complement(434872..435999)
                     /locus_tag="BSVBI22_RS12145"
                     /old_locus_tag="BSVBI22_B0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_006191899.1"
                     /db_xref="GI:493203736"
                     /translation="MLLTDTQEQIREAARDFAQERLAPGAAARDREHAFPRAELTEMG
                     ALGFLGMLVPEEWGGSDLGMVAYALALEEIAAGDGACSTIVSVHSSVGCMPILRFGTE
                     DQKRRFLPKMACGEWIGGFALTEPQAGSDASALKTRARLDGDHYVIDGSKQFITSGKN
                     GNVVIVFAVTDPAAGKKGISAFIVPTDTPGYEVMSVEHKLGQHSSDTCALGFTNMRAP
                     VENRLGAEGEGYKIALANLEGGRIGIAAQAVGMARAAFEAARDYARERITFGKPIIEH
                     QAVAFRLADMATRIETARQMVLRAAALREAGKPCLTEASMAKLVASEMAEQVCSAAIQ
                     IHGGYGYLADYPVERIYRDVRVCQIYEGTSDVQRLVIARGL"
     gene            complement(435999..437189)
                     /locus_tag="BSVBI22_RS12150"
                     /old_locus_tag="BSVBI22_B0444"
     CDS             complement(435999..437189)
                     /locus_tag="BSVBI22_RS12150"
                     /old_locus_tag="BSVBI22_B0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510413.1"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_004692348.1"
                     /db_xref="GI:490830262"
                     /translation="MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGA
                     GLAPEAVEEVIMGCVLPAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAH
                     DLILAGSADVIVAGGMESMTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRL
                     MGTFAEDCAEAYQFTREAQDAFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVT
                     IDEQPGKAKLDKIPTLRPAFREGGTVTAANSSSISDGAAALLLMRASEAEKRGLTPHA
                     VITGHATYADKPNLFSTAPIGAIRKLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLD
                     LPHDKVNIHGGACALGHPIGASGARILVTLLAALETHGLKRGIAGICLGGGEATAMGI
                     ERII"
     gene            complement(437258..438025)
                     /locus_tag="BSVBI22_RS12155"
                     /old_locus_tag="BSVBI22_B0445"
     CDS             complement(437258..438025)
                     /locus_tag="BSVBI22_RS12155"
                     /old_locus_tag="BSVBI22_B0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxy-2-methylbutyryl-CoA dehydrogenase"
                     /protein_id="WP_004690152.1"
                     /db_xref="GI:490828062"
                     /translation="MQIENRVFLITGAGSGLGAAVSKMAVEAGAKVVLLDVNAEAGEA
                     GAKALGASARFQRTDVASDTDGKAAIAAAIEAFGRIDVLVNCAGVAPGEKVLGREGAH
                     KLETFTRTISINLIGTFNMLRLAAEAMAKNEPGQGGERGVIINTASVAAFDGQIGQAA
                     YSASKGGVAAMTLPVARELARHGIRVMTIAPGIFKTPMMAGMPQEVQDALGASVPFPP
                     RLGEPAEYAALVHHIVENQMLNGEVIRLDGALRMAAK"
     gene            complement(438038..439708)
                     /locus_tag="BSVBI22_RS12160"
                     /old_locus_tag="BSVBI22_B0446"
     CDS             complement(438038..439708)
                     /locus_tag="BSVBI22_RS12160"
                     /old_locus_tag="BSVBI22_B0446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-binding protein"
                     /protein_id="WP_006191900.1"
                     /db_xref="GI:493203737"
                     /translation="MTESPASARLDRYDDAVAQFDIAKAIALLAGNPDTGINACIECC
                     DRYTGENRVALRAISIDNTLTELTFEDLRDMSARVGNMLADAGISAGDVVAGLLPRTP
                     ELVATILGAWRIGAIYQPLFTAFGPKAIEQRFGTSGAKLVVTNLANRSKLAEVENCPR
                     VATILAPGESLPEGDIDFRAAVAAASTECEPVMRKGSDLFMMMSTSGTAGLPKGVPVP
                     LRALMAFGAYMRDAVGLRSDDIFWNIADPGWAYGLYYAVTGPLLLGVPTILNEGGFTA
                     ENTYDIIERLGVTSLAGSPTAFRLLMAAGPESAARVKGRLRVVSSAGEPLNPEVIRWF
                     DACLGAPIHDHYGQTELGMVVNNHHGLEHPVRQGSAGYAMPGYRVAVLDEAGKEVGPN
                     EPGVLAIDIDNSPLLWFTGYYKKDTPSISGGYYRTGDTVEFEPDGSISFIGRADDVIT
                     SSGYRIGPFDVESALLKHPAVNEAAVVGVPDPQRTEIVKAFVILAPGFEGTPELAEEL
                     ALHVKKQLSAHAYPRQIDFVAELPKTLSGKIQRFLLRKAEVEKQQQQN"
     gene            439835..440818
                     /locus_tag="BSVBI22_RS12165"
                     /old_locus_tag="BSVBI22_B0447"
     CDS             439835..440818
                     /locus_tag="BSVBI22_RS12165"
                     /old_locus_tag="BSVBI22_B0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014299757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_004688949.1"
                     /db_xref="GI:490826859"
                     /translation="MERHNITPGFVEDALESVRQRGLDTAPLMAAAGLPQKVREPVTN
                     VQYGRLWWLIAQTIDDEFFGLAARPMRPGSFDLLCHAVLHAGTLERALRRALQFLNVV
                     LDDPRGELRIRDGMAHIVLTDAAGHRPAFAYRAYWLILMGVACWLVGRRIPLRTLDFA
                     CPAPVHRQDYHKFFGAPVLFDQPATRLVFSSTYLALPIIRSDVALENFLREAPANILI
                     RYRHDHDISSRVRAQLNALPAQEWPSFDDLAKGLRMSAPTLRRRLKAEGQSFGTIKDE
                     LRFVIAQKLLQEKKLSIAEVAAELGYSEPSAFYRAFQKWVGRSPGQFRVEP"
     gene            complement(440872..440997)
                     /locus_tag="BSVBI22_RS12170"
     CDS             complement(440872..440997)
                     /locus_tag="BSVBI22_RS12170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein"
                     /protein_id="WP_002970716.1"
                     /db_xref="GI:489060662"
                     /translation="MNERKADVNTMFRIEPIWRSLLALQPFIYTPALALNFEKSV"
     gene            441042..442280
                     /locus_tag="BSVBI22_RS12175"
                     /old_locus_tag="BSVBI22_B0449"
     CDS             441042..442280
                     /locus_tag="BSVBI22_RS12175"
                     /old_locus_tag="BSVBI22_B0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoglycerate dehydrogenase"
                     /protein_id="WP_002967316.1"
                     /db_xref="GI:489057196"
                     /translation="MTERLSLSRDRINVLLLEGISQTAVEYFKSSGYTNVTHLPKALD
                     KADLIKAISSAHIIGIRSRTQLTEEIFAAANRLIAVGCFSVGTNQVELKAARKRGIPV
                     FNAPFSNTRSVAELVIGEIIMLMRRIFPRSVSAHAGGWEKTAIGSREVRGKTLGIVGY
                     GNIGSQVGNLAESLGMTVRYYDTSDKLQYGNVKPAASLDELLKTSDVVSLHVPSSKST
                     SKLITEAKLRKMKKGAFLINNARGSVVDLEALAKVLQEGHLAGAAIDVFPVEPASNGE
                     RFSTPLQGLENVILTPHIGGSTEEAQERIGTEVTRKLVEYSDVGSTVGAVNFPQVQLP
                     PRPTGTRFMHVHENRPGILNSLMNVFSHHHINIASQFLQTDGEVGYLVMEADGVGEAS
                     DAVLQEIREIPGTIRARLLY"
     gene            complement(442333..442827)
                     /locus_tag="BSVBI22_RS12180"
                     /old_locus_tag="BSVBI22_B0450"
     CDS             complement(442333..442827)
                     /locus_tag="BSVBI22_RS12180"
                     /old_locus_tag="BSVBI22_B0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006641743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase-like"
                     /protein_id="WP_002966173.1"
                     /db_xref="GI:489056031"
                     /translation="MTVRLIVKYPDPRLRAAAEPVTTFDEGLRKLADDLLDTMRAAPG
                     IGITAPHIGISKRVVVLELDRAAGPKIYINPEIVWACEEKIRHQEGSVSMPGVVDEVE
                     RHARIRLRYQDLDGNEQTEESDGLLAVCHQHEIDQLDGIFWVQRLSRLRRERLIKRYE
                     KLQR"
     gene            complement(443573..444514)
                     /locus_tag="BSVBI22_RS12185"
                     /old_locus_tag="BSVBI22_B0451"
     CDS             complement(443573..444514)
                     /locus_tag="BSVBI22_RS12185"
                     /old_locus_tag="BSVBI22_B0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_004681829.1"
                     /db_xref="GI:490819731"
                     /translation="MASGLFALLDDIAAIAKMAAASLDDVAGQTAKASAKAAGIVIDD
                     TAVTPKYVVGLTPERELPVIWKITKGSLRNKLIFLLPIALVLGYFAPDFIMPLLMLGG
                     IYLAFEGTEKLVEFFLPHDEEEHSETQGNSAREIEASTVAGAIRTDFILSAEIMALTL
                     AGLPPSSIFTQAIILAAVGILITFAVYGVVGIIVKLDDMGASLFMHSHTSVGRKLGKG
                     LVGAMPVLLETLSSVGTIAMLWVGGSIIVHGLASLGFHTVEEFIRSVAQAIPAERFPF
                     PEAVRWVVTSFLQAVLAVLTGLVAVVIVHLAKRIARR"
     gene            444827..445150
                     /locus_tag="BSVBI22_RS12190"
                     /old_locus_tag="BSVBI22_B0452"
     CDS             444827..445150
                     /locus_tag="BSVBI22_RS12190"
                     /old_locus_tag="BSVBI22_B0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_004690154.1"
                     /db_xref="GI:490828064"
                     /translation="MDTRLVMREQMEARANEVAELLKTLSHPARLMLACTLAEGEYSV
                     GELEEMLGIRQPTLSQQLGVLREADIVETRREAKQIYYRLVETKAAKLIDALYGIFCK
                     EGTDS"
     gene            445150..445557
                     /locus_tag="BSVBI22_RS12195"
                     /old_locus_tag="BSVBI22_B0453"
     CDS             445150..445557
                     /locus_tag="BSVBI22_RS12195"
                     /old_locus_tag="BSVBI22_B0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011005712.1"
                     /db_xref="GI:499315220"
                     /translation="MALYMQALLGGMLIGLSAVLLLLLNGRVAGISGIVGRLLDGKQI
                     SGNLLFIIGLLMGPVVYAWIFGAFPATDIAASWPVILIAGLLVGVGTRMGSGCTSGHG
                     IVGLARFSRRSLVATIVFLIAGVIAASLAGAFL"
     gene            445554..445991
                     /locus_tag="BSVBI22_RS12200"
                     /old_locus_tag="BSVBI22_B0454"
     CDS             445554..445991
                     /locus_tag="BSVBI22_RS12200"
                     /old_locus_tag="BSVBI22_B0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006191901.1"
                     /db_xref="GI:493203738"
                     /translation="MNRLSFLRLGAALAAGVIFSFGLSVSGMINPARVIGFLNIASGH
                     WDPSLAFVMGGGLLVTIPGIALCRRLSAPAFDTAFHLPTKTQIDRRLIAGSALFGIGW
                     GLGGFCPGPAVAALSLGLPQVALFVLAMAVGMIIHDRWLAKTL"
     gene            complement(446014..446721)
                     /locus_tag="BSVBI22_RS12205"
                     /old_locus_tag="BSVBI22_B0455"
     CDS             complement(446014..446721)
                     /locus_tag="BSVBI22_RS12205"
                     /old_locus_tag="BSVBI22_B0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002966168.1"
                     /db_xref="GI:489056026"
                     /translation="MILLETKMAKENSNSGARWFPVYQGLCEAVVGHSLLPGTKLPED
                     ELASIYTVSRAVVRSALQALAHDRLVRLEPNRGAFVAEPSPEEAREVFEARSLIEPEI
                     AALAAKKATPKQIEELRQHLEREHDALQAGHDSDAIRLSALFHSYLAKIAGHSIFASF
                     VSELLPRSSLIIALYWQRREITCQNDAHHALVNAIEKHDAHEAAALMKTHILDLLSGL
                     SLNRIKKEQKRLADVLR"
     gene            446967..448025
                     /locus_tag="BSVBI22_RS12210"
                     /old_locus_tag="BSVBI22_B0456"
     CDS             446967..448025
                     /locus_tag="BSVBI22_RS12210"
                     /old_locus_tag="BSVBI22_B0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006133769.1"
                     /db_xref="GI:493096794"
                     /translation="MSVQRASFYILLTLVTIAFAWLLIPYYTAVLWAVIMAVIFYPVQ
                     QWLVLLLRGRRNIAAFLSVLMCICLVIIPMLAIFGSLVDEGTSLYQRLSSREFDINGY
                     IARIMAALPESLEEWLKRFELGTFADWRARISSVVMQGSQLFAARLVSFGQNTLQFFI
                     GFGIMLYLLFFLFRDGADVGKKIRRAIPLSDDYTRQFLEKFTAVIRATVKGNIIIAII
                     QGMIGGVTFWLLGIEAALLWGVIMTFCSMLPAVGAALVWTPAAVWFFVSGDWWSGAIL
                     VVVGVLVIGLVDNLLRPPLVGKGTRMPDYVVLISTVGGISLIGINGFVIGPLIAAMFI
                     AAWSLLAEEQKDQHMPDQ"
     gene            448644..449363
                     /locus_tag="BSVBI22_RS12215"
                     /old_locus_tag="BSVBI22_B0458"
     CDS             448644..449363
                     /locus_tag="BSVBI22_RS12215"
                     /old_locus_tag="BSVBI22_B0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_006191902.1"
                     /db_xref="GI:493203739"
                     /translation="MADSEDKKPPQASLSSEQTRKALIVAALRLFGAKGYEATSTREI
                     ASLTKANIGSIAYHFGGKEGLRLAAADYIVETFRLIAAQALGNFQPAGFSREEREDAR
                     AQMISALERMVHFIVARPETGEIVQFLLRELAHPTAALDRIYKGVFEPVHKRLCMIWE
                     AATGEAAESEATRLVVFTLVGQIFYFRIAQEAVKRRMNWPVMGSDQADMVAGVVKQNL
                     AAMLDARGPTGAQQPVADGGK"
     gene            449368..450312
                     /locus_tag="BSVBI22_RS12220"
                     /old_locus_tag="BSVBI22_B0459"
     CDS             449368..450312
                     /locus_tag="BSVBI22_RS12220"
                     /old_locus_tag="BSVBI22_B0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_006191905.1"
                     /db_xref="GI:493203742"
                     /translation="MSLLCVIPFVSSLFAACGTQSLAVGHVEGEFVQLAPLQVAQVRD
                     IAVKRGDRVEAGEPIATVEDTDARIAVAQAEAALAQAQAQLANLQVGKRPEEIAVLEA
                     AVRSARAQADDAQRTLLRTRDLARRGVATQAQLDDAATQLEVAEAAIGQSTANLAVGK
                     LPARPEEIKAAENAVKSAKAQLQTAKWQRAQRTIEAPAAGRITDVVRNPGDIAGPSAP
                     VLTMLPDGAVKLKVYIPEERFSDVAVGSVLSVHCDGCAPGLQARVSYVSPDPEFTPPV
                     IYSLETRQKLVYLVEAHPVNPASPLQPGQIVDVDLGAK"
     gene            450323..>450810
                     /locus_tag="BSVBI22_RS12225"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            450754..451230
                     /locus_tag="BSVBI22_RS12230"
     CDS             450754..451230
                     /locus_tag="BSVBI22_RS12230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073590.1"
                     /db_xref="GI:492971838"
                     /translation="MHKPKLLLLDEPTAGVDPKARRDFWDEIHRLADGGLTVLVSTHY
                     MDEAERCHRINYISYGKLLATGTVSEVIERTGLTTFFVSGKRLGNVARELEEMPGVDQ
                     VAPFGATLHVVGSDREKLTAALDRIKHREDIHVEAGQTSLEDVFIQFMAGAKDNMQ"
     gene            451227..452366
                     /locus_tag="BSVBI22_RS12235"
                     /old_locus_tag="BSVBI22_B0461"
     CDS             451227..452366
                     /locus_tag="BSVBI22_RS12235"
                     /old_locus_tag="BSVBI22_B0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="WP_004690159.1"
                     /db_xref="GI:490828069"
                     /translation="MTMQWFSLARLRAMLMKEFIQMWRDHITFAMMLIVPLMQLLLFG
                     FAINNDPKSLPSALVALSNDHYTRAMISALETTNYYRFDHVVHSAAEADALLANGSVS
                     FVVTIPSDFARRVDAGDRPQLLIEADATDPSVASGAISTLSTVASQALLREQGRQAEA
                     ENASRSQLEVVVHRRYNPEGISQYNIVPGLLGVILQMTMVMMTAMALTRETERGTMEN
                     LLAMPATPAEIMLGKILPYLAVGGVQMVVVLVAAKLIFGVPFVGSLTLLLSSVLIFVL
                     SLVLLGYTISTVSRTQMQAMQLTFFFFLPSLMLSGFMFPFRGMPDWAQALGNIFPLTY
                     FLRIVRAVMLKGAGLADIAGEVMALILFVFLFAGLALLRFQRTLD"
     gene            452404..452802
                     /locus_tag="BSVBI22_RS12240"
                     /old_locus_tag="BSVBI22_B0462"
     CDS             452404..452802
                     /locus_tag="BSVBI22_RS12240"
                     /old_locus_tag="BSVBI22_B0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_004690160.1"
                     /db_xref="GI:490828070"
                     /translation="MVEITRNGSQASRKGPAEWFTGNVRIDPLFVANEARRAEASTVT
                     FEPGARTAWHTHPLGQTLVVTAGLGLVQREGGPIEKIRPGDVVWFEPGEKHWHGASPS
                     TVMTHIAIQEKLDSKVVDWLEHVTDEQYGG"
     gene            complement(452809..453627)
                     /locus_tag="BSVBI22_RS12245"
                     /old_locus_tag="BSVBI22_B0463"
     CDS             complement(452809..453627)
                     /locus_tag="BSVBI22_RS12245"
                     /old_locus_tag="BSVBI22_B0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002969349.1"
                     /db_xref="GI:489059278"
                     /translation="MSDADVSKTARPVRPVEFRGGGFAPSPVRGIGLAVFVVLMVAAE
                     IGTRSGFISNLTLPRPSAVLETFGQLWQTGLLWQHLLPSLQRLIIGASLGIAVGISLG
                     VMIGLFSYVRAGLVPLVAALFPIPKIALLPLFVIWFGIDEMSKYMLIAFGTFTPTVVA
                     TYGAVDNVDRSLIRMGQSFGLSWWSIVRKIVLPGAFPAILSGLRVSISIAIILLVAAE
                     MLGAQYGVGSYILEAGSLYDLEKLFAGVAILSVMGLIVNVVIGWVERRFLNWRG"
     gene            complement(453620..454387)
                     /locus_tag="BSVBI22_RS12250"
                     /old_locus_tag="BSVBI22_B0464"
     CDS             complement(453620..454387)
                     /locus_tag="BSVBI22_RS12250"
                     /old_locus_tag="BSVBI22_B0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ABC transporter ATP-binding protein"
                     /protein_id="WP_004688958.1"
                     /db_xref="GI:490826868"
                     /translation="MDLKLQNISHFYGKVEVLKDISLDIPQGQIVCLIGPSGCGKSTL
                     LRFLGGLERPGSGQVLQIGDPPPDSLNPLTYVFQHFALLPWRTVEGNIKLVLEDHRLS
                     QREMNDIVTDVLERTRLGDFRTALPKQLSGGMRQRVAISRALAVRPAVMLMDEPLSAL
                     DSQTRALLMDDLVSLWTRQPFTSVYVTHNLAEAVRLGHRVVVLSRRPGRIRQIVDIDI
                     PLSERALGDPALEAKQKMLWDLMREEAMAADKELTDV"
     gene            complement(454433..455524)
                     /locus_tag="BSVBI22_RS12255"
                     /old_locus_tag="BSVBI22_B0465"
     CDS             complement(454433..455524)
                     /locus_tag="BSVBI22_RS12255"
                     /old_locus_tag="BSVBI22_B0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014315872.1"
                     /db_xref="GI:504081878"
                     /translation="MHENNEIGQLDETGAALAEENTHMKFSLNRRQALLGMGAAGAAV
                     AFGFPARAATRNLAVLHLASHAPSFIAHERGYFKDAGLDIELKFFEAAQPSAVAIASG
                     DADFGVTAMSGGLISLAQKGAVKVIGGALIEEKGVVGAIILASNKAYDAGLTDPSRLA
                     GKTFGITTAGSSFHFMAHKIAQANNIDLKQIQLRPLQKLGAVVGALSSGQIDAWAIQP
                     NIAKKLIREGAARQIGLVADYAPNYQVTTAFTSTRNATDERALTEAFVKAYSRAIDDY
                     NAAFVDNKTDDAERDALARIVHKYVESDSPFDTARQNLIDGAMRINPGLALALDSCVE
                     QLDWFKSEGMVKDSITNEQLFDTFYVKTI"
     gene            455802..456306
                     /locus_tag="BSVBI22_RS12260"
                     /old_locus_tag="BSVBI22_B0466"
                     /note="MarR family transcriptional regulator; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            456313..457944
                     /locus_tag="BSVBI22_RS12265"
                     /old_locus_tag="BSVBI22_B0467"
     CDS             456313..457944
                     /locus_tag="BSVBI22_RS12265"
                     /old_locus_tag="BSVBI22_B0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_004692324.1"
                     /db_xref="GI:490830238"
                     /translation="MPDARDDKKEAPEAAPAAPQPAHMPLYMSIIYIAASMLLWSTRG
                     LSMYFISANTQQIQGSLGATLTETTWLVAAYMAPFASLTILLLKIRTQFGLRRFAEVA
                     IAVFLVASLLHLLVYDVWSAIPVRFIAGAAAVPISSVGFLYMLEAFPPDKKRTWGLSL
                     ALTCSGAAGPFARIISPMLFDIGQWQQLYMLEIGLALACFAVVYVLPLTQIPRAKVLH
                     WLDFVAYTFIAIGFGALVVVLVQGKNYWWFEAPWIGVCLAISILSLAIAAAIELNRDQ
                     PLMNLHWLASPEILRFTLILLVFRMVLAEQTSGALGLFQVFGLQDAQSKGLYTLILLA
                     SFAGGITCGALLKVERVPVIFGFALLCIAVGAFLDSHATNLTRPHNVYVSQGLIAFGG
                     ALFLPPAMLAGITKAMKQGPAYMTSFIVVFLFTQNIGGLIGSALFSTFISIREKYHSA
                     HLVEQLVMSDPLVAQRVQALSGTYAKVLADQGLTKAEGLVLLGQQVTKEATILSYNDA
                     FLAISVIAVIALCCQVTYRVYEAFRARRSALAVMS"
     gene            457969..459018
                     /locus_tag="BSVBI22_RS12270"
                     /old_locus_tag="BSVBI22_B0468"
     CDS             457969..459018
                     /locus_tag="BSVBI22_RS12270"
                     /old_locus_tag="BSVBI22_B0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_002971258.1"
                     /db_xref="GI:489061219"
                     /translation="MSVSKKYIRGGFAILIGLLGVFIILWAWQLPPFKHSVETTDNAY
                     VRGQVTVMSPQVSGYITKVNVTDYEQVKKGDLLFEIDSRSYQQKLDQALAALDSKKAA
                     LANSEQSQRSAEATIKAREAQISGAKAALEVAKANTVRVDALLPRGVTTQSSADTAHG
                     NMLQAQAAVDQAEAALAVAKEDLRTIIVAREGLNADLHNAEAAVALARIDLQNTKILA
                     PRDGKLGEVGVRLGQYVTAGTQLVSLVPAVKWIMANFKETQLYGMKVGQPVTLTVDAL
                     RHAELKGHIEAFSPATGSEFSVIKSDNATGNFTKITQRLSVRISIDEGQPDAELLAPG
                     MSVVVRVDTASTPDK"
     gene            complement(459090..460514)
                     /locus_tag="BSVBI22_RS12275"
                     /old_locus_tag="BSVBI22_B0469"
     CDS             complement(459090..460514)
                     /locus_tag="BSVBI22_RS12275"
                     /old_locus_tag="BSVBI22_B0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002969347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="osmolarity sensor protein EnvZ"
                     /protein_id="WP_006191919.1"
                     /db_xref="GI:493203756"
                     /translation="MRLPLPHSLPIWLLTILISGLLTTQIATLWIVSQDRADANNALE
                     LFRLSERATYLVKLLHATPPDDWNNLAIRVSGSGEAMNITSEPDVTTALASENDLAEL
                     EDVLVARLTRYGVVDARIRRDTTGYRLPKEETAVHDSTEMGIIEKQIDSLAATTRSGA
                     SPTTSLQFNDGRWLNFITHITPIDPIVTSDTIPLFTLVALCVILGAIWATQRLIAPYR
                     ILEDAIDRIGGDLKSPPLPETGIREYTAAARAVNSMQARLLDYVAEREQLAAALAHDL
                     RTPLTRMKLRMELLDDDALRQSLSRDLNDIEAISRSVIDFATSELAHEKAERLDLWSL
                     LLSVADKYPQVSLDEKGSDYRDAICLCQPISIQRCITNLIDNALAYGGKVRLSLHRDG
                     DDLLLRIKDNGPGISPERIEEMFKPFSRADKSRNRESGGFGLGLTIARNIARKNGGEI
                     SLRNDPAGGLIAELRLPGSRLMPR"
     gene            complement(460511..461227)
                     /locus_tag="BSVBI22_RS12280"
                     /old_locus_tag="BSVBI22_B0470"
     CDS             complement(460511..461227)
                     /locus_tag="BSVBI22_RS12280"
                     /old_locus_tag="BSVBI22_B0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002966153.1"
                     /db_xref="GI:489056011"
                     /translation="MKEDAHILIVDDDKDIRDLLHEFLKRRGMHVSIACNGDEMLDVL
                     SRTPIDLVILDVMLPGKSGIEICQDVRRTSRVPIIMLTAIADAADKILGLEIGADDYI
                     AKPFDPRELLARIRAVLRRFEGNRSPQRALTQIYRFAGWTLDCARRRLTSPHDVRVEL
                     TTAEFNLLEAFVKSSQHILSRDQLMEMAGHQAVYGYDRSVDILISRLRKKLEDDPCAP
                     KLILTIRGGGYQFGHEVEIA"
     gene            complement(461421..461621)
                     /locus_tag="BSVBI22_RS12285"
     CDS             complement(461421..461621)
                     /locus_tag="BSVBI22_RS12285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966151.1"
                     /db_xref="GI:489056009"
                     /translation="MLAAHNTQKTKPAAAFDVLIELNMRSLRYWVRFQFLKQTLYDIA
                     SLLVFFANVAFCFSIVAQANAA"
     gene            461928..462145
                     /locus_tag="BSVBI22_RS12290"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            462340..462690
                     /locus_tag="BSVBI22_RS12295"
                     /old_locus_tag="BSVBI22_B0474"
     CDS             462340..462690
                     /locus_tag="BSVBI22_RS12295"
                     /old_locus_tag="BSVBI22_B0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="WP_002966149.1"
                     /db_xref="GI:489056007"
                     /translation="MAEVSLKRIYEEPSPQDGYRVLVDRVWPRGMTKEKARIDVWAKD
                     IAPSTELRKWFGHDPAKWGDFQKKYREELESKLPALKDLLAGAGGRHITLLYGAKDEE
                     HNQAVVLHNFMEKL"
     gene            complement(462813..464087)
                     /locus_tag="BSVBI22_RS12300"
                     /old_locus_tag="BSVBI22_B0475"
     CDS             complement(462813..464087)
                     /locus_tag="BSVBI22_RS12300"
                     /old_locus_tag="BSVBI22_B0475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006092242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="WP_004687334.1"
                     /db_xref="GI:490825244"
                     /translation="MDAANSPHIVVVGAGFGGLQLIRDLDGAKVRITLIDQRNHHLFQ
                     PLLYQVATTILSTSEIAWPIRNLFRDRAEVTTLLGTVIDVDTARKSVFLENGDEVSYD
                     MLVLATGARHAYFGNDQWEKLAPGLKALEDATTIRRRLLLAFERAEREPDMARRQALL
                     TFSIVGGGPTGVELAGIIAELARRTLWPEFRNIDTRQARVLLLEAGPRILSAFPEDLS
                     AYARRALEKLGVEVRLGIPVKDITQEGVTVGDEFIPCHTTVWAAGVAASPAALWLDAE
                     SDRAGRVKVLSNLSVPGHEDIFAIGDTAWVEGDDGRPVPGIAPAAKQQGAYVAKVIRS
                     RVENKTPPLPFRYKHQGNLATIGKGAAVVDMGRIRLKGTIAWWFWGIAHIFFLIGTRS
                     RAAVAWSWLWTYITGQHSARLITQGKPSDEFR"
     gene            complement(464170..464619)
                     /locus_tag="BSVBI22_RS12305"
                     /old_locus_tag="BSVBI22_B0476"
     CDS             complement(464170..464619)
                     /locus_tag="BSVBI22_RS12305"
                     /old_locus_tag="BSVBI22_B0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006119338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_002966147.1"
                     /db_xref="GI:489056005"
                     /translation="MSNGPEIPFETTLFVRDTCLCLHVQRAARALARLFDEALRPAGL
                     TNGQFSLMMSLNRPSPPPMKPVAELLAMDQTTLTAALKPLQRRGWVEILVNPADRRER
                     LLQLTAEGKAVLASAVPIWTATHAQIEARLAGGNGDALRHDLIMLSS"
     gene            464901..465680
                     /locus_tag="BSVBI22_RS12310"
                     /old_locus_tag="BSVBI22_B0477"
     CDS             464901..465680
                     /locus_tag="BSVBI22_RS12310"
                     /old_locus_tag="BSVBI22_B0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bleomycin resistance protein"
                     /protein_id="WP_006191923.1"
                     /db_xref="GI:493203760"
                     /translation="MKNGGSPFVWYELMTSDAKQAQDFYSKVIGWTAKDAGMPGMKHT
                     LFDALGCTIAGMMALSDLPGEGCMDARPGWLGYIGVADVDAAAEKVMAEGGKILRAAG
                     DIPGVGRFAVAADPQGAMFSLYSPKADMEPPADFGSRKVGHPSWHELYARDGEAVFPF
                     YEKVFGWKLSRDFDMGSMGKYKVFSVDGADMGGIMTAPPGAENGWGFYFMVDGVGAAA
                     ARIKSLGGTVLAGPMEVPNGEWVIKCCDPQNVSFSLVSAKE"
     gene            complement(465744..465914)
                     /locus_tag="BSVBI22_RS12315"
                     /old_locus_tag="BSVBI22_B0478"
     CDS             complement(465744..465914)
                     /locus_tag="BSVBI22_RS12315"
                     /old_locus_tag="BSVBI22_B0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006092241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966145.1"
                     /db_xref="GI:489056003"
                     /translation="MQPRVSLHAPPVLRATAGGREASMSNIIFWTALVVVPILVGTAY
                     AYLRHFHHEDDF"
     gene            complement(465961..467394)
                     /locus_tag="BSVBI22_RS12320"
                     /old_locus_tag="BSVBI22_B0479"
     CDS             complement(465961..467394)
                     /locus_tag="BSVBI22_RS12320"
                     /old_locus_tag="BSVBI22_B0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:alanine symporter"
                     /protein_id="WP_006191925.1"
                     /db_xref="GI:493203762"
                     /translation="MATIIDFLNNVFWNYVLVYGLLAVGLFFTIRLKFVQFVHFPELF
                     RVVFAAGRRDEAGISPFQALTISIASRVGTGNITGVAVALYLGGPGAIFWMWIVALVG
                     LATAYSESALAQLYKIRSQDGQYRGGPAFYIARGLGLPWAGALFSICLILSFGLVFNA
                     VQANAIADSMVMAFNMPKLGTGIVLAILSDVVIFGGIRQIARVAEVVVPFMAFAYILM
                     AICILAINFQAVPSTIALIFSSAFGLHEAVGGVTGGITAAMLNGVKRGLFSNEAGMGS
                     APNTAAVATPAPHHPSSQGFVQSLGVFIDTILVCTATAIMILLSGILEPGSGLTGTQL
                     TQMAMTHHIGDVGVYFIAAAIFFFAFTSIIGNYSYAESAMTFLGLGGKVPITILRCAL
                     LAMVVWGAYESIHTVFDAADASMGPMATINLIAIVLLSGTVKKLTVDYFAQRRAGQFL
                     TFHAADYPELQGQIDMEIWSEQNTTNK"
     gene            467381..467665
                     /locus_tag="BSVBI22_RS12325"
                     /old_locus_tag="BSVBI22_B0480"
     CDS             467381..467665
                     /locus_tag="BSVBI22_RS12325"
                     /old_locus_tag="BSVBI22_B0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004687332.1"
                     /db_xref="GI:490825242"
                     /translation="MIVAMKNPRLVGRFNDNHGLLSSPDGNFDFDNVERARWLSTRAE
                     IKSEYKIAGAGYRNACGRSDFAFGKCSQTSMELLLARFCQNTIASHGEFE"
     gene            467822..468742
                     /locus_tag="BSVBI22_RS12330"
                     /old_locus_tag="BSVBI22_B0481"
     CDS             467822..468742
                     /locus_tag="BSVBI22_RS12330"
                     /old_locus_tag="BSVBI22_B0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009374358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-succinyltransferase"
                     /protein_id="WP_002966142.1"
                     /db_xref="GI:489056000"
                     /translation="MPIKIPDDLPATSVLEAEGVMVMREADAVRQDIRPLRIGLLNLM
                     PNKVTTETQIARLLGATPLQVELTLVRMTNHVARHTPADHMLSFYCPWEEVNDQRFDG
                     FVITGAPVERLPFEEVTYWDEMRRVFDWTQSHVHRTLNICWAAQAAVYHFHGMKKYDL
                     PAKASGVFRQRSLVPASPYLRGFSDDFAIPVSRWTEVRKSDIPADSGLKVLVDSTETG
                     LCLLDDPRHRSLHMFNHVEYDTTSLADEYFRDIQVQPEAKVPVNYFPGDDAKRPPENR
                     WRSHAHLLFGNWINEMYQSTPYDIERIGKV"
     gene            complement(468810..469880)
                     /locus_tag="BSVBI22_RS12335"
                     /old_locus_tag="BSVBI22_B0482"
     CDS             complement(468810..469880)
                     /locus_tag="BSVBI22_RS12335"
                     /old_locus_tag="BSVBI22_B0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191928.1"
                     /db_xref="GI:493203765"
                     /translation="MRFSLVTAIALAAALTGCTSSSGIDNIMLQPQPSAETTSSIVWP
                     VPPAPVHELASAPEVSVPQPREEILAWAGPIPDAIPNAGPFKAEPPVPIAPQPEQRPV
                     ARISVPKPEIAAYPPVRLSQPQRTKIYSHRFRDAKPINFGRASPRKLAVHGVDVSRWQ
                     GDIDWVKLRTQGANFAYIKATDGGDHLDPMFRKNWREAKAAGIKRGAYHFFYWCRVAS
                     QQADWFIRNVPNDPDALPPVIDVEWNGDSSCKRRPSRAQVLEKMQIFMDKLERHYGKR
                     PIIYTAPDFYDDNLKGTFTDYPFWLRAVAQHPSKVYPGRRWLFWQYSGSGLSQGVNEK
                     IDLNVFHGSEDEWHRWVGRVTS"
     gene            complement(470152..471132)
                     /locus_tag="BSVBI22_RS12340"
                     /old_locus_tag="BSVBI22_B0483"
     CDS             complement(470152..471132)
                     /locus_tag="BSVBI22_RS12340"
                     /old_locus_tag="BSVBI22_B0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006092240.1"
                     /note="FabF, beta-Ketoacyl-ACP synthase II, KASII;
                     catalyzes a condensation reaction in fatty acid
                     biosynthesis: addition of an acyl acceptor of two carbons
                     from malonyl-ACP; required for the elongation of
                     short-chain unsaturated acyl-ACP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_002966140.1"
                     /db_xref="GI:489055998"
                     /translation="MTVCSSRLAGFGHAVPDRRVENAEIEAQLGLETGWIERRTGIRC
                     RRWAMPDETLSHLAASAADMALSDAGIERSDIALTLLATSTPDHLLPPTAPLLTHWLN
                     LQNSGAADLAGACTGFLYALVLADGFVRAQGKPVLVVAANLLSRRINMAERASAVLFG
                     DAAGAVVLAPSAKANSFQSQFITNGSHYDLIKVPAGGSARAYAPERDASEFLMTMQDG
                     RAVFTEAVRIMSGASQNVLASAAMLPQAIDRFFPHQANIRIVDKVCETIGVPRAKAAS
                     TLETYGNSSAATIPLSLSLANLEQPLREGERLLFAAAGAGMTGGAVLMQV"
     gene            complement(471129..472403)
                     /locus_tag="BSVBI22_RS12345"
                     /old_locus_tag="BSVBI22_B0484"
     CDS             complement(471129..472403)
                     /locus_tag="BSVBI22_RS12345"
                     /old_locus_tag="BSVBI22_B0484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936877.1"
                     /note="catalyzes the formation of
                     S-adenosyl-4-methylthionine-2-oxobutanoate and
                     7,8-diaminononanoate from S-adenosyl-L-methionine and
                     8-amino-7-oxononanoate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="WP_004684995.1"
                     /db_xref="GI:490822905"
                     /translation="MNPNTSPVWHPFTQHRLEPRPDRIVRTEGAYLFREDGSAVLDMI
                     SSWWVITHGHRHPAIMDAIRQASADLDQIIFADFSHQPAEELAKGLIALAPDGLSHVF
                     YSDSGSTAVEVAIKMALGYFYNRGEPRSRIAVLQHSYHGDTIGTMSAGERGVFNAAYG
                     ALLFNVETLPFPSPGHEQPMLDRLEDVCRGGDLAALLVEPLVLGAGGMKMYPAHILAA
                     MREITERHGVLLAVDEVMTGWGRTGTLFACEQAGITPDILCTSKGLTGGSLPLAATLC
                     TAAIFDAHYSDDRSKTFFHSSSYTANPIACAAALANLQVWLSEPVTERISALTRMQTE
                     RLHRFKDDSRFAGLRQTGTITALELDVPAGGYLSDAGPKLRTFFKQNGVLLRPLGNVI
                     YVMPPYCVTAEELDRTYDVITQGVDMIAGQTR"
     gene            complement(472400..473038)
                     /locus_tag="BSVBI22_RS12350"
                     /old_locus_tag="BSVBI22_B0485"
     CDS             complement(472400..473038)
                     /locus_tag="BSVBI22_RS12350"
                     /old_locus_tag="BSVBI22_B0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8FWG5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent dethiobiotin synthetase BioD"
                     /protein_id="WP_004688969.1"
                     /db_xref="GI:490826879"
                     /translation="MNSRLIVTGTDTGIGKTVFSAALCHALGAAYWKPVQSGLEEETD
                     SEIVARLAQASPQRILPEAWRLNTPASPHLSARLDGVEIRPEEMHIPATSLPLVIEGA
                     GGLLVPLNDKTLFADLFAIWRIPAILCARAALGTINHTLLSLEAMRSRDIPVLGVAFI
                     GEANEDTETTIAHLGRVKRLGRLPLLDDLSPEKLHHSFARNFHIDDFAGVAR"
     gene            complement(473035..474171)
                     /locus_tag="BSVBI22_RS12355"
                     /old_locus_tag="BSVBI22_B0486"
     CDS             complement(473035..474171)
                     /locus_tag="BSVBI22_RS12355"
                     /old_locus_tag="BSVBI22_B0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="WP_006191931.1"
                     /db_xref="GI:493203768"
                     /translation="MKLDTYLTRLENLERKGRRRNLALADGLDFSSNDYLGLATHPGI
                     KAAVEAALQRGVPLGATGSRLLRGNHAEHEALEAEAAAHFSAPRMIYFGSGYMANLAA
                     LSTLPQPGDLIVYDELIHASAHAGIRAGRAEAVGARHNDAQAFEDRIRAWRENGGRGT
                     PWIVVESIYSMDGDQAPLKALHAIATRYDGVLYIDEAHATGVYGANGGGFAATLGDAE
                     NIVTLHTCGKALGGSGALLGAHATLCDYLVNRASGFIFTTAPSPLQAAALREALRILR
                     DQPERRARLFSRISHANERIATALGQPVSGTQIIPIIVSDNERAVRLAAQMQAQGFDI
                     RAIRPPTVPHGTARLRISITLNVGLADIDRMVETLSYATFREAA"
     gene            complement(474168..475208)
                     /locus_tag="BSVBI22_RS12360"
                     /old_locus_tag="BSVBI22_B0487"
     CDS             complement(474168..475208)
                     /locus_tag="BSVBI22_RS12360"
                     /old_locus_tag="BSVBI22_B0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643241.1"
                     /note="catalyzes the formation of biotin from
                     dethiobiotin; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="WP_002966136.1"
                     /db_xref="GI:489055994"
                     /translation="MPCTVEKHEKPAAKAAQAMPDRGGENGASCSVGRWSAEEARAIY
                     NLPFNDLLFRAHGLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSASAENGLKASK
                     LMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGLETCMTLG
                     MLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGIKVCSG
                     GILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGTRLAKAAPVDPLEFVRVVA
                     LARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPGDDRDSSLLR
                     RLGIQAETEQPA"
     gene            complement(475565..475846)
                     /locus_tag="BSVBI22_RS12365"
                     /old_locus_tag="BSVBI22_B0489"
     CDS             complement(475565..475846)
                     /locus_tag="BSVBI22_RS12365"
                     /old_locus_tag="BSVBI22_B0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966134.1"
                     /db_xref="GI:489055992"
                     /translation="MPFSRDYHYGRFKTAELENLQAAYLKTCEALGHCPITSPQKDHI
                     AHQIIQIYECGVSNPDKIAELMVQIESVKPKPLVEELFTKTSATKTRIA"
     gene            476109..476627
                     /locus_tag="BSVBI22_RS12370"
                     /old_locus_tag="BSVBI22_B0491"
     CDS             476109..476627
                     /locus_tag="BSVBI22_RS12370"
                     /old_locus_tag="BSVBI22_B0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor synthesis domain-containing
                     protein"
                     /protein_id="WP_002966133.1"
                     /db_xref="GI:489055991"
                     /translation="MKIGVVTVSDRASRGEYEDLSGPAIEAWLKGAIVTPYEIVRRVI
                     PDGMESVRDTLIDLCDTVACDLILTTGGTGPSPRDETPEAMKAVLHKELPGFGEQMRR
                     VSLEQTPTAVLSRQTAGSRGKSFILNLPGKPASIAMTLQAIFPAVPYCLDLIGAGRID
                     TDPSVVKAHRPG"
     gene            complement(476679..477278)
                     /locus_tag="BSVBI22_RS12375"
                     /old_locus_tag="BSVBI22_B0492"
     CDS             complement(476679..477278)
                     /locus_tag="BSVBI22_RS12375"
                     /old_locus_tag="BSVBI22_B0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009374351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966132.1"
                     /db_xref="GI:489055990"
                     /translation="MNNALLDSIKKRRTQYALGKTLPHAREDVAELIREAIKHTPSSF
                     NSQSSRAVILFGQESDKLWNIVKETLRPIVPAEAFPQTEAKIDGFAAGAGTVLFYEDQ
                     SVVKGLQENFPLYADNFPVWSEQSGGMAQHAVWAALANAGIGASLQHYNPLIDAEVAK
                     TWDVPSNWKLRAQMPFGSNEQPFPEKQFMNDAERFKVFF"
     gene            477602..478930
                     /locus_tag="BSVBI22_RS12380"
                     /old_locus_tag="BSVBI22_B0494"
     CDS             477602..478930
                     /locus_tag="BSVBI22_RS12380"
                     /old_locus_tag="BSVBI22_B0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacylglutathione hydrolase"
                     /protein_id="WP_004690170.1"
                     /db_xref="GI:490828080"
                     /translation="MKSFIIIGGGASGVIIAAQLLRRAQDATVRIFEKSGRLGAGIAY
                     STGNPSHLLNVRAGNMSAFPDEPEHFVNWLRTTDEGGGWDAQSFAPRRLYRDYLAGLL
                     QPYHLEAHPRLFVEKVEAADIVLEDGKPVVVAAAGTRFSADAIILATGNEASIATPGK
                     HVAEYWSSNGYFNIPIDAPVAIFGTGLSMIDSVLSLLDNGHKAEIFAISRRGLVPVRH
                     LGGQPMQIGAEELTPASSLPSLVQHIRALMRKVEQKGGNWRDVMDGLRPHTQRLWSGL
                     SVGQKVRFLRHLRPWWDVHRHRMAPAVADRIAAAVKSGQLKVMAGRLVSVRQDGEDIA
                     VCYSPRGKGGEQMLRVAAIIDCRGGNQHFSTTRNPALIRLMEQGLARPDALDLGLDVT
                     NDLQVVNARGEPSGPFFALGPVTKGMFWEVTAVPDIRVQAEKLAQRLLQE"
     gene            479371..482289
                     /locus_tag="BSVBI22_RS12385"
                     /old_locus_tag="BSVBI22_B0495"
     CDS             479371..482289
                     /locus_tag="BSVBI22_RS12385"
                     /old_locus_tag="BSVBI22_B0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_004690171.1"
                     /db_xref="GI:490828081"
                     /translation="MTMDGRILFLLVLLPFLGSAITGLFRRADRSGSAWFTAAIALVA
                     FVATASIYPIVSGGKVLHGTLEWLPAYGLNVTLRMDGFAWLFAMLITGIGLLVVIYAR
                     YYMSPEDPVPRFFSFLLGFMGSMLGIVLSGNIVLLAVFWELTSVFSFLLIGYWYHNAS
                     ARDGARMALTVTGIGGFCLLAGVLLLGHVVGSYDLDRVLAAGDLVRAHPLYTVILVLI
                     ALAAFTKSAQFPFHFWLPNAMAAPTPVSAYLHSATMVKAGVFLLARLWPVLAGTEEWF
                     WILGGAGLISLLIASFFAVFQQDLKGLLAYSTISNLGLITVLLSLGSPLAAVAAIFHM
                     VNHAIFKASLFMAAGIIDHETGTRDMRRLSGLLKPMPYTATLAMVASAAMAGVPLLNG
                     FLSKEMFFAESVETHLVSWLDTITPYVATIAGIFTVAYSVRFIYSTFFGPPPHDLPKE
                     PHEPPHWMRRPIELLVLLCLLIGIVPGLSIGPFLHSAVISVLGQATPVYSLAVWHGFS
                     LPLMMSIVAMVGGILLHWLLKNYLATSEDGPPFFRHLQGQRIFERVLVTLSWNWARKA
                     ETFLSTRRLQPQLRIVVAFAVVAAAWPILEAGIPTGMLGVQPVDPIFAGLWILGGACA
                     VGAAYQAKFHRLVALILLGGAGLITCITFVWLSAPDLAVTQLLVEIVTTVLLLLGLRW
                     LPKRWEDPDAAASVNFGPRLRRYRDLALAVVSGAGVAVIAYAMMTRPSPSSIGDYFLE
                     NAYSGGGGMNVVNVILVDFRAFDTFGEIAVLGIVSLTVFALLRRFRPAPESTGSTDQQ
                     KIQDAYDEAMPGRKAGETLADYLAVPSVIMHWLFPVIIVLAVHLFLRGHDFPGGGFAA
                     GITLAIAFLLQYLASGTRWVEDRLRILPLRWIGLGLLFAAATGMGAWFFGYPFLTSFF
                     RYAEIPHIGKMPIASALLFDFGVFLLVVGATVLVLIALAHQSIRKHRVEKLAAAKEEN
                     "
     gene            482289..482627
                     /locus_tag="BSVBI22_RS12390"
                     /old_locus_tag="BSVBI22_B0496"
     CDS             482289..482627
                     /locus_tag="BSVBI22_RS12390"
                     /old_locus_tag="BSVBI22_B0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966129.1"
                     /note="subunit C of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_004681849.1"
                     /db_xref="GI:490819752"
                     /translation="MELVLALAIGVLMASGVWLILRPRTFQVAIGLSLVSYAVNLFIF
                     SMGRLRTDAPPVLESGLDVQAAQYTDPVPQALVLTAIVIGFAMTALFLVVLLASRGLT
                     RTDHVDGKEN"
     gene            482630..484258
                     /locus_tag="BSVBI22_RS12395"
                     /old_locus_tag="BSVBI22_B0497"
     CDS             482630..484258
                     /locus_tag="BSVBI22_RS12395"
                     /old_locus_tag="BSVBI22_B0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002970701.1"
                     /note="subunit D of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; contains an oxidoreductase domain; catalyzes the
                     transfer of electrons from NADH to ubiquinone; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_002966128.1"
                     /db_xref="GI:489055986"
                     /translation="MDWKTHLVVAPIVLPLVTAAVLLLFDERRRRLKMAISFVSMVCL
                     IALAITLVGMASEKAPEAIVYLIGNWPAPFGIVLVLDRLAALMLVLASLLGLAALSFS
                     FASWHKASPHFHTIFQLLLMGLNGAFLTGDLFNLFVFFEVMLAASYGLALHGSGPARV
                     KAGMHYIAVNLVASSLFLIGVSLIYGVTGTLNMADLAQRISHVAAQDRMLLEAGAAVL
                     GVAFLIKAGMWPLNFWLAPAYTAAAAPVAAVFAIMSKVGIYVLLRLSPLMFGISAGSS
                     YGFGNDWLYFGGMITLAFGLIGVVASQAMGRLASYSILVSSGTLLAAIGSGNTAMTGA
                     ALFYMVSSTLAIAAFFLLIELVERGQDAAANVLAVTMEAYGDDEEEEDEEEVGTVLPA
                     TLAILGTCFCICAILLIGLPPFSGFLAKFLILTAVFNGDGSAPQLTAPVSAASWVLVS
                     LILLSGLSALIAMTRTGIRTFWASLEGNVPRVLVREVVPIAGLLGVCLALTIAAGPTM
                     RYMDETARSLHNPDDYINSVLRAPRTGAETAGAQ"
     gene            484255..484770
                     /locus_tag="BSVBI22_RS12400"
                     /old_locus_tag="BSVBI22_B0498"
     CDS             484255..484770
                     /locus_tag="BSVBI22_RS12400"
                     /old_locus_tag="BSVBI22_B0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073627.1"
                     /note="subunit E of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_002966127.1"
                     /db_xref="GI:489055985"
                     /translation="MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMM
                     ALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRLILSPGRQRHPGFVVIPLELQNR
                     TALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG
                     AVDIVEGEKSA"
     gene            484767..485048
                     /locus_tag="BSVBI22_RS12405"
                     /old_locus_tag="BSVBI22_B0499"
     CDS             484767..485048
                     /locus_tag="BSVBI22_RS12405"
                     /old_locus_tag="BSVBI22_B0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966126.1"
                     /note="subunit F of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; in S. meliloti it is known to be involved
                     specifically with K+ transport; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_002966126.1"
                     /db_xref="GI:489055984"
                     /translation="MSAVLIFWALLAAQVMLVAAMGCAVYRLLVGPRAQDRILATDAL
                     YLDALLLLLTFGIRTGSIIYFEAALIIALLGFVATVALSKFLMRGEVIE"
     gene            485045..485407
                     /locus_tag="BSVBI22_RS12410"
                     /old_locus_tag="BSVBI22_B0500"
     CDS             485045..485407
                     /locus_tag="BSVBI22_RS12410"
                     /old_locus_tag="BSVBI22_B0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012219744.1"
                     /note="subunit G of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_002966125.1"
                     /db_xref="GI:489055983"
                     /translation="MIEAADFPLWAAILVSFLLVAGAFLTLVGCIGLVRFKTFYERVH
                     APTIGSSFGAGGILLASIIFFSILQSKPILHEVLITVFVVVTTPVTLMLLSRAVLHRD
                     RTRDSKELPSSSESFQGR"
     gene            485784..486368
                     /locus_tag="BSVBI22_RS12415"
                     /old_locus_tag="BSVBI22_B0502"
     CDS             485784..486368
                     /locus_tag="BSVBI22_RS12415"
                     /old_locus_tag="BSVBI22_B0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_002966123.1"
                     /db_xref="GI:489055981"
                     /translation="MELSPIVQSFVLHFGEMGSRWGINRTVGQIYALLYLSPEPLCAD
                     EIVEALGVSRSNVSMGIRELQGWNLVLLKHIPGDRRDFFTTPDDVWQILRTLAEERKK
                     REIDPTLSVLREVLMEQPQDDSDRYAQDRMKDMYSLIERLTNWYDDVKKLDTDRLTSL
                     LALGAKVTRFLETTDRIVALGRGRTSAKKEPKRE"
     gene            486365..488101
                     /locus_tag="BSVBI22_RS12420"
                     /old_locus_tag="BSVBI22_B0503"
     CDS             486365..488101
                     /locus_tag="BSVBI22_RS12420"
                     /old_locus_tag="BSVBI22_B0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol reductant ABC exporter, CydD subunit"
                     /protein_id="WP_006191938.1"
                     /db_xref="GI:493203775"
                     /translation="MTSVAPRTEDLKAEDGRTAGDGKRQRRAMPSLLKRGAMLQTLAA
                     VLWLPQAALLAYAAGRLADTGFDSSIYYYAAALFVIGCLRSVLDARGGTQAFDAARLQ
                     LTSLREKAFAALARRSPLDVSRPSSGEAASILAEQAEMVVPYLSRFVPVRYRVMLVPL
                     IILAAVLWFSWVAALILLVAAPLIPVFMALIGWRAKAASEKQLVALGGMNGFLLDRLR
                     GLTTIRTFHAVDMTAKRLRENAETLRAKTMAVLRIAFLSSAVLELFAALGVAMVAIYI
                     GFHLLGTLQFGAWGHKLTLGEGLFILLLAPAFFEPLRDLSAVLHDRAAGEAAIDALES
                     LTHHTMPVVGEGGSAEVARCAPSVTLRDVGFRYSGGPVVLEGFSLDIAAGEHIALLAP
                     SGYGKSTLLALIAGLAAPQAGEITIGDTLLEPRTAVALRKRMSWVGQKPHIFAGSARH
                     NITLGRYADRAAIAGIIDDTALSHVAGVAGNRLIGENGAGMSGGEALRLALARIAVDP
                     EADIILADEPTAHLDHETAEKIAENLVRLAQGKTLIVATHDETLARRMHRIVRLDHRG
                     DDAAVIQRRAAE"
     gene            488098..489780
                     /locus_tag="BSVBI22_RS12425"
                     /old_locus_tag="BSVBI22_B0504"
     CDS             488098..489780
                     /locus_tag="BSVBI22_RS12425"
                     /old_locus_tag="BSVBI22_B0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006256541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_006073635.1"
                     /db_xref="GI:492971950"
                     /translation="MKGLHSLRPVLRLFFRSRAVALYAGIAAATITVLAGIALLGLSG
                     WFITATAIAGLSAATAVAFDVFAPAAGIRLLAILRTGARYLERLVTHDATLAVLAALR
                     EKLFRSWAQPSAAHALLKRPARLLFRLTADIDALDSLYLRVLVPIGAALATALFAGVA
                     LGFMHPLFGLLVALTLLVIGLGLPVIAAMRSEPAMRRRAKGTEALRARAIDLVAGQTE
                     LLMAGRMEAQQAALVRADAYMGSADKALNRIEIATGAGLGIAHAAILAGGLAGVGLLV
                     GAGMIDAPVAVLGILIILGAMEPFAALRRGAMELGRTVLAARRVGPQLEEPAKAACLP
                     LPVPGQAVVLENVSVRHEGAAATALKGFNLDIAEGERVAVVGTSGAGKSTLFNLLAGE
                     IAAESGSVAALPTRLLTQRTELFQDSLRNNLLLAKPDATDAELIDALQAAGLGEFMRN
                     APAGLDTALGEGGMGLSGGQARRLALARLFLTDAPLWELDEPTEGLDHATAEDVLARL
                     SEKVAGRTLLIATHIGRETKICNRIIVLNQGALILSVRKGEPLFDDILKTMR"
     gene            489924..491501
                     /locus_tag="BSVBI22_RS12430"
                     /old_locus_tag="BSVBI22_B0505"
     CDS             489924..491501
                     /locus_tag="BSVBI22_RS12430"
                     /old_locus_tag="BSVBI22_B0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967308.1"
                     /note="part of the aerobic respiratory chain; catalyzes
                     the ubiquinol to ubiquinone; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome BD oxidase subunit I"
                     /protein_id="WP_002967308.1"
                     /db_xref="GI:489057188"
                     /translation="MELDIVSLSRLQFAITALYHFLFVPLTLGLSVLLAIMETVYVMT
                     GRLIWRQMTKFWGTLFGINFVMGVATGIVMEFQFGMNWSYYSHYVGDIFGAPLAIEGM
                     MAFFLEATFVGLFFFGWDRLSKVGHLVATYAVAAGSNFSALWILIANGWMQNPVGSAF
                     NPETMRMEITDFFAVLTNPVAQAKFVHTVSAGYATASIFVLGISAWYLLRGRSVELAK
                     RSLTVAASFGLAASLSVVVLGDESGYLTNEHQKMKIAAIEAMWETEPAPASFTLFGFP
                     DQEARETHFAVRIPWVMGLIGTRSLTTPIEGIDQLVQNAEKHIRNGIVAYDALQKIRA
                     AGGTNAVSQEVRDAFADNSQWMGYALLLKRYVDDPRNATDEQIVKAANDTVPGVLPLF
                     WAFRIMVGIGFFLILLTGTFFVLSARRALDRYPFLLKVAVFAIPLPWIAAEMGWVVAE
                     FGRQPWSIEGILPTAVAVSNLGASTVLLTIVGFVVIYTVLFIIEMGLMLRAIKAGPEP
                     DSKPEAMLAPASIAPAE"
     gene            491507..492661
                     /locus_tag="BSVBI22_RS12435"
                     /old_locus_tag="BSVBI22_B0506"
     CDS             491507..492661
                     /locus_tag="BSVBI22_RS12435"
                     /old_locus_tag="BSVBI22_B0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016149359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome BD oxidase subunit II"
                     /protein_id="WP_004681855.1"
                     /db_xref="GI:490819758"
                     /translation="MILSDLLDYQTLRIIWWVLLGVLLIGFAAMDGFDLGVGTLLPFV
                     ARTDVERRVVINTIGPVWEGNQVWLILGGGAIFAAWPPLYAVSFSGFYLAMFVILFAL
                     ILRPVGFKFRSKRDGETWRNSWDWALFIGGFVPALIFGVAVGNVLQGVPFRLNGDLQI
                     FYEGSFFGLLNPFALLCGILSVTMLTMHGAAWLVLKTDGVIQARARAYGSVAALLTVI
                     LYIVAGAISWLWVSGYRITSAVVMDGPSNPLQKTVELDHGAWFANYANYPILLIAPAL
                     GILGALAVLATLRGGRELAPLLFGKLSIFGIISSVGVSMFPFILPSSIDPQSSLTVWD
                     SSSSHQTLFIMLVVTVVFIPIIVAYTAWVYKVLWGKVDKSMIEDESNHAY"
     gene            492678..492833
                     /locus_tag="BSVBI22_RS12440"
     CDS             492678..492833
                     /locus_tag="BSVBI22_RS12440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007879168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome bd ubiquinol oxidase subunit X"
                     /protein_id="WP_002972046.1"
                     /db_xref="GI:489062017"
                     /translation="MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELA
                     LEGNKHH"
     gene            complement(492884..493657)
                     /locus_tag="BSVBI22_RS12445"
                     /old_locus_tag="BSVBI22_B0508"
     CDS             complement(492884..493657)
                     /locus_tag="BSVBI22_RS12445"
                     /old_locus_tag="BSVBI22_B0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002966117.1"
                     /db_xref="GI:489055974"
                     /translation="MSGNFGAFLPKNLQGSAPSSGAGPLYVQLRQSLEAAIRAGQLAD
                     GEALPPERDIAEYANISRVTVRKAVDDLVKAGLLVRRHGSGTFVVRPGERVQQSLSML
                     TSFTEDMARRGIATQSRWLERGLYYPSPEEMMKLGLSSETRVARLGRLRMVGDMPLAI
                     ERASLSSEFLPDPDAVQGSLYAELGRTGFRPVRAVQRIAACNIKTSDARILGVQEGDA
                     GLSIERLSYLASGRVVEFTKSLYRGDAYDFVAELTIPQS"
     gene            complement(493654..494541)
                     /locus_tag="BSVBI22_RS12450"
                     /old_locus_tag="BSVBI22_B0509"
     CDS             complement(493654..494541)
                     /locus_tag="BSVBI22_RS12450"
                     /old_locus_tag="BSVBI22_B0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine kinase"
                     /protein_id="WP_004692299.1"
                     /db_xref="GI:490830213"
                     /translation="MTEFFIGVDGGGTGCRAVVAGRDGTILGFGHSGSANIVTDPQTS
                     LVNVKAAIDNAFDEAGLDKAHYATSHAVLGLAGGNVEGAGLPIERGLPFAHANVEFDG
                     LIALQGALGDKDGVVAILGTGTAYIIRKGARIHSVGGWGFPLSDLGSGARLGQSLLQE
                     CLLVHDGIHPGSPLTTAILNEFGNKPDNLVEFAWTAKPGDFGKYAPRIFQYAREGDPT
                     AHMLLKHSAAYVSETLEVLIGQGAERISLLGGMALLYVEWLPLHQQKLLVEPAADALT
                     GALQLALNRYGPKNGRACG"
     gene            494890..496149
                     /locus_tag="BSVBI22_RS12455"
                     /old_locus_tag="BSVBI22_B0511"
     CDS             494890..496149
                     /locus_tag="BSVBI22_RS12455"
                     /old_locus_tag="BSVBI22_B0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_004690178.1"
                     /db_xref="GI:490828088"
                     /translation="MIRNTSKLMLLGSTLLATGSVAFAEDVTLTVESWRNDDLQIWQE
                     KIIPAFEAKHPGIKINFAPSAPTEYNAALNAKLDAGSGGDLIACRPFDTSLELFNKGK
                     LADLTDLEGMKNFSDVAKSAWTTDDGSKTFCVPMASVIHGFIYNQEAFDKLGLKAPTT
                     EAEFFDVLEKIKADGTYIPMAMGTKDMWEAATMGYQNIGPTYWKGEEGRKALIAGKEK
                     LTDPEWVEPFKVLAKWKDYLGDGFEAQTYPDSQNLFTLGRAAIYPAGSWEIGLFNTQA
                     QFKMGAFPPPVKNVGDTCYISDHNDIGLGLNAASKNAEQAKVFLNWVASPEFAEIYAN
                     ALPGFFSLNSTAVKMADPLAQEFVSWREKCKPTIRSTYQILSRGTPNLESETWVESAN
                     VINGTDTPDEAGKKLQAGLDSWYKPAK"
     gene            496522..497466
                     /locus_tag="BSVBI22_RS12460"
                     /old_locus_tag="BSVBI22_B0513"
     CDS             496522..497466
                     /locus_tag="BSVBI22_RS12460"
                     /old_locus_tag="BSVBI22_B0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006237989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004690179.1"
                     /db_xref="GI:490828089"
                     /translation="MSQSADMPAIVHKRPKRWHIAVFLLPCVLIYTAVMVLPLIETLR
                     QAFYNVVDGQRVFIGLANFEALFGDPNWSRDFWNALKNNVIFFLIHMLVQNPIGIFLA
                     AMLSLPRLRFSAFYRTALFLPTLLSFVIVGFIWKLILSPIWGVAPWMMDLVGLKWAFA
                     PWLGKADTALVTVSLVSVWQFVGIPMMLIYAALLNIPEEIVEAAECDGITGWSQFFKI
                     KLPLILPSIGLISVMTFVANFNAFDLIYSMQGALAGPDKATDILGTFLYRTFFGFQLQ
                     LGNPSMGATIAAVMFLIILAGVSLYLFGIQRRMRRYQF"
     gene            497479..498318
                     /locus_tag="BSVBI22_RS12465"
                     /old_locus_tag="BSVBI22_B0514"
     CDS             497479..498318
                     /locus_tag="BSVBI22_RS12465"
                     /old_locus_tag="BSVBI22_B0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002966111.1"
                     /db_xref="GI:489055968"
                     /translation="MSKARTSPVRTALVHATLIFYMLIAVFPVALTLINSFKSRNAIF
                     REPLRFPTPESFSLIGYETVLKQGSFLTYFQNSAIVTVVSIFLVILFGAMAAFALAEY
                     RFRGNMLTGLYLAIGIMIPIRLGTVALLQGMVAAGLVNTLTALILVYTAQGLPLAIFI
                     LSEFMRTVSDDLKNAGRIDGMSEYAIFFKLVLPLIRPAMATVAVFTMIPIWNDLWFPL
                     ILAPSEATKTVTLGAQLFIGQFVTNWNAVLAALSLAMFPILILYVLFSRQLIRGITAG
                     AVK"
     gene            498315..499385
                     /locus_tag="BSVBI22_RS12470"
                     /old_locus_tag="BSVBI22_B0515"
     CDS             498315..499385
                     /locus_tag="BSVBI22_RS12470"
                     /old_locus_tag="BSVBI22_B0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009374340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004688980.1"
                     /db_xref="GI:490826890"
                     /translation="MSSENQAPVRVLSAGLGNMGRSHALAYHRNPGFEIVGLVNRTKV
                     PVPDELAGYIIHPSFHEALKELKPDLACVATYSESHAEYAIAAMEQGADVFVEKPLAT
                     TVEDARRVIDCARANGRKLVIGYILRHHPSWMRLIEEARKLGGPYVFRMNLNQQSSGA
                     TWETHKNLMNTTSPIVDCGVHYVDVMCQITDARPVEVRGMGLRLSDEIKPDMYNYGHL
                     QVLFDDGTVGWYEAGWGPMMSETAFFVKDVISPNGCVSIVMNEAVTKSDDVDAHTKTA
                     NIRIHRAERDADGRFLHPDTNLSMADEPGHQELCEREQAFMLKAIRENLDLDRHMNDA
                     LQSLRICLAADESVRSGQPVKL"
     gene            499415..500416
                     /locus_tag="BSVBI22_RS12475"
                     /old_locus_tag="BSVBI22_B0516"
     CDS             499415..500416
                     /locus_tag="BSVBI22_RS12475"
                     /old_locus_tag="BSVBI22_B0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter ATPase"
                     /protein_id="WP_004690181.1"
                     /db_xref="GI:490828091"
                     /translation="MGSLQLKSVHKRYGAQEVLKDINLEVNDGEFIIFVGPSGCGKST
                     LLRSIAGLEDVSAGQVLINGEDVTVTPPSRRGIAMVFQSYALYPHLTVKANMGLSLKQ
                     AGAPKDEIEGRVAKASAMLALEPYLARRPAELSGGQRQRVAIGRALVRNPELFLFDEP
                     LSNLDAALRVQTLLEIAKLHRELKATMIYVTHDQVEAMTLADRIVVLNAGRIEQIGSP
                     MELYNRPDNLFVAGFIGSPQMNFIEAARIGATGARTIGIRPEHLSVSRESGTWKGKVI
                     HAEHLGADTILYVETETAGLVTARLFGEQHYNEDDVIFLTPEEGKTHRFDEAGKAIR"
     gene            500469..500720
                     /locus_tag="BSVBI22_RS12480"
                     /old_locus_tag="BSVBI22_B0517"
     CDS             500469..500720
                     /locus_tag="BSVBI22_RS12480"
                     /old_locus_tag="BSVBI22_B0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966108.1"
                     /db_xref="GI:489055965"
                     /translation="MRFEMRIAIRILVVRKERCGQNIAPHTIFLFLKLWRERKQYQPV
                     LTLSAMIGKNIALEGANSFHIKPPINHGNKLISSQARRS"
     gene            501017..502249
                     /locus_tag="BSVBI22_RS12485"
                     /old_locus_tag="BSVBI22_B0518"
     CDS             501017..502249
                     /locus_tag="BSVBI22_RS12485"
                     /old_locus_tag="BSVBI22_B0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoisovalerate dehydrogenase subunit alpha"
                     /protein_id="WP_006191945.1"
                     /db_xref="GI:493203782"
                     /translation="MSDDVVLSLHVPEPEWRPGDAPDFSHVKIPRAGSVRRPEIDEKP
                     EAMRDMAFSIIRMLNREGEAVGPWAGTLTDEELKDGLRHMMMLRAYDARMMMAQRQGK
                     TSFYMQHLGEEAVSCAFRKALRKGDMNFPTYRQAGLLIADDYPLVTMMNQIFSNEQDP
                     LKGRQLPVMYSSKEHGFFTISGNLATQYTQAVGWAMASAISHDTKIAAAWIGDGSTAE
                     SDFHATLVFASTYKAPVVMNIVNNQWAISTFQGIARGGSGTFAARGHGFGIPSLRVDG
                     NDYLAVHAVAKWAVERARRNLGPTIVEYVTYRAGGHSTSDDPSAYRPKAENDAWPLGD
                     PILRLKNHLIKRGVWSEERHKQAEAEVMDIVVSAQREAEAIGTLHDGRKPSMRDMFED
                     VYAETPPHLIRQRQEAGF"
     gene            502353..503366
                     /locus_tag="BSVBI22_RS12490"
                     /old_locus_tag="BSVBI22_B0519"
     CDS             502353..503366
                     /locus_tag="BSVBI22_RS12490"
                     /old_locus_tag="BSVBI22_B0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoisovalerate dehydrogenase subunit beta"
                     /protein_id="WP_004687311.1"
                     /db_xref="GI:490825221"
                     /translation="MTKMTMIEAIQNAHDIAMERDQKVVVFGEDVGYFGGVFRCTAGL
                     QKKYGKERCFDAPISELGIVGTAIGMAVYGLRPCIEVQFADYVYPAYDQIVSEAARLR
                     YRSAGEFTCPIVIRMPSGGGIYGGQTHSQSPEALFTHVSGLKTVMPSTPADAKGLLLA
                     AIEDPDPVIMFEPKRLYNGPFDGHHDKPVTSWKKHDLGEVPEGYYTVPLGKAAIRREG
                     SDVTVLAYGTMVHVALAAAEETGVDAEVIDLRTLLPLDTETIMASVKKTGRCIIVHEA
                     TLTCGYGAELAALVQRDCFYHLEAPIMRVTGWDTPYPHAQEWAYFPGPDRVGRALVSI
                     MEA"
     gene            503367..504662
                     /locus_tag="BSVBI22_RS12495"
                     /old_locus_tag="BSVBI22_B0520"
     CDS             503367..504662
                     /locus_tag="BSVBI22_RS12495"
                     /old_locus_tag="BSVBI22_B0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain alpha-keto acid dehydrogenase
                     subunit E2"
                     /protein_id="WP_004687310.1"
                     /db_xref="GI:490825220"
                     /translation="MAHFAIKLPDVGEGVAEAELVEWHVKVGDIVREDDLLAAVMTDK
                     ATVEIPSSRAGKVIAINGEVGEKIAVGSELVRLEIEGGATEKAEEPQPQAAEPTAPAA
                     AVPEAPVLLQTPVPEKPAAPKRENAGRPFTGAGPLRPEGEKPLATPSVRLRARDAGID
                     LRRVRGTGPAGRITHEDLDAFFQMESGAAPALSGYAADTSINEIKVIGLRRKIAERMA
                     EAKRHIPHITIVEEVDVTQLEELRNGLNHEKKEGRPRLTLLPFIIRTIVKAVKEQPGL
                     NAHFDDEADIIRQFGGVHVGIATQTPNGLIVPVVRHAESMSVFAAATELSRVTEAARN
                     GTAKREELTGSTITITSLGPLGAIATTPIINRPEVAIVGINKMAVRPMWDGTQFVPRK
                     MMNLSCSFDHRVIDGWDAAVFVQKLKSLLETPAMIFVEG"
     gene            504667..506061
                     /locus_tag="BSVBI22_RS12500"
                     /old_locus_tag="BSVBI22_B0521"
     CDS             504667..506061
                     /locus_tag="BSVBI22_RS12500"
                     /old_locus_tag="BSVBI22_B0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="WP_004692293.1"
                     /db_xref="GI:490830207"
                     /translation="MSEISCKLLIIGGGPGGYVCGIRAGQLGIDTVLVEKTRLGGTCL
                     NVGCIPSKALIHAADEFHRLTTFAAKSPLGITTQNPAIDFARTLEWKDGIVHRLNSGV
                     AGLLKRSRVRMFQGQARFQDGKTVLVDTDTGRQTIHAENIVIATGSVPVEIQALPFGG
                     NIISSTEALSLEKIPERLAVVGGGYIGLEIGTAFAKLGSRVTVVEATDRILPQYDAEL
                     TRPVMARLKTLGVEVLTGTSAKGLSADGKALEIRTQDGAVKAIEADKILVTVGRKPQT
                     DGWGLSEIRLDMDGRFIRIDDRCRTSMRGIYAIGDVTGEPMLTHRAMAQGEMVAEIIA
                     GGKHAWDKRCIPAVCFTDPEIVTVGLSPDEARKAGHNIQTGLFPFQANGRAMTMERDD
                     GIVRVVARADNHVILGIQAVGAGISELSAAFAQAVEMGARLEDIAATIHAHPTLGEGF
                     AEASMKALGHALHV"
     gene            complement(506050..506811)
                     /locus_tag="BSVBI22_RS12505"
                     /old_locus_tag="BSVBI22_B0522"
     CDS             complement(506050..506811)
                     /locus_tag="BSVBI22_RS12505"
                     /old_locus_tag="BSVBI22_B0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004688982.1"
                     /db_xref="GI:490826892"
                     /translation="MPLPSKANGQIVRKRSRFFLGFMAVLGAAFFLLFVGLGIWQVER
                     LQWKLDLIARVDARVHADPVAAPGKDEWAHINRKDDEYRHVTLTGTYLNDKEILVHAL
                     TERGSGYWVLTPMRSDAGVLIFINRGFVPGEKRDAASRAQTQIAGETTVTGLLRMPEP
                     GGFFLRPNDPSRDDWNSRDIAAFAEKENLGPVAPYFIDADAQSNPGNLPVGGLTVVKF
                     RNSHLSYAITWFALAAMVAGAAIFVWRHERRSSNM"
     gene            complement(507505..509970)
                     /locus_tag="BSVBI22_RS12510"
                     /old_locus_tag="BSVBI22_B0524"
     CDS             complement(507505..509970)
                     /locus_tag="BSVBI22_RS12510"
                     /old_locus_tag="BSVBI22_B0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="WP_004681862.1"
                     /db_xref="GI:490819765"
                     /translation="MRNLRENFPYSNGNRVENASDPKLQRGQAEAQNPASDGAWKIHF
                     SLGENVRFTRTPEVELMRRRGEVLPDVNEQHPRAEAPVPAVDVKKAAQAQPMAVAALQ
                     KTVSQNMVRTPVAPVPPVIPSAPASVAPTVDNEPRQAASAAPATTTTTTTQTPVPAFA
                     YLSDSAFWEGCDIDIALMPSTLVVAAVPAEPRKPAPSVESILARFRVREWQKPQEETP
                     VAVVAPQPVQPIAETAKPVAAEPFVEEPAAPAVEMAVAQGESTEDEVVLSVAEAEEHE
                     AEEVAAPAAIVEAPAPVKAAPSIALYQPQPLPRAETPVIFGAYEFPPRALLQEPPSLE
                     GNVITQEMLERSAGLLESVLEDFGVRGEIIHVRPGPVVTLYEFEPAPGVKSSRVIGLA
                     DDIARSMSALSARVAVVPGRNVIGIELPNANRETVYLREMIDSRAFESSNYRLPLCLG
                     KGIGGEPIIAELAKMPHLLVAGTTGSGKSVAINTMILSLLYRFKPEECRLIMVDPKML
                     ELSIYDGIPHLLTPVVTDPKKAVVALKWAVREMEDRYRKMARLGVRNIEGFNQRAASA
                     KGKGETVMCTVQSGFDKETGEPTYIQEELDLTPMPYIVVIIDEMADLMMVAGKDIEGA
                     VQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGA
                     EQLLGQGDMLHMAGGGRIVRVHGPFVSDEEVEKVVNHLKEQGRPDYLATVTEDEEEED
                     VAAEPAVFDNTAMGGEDGEDVYEQAVKVVMRDKKCSTSYIQRRLGIGYNRAASLVERM
                     EKEGLVGPANHVGKREILTGQRD"
     gene            complement(510265..511287)
                     /locus_tag="BSVBI22_RS12515"
                     /old_locus_tag="BSVBI22_B0525"
     CDS             complement(510265..511287)
                     /locus_tag="BSVBI22_RS12515"
                     /old_locus_tag="BSVBI22_B0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006179242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_004690188.1"
                     /db_xref="GI:490828098"
                     /translation="MTGNARDFGIVCGIMPTGERNAITDVPGVQVGHHTLRDGNINTG
                     VTAIIPHGGNLYRRKVLAACDIINGFGKSTGLVQIEELGSLETPILLTNTFGVGTCAN
                     ALIRDAIAANPDIGRATATVNPVVLECNDGPLNDIQAMAVTEEHARLALRSAQVNVPQ
                     GNVGAGTGMTCFGFKGGIGTSSRRFEFDGKLHHLGILALTNFGRAGDLVLPDGRRPSP
                     KAETQPEKGSVILVLATDVALEHRQLKRVTRRCGAGLARLGAFWGHGSGDIAIGFTTG
                     ITFNHDEPNDFIPMMILNENRIDTLFRAAAEATEEAVLNSMCRAQAMRGRAGNRRRSL
                     ADWLSH"
     gene            511534..512844
                     /locus_tag="BSVBI22_RS12520"
                     /old_locus_tag="BSVBI22_B0526"
     CDS             511534..512844
                     /locus_tag="BSVBI22_RS12520"
                     /old_locus_tag="BSVBI22_B0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_004692290.1"
                     /db_xref="GI:490830204"
                     /translation="MNITIEETLDQAGTGSFQRGLLGIFGLVWAADAMQVLAVGFTGA
                     AIAKTFGLTVPQALQTGTLFFLGMLVGAALFGRLADKYGRRRILLITVACDALFGLLS
                     AFAPDFGSLLALRFLTGLAVGGTLPVDYAMMAEFLPAKNRGRWLVMLEGFWAVGTVVI
                     AIAAWATSVAGVEDAWRYIFIVTAAPALIGIWLRFRVPESPMHLLKSGRVEEAKAVIN
                     LVLSRNGKPELPPGAKLLAPRLVTNERLLSPNLRQRTLTSLAIWFLVSVSYYGIFTWI
                     PAKLASDGFGFVRGYGFLVVVALAQLPGYALAAYGVEAWGRRKTLIGFLFVSAAACAL
                     FTVATSSSVVGASILIMSFALLGTWGALYAFTPELYPTALRASGMGAAGAMARLGGLL
                     APSAMAVVINQSFYTAVAMFAGLLALAGIIAFFINVETRQRALN"
     gene            complement(513003..513641)
                     /locus_tag="BSVBI22_RS12525"
                     /old_locus_tag="BSVBI22_B0527"
     CDS             complement(513003..513641)
                     /locus_tag="BSVBI22_RS12525"
                     /old_locus_tag="BSVBI22_B0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363502.1"
                     /note="oxidative demethylase of N1-methyladenine or
                     N3-methylcytosine DNA lesions; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_002966098.1"
                     /db_xref="GI:489055955"
                     /translation="MKDLFDNLNTREIMAPGAVLLRGFALACEESILSAVARVCAAAP
                     FRHMTTPGGYRMSVAMTNCGPVGWVTDRTGYRYSPADPETGKPWPSMPDTFLALAQDA
                     ARQAGYPDFTPDACLINRYEPGARLSLHQDKDERNFSNPIVSVSLGLPATFQFGGMKR
                     TDPITKYILHHGDVVVWGGPSRLFYHGILPLKSGEHERLGPFRLNLTFRKAF"
     gene            complement(513723..515333)
                     /locus_tag="BSVBI22_RS12530"
                     /old_locus_tag="BSVBI22_B0528"
     CDS             complement(513723..515333)
                     /locus_tag="BSVBI22_RS12530"
                     /old_locus_tag="BSVBI22_B0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014315865.1"
                     /note="with YejAEF is involved in resistance to microcin
                     C; Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_006191954.1"
                     /db_xref="GI:493203791"
                     /translation="MTTENILSVRDLRVTFDTHDGPVQAVRGINLDVKAGETIAIVGE
                     SGSGKSQTTMAMMGLLAQNGKATGQALYRGQDLIGLSEKELNKIRGAKITMIFQEPMT
                     SLDPLYRIGDQLAEPLRYHRGLSKKDARPRILELLKLVGIPEPERRIDSYPYELSGGQ
                     RQRVMIAMALANEPDILIADEPTTALDVTIQAQILDLLADLQKRLGMAVVFITHDLGI
                     VRRFADRVYVMRSGEVVETGVTEKLFTAPEHPYTRMLLDAEPEGEKAPPPDDSPVLIR
                     ADNVKVNFLINKPWIGAANYLTAVNDVSLTLKEGQTIGIVGESGSGKSTLGCAILRLI
                     ESEGRIAYLGQELPRESQAMRAKRRELQLVFQDPFGSLSPRMTIGRIITEGLLIHEPQ
                     LSAKDRDRRAQEALREVGMDPAMRNRYPHEFSGGQRQRIAIARTMILKPRVIMLDEPT
                     SALDRSVQKQIVTLLRDLQKDHGLSYLFISHDMAVVRAVSDYVIVMKNGKIVEQGDTE
                     QVFDHPREEYTKALMAAALSEERFGTNG"
     gene            complement(515335..516468)
                     /locus_tag="BSVBI22_RS12535"
                     /old_locus_tag="BSVBI22_B0529"
     CDS             complement(515335..516468)
                     /locus_tag="BSVBI22_RS12535"
                     /old_locus_tag="BSVBI22_B0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006191958.1"
                     /db_xref="GI:493203795"
                     /translation="MTDLTVPTETAELSMPSRSLWQDAFLRLRKNKAAVTSAIVLVLM
                     ALIGIFGPLLSPHPYDKIYPQFVRVAPSLEAYPRADTIMPGLEQVLARARLKAAGEPE
                     LTGNQLVLNVTAQRPTDERVLRYFQRSDLFSNPKIELAPDGLSGKLTMNVSRNYFLLG
                     TDNLGRDLMTRIFIGVRMSLAIGLLASAMALVLGVGYGAISGYLGGRVDNVMMRLVDI
                     LYSLPFIFFVILMLVFFGRSIFIIFIAIGATEWLDMARIVRGQTLSLKRQEFVQAADA
                     LGATRSGVITRHIIPNALGPVIVFVTLLVPKAILLESLLSFLGLGVQDPLTSLGLLIS
                     EGAQNMRGASWQLIWPAATLTIILFALNFLGDGLRDSLDPKDH"
     gene            complement(516461..517384)
                     /locus_tag="BSVBI22_RS12540"
                     /old_locus_tag="BSVBI22_B0530"
     CDS             complement(516461..517384)
                     /locus_tag="BSVBI22_RS12540"
                     /old_locus_tag="BSVBI22_B0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_002966095.1"
                     /db_xref="GI:489055952"
                     /translation="MLGYTLRRLGSAIPTIFIIITLTFFLIRLAPGGPFDLERPIDPL
                     ILENLKKAYNMDAPLWQQYLIYLGNLLHGDLGPSFTRRDFTVNDLFASGLPVSIILGT
                     LGLTLAAIIGTFLGTLAALKQNSATDYFVVALATFGITTPNFVVAPLLSLLFGVILGW
                     VPAGGWSSANVAYWILPVLTLALPQVGVIARLVRGATIEALRANHVRTARAYGLPSRV
                     VVGIHALRAAMLPAVSYLGPTAAALLTGSVVVETIFGIPGIGRYFVQGALSRDYTLVM
                     GTVVVISIFVVVFNLIVDLLYAWLDPRVRYD"
     gene            complement(517599..519176)
                     /locus_tag="BSVBI22_RS12545"
                     /old_locus_tag="BSVBI22_B0531"
     CDS             complement(517599..519176)
                     /locus_tag="BSVBI22_RS12545"
                     /old_locus_tag="BSVBI22_B0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017403533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_006191961.1"
                     /db_xref="GI:493203798"
                     /translation="MVRGILMTGICLLALNSAASAQTVLNRGNDTDPATLDQHHTSTV
                     SENRVLRDLYEGLLAQNAKGEAIPGAASSWDISEDGKVYTFHMRDGAKWSNGDPVTAG
                     DFEFSFRRIMDPKTAAGYASVLYAIQNGEEVATGKMPVDQLGVKALDDKTLQITLKSP
                     APYFLEFLTHQTGFPVNKKAVEKFGDKFTLPGNLVTNGPYQLVSFVPNDKIVMKKNPN
                     YWDADNVKIDTVNWMPFEDRSSCMRRFEAKEVDICSDVSAEQMDYVKKNLSKEFRLAP
                     YLGIYYVDIKGEPSSKLRDPRVRRAISLAADREFMADEVWRGVMLPAYSMVPPGIANY
                     VKDAPKLDFANEDILDREDKAKELLKEAGVEPNTLSVTLRYNTSENHKNTMAAFANML
                     KNIGINAKLDEVEGTTYFNYLQEKGMFDLTRDGWIGDYNDPNSFLELYTTGNYFNYAE
                     WSNKDYDALMDKSAVTTDLAERAKILAEAEEILLKEGAIVPLMYYSSTALVADRVQGC
                     DDNLMNSHGTRWLSVKN"
     gene            complement(519287..520864)
                     /locus_tag="BSVBI22_RS12550"
                     /old_locus_tag="BSVBI22_B0532"
     CDS             complement(519287..520864)
                     /locus_tag="BSVBI22_RS12550"
                     /old_locus_tag="BSVBI22_B0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019298781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_004690193.1"
                     /db_xref="GI:490828103"
                     /translation="MYRKFLLMGVCLLALAGAASAEAVLNRGNDTDPATLDHHHTSTV
                     AEGNVLRDLYDGLTIQDADGKAIPGVAKSWDISEDGTVYTFHLRDNAKWSNGDPVTAG
                     DFQFTFRRLMDPKTAAGYASMLFIIKNAEDVAAGKKPVDQLGVEAVDDHTLKITLNSP
                     APYFLELLTHQTGFPLHQKSVEANGDKFTTPGKMVTNGAYMLESFTPNDKIVMKKNPY
                     YYEADQVKIDKVNWIPFEDRASCMRRFEAKEVQICSDVPAEQMDYVKKNLSKEFRMAP
                     YLGVYYLPVKGKTADSKLKDPRVRQAISMAIDRDFLADQVWQGTMIPGYSMVPPGIAN
                     YVKDAPKLDYSDDMLEREDKAKELLKEAGVEPNTLSIELLYNTSENNKNTMAAIADQL
                     GNIGIKARLNETEGASYFNFLREDGPFDIARASWIGDYNDPQNFLYISQGNVSFNYAK
                     WKNADYDALMAKAEKTQDLGERANILADAAKIQLNELGAIPILYYSSLALVSSDVDGW
                     NDNLMNSHKTRWLSLKK"
     gene            complement(521291..521638)
                     /locus_tag="BSVBI22_RS12555"
                     /old_locus_tag="BSVBI22_B0534"
     CDS             complement(521291..521638)
                     /locus_tag="BSVBI22_RS12555"
                     /old_locus_tag="BSVBI22_B0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966091.1"
                     /db_xref="GI:489055948"
                     /translation="MFKKTLIAAIAFSFVGASFAQAQDWRPQHGQHKVEPRRPMPPHK
                     FERNDRRDYGKHNRWSKGQRYNDWRRHQEIRDYKRYGLRAPARGQRWIKVDDQFLLIT
                     AATGLIVGVLAGR"
     gene            522433..523446
                     /locus_tag="BSVBI22_RS12560"
                     /old_locus_tag="BSVBI22_B0536"
     CDS             522433..523446
                     /locus_tag="BSVBI22_RS12560"
                     /old_locus_tag="BSVBI22_B0536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006223432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_002966088.1"
                     /db_xref="GI:489055945"
                     /translation="MGAIFNSLTSNTIEKARRHVLVAGGAGFLGSHLCERLLNEGHSV
                     ICVDNFSTGRIENIRHLLNFDGFSFIRHDIVNTLDLRVDEIYNLACPASPPHYQADPV
                     HTMKTNVIGSLNLLELAAHYKARIFQASTSEVYGDPHVHPQPENYWGNVNSFGPRSCY
                     DEGKRSAETLFHDFHQQYGVDIRIVRIFNTYGPRMRPDDGRVVSNFIVQALKGEDITV
                     YGDGSQTRSFCYVDDLIEGFHRLMYSPHAIRVPVNIGNPGEFTVGALAEQIIAMTGSR
                     SRIVYYPLPVDDPRQRRPDITVAKRELGWEPTVALAQGLEPTIAYFEHQLRKPTGKLV
                     EAA"
     gene            523446..524432
                     /locus_tag="BSVBI22_RS12565"
                     /old_locus_tag="BSVBI22_B0537"
     CDS             523446..524432
                     /locus_tag="BSVBI22_RS12565"
                     /old_locus_tag="BSVBI22_B0537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="WP_002966087.1"
                     /db_xref="GI:489055944"
                     /translation="MSANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAV
                     RWGDFVEGDILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSL
                     LDACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEHMLADYAVA
                     YGLRYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAGRLDVLEVYGDDYETPD
                     GTCIRDYIHVTDLARAHVLAVEHLKEAGGNLAVNLGTGRGTSIREIVQSIGRLTGRSV
                     PVAMRARRAGDPPALYADPALAAEKLGFHTVYSDLDTIIRTAAPHFGLEVRG"
     gene            524429..526273
                     /locus_tag="BSVBI22_RS12570"
                     /old_locus_tag="BSVBI22_B0538"
     CDS             524429..526273
                     /locus_tag="BSVBI22_RS12570"
                     /old_locus_tag="BSVBI22_B0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="WP_004690194.1"
                     /db_xref="GI:490828104"
                     /translation="MKMRSTDSRADQVSAWAPVFGGWRRVEYLLGAGVWVAAIIYFWH
                     WWLQPANHTYLVGSILVTAILAWVTLLPAYFIFLFFRARRPVGPLNLPAGSRIAMVVT
                     KAPSEPFGVVAETLRAMLAQNVPHDTWLADEDPSPETLAWCREHGVFVSTRRERADYH
                     LHTWPRRTRCKEGNLAFFYDHYGYERYDFVAQLDADHVPTEGYLFEMLRPFADPAIGY
                     VSAPSICDRNAHESWSARGRLYAEASMHGSLQAGYNNGLAPLCIGSHYAVRTVALREI
                     GGLGPELAEDHSTTLMMNAGGWRGAHALDAIAHGDGPRTFADLVTQEFQWSRSLVMIL
                     LQYSPRLVRTLPFRMKFQFLFSQFWYPLFSAFMALMFMLPIIALVAGQNFVAVTYPDF
                     LAHFVPQAVILILLAYRWRASGTFRPFDAKILSFEATLFLFARWPWALAGTLAALRDW
                     ATGSFVDFRVTPKGASEVDPLPLRVLAPYGVMAILSIMPVLLIRDASESSRGFYIFAI
                     MNALAYVVLLLVIIVQHARENTVRYRTRFYQPALAASLLALMALPAVATVERGRDGIV
                     ALSWGTRSFSLFDDRFSVAGAGIGGRDIHKVIFNPHWRVGATGNPDQK"
     gene            526288..527712
                     /locus_tag="BSVBI22_RS12575"
                     /old_locus_tag="BSVBI22_B0539"
     CDS             526288..527712
                     /locus_tag="BSVBI22_RS12575"
                     /old_locus_tag="BSVBI22_B0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="WP_006191963.1"
                     /db_xref="GI:493203800"
                     /translation="MKIAVIGTGYVGLVSGTCFAAWGHEVVCVDKNARKIAVLERGIL
                     PIYEPGLDELVERNCAEGRLRFTCNLAEAVRGAEMVFIAVGTPPRAGHGDADLSFVYM
                     VARELAPLIDENAVVVVKSTVPVGTGDIVQKLIGSVRRAGTFSVASNPEFLREGVAIR
                     DFLYPDRVVIGVEDERARKALLDLYGTPLKEQKTPIVVTQRRTSELIKYAANAFLATK
                     ITFINELADLCEHVGSDVSQLALGIGLDKRIGESFLNAGPGYGGSCFPKDTLALLRTA
                     QDHGVALRIVEETVTANEARKRRMALKVLDALGGDVEGLTIAVMGLTFKPDTDDMRDA
                     PSVPLIETLQRFGARIRAYDPIGAENARNILSDVELCDDPYECVRAADAMVVITEWDS
                     IRRLDLSRVRQAMRQPVLIDLRNAYEPNVAENLGFRVSAVGRAATARHETSIKDALSL
                     LASRSRRADSAEELVPEGGGSNDL"
     gene            527702..528247
                     /locus_tag="BSVBI22_RS12580"
                     /old_locus_tag="BSVBI22_B0540"
     CDS             527702..528247
                     /locus_tag="BSVBI22_RS12580"
                     /old_locus_tag="BSVBI22_B0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966084.1"
                     /db_xref="GI:489055941"
                     /translation="MTFKPEKAFHAFVALPTVTILLMATTAFAGPVASAPQASETPTG
                     TRVMTAMELYTLYRNKSWQWTDGAGYMTGKDRSFAAWVDGPNGKSWGEGRWVITDTGR
                     MCLKANWYTKKGVFPAETCFEHRIGDGSIYQRREPDGTWYVFRHDPMQDGDEAQKLVS
                     ADLVSAHREEMKAALAAIPVK"
     gene            528297..529241
                     /locus_tag="BSVBI22_RS12585"
                     /old_locus_tag="BSVBI22_B0541"
     CDS             528297..529241
                     /locus_tag="BSVBI22_RS12585"
                     /old_locus_tag="BSVBI22_B0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannan endo-1,4-beta-mannosidase"
                     /protein_id="WP_006191964.1"
                     /db_xref="GI:493203801"
                     /translation="MKRLLKVSAALLCGTMVCGAVYAASGVSGANVDTRNIFQDKRPV
                     ITANSVTPGAYDPHGDYTNDPNSKIEHLFLLWEDVDLTSLHAADAYVRERGRSLLITI
                     EPWSWARDWRVGPEDLLSGILNGRYDSNMAAVCSEAAKLKSPVTIRWAQEMEDDAGQF
                     TWAFWKPEGYVKAYRHVIDVCRKSLPSARYMWSPKGEEGLEAYYPGDNYVDIIGLSVF
                     GYQPFDQLEVGRDTTFVERTKPGYDRVARFNKPIAIAELGYEGDDDYVRAWAAEANKP
                     HAEFPAMTAVVYFNDREVYPWPRDVGRPDWRVANHPLD"
     gene            529358..529855
                     /locus_tag="BSVBI22_RS12590"
                     /old_locus_tag="BSVBI22_B0542"
     CDS             529358..529855
                     /locus_tag="BSVBI22_RS12590"
                     /old_locus_tag="BSVBI22_B0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972060.1"
                     /db_xref="GI:489062031"
                     /translation="MMSSIRFSIAGAAFSVLLLTGAAGAAPGTEADIAVQKMALAAAP
                     MSAAALEQLYGGRTWRWNDGGGYFSTKKHRFTAVTRKGTARSFATGRWFATDGGKLCM
                     KAYWSNAGGGSGAITCFLHREQDGVVYQKPNLGGQWYVFRHNPVQKDDEARKLLRGDR
                     IRQGR"
     gene            complement(529931..530257)
                     /locus_tag="BSVBI22_RS12595"
                     /old_locus_tag="BSVBI22_B0543"
     CDS             complement(529931..530257)
                     /locus_tag="BSVBI22_RS12595"
                     /old_locus_tag="BSVBI22_B0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004688990.1"
                     /db_xref="GI:490826900"
                     /translation="MNIANIFDRMNFRRAVMFTVAAIGLAASPLFTAPAQAGEARKSR
                     EDIRLVYLAKYRVNGDVRYSKQPRGKLMRVSVSQYRTSNSYVCTPSGFGQKSHCHTAN
                     QIKEYF"
     gene            complement(530400..531521)
                     /locus_tag="BSVBI22_RS12600"
                     /old_locus_tag="BSVBI22_B0544"
     CDS             complement(530400..531521)
                     /locus_tag="BSVBI22_RS12600"
                     /old_locus_tag="BSVBI22_B0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006279941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_004688991.1"
                     /db_xref="GI:490826901"
                     /translation="MAADDGSQFVERRRWPRVSQAPLGEGLTASPALVPLRFETSSLP
                     TDQQFAAWQAHMSVLLTTHLPESAQPDDGFSVTQHVWNLDGILIVQQDTSAFHFERSA
                     NEVRFSPIDHWMITIMRSGQSWTGMNGQVVENHPGLVEIRSLGQPFSGRTLAASSTSL
                     IIPADAFADRGGLPITCNNVALGGHRAQLLIGYLTSVEASLGKLAQGDLAGVKANLRE
                     LVFDAIAPLVEHIDEKDNVSQIALMTKARRFIQNNLASPDLTPDALGRELALSRTRLY
                     ELFETFGGVANYIRRRRMLAAHAMLADPADTRKVAEVGEVIGFDSAANFSRAFTHQFG
                     YSPSNIRKQTATGAPATRNTPDIPPQATFESLLLTLGLF"
     gene            complement(532277..532645)
                     /locus_tag="BSVBI22_RS12605"
                     /old_locus_tag="BSVBI22_B0546"
     CDS             complement(532277..532645)
                     /locus_tag="BSVBI22_RS12605"
                     /old_locus_tag="BSVBI22_B0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_025200475.1"
                     /db_xref="GI:642987412"
                     /translation="MSRRSLTDEQWNRIEAYLPGRVGTPGRSGVDNRLFVDAILWMAA
                     NAAHWRDLPATFGKWTAVHARFRRWSHAGVWGRLFHALADTPDFEYVLIDSTISKVHA
                     DAAGAKGGLKLPASVARAVD"
     gene            complement(532680..534644)
                     /locus_tag="BSVBI22_RS12610"
                     /old_locus_tag="BSVBI22_B0547"
     CDS             complement(532680..534644)
                     /locus_tag="BSVBI22_RS12610"
                     /old_locus_tag="BSVBI22_B0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014008518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006133796.1"
                     /db_xref="GI:493096821"
                     /translation="MAVATRIGDLTEDSGTNTAAVSGNTIRAQTIVNDSSNTLEGKLS
                     DDYASSTLGTSSLTFGTPFGLEPRHVTQGAILAETAQINIATGHKATVSEGIIGTQNT
                     AKQEVAAGASLSLQENTIDASLAVNNAANRIAIDKESDPTFQGSVLITNLQQNKEGSV
                     DAETTESGILAQATEGDVANVMSILSGSLNVAENIVSSSATGNQTVGAAGAAGHQIVI
                     GGQLSVDSNTTGNGSSTISHDGGSAFAETAADFVIANNQANIGTDAADHLTISSASIG
                     VEGTPTIGAVVDAVEGGSVVLADNAVTSQAVGNNTSAAILKDDDSAVGFDATAALANH
                     QINLFSDIAATTQNGSVVAIVGKARDSIFDEGTVDVSGNKISALAFGNSASQQLALDA
                     NNLTAGDSTGLLTGGPNDETTHDSGLRAKAGAMLTSLQANYSSDISANNAASVVGVYG
                     DNKVGSDISGAKLTVENNTQQATAIGSDATNLLGQVHYEDGKADHVAGLGGNSVAGSA
                     GIANVQVGDAGSSVIASLTDAVAGFPGISSRAPITLPFFNANVKQEESSFSVTDNVQS
                     ASASGTQSRNELVVESNSVTANIGTGAQEHPTSSNTGLDGAYVRDNEDSFHTIHQPMI
                     MATYGLINDQSIGGRVNALGPVCIQGFPFA"
     gene            534746..535075
                     /locus_tag="BSVBI22_RS12615"
     CDS             534746..535075
                     /locus_tag="BSVBI22_RS12615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family transcriptional regulator"
                     /protein_id="WP_029643050.1"
                     /db_xref="GI:658385199"
                     /translation="MVPYSCCDELYGCEVVFRALIISGCDASELLDPVEEALHEIALP
                     IDPARKHERALAIALRRDVGPGLSRGGLSPNGIRVIPLVGQQDVSLTKLIRQRVGFGT
                     IGDLSTS"
     gene            complement(535220..535825)
                     /locus_tag="BSVBI22_RS12620"
                     /old_locus_tag="BSVBI22_B0549"
     CDS             complement(535220..535825)
                     /locus_tag="BSVBI22_RS12620"
                     /old_locus_tag="BSVBI22_B0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006260663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_004690197.1"
                     /db_xref="GI:490828107"
                     /translation="MKAPKRAKLLTLDQLETWFDKAEPAPPCRGVSTLNGFLTGLAAG
                     PVFLLPNDWMFHVIGKHEEKAFVGNKTYAVIETIVDHYNLIAHQLTAPRRYAPMFMRT
                     DDEEVLPGDWADGFYGAIKLNLAAWAPLMAEKQTGDPIMAILMQATEPDLLEMVSAVY
                     PKPPEAILKDAWRAIPTAIETIYAHCKPMRFNPGAPANDIS"
     gene            complement(535822..537393)
                     /locus_tag="BSVBI22_RS12625"
                     /old_locus_tag="BSVBI22_B0550"
     CDS             complement(535822..537393)
                     /locus_tag="BSVBI22_RS12625"
                     /old_locus_tag="BSVBI22_B0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_006191969.1"
                     /db_xref="GI:493203806"
                     /translation="MLNRGQHLPRDPDILVGMILERDAEIERLKVLLKAANAKPFGQR
                     SEQLAHMVERQIRLDLGDVVHEPEVASASEGAGLPKMPRQASAHSRPRRNIGALPEHL
                     ERVVEVIEPSSLECACCQGKLHCIGEDESEVLASRPATLYVLRTVRPKYACRACEAGI
                     VQAKAKPRLFDGGLATTSMISNVVVWRYAWYLPLNRQVQMLKGQGVRLDTSTLCSWVK
                     RSAWWLKSLYDKLLAYIHSHSRVFVDETRMPVLKRDRTRTKICQFWAHAVDDRPWNGP
                     AYPAVAYVFAQGRGKTEIQSQLVRYSGILQVDAYKAYKSLTRPDRRAGSIALAYCLAH
                     ARRKFVDVFKKYKSELAKVVIERLAEVYAIEASIRSTSAEHRLGVRQAKSKVLMADLK
                     MLLMDTLKDISAKDPVASAIKYTLGHWAGLTLFLEDGRLEVDSNTVERNMRSVALGRV
                     NSLFAGSDGGAETWAILSSLLTTAKLNGLDPYTWLNDVLERIVSGEIKSTSLWRCLPW
                     HWKQEHADMNMAVAA"
     gene            complement(537443..537796)
                     /locus_tag="BSVBI22_RS12630"
                     /old_locus_tag="BSVBI22_B0551"
     CDS             complement(537443..537796)
                     /locus_tag="BSVBI22_RS12630"
                     /old_locus_tag="BSVBI22_B0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966077.1"
                     /db_xref="GI:489055934"
                     /translation="MISLGSDLRIMIASKPVDFRKGINGLAALVSTALGANPYSGDIY
                     VFRSKRNDRLKMVVWDGSGMVLLTKVLEDRRFIWPAVHAGAVRLSASELALLLDGLDW
                     TRVEKKPVKRPAKTA"
     gene            complement(537793..538260)
                     /locus_tag="BSVBI22_RS12635"
                     /old_locus_tag="BSVBI22_B0552"
     CDS             complement(537793..538260)
                     /locus_tag="BSVBI22_RS12635"
                     /old_locus_tag="BSVBI22_B0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002968421.1"
                     /db_xref="GI:489058323"
                     /translation="MDLGSVDVDEKASPHSADDRHQHYAVSKVVDDRPAPRRVEVLLG
                     KERRRRWSADEKAEITAASFVPGANISAVARQYGVSQGLLHYWRRCAREHMSDDEEMR
                     FVPVVRADEGLGVPAAVTALTIRVEINGTCAVIEGGIDEQALCMVFKALRASA"
     gene            complement(538341..538703)
                     /locus_tag="BSVBI22_RS12640"
                     /old_locus_tag="BSVBI22_B0553"
     CDS             complement(538341..538703)
                     /locus_tag="BSVBI22_RS12640"
                     /old_locus_tag="BSVBI22_B0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_004686875.1"
                     /db_xref="GI:490824785"
                     /translation="MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFR
                     TGSPWAEVSERYGPPTACYNRFVRWRKAGVWDRLLEAVSKAYDGDIVMIDSTCVRVHQ
                     HAATGKKGMETMVAWDVP"
     gene            539470..539877
                     /locus_tag="BSVBI22_RS12645"
                     /old_locus_tag="BSVBI22_B0554"
     CDS             539470..539877
                     /locus_tag="BSVBI22_RS12645"
                     /old_locus_tag="BSVBI22_B0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972070.1"
                     /db_xref="GI:489062041"
                     /translation="MSNIETIFSSGLDQLMTFSIGASAGIVGLALAKRGVEYAKSFVG
                     FSDPFSYVHSIDGVESGDFDGFSLRYNGMYFEDESELNDYLLDQNDPDREANWQAYLR
                     DIGYYESSGVDSYIREALANDSASAYDDHEQSF"
     gene            complement(540002..540091)
                     /locus_tag="BSVBI22_RS12650"
                     /old_locus_tag="BSVBI22_Bt03"
     tRNA            complement(540002..540091)
                     /locus_tag="BSVBI22_RS12650"
                     /old_locus_tag="BSVBI22_Bt03"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(540055..540057),aa:Ser,seq:tga)
     gene            540350..540808
                     /locus_tag="BSVBI22_RS12655"
                     /old_locus_tag="BSVBI22_B0555"
     CDS             540350..540808
                     /locus_tag="BSVBI22_RS12655"
                     /old_locus_tag="BSVBI22_B0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="WP_002966074.1"
                     /db_xref="GI:489055931"
                     /translation="MSLESVKAFFASKAPEVEVIELPTSTATVALAAEAHGVEPGQIA
                     KTLSFSTKDQTILIVTRGDARIDNRKFKDRFGTKPRMLDAQTVLAETSHPVGGVCPFG
                     LPGALPVFCDISLKTYDEVVPAAGATNSAVRIAPQKMADLVEAEWVDVCQ"
     gene            541054..541515
                     /locus_tag="BSVBI22_RS12660"
                     /old_locus_tag="BSVBI22_B0556"
     CDS             541054..541515
                     /locus_tag="BSVBI22_RS12660"
                     /old_locus_tag="BSVBI22_B0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004690199.1"
                     /db_xref="GI:490828109"
                     /translation="MRLTRQTNYAIRMLMYCAANDGKLSRIPEIARAYNVSELFLFKI
                     LQPLVKHGLVETVRGRDGGVRLGRASQDISLFDVVRVTEENFSMAECFENDASECPLV
                     DSCGLNAALREALNAFFAVLMKYSIADLVKARPNVRLLLGLDEMEAPRIAS"
     gene            541632..541946
                     /locus_tag="BSVBI22_RS12665"
                     /old_locus_tag="BSVBI22_B0557"
     CDS             541632..541946
                     /locus_tag="BSVBI22_RS12665"
                     /old_locus_tag="BSVBI22_B0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_002966072.1"
                     /db_xref="GI:489055928"
                     /translation="MFIAMNRFKVRIGSETDFETVWKNRDSQLSDVPGFESFHLLRGA
                     TNEDEGYTLYASHTVWRSQEDFIGWTRSEQFRHAHRNAGENKPLYLGPPQFEGFTAVL
                     GQ"
     gene            542403..542714
                     /locus_tag="BSVBI22_RS12670"
                     /old_locus_tag="BSVBI22_B0558"
     CDS             542403..542714
                     /locus_tag="BSVBI22_RS12670"
                     /old_locus_tag="BSVBI22_B0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966070.1"
                     /db_xref="GI:489055926"
                     /translation="MLVCSCNIITEKEIEDTIIELLDEDCWQLIVPGTVYNAMNQRGR
                     CCGCFPNVVETIIRVTEEYYLRRNQMDENVIQFMDRVRSLRDKFGSSWNERRTKGHRA
                     A"
     gene            542680..543165
                     /locus_tag="BSVBI22_RS12675"
                     /old_locus_tag="BSVBI22_B0559"
     CDS             542680..543165
                     /locus_tag="BSVBI22_RS12675"
                     /old_locus_tag="BSVBI22_B0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="WP_002968422.1"
                     /db_xref="GI:489058324"
                     /translation="MKGEPKVIERLNEALFLELGAVNQYWLHYRLLNDWGYTRLAKKE
                     REESIEEMHHADKLIDRIIFLEGFPNLQTVSPLRIGQNVKEVLEADLKGEYDARASYK
                     ESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGEERYGQLNAAPADEA
                     E"
     gene            543329..544642
                     /locus_tag="BSVBI22_RS12680"
                     /old_locus_tag="BSVBI22_B0560"
     CDS             543329..544642
                     /locus_tag="BSVBI22_RS12680"
                     /old_locus_tag="BSVBI22_B0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q577W6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S12 methylthiotransferase
                     RimO"
                     /protein_id="WP_002966068.1"
                     /db_xref="GI:489055924"
                     /translation="MSAPRVSFVSLGCPKALVDSERIITGLRSEGYEISRKHDGADLV
                     IVNTCGFLDSARDESLEAIGLALNENGKVIVTGCLGAEPDVIRERHPNVLAITGPQAY
                     ESVMNAVHEVAPPAHDPFVDLVPPQGVKLTPRHYAYLKISEGCSNRCSFCIIPALRGD
                     LVSRPINEVLREAEKLVQAGVKEILVISQDTSAYGLDIKYQEAMWQDRTVRTKFLDLS
                     RELGEMGVWVRMHYVYPYPHVDEVIPLMAEGKILPYLDIPFQHASPAVLKNMRRPAHQ
                     EKTSRRIQAWRETCPDLAVRSTFIVGYPGETEEDFQMLLDWLDEAKIERAGCFKYEAV
                     KGAKANDLGLEQVPEEVKEARWHRFMAKQQQISTNLLKKKVGKRLPVIIDEANGTIGK
                     GRTRYDAPEIDGSVHISSRRPLRVGDIVTVKIEASDAYDLHGTAV"
     gene            complement(544782..545849)
                     /locus_tag="BSVBI22_RS12685"
                     /old_locus_tag="BSVBI22_B0561"
     CDS             complement(544782..545849)
                     /locus_tag="BSVBI22_RS12685"
                     /old_locus_tag="BSVBI22_B0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_006191974.1"
                     /db_xref="GI:493203811"
                     /translation="MKKTLMVIATVAGFMLGGAAHAEEKLKVGFIYIGPPGDFGWTYQ
                     HDQARKELVEALGDKVETTFLENVAEGADAERSIERLARAGNKLIFTTSFGYMDPTVK
                     VAKKFPDVKFEHATGYKTADNMSAYNARFYEGRYVQGVIAAKMSKKGIAGYIGSVPVP
                     EVVQGINSFMLGAQSVNPDFKVKVIWVNSWFDPGKEADAAKALIDQGVDIITQHTDST
                     AAIQVAHDRGIKAFGQASDMIKFAPDTQLTAVADEWGPYYIDRAKAVLDGTWKSQNIW
                     WGMKEGLVKMAPFTNMPDDVKKLAEETEARIKSGELNPFTGPIKKQDGSEWLKAGEKA
                     DDQTLLGMNFYVAGVDDKLPQ"
     gene            complement(545932..546852)
                     /locus_tag="BSVBI22_RS12690"
                     /old_locus_tag="BSVBI22_B0562"
     CDS             complement(545932..546852)
                     /locus_tag="BSVBI22_RS12690"
                     /old_locus_tag="BSVBI22_B0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004681885.1"
                     /db_xref="GI:490819788"
                     /translation="MDLTQAILLTIATAATPLLIAAIGELVVERSGVLNLGVEGMMLM
                     GAVSGFAVAQITGSAWLGLVAAVLVGALFAAVFGFLTLTLVTNQVATGLALTILGVGV
                     SALLGESFVGLPGVRLNPIYIPYLTDLPLIGRFLFGQDPIFYMSIALVIGVAWFLFRT
                     RAGLTLRAIGDSHGSAHALGVHVVRTRYLAVLFGGACAGLAGAQLSLVYVPQWVENMT
                     AGRGWIALALVVFASWRPWRVLVGAYLFGAVTIGQLHAQALGFGLPSQFLSALPYLAT
                     IVVLVIISRNKRLTMMNTPASLGKPFVPDR"
     gene            complement(546857..547939)
                     /locus_tag="BSVBI22_RS12695"
                     /old_locus_tag="BSVBI22_B0563"
     CDS             complement(546857..547939)
                     /locus_tag="BSVBI22_RS12695"
                     /old_locus_tag="BSVBI22_B0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002971245.1"
                     /db_xref="GI:489061206"
                     /translation="MRIELVKRPQPSRLFSALSPVLALALTLIFGGLAFLVMGKDPLH
                     ALYVFFVEPLFDIWSWHELLVKAAPLILIAVGLCVCFLSNNWNIGAEGQFIMGAIAGS
                     ILPVMFPDLESWIVLPLMMAMGMAGGAAYASIPALLKVRFNTNEILTSLMLVYVAQLF
                     LDWLVRGPWRNPEGHNFPETRQFNDSAILPEIWSASGRAHWGFIFALVAAVMVWFLLK
                     HTLKGFEVKVIGQSPRAGRFAGFSAGRMVFFVFALSGALAGLAGIAETSGAIGQLRPV
                     ISPGYGFTAIIVAFLGRLNPLGAIVAGLVLALSYLGGEAAQVAIGISEKSARVFQGMI
                     LFFVLACDTLILYRIRIVMNRQAGKA"
     gene            complement(547939..549501)
                     /locus_tag="BSVBI22_RS12700"
                     /old_locus_tag="BSVBI22_B0564"
     CDS             complement(547939..549501)
                     /locus_tag="BSVBI22_RS12700"
                     /old_locus_tag="BSVBI22_B0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_006191977.1"
                     /db_xref="GI:493203814"
                     /translation="MSARSTDRPLLDVRRLTKVFGQLRACDGVDLTIAEGEIHALLGE
                     NGAGKSTFVKMLFGALQPLEGQIVWKGQGVAIHEPAAARKLGIGMVFQHFSLFDSLTA
                     AENIALSLDRSLPLAEVARRAREVGRTYGLPVDPQAHVGDLSVGKRQRIEIVRCLLQQ
                     PDLIILDEPTSVLTPQEADRLFETLERLRAEGKSILYISHRLEEVKRLCDRATVLRHG
                     KVVGHCDPRKETAASLARMMVGNDIDVVARSTIAANGAGEPLFEIRAMSQPPRGPFST
                     ALKDISLCVAAGEVVGIAGVAGNGQGEFFEAISGEVLQAGASVVRIGGKDAGRLGISE
                     RRMMGAAFVPEERLGHGAVPGMTLTDNLFLSRYKTDARAFLRGGKLKLIAESALRSAT
                     KRIIERMDVRKSAENPAASALSGGNLQKFIIGRELDRAPSVMVVNQPTWGVDAGAAAH
                     IRQALVDLARSGSAVLVISQDLDELLEISDRIAVMNHGRLSDPIPIADVTLEKIGLLM
                     GGMAGETQAGAA"
     gene            complement(549605..550579)
                     /locus_tag="BSVBI22_RS12705"
                     /old_locus_tag="BSVBI22_B0565"
     CDS             complement(549605..550579)
                     /locus_tag="BSVBI22_RS12705"
                     /old_locus_tag="BSVBI22_B0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_004689000.1"
                     /db_xref="GI:490826910"
                     /translation="MINAIRVHRTGGPDVLHYEQVEIGEPGPGEARVRHEAVGLNFID
                     VYFRTGLYKAAKMPFTPGNEGAGIVVAVGAGVENVRVGERVAYAATPGSYADERILPA
                     DRLVKVPDTIDLKTAASMMLKGMTAQYLLRRTFRVEPGQTILFHAAAGGVGLIAGQWA
                     KHLGATVIGTAGSEEKIALARKHGYDHVINYRSENFVERVRELTNGEGVDVVYDSVGR
                     DTYMGSLDVLKPLGMFACFGQSSGVIPPFDLGILAQKGSLFATRPTLFNYIARRADLE
                     KTTAELFDVVESGAVKIEINQTYALKDACKAHEALEARKTTGTSILLP"
     gene            complement(550576..551406)
                     /locus_tag="BSVBI22_RS12710"
                     /old_locus_tag="BSVBI22_B0566"
     CDS             complement(550576..551406)
                     /locus_tag="BSVBI22_RS12710"
                     /old_locus_tag="BSVBI22_B0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylcholine synthase"
                     /protein_id="WP_006191979.1"
                     /db_xref="GI:493203816"
                     /translation="MGGQKERADSVKTKLTGKLKAKKVTAPQAKAFSVHLLTASGSFL
                     AFLSVVAASDGRYTAMWWWLGLALFVDGIDGPIARKLKVKYVLPNWSGELLDSIIDYV
                     TYVLIPAFALYQSGFMGTNLSFISGAIIVVSSAIYYADTGMKTKENFFKGFPVVWNMV
                     VFMLFIVRPGEWVAFGTVVASAILSFLPINFLHPVRVVRLRPLNLTIFLLWCAFGVIA
                     LYYMLDAPLWVRIGISVTGLYIYFIGAIMQLFPSLGREAALAKARKLVEKQQKSGEAP
                     "
     gene            551706..552950
                     /locus_tag="BSVBI22_RS12715"
                     /old_locus_tag="BSVBI22_B0567"
     CDS             551706..552950
                     /locus_tag="BSVBI22_RS12715"
                     /old_locus_tag="BSVBI22_B0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006123248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
                     /protein_id="WP_002969339.1"
                     /db_xref="GI:489059268"
                     /translation="MNDVVVNKPLTDIVISGGGPAGMMAALALGVRGYHTVLLGPETD
                     KTDRRTTALMMPAIRFLEQIGVWAAIEPEAAPLQSMRIVDATRRLIRSPAVMFRASEI
                     DEIAFGYNIPNAVLNAKLAEAVAASRNIRRITVPAIEYRPNGDHVTVTLKGGDTLHTR
                     LLVAADGRNSGARDAAGIRTRRWSYPQTAVVLSFSHMIDHENISTEFHTEEGPFTQVP
                     LKGRRSSLVWVVNPARAEKLLSMSDEALAVHIEEMMQSMLGKITLEVRPQAWPLSGLV
                     PHVFAAKRTILIGEAAHVFPPIGAQGLNLGTRDVETLVKAIESDSVDPGSERVMRAYD
                     RARRPDIFARTGSVDALNRSLLSSMLPAQILRGVGLEMLRSFAPLRAFFMREGLRPGS
                     GFSHLLPRLPRLPGKADDAARQ"
     gene            553023..553361
                     /locus_tag="BSVBI22_RS12720"
                     /old_locus_tag="BSVBI22_B0568"
     CDS             553023..553361
                     /locus_tag="BSVBI22_RS12720"
                     /old_locus_tag="BSVBI22_B0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004689002.1"
                     /db_xref="GI:490826912"
                     /translation="MGMAQIKHAKYQIGQVVKHRLFPFRGVIFDVDPEFANTEEWYQN
                     IPEDARPRRDQPFYHLLAENGETEYVAYVSEQNLVPDLSGEPLRHPQIDEMFDRMDNG
                     TFRVKAQHSN"
     gene            complement(553494..554111)
                     /locus_tag="BSVBI22_RS12725"
                     /old_locus_tag="BSVBI22_B0569"
     CDS             complement(553494..554111)
                     /locus_tag="BSVBI22_RS12725"
                     /old_locus_tag="BSVBI22_B0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="invasion protein B"
                     /protein_id="WP_006073704.1"
                     /db_xref="GI:492972110"
                     /translation="MSSTKTIAAASAIAGAFALLASATMPASAQQPPQGWFKVCSKQE
                     DNDICNTQNIVTADSGQLLTAVNLIEIKGKINRKIFQVTVPIGRLIPAGVGLQIDNNK
                     PVKLEYGICFPDRCIAEAPLTDELINALKKGSKLTLTSVNYQNKPNPIPVALTGFSQA
                     LTGPALKQSELEERQKELQDAVQKRQKEFEAKMKAEQGKAKGAAK"
     gene            554456..556303
                     /locus_tag="BSVBI22_RS12730"
                     /old_locus_tag="BSVBI22_B0570"
     CDS             554456..556303
                     /locus_tag="BSVBI22_RS12730"
                     /old_locus_tag="BSVBI22_B0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bicyclomycin resistance protein"
                     /protein_id="WP_006191983.1"
                     /db_xref="GI:493203820"
                     /translation="MLNRFIAFFRSVFLIGLVATAFGALPARAANETAPDYALSMHGD
                     VALPADYTHFPYTNPDAPKKGSLTVGVVGTFDSLNPFVLKSMRTTARGLYNDGEFGNM
                     VYQTLMLRSRDEPFTLYSLLAEKVAIDPERKWVEFTLNPKAKWSDGQPVTVDDVLFTY
                     DILTEKGRPPYNSRMSRVAKIEKTGERSVRFTFNEKSDREFPMLIAGSMPVLPKHAIN
                     RDTFGNSTLEPPIGSGPYVVASVQPGQRIVYKRNPDYWGKDLPSQRGFNNFDKISIEY
                     YRNETSLFESFKKGILDIFIEGNPIRWEKLYDFPAVEQGKVIKDTFEKGTPADMLGFV
                     FNTRRPIFADRRVRQALGLLFDFEWANRNLFAGQYRRTQSFWEGSQLSSVGRPADARE
                     RELLAPFPGAVREDVMNGTWHPPVTDGSGHDRVPAKKAYDLLSQAGFQFKDGMAIDPT
                     GKPFAFEIMTRSPDEEKIALAYQRNLSRLGIAVEIHTVDDAQYQQRLQTFDYDMILGA
                     LASSLSPGNEQWLRWGSASRDVQGSFNFAGVADPAVDAMIEALLAARNRADFVSAVRA
                     LDRVLISGDYYVPLYHLPYQWVARWDRIEHPQKTPLSGYQLPTWWHTSQ"
     gene            556483..557157
                     /locus_tag="BSVBI22_RS12735"
                     /old_locus_tag="BSVBI22_B0571"
     CDS             556483..557157
                     /locus_tag="BSVBI22_RS12735"
                     /old_locus_tag="BSVBI22_B0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_004681889.1"
                     /db_xref="GI:490819792"
                     /translation="MTGKKITIDVVSDVVCPWCFLGRKRLEAALASLPDVEAEIRWRP
                     FQLDPTLPPHGKDRQTYLREKFGTGSKIDDSHRQLRALGEEYGIVFDFDAIIRAPNTL
                     DAHRVIHWAAQAAPDTQDRMVGMLFSLYFEQGQDIGNHEVLVDAAASVSMDAEVVARL
                     LQSEADKDTIRDEIATANRIGVRGVPCFIIDQKYAVMGAQTPDVLADAIRQTAEGFEP
                     GIAEDR"
     gene            complement(557333..557752)
                     /locus_tag="BSVBI22_RS12740"
                     /old_locus_tag="BSVBI22_B0572"
     CDS             complement(557333..557752)
                     /locus_tag="BSVBI22_RS12740"
                     /old_locus_tag="BSVBI22_B0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fosmidomycin resistance protein"
                     /protein_id="WP_004687281.1"
                     /db_xref="GI:490825191"
                     /translation="MVQGLSHMTFIVRDLDRMEEILTTVFDARRVYDSGAETFSLSKE
                     RFFLIGNGKEPIWIATMEGEPLPTRTYNHVAFKIANNEYEAYLKRIRALGLEVREGRS
                     RVPGEGQSIYFYDDDNHMFELHTGTLDERLKRYGQGR"
     gene            complement(557824..561336)
                     /locus_tag="BSVBI22_RS12745"
                     /old_locus_tag="BSVBI22_B0573"
     CDS             complement(557824..561336)
                     /locus_tag="BSVBI22_RS12745"
                     /old_locus_tag="BSVBI22_B0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="WP_006191987.1"
                     /db_xref="GI:493203824"
                     /translation="MPVFSKLGLKPGAIANKGRHIVIDGVADGFEAFCLARLVEEIGE
                     RGPIMYIVRDGQRIADLEQVLGFVSPDLPVLHLPAWDCLPYDRVSPGADAAARRLAAL
                     SALCALKKAPHPAVILTTANAVLQKLPPQAALGEQVISARPGNQLDMNDLAARLERNG
                     FERVSTVRDIGEYAVRGGILDLYAPGAEEPLRLDFFGDTLETIRAFDPASQRTTGTRK
                     EFVLQPMSEITLSSDMISRFRKNYVATFGAPQRDDALYQAISEGRRFAGMEHWLPLFY
                     DNLETVFDHAGPMPVVFDHLVHEALTERHTMVVDHYEARLRQAEGKEAGSDAVPYKPV
                     KPEMLYLTPGQVEEAAEAAGLRIDLTPFGAPEVSGRTIIHADVHKGRSFAEERAATDV
                     NLFEAVVKHIADLRASGKKVLVAAWTEGSLDRLCQVLDEHGLEKIETVDRLSTVKALS
                     RDKVTAAVLAVESGFDAGDLVVVAEQDILGDRLIRRSRRRKRDQDFISEVASLTAGDI
                     VVHVDHGIGRFIGLKTITAAGAPHDCLEIHYAGDDRLFLPVENIELLSRYGLEGSDAV
                     LDKLGGGAWQARKAKLKKRLLEIAGHLIQIAAERQMRGAPVMTPPDGLYAEFAARFPY
                     DETDDQLTAIEAVADDLAQGKPMDRLICGDVGFGKTEVALRAAFIAAMSGVQVAVVVP
                     TTLLSRQHFKTFSNRFHGLPINVAHASRLVGAKELAATKKGLEEGTVDIVVGTHALLG
                     SSIKFKNLGLLIIDEEQHFGVKHKERLKELKSDVHVLTLSATPIPRTLQLALTGVREL
                     SLITTPPVDRMAVRTFVSPFDPLVIRETLLRERYRGGQSFYVVPRIADLTDIEEFLKE
                     HVPELKVAVAHGQMAPGVLDDIMNAFYDGQYDVLLSTTIVESGLDIPTANTMIVHRAD
                     MFGLAQLYQLRGRVGRSKQRAFALFTLPAGKMLTQMAERRLKVLQSLDTLGAGFQLAS
                     HDMDIRGAGNLLGEEQSGHIKEVGFELYQQMLEEAVATLKGSGEVEDSQWSPQIAIGT
                     AVMIPEAYVPDLQLRLGLYRRLADLEEPQDIDAFGAELIDRFGPMPDEVQHLLKIVYI
                     KALCRRANVEKLDAGPKGVVIQFRHATFNNPVGLVKMIGEQGSMAKIRPDQSIVFIRD
                     WPTPEKRLNGSAVIMTQLAKIAAA"
     gene            complement(561347..561634)
                     /locus_tag="BSVBI22_RS12750"
                     /old_locus_tag="BSVBI22_B0574"
     CDS             complement(561347..561634)
                     /locus_tag="BSVBI22_RS12750"
                     /old_locus_tag="BSVBI22_B0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966054.1"
                     /db_xref="GI:489055909"
                     /translation="MTGSTMATENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVS
                     FNDDQLNEFEHILEVLDRDLLKWVTGESPIPAEYDTPLFRDIVAFRDRVEF"
     gene            561785..563893
                     /locus_tag="BSVBI22_RS12755"
                     /old_locus_tag="BSVBI22_B0575"
     CDS             561785..563893
                     /locus_tag="BSVBI22_RS12755"
                     /old_locus_tag="BSVBI22_B0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_032448589.1"
                     /db_xref="GI:694105706"
                     /translation="MRPSMLDPFFASVRSLSGIGPKVAVLLGKLLGTDVPGGEPKIGQ
                     LLFLPPHSIIDRRNRPGIAFAQEGAIVTLEVTVDQHQPAPKGRGNVPHRVFAHDDTGE
                     IALTFFHAQLPWLQKMLPEGETVIVSGKVEWFNGRASMVHPDYIASMDDAASLPLVEP
                     VYPLTAGLSPKTLGRAIKEALTRVPVLPEWIDAPLLAREGFPAFQQALNTLHQPEDPG
                     DIALESITRRRLAYDEFLAGQLALALVRAKTRRLSGRPLEGTGNIVAEIMRHLPYRLT
                     KAQEQAVREIITDLKSPQRMLRLLQGDVGSGKTVVGLLSMAHAAESGGQSALMAPTEV
                     LARQHFATIAPLAEKAGLKAALLTGREKGRERNAVLEGLKSGEIDIVIGTHALFQEKV
                     EYHDLVFVIIDEQHRFGVHQRLMLTAKGSAPDMLVMTATPIPRTLVLTAFGDMDVSKL
                     TEKPVGRQPITTAIVPMERMGELVERIRKAVSEDQKIYWICPLVEESEVVELTSAEER
                     FESLKSVFGERIGLIHGRMSGAEKDEAMRAFKQGETRLLVATTVIEVGVDVPDATIIV
                     IEHAERFGLSQLHQLRGRVGRGDKPSTCLLLYKGPLGEIAQARLKVMRETEDGFRIAE
                     EDLKLRGEGELLGTRQSGTPGFRLASIEAHGDLLEIARKDARYILASDPDLESERGQA
                     LRVLLYLFGRDEAIRLLRAG"
     gene            complement(564048..565871)
                     /locus_tag="BSVBI22_RS12760"
                     /old_locus_tag="BSVBI22_B0576"
     CDS             complement(564048..565871)
                     /locus_tag="BSVBI22_RS12760"
                     /old_locus_tag="BSVBI22_B0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510617.1"
                     /note="Catalyzes the first step in hexosamine metabolism,
                     converting fructose-6P into glucosamine-6P using glutamine
                     as a nitrogen source; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--fructose-6-phosphate aminotransferase
                     [isomerizing]"
                     /protein_id="WP_004689005.1"
                     /db_xref="GI:490826915"
                     /translation="MCGIIGIIGNDEVAPRLVDALKRLEYRGYDSAGIATLQNGRLDR
                     RRAEGKLVNLEKRLAGEPLPGVIGIGHTRWATHGRPVERNAHPHITTRLAVVHNGIIE
                     NFAELRAMLEAEGRKFETETDTEAVAHLVTRELEKGKSPVEAVRDCLPHLKGAFALAF
                     LFEGDEELLIGARQGPPLAVGYGEGEMFLGSDAIALAPFTDTISYLEDGDWAVLTRNG
                     VSIYDENNKPVERPVQKSQNTNMLVSKGNHRHFMQKEMFEQPEVISHTLANYLDFTTG
                     KVRKEAIGIDFSKVDRLTITACGTAYYAATVAKYWFEQIARLPVDSDIASEFRYREMP
                     LSKDSLAMFVSQSGETADTLASLRYCKAQGLKIASVVNVTGSTIARESDAVFPTLAGP
                     EIGVASTKAFTCQLSAMASLAIAAARARGAIDEVREQELVHQLSEAPRFINQVLKLED
                     QIAAVCHDLSKVNHVLYLGRGTSFPLAMEGALKLKEISYIHAEGYAAGELKHGPIALI
                     DETMPVIVIAPSDRLYEKTVSNMQEVAARGGRIILITDKKGAESASIDTMATIVLPEV
                     PEFISPLVYALPIQMLAYHTAVLMGTDVDQPRNLAKSVTVE"
     gene            complement(565975..567339)
                     /gene="glmU"
                     /locus_tag="BSVBI22_RS12765"
                     /old_locus_tag="BSVBI22_B0577"
     CDS             complement(565975..567339)
                     /gene="glmU"
                     /locus_tag="BSVBI22_RS12765"
                     /old_locus_tag="BSVBI22_B0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364306.1"
                     /note="forms a homotrimer; catalyzes the acetylation of
                     glucosamine-1-phosphate and uridylation of
                     N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
                     function in cell wall synthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein GlmU"
                     /protein_id="WP_004689006.1"
                     /db_xref="GI:490826916"
                     /translation="MTDRTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVR
                     GTGKSDVALVVGRGAEDVRSAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDL
                     LIVFGDTPLIEAQSLLAARERLAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEK
                     EATDEQKKIGFCNGGLMALRGQHALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTA
                     IEVPVDNVIGINNRAELAEAETIWQNRKRRELMLSGVTLIAPETVFFSYDTVIEPDVV
                     IEPNVFFGPSVHVASGALIHSFSHLEGAQVGEKAEIGPFARLRPGADLAEKSKVGNFC
                     EVKNAKVGKGAKINHLTYIGDAVIGASSNIGAGTITCNYDGYNKFKTIIGDNAFIGSN
                     SSLVAPVEIGDNAYIASGSVITADVPADALALGRARQETKEGRAKILREKYAAIKAAK
                     SVSK"
     gene            complement(567421..568167)
                     /locus_tag="BSVBI22_RS12770"
                     /old_locus_tag="BSVBI22_B0578"
     CDS             complement(567421..568167)
                     /locus_tag="BSVBI22_RS12770"
                     /old_locus_tag="BSVBI22_B0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="WP_002966050.1"
                     /db_xref="GI:489055905"
                     /translation="MLDISYMTAAGAGALSFLSPCVLPLVPPYLCYMAGVSVEDFRAD
                     ASKATAKPSARRSLGFAALCFVLGFTTVFVALGAGASSIGAFLRTWQQQIAIVAGVVI
                     ILMGLNFLGLLRLSFLSREARFQARNAPASPLGAYIMGLAFAFGWTPCIGPVLGPILT
                     LAGGSSTVGEGALLLATYSLGLGIPFLIAALFSGAFMRFLSRFRVHLGKVEKAMGVLL
                     IIAGVVFLTGGMQSFSFWLLENFPALGRLG"
     gene            568355..570973
                     /locus_tag="BSVBI22_RS12775"
                     /old_locus_tag="BSVBI22_B0579"
     CDS             568355..570973
                     /locus_tag="BSVBI22_RS12775"
                     /old_locus_tag="BSVBI22_B0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysylphosphatidylglycerol synthetase"
                     /protein_id="WP_004689007.1"
                     /db_xref="GI:490826917"
                     /translation="MSLIDDEIPSSQPQVSGRHFGWLKQYQHFLFPIAGIAIALLAIY
                     VLENLLRHTSRTETLAALHNISWTTLALAVFFTALSYAAVALYDVVAVDTIAPNQIPR
                     RIAAVAGAAGYAISNALGFSLLTGGALRYRIYAAEGISLADIGKIVGTSWFAIWFALI
                     IMVGAALLIDPQDVPFLSAIDIRIDIVAGILILGGIGWLIYWLSHGERNVSIGSFSLR
                     LPNSKGALTQIFAGVVDVGAAAATLYVLLPEGAVPSFAVFALVYVIAIVLGIASHAPG
                     GLGAFEATIIAGLGLGGKPDAIAGLLAYRLIYTVLPLVVATAGILIWEVMRRRHMLDK
                     QARFAKRLVEPLVPGLSASIIFLGGIILLISGATPDMRYRVKLLSDIVPEFLVEMSHL
                     AASLVGVALLIVARGLSKRLERAWVAAMVLLLCGAVFSIAKGLDWEEASILCLFALSL
                     WGFRDSFYRRPIAGPFELSWNWIATVGTTVLVSTWLGFFVYRHIEYSSDLWWDFAWNG
                     NAPRFLRATVLVFAVVAAVGLHSIINRHGQRRRKVDHSIPDAVPALVARCPHTDAALA
                     MLGDKQFLLAPDDSAFIMYAQSGGSLIALGEPIGDAEAGKELAWSFHSLADRLALRTV
                     FYGVGPQSLPLFLDMGLIALKLGEVARVDLTDFSLEGPRRQPFRYADRKVDKDGLTFE
                     IIPAADVPPLIPRLRAISDAWLDHKSGSEKGFSLGYFNDEYLKRFDIAVLKKDGEIVA
                     FANIWRGADKYEITVDLMRYMPNVHKLLMDALFAKLLTFSKQEGYKWFNLGAAPLSGL
                     SGSRLASRWNRFGSFIYRRGADLYHFDGLKAFKEKFDPVWTPHYMVCPGGLETPRALL
                     DATTLINGSPLEFIRK"
     gene            571222..572382
                     /locus_tag="BSVBI22_RS12780"
                     /old_locus_tag="BSVBI22_B0580"
     CDS             571222..572382
                     /locus_tag="BSVBI22_RS12780"
                     /old_locus_tag="BSVBI22_B0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014008520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor"
                     /protein_id="WP_011069144.1"
                     /db_xref="GI:499381573"
                     /translation="MDAMLARNIIVMPVELGPWRAALDKEDGECNYLDSDFEAIAKEA
                     LRGLDLGVYFHPVLTGIGQGATIAYAAASDSPDATIAGAVSLDPTPARTRLPSCTEKA
                     EAIKGPDGGFTYSVNAALPAPALLISPPGSPVNNPVEARRKNIAVLQTAPDFSARMKM
                     AVDNVVAMADQDAKNEALPIIDLPAKGGNADMVAVFYSGDGGWRDIDKSIGEWLQAHG
                     VHVIGVDSLRYFWSERTPEEIANDTTAMIKKADPTGKLPVAVLGYSFGADTFPFAWKY
                     LDPSIQDRTRMVGLLGVETTTTFQVSIEGWLGMNGDKDVVPAIASIPLDRVVCVYGQE
                     EDDTACTADELKGMDTIKLPGGHHFDENYEPIAAALLDKMRSRAGLPPRPAR"
     gene            complement(572467..572542)
                     /locus_tag="BSVBI22_RS12785"
                     /old_locus_tag="BSVBI22_Bt04"
     tRNA            complement(572467..572542)
                     /locus_tag="BSVBI22_RS12785"
                     /old_locus_tag="BSVBI22_Bt04"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(572507..572509),aa:Lys,seq:ttt)
     gene            complement(572886..573386)
                     /locus_tag="BSVBI22_RS12790"
                     /old_locus_tag="BSVBI22_B0581"
     CDS             complement(572886..573386)
                     /locus_tag="BSVBI22_RS12790"
                     /old_locus_tag="BSVBI22_B0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004687275.1"
                     /db_xref="GI:490825185"
                     /translation="MLKSLKKVMVGMLGATFLISALAPVSAAPTMLSAPAVANENLQQ
                     VRDHRWGGGDRHWGGHRPGYRPGWQGRPGYWNGHRGYRYYRHGYRRHSDGWWYPLAAF
                     GAGAIIGGALAAPPPPPPPVYPAPAYRYSNAHIQWCYNRYKSYRASDNTFQPYNGPRQ
                     QCYSPY"
     gene            573626..575095
                     /locus_tag="BSVBI22_RS12795"
                     /old_locus_tag="BSVBI22_B0582"
     CDS             573626..575095
                     /locus_tag="BSVBI22_RS12795"
                     /old_locus_tag="BSVBI22_B0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="blue-light-activated histidine kinase"
                     /protein_id="WP_002971240.1"
                     /db_xref="GI:489061201"
                     /translation="MAIDLRPFIPFGRGALSQATDPFRAAVEFTLMPMLITNPHLPDN
                     PIVFANPAFLKLTGYEADEVMGRNCRFLQGHGTDPAHVRAIKSAIAAEKPIDIDIINY
                     KKSGEAFWNRLHISPVHNANGRLQHFVSSQLDVTLELSRLVELEKERKTLSIETARSK
                     DQLDYIVEVANIGFWTREFYSGKMTCSAECRRIYGFTPDEPVHFDTILDLVVLEDRMT
                     VVQKAHQAVTGEPYSIEYRIVTRLGETRWLETRAKALTGENPLVLGIVQDVTERKKAE
                     ANKALVSREIAHRFKNSMAMVQSIANQTLRNTYDPEQANRLFSERLRALSQAHDMLLK
                     ENWAGATIQQICATALAPFNSTFANRIHMSGPHLLVSDRVTVALSLAFYELATNAVKY
                     GALSNEKGVINITWAIMEDKGEKKFHMRWAESRGPEVMQPARRGFGQRLLHSVLAEEL
                     KAKCDVEFAASGLLIDVLAPITPEVFPGMGHNVPEQRIA"
     gene            575223..576026
                     /locus_tag="BSVBI22_RS12800"
                     /old_locus_tag="BSVBI22_B0583"
     CDS             575223..576026
                     /locus_tag="BSVBI22_RS12800"
                     /old_locus_tag="BSVBI22_B0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q577Y8.1"
                     /note="lipoyl/octanoyltransferase; catalyzes the transfer
                     of the lipoyl/octanoyl moiety of lipoyl/octanoyl-ACP onto
                     lipoate-dependent enzymes like pyruvate dehydrogenase and
                     the glycine cleavage system H protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octanoyltransferase"
                     /protein_id="WP_004690211.1"
                     /db_xref="GI:490828121"
                     /translation="MPTGKLRQKPPYAAIMTNSPVTPSTETQQPKRDALYARFLPQEA
                     DAPPVEWLIAEGLTDYEEALAFMEARVQAIREGTASELVWLVEHPPLYTAGTSANAED
                     LLTPDRFPVFNTGRGGEYTYHGPGQRVAYVMLDLKRRREDVRAFVASLEQWIIETLAA
                     FNIMGERREDRVGVWVVRPEKPRLADGSMCEDKIAAIGIRLRRWVSFHGIAINVEPDL
                     SHYGGIVPCGISEHGVTSLVDLGLPVTMGDVDVALGKAFESVFGPRQTK"
     gene            complement(576030..576959)
                     /locus_tag="BSVBI22_RS12805"
                     /old_locus_tag="BSVBI22_B0584"
     CDS             complement(576030..576959)
                     /locus_tag="BSVBI22_RS12805"
                     /old_locus_tag="BSVBI22_B0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004687273.1"
                     /db_xref="GI:490825183"
                     /translation="MPKTTGGGVEAHVKGMGFMVLSVLMLPLMDAIGKWLAMMDDLPP
                     ATATFMRFFVQCWLMFFIILVVGGLRALATSHLMGNLLRGALMGFGGLCFFTAVKYMP
                     LADAMAVFFAEPLILTLFSALFLKEKVGWRRFSAVGIGLIGTMIVIQPSFEIFGMVSL
                     LPLATAVTFAIYLILNRKYGAKESPLTMQLYAGLGGWLFVGVAMLLAADRSFDDMHFA
                     LPHSVQPWLLLLLLGTIGTVSHLIVVQAFKLAPASMLAPFQYLEIVNAVLVGLIIFGD
                     FPTPSKWLGIAIIIGSGFYVFMRESKKKTGRIS"
     gene            577264..579363
                     /locus_tag="BSVBI22_RS12810"
                     /old_locus_tag="BSVBI22_B0585"
     CDS             577264..579363
                     /locus_tag="BSVBI22_RS12810"
                     /old_locus_tag="BSVBI22_B0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="WP_006191995.1"
                     /db_xref="GI:493203832"
                     /translation="MDDSNDLFSRVVNNARERQMERQTGENTVAQPVVQPAPSAPKPV
                     PAAAKAPPAASGGDDYNASSIRVLEGLEPVRLRPGMYIGGTDEKALHHLFAEVIDNSM
                     DEAVAGHANFIEVTVDKEGFVTVSDNGRGIPVDKHPQVPGKSTLEVIMTKLHAGGKFD
                     GKAYETSGGLHGVGVSVVNALSDVLEVEVARNRRLYRQCFSRGIPQGGLEELGEVHNR
                     RGTRVRFHPDPEIFGKNAHFDPHRLYRMARSKAYLFGGVEIRWNCDPSLLDPKKETPE
                     KAVFHFPGGLKDYLEASLGKEHQVTREVFAGRTEKQGGHGAVEWAVAWFGGDGFVHSY
                     CNTIPTGDGGTHEAGLRIALTRGLKAYAELTNNKRASIITTDDVMVSAAGMLSVFIRE
                     PEFVGQTKDKLATVEAQRLVENAIRDPFDHWLAASPQEASRLLEWVIDRADERLRRRQ
                     EKETVRKSATRKLRLPGKLADCTQNAAAGAELFIVEGDSAGGSAKQARNRANQAILPL
                     RGKILNVASAGREKLTANQQIADLVQALGCGTRKNYREDDLRYDRVIVMTDADVDGAH
                     IASLLITFFYQEMPELIRNGHLYLAVPPLYRLSQGGKTAYARDDAHKEELLRTVFTGR
                     GKIEIGRFKGLGEMRADQLKETTMDPAKRTLLRVQVDEEYGDETRNTVDDLMGTKPEA
                     RFRFIQDRAAFVEELDI"
     gene            complement(579369..579551)
                     /locus_tag="BSVBI22_RS12815"
                     /old_locus_tag="BSVBI22_B0586"
     CDS             complement(579369..579551)
                     /locus_tag="BSVBI22_RS12815"
                     /old_locus_tag="BSVBI22_B0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966041.1"
                     /db_xref="GI:489055896"
                     /translation="MWIMLTDVSGDKIAVNFNHVLSYNVYGTGTRLVTLSADLTFFVR
                     ESTEEIETRLGIKVRE"
     gene            complement(579785..581266)
                     /gene="gatA"
                     /locus_tag="BSVBI22_RS12820"
                     /old_locus_tag="BSVBI22_B0588"
     CDS             complement(579785..581266)
                     /gene="gatA"
                     /locus_tag="BSVBI22_RS12820"
                     /old_locus_tag="BSVBI22_B0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006468928.1"
                     /note="allows the formation of correctly charged
                     Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
                     of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
                     which lack either or both of asparaginyl-tRNA or
                     glutaminyl-tRNA synthetases; reaction takes place in the
                     presence of glutamine and ATP through an activated
                     phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
                     /protein_id="WP_006191997.1"
                     /db_xref="GI:493203834"
                     /translation="MSELTALTIAEARDKLKAKAITATELTDAYLSAIDAANDAINAY
                     VAVTHDQARSMAKASDERIAKGEAGALEGIPLGVKDLFATKGVHTQACSHILDGFKPE
                     YESTVTANLWADGAVMLGKLNMDEFAMGSSNETSYYGPVKNPWRAKGSNADLVPGGSS
                     GGSAAAVAAHLCAGATATDTGGSIRQPAAFTGTVGIKPTYGRVSRWGTVAFASSLDQA
                     GPIARDVRDAAILMKSMASLDLKDTTSVDLPVPDYEAALGRSVKGMKIGIPREYRVDG
                     MPGEIEELWQKGIQYLKDAGAEIVDISLPHTKYALPAYYIVAPAEASSNLARYDGVRY
                     GLRVPGKDIADMYEQTRAAGFGKEVKRRIMIGTYVLSAGYYDAYYLRAQKVRTLIKKD
                     FEDVFAKGVDAILTPATPSAAFGLADEVLANDPVKMYLNDIFTVTVNMAGLPGIAVPG
                     GLNGQGLPLGLQLIGRPFEEETLFQAAHVIEQAAGRFTPAKWW"
     gene            complement(581325..581612)
                     /locus_tag="BSVBI22_RS12825"
                     /old_locus_tag="BSVBI22_B0589"
     CDS             complement(581325..581612)
                     /locus_tag="BSVBI22_RS12825"
                     /old_locus_tag="BSVBI22_B0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P64204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA amidotransferase subunit C"
                     /protein_id="WP_002966038.1"
                     /db_xref="GI:489055893"
                     /translation="MSVDISTVKRVAHLARIAVSEDDAERMTGELNAILGFVEQLNEV
                     DVEGIEPMTSVTPMKMRMREDKVTDGGIAAAVVANAPVTEDNFFVVPKVVE"
     gene            complement(581707..582420)
                     /locus_tag="BSVBI22_RS12830"
                     /old_locus_tag="BSVBI22_B0590"
     CDS             complement(581707..582420)
                     /locus_tag="BSVBI22_RS12830"
                     /old_locus_tag="BSVBI22_B0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_006133812.1"
                     /db_xref="GI:493096837"
                     /translation="MKITWLGHAAFRVETAKAVILIDPFLNGNPGAKGIDFKGATRGV
                     THIALTHGHGDHVGDTVAIAREHGATVIANADLASWLGSQGVEKLDPGNTGGTLAHEG
                     FTITFVNALHSSAMLTENGVSQALGNPNGLVFHFEDSPTLYHMGDTDIFSDMALINEL
                     HQPEIGIVPIGDRFTMGGAVAALACQRYFNFNSVLPCHYASFPIIDRTADKFIAGMAD
                     HPATKVLADPAGTVHSFQA"
     gene            582520..583008
                     /locus_tag="BSVBI22_RS12835"
                     /old_locus_tag="BSVBI22_B0591"
     CDS             582520..583008
                     /locus_tag="BSVBI22_RS12835"
                     /old_locus_tag="BSVBI22_B0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006236364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase"
                     /protein_id="WP_004684953.1"
                     /db_xref="GI:490822863"
                     /translation="MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPR
                     PVIKRVKFTIDAQVLLKALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTMQPLTD
                     LPFVFWDERLSTVAAERALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMMRRNDYD
                     AG"
     gene            complement(582993..584621)
                     /locus_tag="BSVBI22_RS12840"
                     /old_locus_tag="BSVBI22_B0592"
     CDS             complement(582993..584621)
                     /locus_tag="BSVBI22_RS12840"
                     /old_locus_tag="BSVBI22_B0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_004689010.1"
                     /db_xref="GI:490826920"
                     /translation="MKTHEVTNQTPPITGTNAYLGDPLLMQIAARFPKELHTELEQAG
                     RFVLSAEAQDLARLANTELPKLRTHDRQGRRIDLVEYHPAYHALMRRSVAQGLHSSIW
                     EDNPLESGRRHQARAARFYLTAQLEAGHLCPLTMTSASLAALMASPEVYKQWSPAVLS
                     RKYDFSQKPAFRKQGVTLGMGMTEKQGGTDVRANATRAEPAIGGAWRLTGHKWFMSAP
                     MSDAFLTLAQTKEGLSCFLLPRLGEKGESNGFFFQRLKDKLGNRSNASSEVEFDGALG
                     QMIGSPGEGVKTIMDMVTLTRLDCAVASAGLMRSGLAEAVHHSRHRHVFGKPLVEQPL
                     MQRVLADMALDVAGATALSMRLARAFDMAASDRAEAAFARSMTPVVKYWVCKIAPALL
                     YEAMECLGGNGYIEDGNLARAYREAPVNAIWEGSGNVMALDVARVLSRAPALFDGVLD
                     WISGQLGPRGQGTIDVLRAALQLTETDQGVARLLTEQLAFAAAAAELRQLGADDIADA
                     FIETRLGGQWRTTYGMLDARHNAMRIIDQLYPAS"
     gene            584805..585773
                     /gene="pyrB"
                     /locus_tag="BSVBI22_RS12845"
                     /old_locus_tag="BSVBI22_B0593"
     CDS             584805..585773
                     /gene="pyrB"
                     /locus_tag="BSVBI22_RS12845"
                     /old_locus_tag="BSVBI22_B0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P65612.1"
                     /note="catalyzes the transfer of the carbamoyl moiety from
                     carbamoyl phosphate to L- aspartate in pyrimidine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="WP_002966034.1"
                     /db_xref="GI:489055889"
                     /translation="MTNQTVSPLFPHRHLLGIKGLSPLDILCLLDLADQEIAVSRQPE
                     KKKSVLRGRTQINLFFEASTRTQSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAM
                     TLNAMQPDILVIRHASAGAAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRAKGQ
                     IENLIVAICGDVLHSRVARSNILLLNALGARVRVVAPSTLLPAGMADMSVEVFNSMEE
                     GLKDADVVMMLRLQRERMAGSFVPSVREYFHFYGLDREKLKFAKPDALVMHPGPMNRG
                     VEIASDVADGPQSVIQQQVEMGVAVRMAVMEALLDPRRNPGNGEPA"
     gene            585770..587056
                     /locus_tag="BSVBI22_RS12850"
                     /old_locus_tag="BSVBI22_B0594"
     CDS             585770..587056
                     /locus_tag="BSVBI22_RS12850"
                     /old_locus_tag="BSVBI22_B0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443385.1"
                     /note="Catalyzes the reversible hydrolysis of the amide
                     bond within dihydroorotate. This metabolic intermediate is
                     required for the biosynthesis of pyrimidine nucleotides;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="WP_006192000.1"
                     /db_xref="GI:493203837"
                     /translation="MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAP
                     EGAEIVDLDGKAVMPGLVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMPDTDP
                     VIDDVALVEFVKRTARDTAIVNVHPTAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNT
                     IANTQIMRRALTYARDFNAVIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIP
                     LERDLRLAALTRSRYHAVQLSCAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEF
                     RTFFRLSPPLRGEEDRLAMVEAVKNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLE
                     TLLAAALRLYHNDNIPLLRLVEVLSTAPAKIFGLNAGTLKPGASADIAIVDLEEPWVV
                     REEDLHSRSKNSCFESARFQGRVVRTIVAGKTVYSA"
     gene            587131..587736
                     /locus_tag="BSVBI22_RS12855"
                     /old_locus_tag="BSVBI22_B0595"
     CDS             587131..587736
                     /locus_tag="BSVBI22_RS12855"
                     /old_locus_tag="BSVBI22_B0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_004690218.1"
                     /db_xref="GI:490828128"
                     /translation="MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGS
                     GNIGATNVLRTGNKKLAAATLILDALKGTAAALIAAHFGQNAAIAAGFGAFIGHLFPV
                     WIGFKGGKGVATYLGVLIGLAWAGALVFAAAWIVTALLTRYSSLSALVASLVVPIALY
                     SRGNQALAALFAIMTVIVFIKHRANIRRLLNGTESKIGAKG"
     gene            587733..588914
                     /locus_tag="BSVBI22_RS12860"
                     /old_locus_tag="BSVBI22_B0596"
     CDS             587733..588914
                     /locus_tag="BSVBI22_RS12860"
                     /old_locus_tag="BSVBI22_B0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA processing protein DprA"
                     /protein_id="WP_004690219.1"
                     /db_xref="GI:490828129"
                     /translation="MKQGANPKTGIRLSDRQRLNWLRFIRTDNIGAVTFRDLILFCGS
                     ASNALEMLPDLNIRGGSARPIRIISVDEAERELEAIERMGARLIGMGEPEYPPQLKNC
                     EAPPPLVIIKGDPGVFRKPPVAIVGSRNASVVGARFTEKLAHDLGSEGFCVVSGLARG
                     IDAAAHKASLSTGTAAVLAGGLDRPYPPENLPLYRAIPENGGALITEMPMGAEPRSRD
                     FPRRNRIIAGLSLGLIVVEAAERSGSLISARMAGEMGRTVFAVPGSPLDPRARGTNLL
                     LKQGATLVTGVEDVIETLLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERD
                     LVIDALGPVPVDVDTLVRHTGIETDAIQLILLELDLAGRLLRYPGNRVAIVPCDEFTQ
                     A"
     gene            complement(588924..589091)
                     /locus_tag="BSVBI22_RS12865"
                     /old_locus_tag="BSVBI22_B0597"
     CDS             complement(588924..589091)
                     /locus_tag="BSVBI22_RS12865"
                     /old_locus_tag="BSVBI22_B0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192003.1"
                     /db_xref="GI:493203840"
                     /translation="MQRRATRREMFIYIEQLIDELAKLAKQAQNPMLVYSLEMAQEEA
                     RDSIEQVTAQD"
     gene            589347..591980
                     /locus_tag="BSVBI22_RS12870"
                     /old_locus_tag="BSVBI22_B0598"
     CDS             589347..591980
                     /locus_tag="BSVBI22_RS12870"
                     /old_locus_tag="BSVBI22_B0598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014517394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="WP_004690220.1"
                     /db_xref="GI:490828130"
                     /translation="MNVVVVESPAKAKTINKYLGSDYKVLASFGHVRDLPAKDGSVRP
                     DEDFAMSWEVDSNSAKRLADIVKALKDSDGLILATDPDREGEAISWHVLEVLRQKKAL
                     NGKTVKRVAFNAITKKAVLDAIAHPRDIDEPLVDAYLARRALDYLVGFTLSPVLWRKL
                     PGARSAGRVQSVALRLVCDREAEIERFVREEYWNIAALLKTPRNDSFTARLTALDGKK
                     LGKLDIKNGEQAGAIRTMLESANFKAVSVEAKPTKRNPGPPFTTSTLQQAASGQLGFS
                     ASRTMQVAQRLYEGVDIGGETAGLITYMRTDGVQIAPEAINAARDAIAKSFGAKYVPE
                     KPRYYSSKAKNAQEAHEAIRPTDFSRHPKDVRRFLDEDQARLYELIWKRAIASQMQAA
                     DIERTTVDIEATNGSRAAMLRANGSVTKFDGFLAAYMDHREEEDDDEESAKLPEIRSG
                     EALAREKIDATQHSTEPPPRYSEATLIKKMEELGIGRPSTYAATLATLRDREYIIIDK
                     RKLIPEAKGRLVTAFLESFFERYVEYDFTADLEEKLDLISDGKLSWKEVLRDFWRAFS
                     GSVEDIKELRITNVLDALNEELAPLVFPAREDGSDPRSCPTCGTGTLSLKLGRYGAFV
                     GCSNYPECKYTRQLGGEANGETAASDEPKPLGKDPFTGEEITARTGRFGPYIQRGEGK
                     EAKRASLPKGWTLDTVDHEKAIALLSLPRNIGLHPETGKMISAGIGRYGPYVSHDGTF
                     ANLENVEEVFSVGLNRAVSVLADKQSKGGGRGRSTPAALATLGDHPDGGAITVRDGRY
                     GPYVNWGKVNATLPKGKDPASVTLEEALALITEKAGSSKGRKAPARKSAASSEKKTTA
                     KKTATKKAPAKAKSKAKAAEE"
     gene            591984..594335
                     /locus_tag="BSVBI22_RS12875"
                     /old_locus_tag="BSVBI22_B0599"
     CDS             591984..594335
                     /locus_tag="BSVBI22_RS12875"
                     /old_locus_tag="BSVBI22_B0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="WP_006192007.1"
                     /db_xref="GI:493203844"
                     /translation="MARRFSKSDTGRSARTERRAATAQSKDSAAFLPTREEVLKYIEE
                     NPDRAGKRELAKAFNIEGDARVYLKDLLRELADEGLVEKRARKLSRPGSLPSVAVLDI
                     TGRDEDGGLLARPAEWVEASHGKPPVVLLRRTRLNKTSESGPVVGVGDRVLAKIFRNE
                     DHAGPDFSARVMKRLEHHANAVLGVVRKLGNGEWRLEPVNRKQGEVQLDPAMLENAES
                     GDLVEVELLSARRYGLPRGKVRQVVGSIDSEKALSMIAIHEHEIPHVFPDEVLREAET
                     AGPATLEGREDWREIPLITIDPADAKDHDDAVYAEPDTDPENPGGQVVIVAITDVAAY
                     VRPGSALDREAQKRGNSVYFPDRVVPMLPERISNDLCSLREMEDRPALTVRMIFSADG
                     RKKSHKFHRIMMRSAAKVAYGQAQAAIDGAPDDKTGPILDTVLKPLWSAYAVLKRGRD
                     AREPLELDLPEKKILLTPEGKVDKVIVPERLDAHKLIEEFMIQANVSAAETLEGRHQP
                     LIFRIHGEPALAKQETLREFLRTLDLNLAKGAQLQPAQFNRILAAVDGTDHQELVNQV
                     VLRTQSQAEYSPDNIGHFGLHLRRYAHFTSPIRRYADLIVHRALIKALGLGTDGLTSA
                     EEAQLEEISALISATERRAMLAERETVDRLIAHFLASHLGDEYEGRVTGVTRAGLFVN
                     LATYGADGLVPISTLGHEYYLYDEANHAIAGERSGRGFRLGDTVTVRLVEALPVAGAL
                     RFEMVSEPHPLPMSTRSHHKASRAMRGRKGKPAGIPRHKRRGH"
     gene            594335..594796
                     /locus_tag="BSVBI22_RS12880"
                     /old_locus_tag="BSVBI22_B0600"
     CDS             594335..594796
                     /locus_tag="BSVBI22_RS12880"
                     /old_locus_tag="BSVBI22_B0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004689015.1"
                     /db_xref="GI:490826925"
                     /translation="MSTLEANSEQNMQVFGGKNPKAILPKRPVGEALWRGFRCRCPHC
                     DEGKLFRAFVKPVDKCMACGEDYTEQRADDLPAYLTILVVGHIVVGLFMGVEATTNLS
                     LWAHMAIWGPMTLIMSLLLLQPIKGSVIGLQWALYMHGFGGENESEYGDAA"
     gene            594805..595536
                     /locus_tag="BSVBI22_RS12885"
                     /old_locus_tag="BSVBI22_B0601"
     CDS             594805..595536
                     /locus_tag="BSVBI22_RS12885"
                     /old_locus_tag="BSVBI22_B0601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_004684950.1"
                     /db_xref="GI:490822860"
                     /translation="MSEPKPIPAKPRRCLRPRDAASLLLVDRSGATPRILMGRRHSSL
                     AFMPGKFVFPGGRADPADGAIAAASELSQNDTQKLLKGMGARASLRRARALGLCAIRE
                     TFEETGLRIAHPASAHIVPPKHEDWCAFLERGMLPQLDSLRYFARAVTPPGNVRRFDT
                     RFFIAFRDSLPEVETQKLVPSGELEDLDWVLIDQIEKLDLARITQAILNEATALLMDT
                     QLDLPATLPVVQYSKRHDRFVREVI"
     gene            595611..596753
                     /locus_tag="BSVBI22_RS12890"
                     /old_locus_tag="BSVBI22_B0602"
     CDS             595611..596753
                     /locus_tag="BSVBI22_RS12890"
                     /old_locus_tag="BSVBI22_B0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="WP_004690223.1"
                     /db_xref="GI:490828133"
                     /translation="MHWRSLAAAIATISAVGAAIGLGIPLLSVLLESRGYSASLIGAN
                     TAVAGLASIAAAPLAAPIAARLGVVKAILLMLLIGGGAFLGFHFLQPLWAWFALRVML
                     HFALTVLFVLSEYWINASAPPEKRGLVLGIYSTSLSLGFALGPWLFSKIGSTGGLPFY
                     VGFAIIMVALIPVLVAWRDSPDFEEGEHVPFLPFIFAVPTATMAVFVFGAVETGGFAL
                     FPVFGTRVGYSEADAALLLTMIGLGNVLMQIPLGIVSDRISDRRKLLLFCATTGLIGM
                     MALPYLMQHWYFMAGILFLWGGVVAGLYTVGLAHLGSELTGRELASANAAFIFCYAIG
                     MLAGPQLVGIGMDAMGPKGFPMTLGIFFAAYALFAAVRLLLRKKQS"
     gene            596912..597079
                     /locus_tag="BSVBI22_RS12895"
                     /old_locus_tag="BSVBI22_B0603"
     CDS             596912..597079
                     /locus_tag="BSVBI22_RS12895"
                     /old_locus_tag="BSVBI22_B0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q92QM4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_002966024.1"
                     /db_xref="GI:489055879"
                     /translation="MAKATTIKIKLLSTADTGFFYVTKKNSRTMTEKMTKTKYDPIAR
                     KHVEFKETKIK"
     gene            complement(597186..598571)
                     /gene="pleD"
                     /locus_tag="BSVBI22_RS12900"
                     /old_locus_tag="BSVBI22_B0604"
     CDS             complement(597186..598571)
                     /gene="pleD"
                     /locus_tag="BSVBI22_RS12900"
                     /old_locus_tag="BSVBI22_B0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643297.1"
                     /note="involved in swarmer-to-stalked cell differentiation
                     in Caulobacter crescentus; catalyzes the condensation of
                     two GTP molecules to form the secondary messenger cyclic
                     di-GMP (c-di-GMP); upon phosphorylation of domain D1 the
                     protein dimerizes; presumably this allows the two
                     GTP-bound GGDEF (diguanylate cyclase) domains to catalyze
                     the condensation reaction; allosterically inhibited by
                     c-di-GMP; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_004681910.1"
                     /db_xref="GI:490819813"
                     /translation="MTARILVVDDVDSNVKLLEARLLSEYYEVVPAYSGAEAIEICLD
                     GQIDIVLLDVLMPGLDGFEVCRRLKANPRTANIPVIMITCLTSPEDKVRGLEAGAEDF
                     LSKPVNDLELLSRLKSLTRLKMMSDELFQRAGRIADAEVDALLARKMAGKDGNKDEIA
                     RILVVDEDELAAARLRHILDENYRVDVASDAETALIRAIETDYDTIIVSASFTYYDPL
                     KLCTQLRTIQRTRLIPIILMVWEDEGALVVRALELGVNDYLMRPLEKIELFARLRTQI
                     KRKCYNDILRQSMERTITQSVTDGLTGLHNRRYIDMHMPLLLTRAIERKQPLSIIMID
                     LDHFKQVNEQYGHGAGDHVLREFSGRLRRNIRGMDLISRYGGEEFVVVLPDTDRQAAF
                     NVAERVRGIVAEAPFVLDDGKRRASLTVSVGVAALRPAGDSLEALFTRATDALIQAKQ
                     SGRNRIVLSAA"
     gene            complement(598692..599063)
                     /locus_tag="BSVBI22_RS12905"
                     /old_locus_tag="BSVBI22_B0606"
     CDS             complement(598692..599063)
                     /locus_tag="BSVBI22_RS12905"
                     /old_locus_tag="BSVBI22_B0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7BBW0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polar-differentiation response regulator DivK"
                     /protein_id="WP_002966022.1"
                     /db_xref="GI:489055877"
                     /translation="MTKSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLARE
                     HHPDLILMDIQLPEVSGLEVTKWLKDDEELRHIPVIAVTAFAMKGDEERIRQGGCEAY
                     ISKPISVPRFIETIKSYLGDA"
     gene            599244..599531
                     /locus_tag="BSVBI22_RS12910"
     CDS             599244..599531
                     /locus_tag="BSVBI22_RS12910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966021.1"
                     /db_xref="GI:489055876"
                     /translation="MKKLMSEADAQGLAIEALAWLAQDKDLLPRFLALTGIEASSIRQ
                     AAREPGFLAGVLQFFLGHEPTLIRFCEETGHDPALFEKAVALLPGGFNQHL"
     gene            complement(599587..600096)
                     /locus_tag="BSVBI22_RS12915"
                     /old_locus_tag="BSVBI22_B0608"
     CDS             complement(599587..600096)
                     /locus_tag="BSVBI22_RS12915"
                     /old_locus_tag="BSVBI22_B0608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase regulator"
                     /protein_id="WP_002966020.1"
                     /db_xref="GI:489055875"
                     /translation="MNGKNRKKPNIVVSEVDYERLMGLASNASERFEEIAEELMAELD
                     RAKVVTAKRIPENVVQMGSTVEFRANDGHERRVTLVYPGEADIAKNRISILTPIGTAL
                     IGLAPGQSISWTARDGKQHELNVLKVMRTDEAAEEVRAEAGNVVAFAGRDAVGVASED
                     DNDPGPSAA"
     gene            600547..601884
                     /locus_tag="BSVBI22_RS12920"
                     /old_locus_tag="BSVBI22_B0609"
     CDS             600547..601884
                     /locus_tag="BSVBI22_RS12920"
                     /old_locus_tag="BSVBI22_B0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799884.1"
                     /note="involved in translesion DNA polymerization with
                     beta clamp of polymerase III; belongs to Y family of
                     polymerases; does not contain proofreading function;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="WP_004692237.1"
                     /db_xref="GI:490830151"
                     /translation="MAESPIVNHPEQGLCRDCLSLQKTQTSRRCHACGSPRLIRHKEL
                     YRLSLAHVDCDAFYASVEKRDNPDLRDKPLIVGGGKRGVVSTACYLARIHGVRSAMPM
                     FKALEACPDAVVIKPNMEKYARVGREVRQMMRDLTPLVEPISIDEAFLDLSGTERLHK
                     APPAVVLARFSKRVENEIGITASIGLSYCKYLAKVASDLEKPRGFSVIGEAEALDFLR
                     DKPVGMIWGVGKAFAAKLESDGIRTIGQLQTMEEGALMKAYGTMGQRLYRLLRGQDSR
                     KVEPDHDMKSVSAETTFNTDLSAAGDLVPVLRALSEKVSRRLKAGEIAGRTIVLKLKT
                     QDFKLRTRNRQLGDPTQLADRIFRTGLQLLEKEMDGTRFRLLGIGVSDLSPSDRADPP
                     DLVDIQATKRAVAESAIDRLRNKFGLNAVETGYTFSKGNLARTQTPTDRDNEP"
     gene            602060..604249
                     /locus_tag="BSVBI22_RS12925"
                     /old_locus_tag="BSVBI22_B0610"
     CDS             602060..604249
                     /locus_tag="BSVBI22_RS12925"
                     /old_locus_tag="BSVBI22_B0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_004690225.1"
                     /db_xref="GI:490828135"
                     /translation="MSKRSLTFALLTALSASVAFSASAEPVFNRIASFAVAENLPEGA
                     DRSKPTSSEIITVSEDGKTLIYSDSPYGAIGFIDITGPAAPKAGGLLKVEGEPTSVVV
                     AGPRVFAGVNTSESYKNPSGRLDVIDIASRKVEQSCDLGGQPDSVATSPDRKFLAVAI
                     ENERDEEFNNGELPQMPGGNLKIIELKDGKPDCAAMKTVDLTGIAEIAPEDPEPEFVA
                     FNGKNEIAITLQENNHIAIVDAASGKILSHFSAGSVDLDKIDTKKDGQIKFNGEMKGV
                     NREPDSVKWLDDDRIVIANEGDYKGGSRGFSIFSKDGKLLHESGNTLEHRIARAGHYP
                     EKRNKKGVEIEGAEAAIFGDTHYIFAASERGSVVGVYKDTGKEPEFLQLLPSGIGPEG
                     LLAIPSRKLFVTANETDLVKDGGARSHVMIYELQDKPAAYPQIVSNLAEDGTPIGWGA
                     LSGLVADPQKDGIFYAVSDSAYYAAPTIYTIDANTKPAKITAALLVKRGKDAAQKLDL
                     EGITTDGEGGFWLANEGNQAKLVPHAILNVDEKGVIRKEVALPADLLKQQTRFGLEGI
                     TRLGEGDDAVLWMAVQREWADDDKGQVKLLAYSPKDESWKAVAYPLDAKEKGWVGLSE
                     ITAHDGNLYIIERDNLIGTEAVNKRLYKVALDGLKPVAIGAKLPVVKKTLVHDFISDL
                     KKLNGFVPDKLEGFAITRTGNAYAVTDNDGVDGSSGETQFFSIGKID"
     gene            604439..604512
                     /locus_tag="BSVBI22_RS12930"
                     /old_locus_tag="BSVBI22_Bt05"
     tRNA            604439..604512
                     /locus_tag="BSVBI22_RS12930"
                     /old_locus_tag="BSVBI22_Bt05"
                     /product="tRNA-Cys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:604471..604473,aa:Cys,seq:gca)
     gene            complement(604778..605500)
                     /locus_tag="BSVBI22_RS12935"
                     /old_locus_tag="BSVBI22_B0612"
     CDS             complement(604778..605500)
                     /locus_tag="BSVBI22_RS12935"
                     /old_locus_tag="BSVBI22_B0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_002968440.1"
                     /db_xref="GI:489058342"
                     /translation="MAGLQLPSGNVWRRTVIVAVIATIISISLSTGIRFALGVKSDTV
                     TILVRLLLPFLIAMPLGVFWFSRLEELERSYRTAVKRANELARVASVDPLTGLLNRRS
                     FIQQFNAANKAGVRGWFLIVDVDYLKQINDQYGHPAGDDAIIAVAQALEDCLSSDSLI
                     ARIGGDEFCAFVPKGAINDVDSVLSDISLRADGLLREKRPNVGSSLTVSVGRISCKTG
                     QIFEEVLSIADEQLYRKKSQRQ"
     gene            complement(606398..606775)
                     /locus_tag="BSVBI22_RS12940"
                     /old_locus_tag="BSVBI22_B0615"
     CDS             complement(606398..606775)
                     /locus_tag="BSVBI22_RS12940"
                     /old_locus_tag="BSVBI22_B0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="WP_006073748.1"
                     /db_xref="GI:492972154"
                     /translation="MTRINCIPPAELTGPHLVAEYRELPRVFALVRAAIQRGEAPQDS
                     RNPQQYTLGAGHVRFFYARLGYLAKRQAALIAEMQARGYAPQFTNIEELLIGIPLEWR
                     ADWEPTAEAIAINRTRIAERLRR"
     gene            606916..607221
                     /locus_tag="BSVBI22_RS12945"
                     /old_locus_tag="BSVBI22_B0616"
     CDS             606916..607221
                     /locus_tag="BSVBI22_RS12945"
                     /old_locus_tag="BSVBI22_B0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002971236.1"
                     /db_xref="GI:489061197"
                     /translation="MNVANLQLEGLCLAIAAINHALVEKGILSQLEIDEALRKAEATA
                     RGDNRFIEDLKPSNRDAICFPIRVLQIANDTGAERPWTFSELARLVGGIKEPYNDML"
     gene            607366..607554
                     /locus_tag="BSVBI22_RS12950"
                     /old_locus_tag="BSVBI22_B0617"
     CDS             607366..607554
                     /locus_tag="BSVBI22_RS12950"
                     /old_locus_tag="BSVBI22_B0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966014.1"
                     /db_xref="GI:489055869"
                     /translation="MLPQTERFNVEVEASNEAEIFELQMQQRTARLVRYGIFAAAILL
                     EILFLVFVVISHSNFFQV"
     gene            607701..607898
                     /locus_tag="BSVBI22_RS12955"
     CDS             607701..607898
                     /locus_tag="BSVBI22_RS12955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969331.1"
                     /db_xref="GI:489059260"
                     /translation="MIYPIHDQYGARIGTVMTEEGNPPQERWVAYTLHGERKAFASWD
                     AAQQWVGETASQPVRNDSPTA"
     gene            607959..608666
                     /locus_tag="BSVBI22_RS12960"
                     /old_locus_tag="BSVBI22_B0619"
     CDS             607959..608666
                     /locus_tag="BSVBI22_RS12960"
                     /old_locus_tag="BSVBI22_B0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_006133824.1"
                     /db_xref="GI:493096852"
                     /translation="MVLCLAGTGQSMTDIYNPSIHTRKKRVIVFDTETTGILPYDRII
                     TLGAVKIEGGELLTQSLYLIFDPRKDSSPQAEAVHGFDNWMTRYQDLFHELAAPIRKW
                     FSWADEVVAHNAQFDMHYIQREFRKAEVDMLDQPVYCTMDGARRLWRGDSTKLDHCLA
                     KIGLARMGHRHGALEDAYLTAGLYLHQQGVAKPLPKINSWQPPKNLKPYPERPAGELP
                     RRTPKRRSAAVSACSTV"
     gene            complement(608800..608874)
                     /locus_tag="BSVBI22_RS12965"
                     /old_locus_tag="BSVBI22_Bt06"
     tRNA            complement(608800..608874)
                     /locus_tag="BSVBI22_RS12965"
                     /old_locus_tag="BSVBI22_Bt06"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(608840..608842),aa:Asn,seq:gtt)
     gene            609042..609323
                     /locus_tag="BSVBI22_RS12970"
                     /old_locus_tag="BSVBI22_B0620"
     CDS             609042..609323
                     /locus_tag="BSVBI22_RS12970"
                     /old_locus_tag="BSVBI22_B0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966011.1"
                     /db_xref="GI:489055866"
                     /translation="MTEEYTDFPRKRAIVILGRRIPMPQSVMMRRTLGGTLMVGGALG
                     FLPILGFWMLPLGLIVLSHDSHRVRRLRRRSEVHIWRKWLKRGSASQGE"
     gene            complement(609424..610194)
                     /locus_tag="BSVBI22_RS12975"
     CDS             complement(609424..610194)
                     /locus_tag="BSVBI22_RS12975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_004681918.1"
                     /db_xref="GI:490819821"
                     /translation="MDISAQECAFAIILLDAVRNLKWNAGRGEDVIASYPAGNAFVIP
                     PHETIQFSWPLPVEYIYFPVSNRNKASHASEEGATGADAIPSKIIRFSSKQCLQVSQI
                     LWEELQSENSEDHFLQALHLVLTNVVIRNAVMAYDTGGVQPGLSPYACRQIEAYLQEN
                     FRGPVSVPDMAAMLGISAGHFATCFRESFGQTPHRYLLKLRLDEAERCLRETDMPISE
                     IAARLNFSSQSHLTTALRKYRRLTPGKIRQAGASKSRY"
     gene            complement(610738..611988)
                     /locus_tag="BSVBI22_RS12980"
                     /old_locus_tag="BSVBI22_B0623"
     CDS             complement(610738..611988)
                     /locus_tag="BSVBI22_RS12980"
                     /old_locus_tag="BSVBI22_B0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase"
                     /protein_id="WP_004692235.1"
                     /db_xref="GI:490830149"
                     /translation="MPMQQQDVIVLGAGIVGVSTALHLQARGRSVLLIDKGEPGEGTS
                     YGNAGLIERSSVIPYSFPQGLWNLLRYGMNRRSDVRYDPLYLPRIARWLFQYWRESSP
                     ERLKIATQAMLPLVEASVREHDFLVQQAGCAKLIRAQGWIEVFRHAPAFNAAVRRLPD
                     LQRFNLSYDILDAPALRQRETALGEVAGGIHWLDPKTVVNPGGLVKAYADLFRRRGGA
                     MLRGDAASLEATGAGWQVKAQEGHVQAREAVVALGPQSGVIFRKLGYPIPLGIKRGHH
                     LHFNMKDGVRLGHTVVDEEAGYVLAPMVQGVRLSTGIEFASPSAPANRIQLKRAEEIA
                     RRLVPQLGQPVEEKPWLGLRPCLPDMRPVIGEAPRHKGLWFNFGHAHHGLTLGPASGR
                     LLAEMMTGAEPFTDPTPYSAERFS"
     gene            complement(612077..612838)
                     /locus_tag="BSVBI22_RS12985"
                     /old_locus_tag="BSVBI22_B0624"
     CDS             complement(612077..612838)
                     /locus_tag="BSVBI22_RS12985"
                     /old_locus_tag="BSVBI22_B0624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010658897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="WP_002966007.1"
                     /db_xref="GI:489055862"
                     /translation="MLKAIVFAGIASVIAVLPAQAREWKEIRIATEGAYPPFNFVASD
                     GSLQGLDVDIAKALCKAMDAKCTIVANDWDGMIPGLKSNKFDAVIASMSVTEERKKEV
                     AFTDKYYSTPLSVAVPKDSDITSVAPESFKGKTVGAQGSTTQGNYAEDVYGKAGAEVK
                     LYPTADEANADLKSGRLDAVVSDKFPISDWIKGDGADCCKLIGDIPGTQTDTAVALRL
                     GDDDLREQFNAAIKKIREDGTYATIVKKYFDFDIY"
     gene            complement(612994..613767)
                     /locus_tag="BSVBI22_RS12990"
                     /old_locus_tag="BSVBI22_B0625"
     CDS             complement(612994..613767)
                     /locus_tag="BSVBI22_RS12990"
                     /old_locus_tag="BSVBI22_B0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="WP_006133828.1"
                     /db_xref="GI:493096856"
                     /translation="MLKSLVLAGLASVVLTVSIQAPVQAKEWKEIRIASEGAYPPFNY
                     MSPDGKLVGFDLDIANALCEAMEAKCTIVANDWDGMIPSLQANKFDAVIASMAITDER
                     KKQVAFTDRYYTTPLAVVVPKDSDIVSLEPSAFAGKMVGAQAGTTQGNYADDVYGKAG
                     ADVKLYPTADEANADLESGRLDALAADKFIAADWLKKQGADCCKFLGDIPGSETQIAV
                     ALRQGDDDLREQFNAAIKKIRENGTYETIRKKYFDFDIY"
     gene            complement(613952..615055)
                     /locus_tag="BSVBI22_RS12995"
                     /old_locus_tag="BSVBI22_B0626"
     CDS             complement(613952..615055)
                     /locus_tag="BSVBI22_RS12995"
                     /old_locus_tag="BSVBI22_B0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006253341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="saccharopine dehydrogenase"
                     /protein_id="WP_004690230.1"
                     /db_xref="GI:490828140"
                     /translation="MKEIVVVGAGKIGATIADLLASTGEYAVTVVDRSQAQLDALEAG
                     AAVKTQALDIEDAKALETALAGKFAVLSAAPFHLTTRIAEATAKAGVHYLDLTEDVAS
                     TRRVKELAKEAKTAFIPQCGLAPGFISIVAYDLAKRFDTLDSVRMRVGALPQYPSNAL
                     NYNLTWSTDGVINEYIEPCEAIVNGELTEVPALEEREEFSLDGVTYEAFNTSGGLGTL
                     CETLEGKVRTLNYRTIRYPGHVALMKALLNDLGLRHRREVLKDIFENALPTTLQDVVV
                     IFVTVSGTKNGRLVQETYANKVYAAQIGKIVRSGIQITTASAICAVLDMLAKGDLPQQ
                     GFIRQEDITLEAFLANRFGKAYAQEDHCARMVD"
     gene            615178..615606
                     /locus_tag="BSVBI22_RS13000"
                     /old_locus_tag="BSVBI22_B0627"
     CDS             615178..615606
                     /locus_tag="BSVBI22_RS13000"
                     /old_locus_tag="BSVBI22_B0627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012093088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_002968445.1"
                     /db_xref="GI:489058347"
                     /translation="MTTEADLALISLLRENARASTADLARRLGVSRTTVQSRIEKLEK
                     RGVIEGYTVRIAPEFERDLVRAHVLVTALPKLAPKVETALRSMMAVRTLHSVSGHFDM
                     IVVVEAPSIQELDAVLDRIGALEGVERTMSSIILSTRIDR"
     gene            615886..617613
                     /locus_tag="BSVBI22_RS13005"
                     /old_locus_tag="BSVBI22_B0628"
     CDS             615886..617613
                     /locus_tag="BSVBI22_RS13005"
                     /old_locus_tag="BSVBI22_B0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014489616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocation pathway signal
                     protein"
                     /protein_id="WP_006192009.1"
                     /db_xref="GI:493203846"
                     /translation="MCLMCGPAAKTILNITRRNLLKALGAASLTAAIPFRAESADSEP
                     GQIVFFGGPIITVEPGAEQVEAVAVTNGVISAAGSKAEILDKKATDVLLVDLKGRTLL
                     PGFIDPHMHTIFSYFEDWLDMGPFVNGSYEQIMDKLRADAKAAKPGDWVRGWQYDPSI
                     TPGAQPITLALLDEIAPNNPLFILEGNGHVTYANSKAFELAGITKDTQDPPEGRYIKD
                     KNGNLSGRIEEYPAFVPFVEKMPQVSPDEMERRVRALFDRGASNGCTAMMDCGLGLLM
                     GEQDVRTIQGVVAKDTPVRVRGALASTMYDKWVELGFKPGFGDDLFRIHAIKAWVDGS
                     NQARTGYMREPYLNSTTRGQLNYSLEDLTATMKRSHEDGWQICVHANGDAGIDNALKA
                     YAATLQDAPRADHRHRIEHCSVLHDEQIKSMGDLGLSPSFLIGHVDYWGEAFRDDILG
                     PERANLYDRCGSARKAGLRISLHSDYNVTPIKPLQHIQTAVTRIMRANGEVLNPDERI
                     PVEAAIRAVTIDAAWQCHMDDLTGSIKAGKAADFVILEDNPLTVDPDKISQIKVSETW
                     LDGKRRYSA"
     gene            complement(617724..618926)
                     /locus_tag="BSVBI22_RS13010"
                     /old_locus_tag="BSVBI22_B0629"
     CDS             complement(617724..618926)
                     /locus_tag="BSVBI22_RS13010"
                     /old_locus_tag="BSVBI22_B0629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968962.1"
                     /note="catalyzes the thiolytic cleavage of
                     beta-ketoadipyl-CoA to succinate and acetyl-CoA; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_002968962.1"
                     /db_xref="GI:489058882"
                     /translation="MTEAYICDYIRTPIGRYGGALSSVRADDLGAVPLKALMERNGSV
                     DWEAVDDVIFGSANQAGEDNRNVARMSLLLAGLPVGVSGTTINRLCGSGMDAVITAAR
                     AIKAGEAELIVAGGVESMSRAPLVMPKADSAFSRKAEIYDTTIGWRFINPLMKKQYGV
                     DSMPETGENVAEDYNISREDQDAFALRSQDKAAAAQANGRLAREIVSVTIPQRKGDPV
                     IVEKDEHPRATSREALAKLPTPFRQGGTVTAGNASGVNDGAAALVIASEAAIRKYGLK
                     PIARIIGGAAAGVPPRVMGIGPAPATRKLCARIGIAPDAFDVIELNEAFASQGLAVLR
                     QLGIADDDKRVNPNGGAIALGHPLGMSGARIAGTAALELSLNNGKYALATMCIGVGQG
                     IAIALERA"
     gene            complement(618935..619624)
                     /locus_tag="BSVBI22_RS13015"
                     /old_locus_tag="BSVBI22_B0630"
     CDS             complement(618935..619624)
                     /locus_tag="BSVBI22_RS13015"
                     /old_locus_tag="BSVBI22_B0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit B"
                     /protein_id="WP_002966000.1"
                     /db_xref="GI:489055855"
                     /translation="MTIDTLEDIKLSNAQIAWRAAQDIADGAYVNLGIGFPEMVARYQ
                     PEGREAIFHTENGILDFGEAPPPGEEDWDLINAGKKAVTLKPGAAFFHHADSFSMVRG
                     GHLDVAILGAYQVAQNGDLANWRVGAKGVPAVGGAMDLVHGAKQVVVITEHVTKKGEP
                     KLVEQCTFPLTGVKCITRIYTSHAVVDVSEGRFVLREKLAAMTLEELQAMTGAKLHIE
                     GPVADLVVPEL"
     gene            complement(619621..620328)
                     /locus_tag="BSVBI22_RS13020"
                     /old_locus_tag="BSVBI22_B0631"
     CDS             complement(619621..620328)
                     /locus_tag="BSVBI22_RS13020"
                     /old_locus_tag="BSVBI22_B0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit A"
                     /protein_id="WP_006192011.1"
                     /db_xref="GI:493203848"
                     /translation="MDKTIGSAAEAVAEIGDGATVMIGGFGGSGAPIELIHALIDKGS
                     KGLTVINNNAGNGRIGIAAMIDAGMVRKMICSFPRSSDPRAFTDRYLAGEIELELVPQ
                     STLAERIRAGGAGIPAFYTPTAYGTELADGKVIAEFDGRPYVQERWLKADFALVKAHL
                     GDSHGNLTYRMAARNFNPLMCMAAAKTIVQVSRIVPLGGIEPENVITPGIFVDRVVEI
                     ANPQQEEELIRAGVAYI"
     gene            620512..621282
                     /locus_tag="BSVBI22_RS13025"
                     /old_locus_tag="BSVBI22_B0632"
     CDS             620512..621282
                     /locus_tag="BSVBI22_RS13025"
                     /old_locus_tag="BSVBI22_B0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_004681922.1"
                     /db_xref="GI:490819825"
                     /translation="MRETDFVGGFAKGLRVIEAFGEDRPRLSIADVSKITGLDRATAR
                     RCLLTLAELGYAEYDGKFFMLLPRILRLGHAYLSGTPLPTIIQPHLDRLSQSVGESAS
                     ASVLDGAEIVYIARASQMRVISINLMAGSRLPAYCASMGRVLLAWLDESEARTILEQT
                     ELRARTPFTQKDPEKLMEELRRIRAQGFAVNDQELELGLRSIAVPVFNHRGAVVAALN
                     IGAPVAHVEVSDLVGRILPEMLKIQSELRSMLRQRLFE"
     gene            complement(621289..622206)
                     /locus_tag="BSVBI22_RS13030"
                     /old_locus_tag="BSVBI22_B0633"
     CDS             complement(621289..622206)
                     /locus_tag="BSVBI22_RS13030"
                     /old_locus_tag="BSVBI22_B0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_002965997.1"
                     /db_xref="GI:489055852"
                     /translation="MRKRIPTYELYGEETDQKPDFWLHCETLYSRSSLHNFEISLHRH
                     DNFFQFLYVESGTGNVNFDGVLHSFRTPCAIIVPPNFNHGFAFSRNIVGHIVTVLQPQ
                     MPFLESGFGTSTADWMMRPKLVQMEGADEADLAFLALTMRHIQSEYQSRKMHKNSMLE
                     SLLKSSLVQIIRHALALQPEHDTWQSYREPRIERLLELIDRHFREHRPVSFYAGQLGL
                     SATHLNRLTRRVAGAPVQHMIARKLIDMARRDLVAMPSSVQHVAYSLGFSDPAYFSRF
                     FQKMTGETPRAFRLRERERLSASMPVTAQ"
     gene            622319..623488
                     /locus_tag="BSVBI22_RS13035"
                     /old_locus_tag="BSVBI22_B0634"
     CDS             622319..623488
                     /locus_tag="BSVBI22_RS13035"
                     /old_locus_tag="BSVBI22_B0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643307.1"
                     /note="catalyzes the formation of protocatechuate from
                     4-hydroxybenzoate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate 3-monooxygenase"
                     /protein_id="WP_006133836.1"
                     /db_xref="GI:493096866"
                     /translation="MRTKVVIIGSGPAGLLLGQLLTRAGIDNVILDRVSENYILGRVR
                     AGVLEEGTVRLMDEAGASDRLHREGLPHDGFSLAFDGRDHRIDLHKLTGKRVTVYGQT
                     ELTHDLMSERHRSGAHGIYEADNITPHDFDTASPYVTYEKDGITHRIDCDYIAGCDGY
                     HGVSRKSVLQKAIRIFEKVYPFGWLGVLADIPPVDHELIYANHERGFALCSMRSLTRS
                     RYYIQCALDEKVEDWSDERFYDELRRRLPAHHAEAMVTGPSFEKTIAPLRSFVAEPMR
                     FGRLFLAGDAAHIVPPTGAKGLNLAASDVHYLFEGLREFYIENSTAGIDAYSARALAR
                     IWKAERFSWSMTKMLHRFPDMGPFDQKVQEAELDYFCNSQAASTALAENYVGLPF"
     gene            complement(623898..624806)
                     /locus_tag="BSVBI22_RS13040"
                     /old_locus_tag="BSVBI22_B0635"
     CDS             complement(623898..624806)
                     /locus_tag="BSVBI22_RS13040"
                     /old_locus_tag="BSVBI22_B0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_004692228.1"
                     /db_xref="GI:490830142"
                     /translation="MIGNRIKFRHLHTFVEVARQKSVVKASEILNISQPAVTKTMREL
                     EEILGVPVLERDGRGIRITRYGEVFLRHAGTALTALRQGLDSVSQELDGSGPPIRIGA
                     LPTVSTRIMPKAISLFLAEKTGSKVKIVTGENAVLLEQLRVGDLDLVVGRLAAPEKMT
                     GFSFEHLYSERVRFLVRAGHPLLDDDTIFDHLANYPVLMPTRNSIIRPFVERLLITNG
                     VGSLPTQIETVSDAFGRAFVRDSDAVWIISEEVAAHDVAEGKLVALPIDTSETTGPVG
                     LTMRTDMVQTAPLQILVQTIREAADH"
     gene            624900..625703
                     /locus_tag="BSVBI22_RS13045"
                     /old_locus_tag="BSVBI22_B0636"
     CDS             624900..625703
                     /locus_tag="BSVBI22_RS13045"
                     /old_locus_tag="BSVBI22_B0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate enol-lactonase"
                     /protein_id="WP_002965994.1"
                     /db_xref="GI:489055849"
                     /translation="MQFAKVNDIVVHYDLRWNGNDKPVLVFINSLGTDFRIWNKVRAR
                     LGHDVSTLVYDKRGHGLSDIGKTPYTIELLAQDLIALLDRLSIHKAVICGLSVGGLIA
                     QGLYAARPDLVAGLVLSNTAHKIGTPEMWNARIDAIMQNGLASILDATMPRWFTAAYR
                     RPDNAAYQAYCNMFTRQPLEGYAATCAALRDADFTAAAHKISVPVRCVAGDQDGSTPP
                     TLVQELASLIPGAVFSQIANSGHIPCVEQPDAYTALLRDFLSHNLLHGE"
     gene            625704..626123
                     /locus_tag="BSVBI22_RS13050"
                     /old_locus_tag="BSVBI22_B0637"
     CDS             625704..626123
                     /locus_tag="BSVBI22_RS13050"
                     /old_locus_tag="BSVBI22_B0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="WP_002965993.1"
                     /db_xref="GI:489055848"
                     /translation="MMAENATETAPSERYKLGMRVRRSVLGDTHVDRASNGATELDAP
                     FQALITEAAWGTVWARPGWSKRERSIVTIALLAALGQDDEVAMHIRATRNTGATKEDI
                     CEALMHVAIYAGVPASNHAFKIAKQTYAQMEAEEAEK"
     gene            626120..626860
                     /locus_tag="BSVBI22_RS13055"
                     /old_locus_tag="BSVBI22_B0638"
     CDS             626120..626860
                     /locus_tag="BSVBI22_RS13055"
                     /old_locus_tag="BSVBI22_B0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit beta"
                     /protein_id="WP_006192016.1"
                     /db_xref="GI:493203853"
                     /translation="MKNSLPETSPFFARDLSMHPPAYTPWYKTSVLRSPTRALISLEG
                     TRSEITGPVFGHNMLNELDNDLILNYARPGEMPVGPRILVHGRVLDEGNRPVPGALLE
                     FWQANAGGRYRHKKETYLAAIDPNFGGVGRTITDENGYYWFKTIQPGAYPWPNGVNDW
                     RPAHIHFSVFGHGFAQRLITQMYFEGDPLIWRCPIVKTIPDKSAIERLIAPLDMNATL
                     PMEMRAFKFDIVLRGRRSTFFENRPEGN"
     gene            626862..627479
                     /locus_tag="BSVBI22_RS13060"
                     /old_locus_tag="BSVBI22_B0639"
     CDS             626862..627479
                     /locus_tag="BSVBI22_RS13060"
                     /old_locus_tag="BSVBI22_B0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit alpha"
                     /protein_id="WP_002965991.1"
                     /db_xref="GI:489055846"
                     /translation="MVQPLGYLKETASQTAGPYVHIGLTPNFVGINGVFAEDLGTGPL
                     YNDKAHGERITIKGRVIDGMGAPLRDALVEIWQADAAGLYNSPSESRGKADPHFRGWG
                     RCPSNMETGEFIFETIKPGRVPFRDGRLMAPHVTLWIVARGINLGLQTRMYFSDEEAA
                     NAEDPVLARIEHRMRVPTLIGQREGDVYHFDIHLQGEKETVFFDI"
     gene            627483..628547
                     /locus_tag="BSVBI22_RS13065"
                     /old_locus_tag="BSVBI22_B0640"
     CDS             627483..628547
                     /locus_tag="BSVBI22_RS13065"
                     /old_locus_tag="BSVBI22_B0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799889.1"
                     /note="Catalyzes the cycloisomerization of
                     cis,cis-muconate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-carboxy-cis,cis-muconate cycloisomerase"
                     /protein_id="WP_006192018.1"
                     /db_xref="GI:493203855"
                     /translation="MSISVFEHPFLTGLFGDDEEISSLFTAYADIAAMLKFEAALAGA
                     QADLGIIPAHAAERIMSATETMEPDLAQLEHGTARDGVVVPTLVRNLRKTVGEDVAAH
                     VHFGATSQDVIDTSLMLRLARVRDILVARIEQLSERFNWLETTFGQNDLTAYTRMQPA
                     ISTTVADRVESWRAPFSDYAQRLAALQFPLQFGGAAGTLEKFVGKGAKLRAELAKRLG
                     LEDRPQWHSQRAFIADFGHLLSLVTGSLGKFGQDIALMAELRDEISLSGGGGSSAMPH
                     KQNPVRAELLVTLARFNAVQVSGLHQAMVHEQERSGTAWMLEWMILPPVVAATGAALK
                     AALVLSDNIVRMGKDRLPET"
     gene            628683..629855
                     /locus_tag="BSVBI22_RS13070"
                     /old_locus_tag="BSVBI22_B0641"
     CDS             628683..629855
                     /locus_tag="BSVBI22_RS13070"
                     /old_locus_tag="BSVBI22_B0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014489619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Leu/Ile/Val-binding protein homolog 6"
                     /protein_id="WP_004692226.1"
                     /db_xref="GI:490830140"
                     /translation="MKKIALTALAVFSLAASAAYADVVKVGVIGPFSGPFALQGKNFK
                     AGIDAYMAEHGNKVGDDTVEVVYRDVPQADPAQSKALAQELVVKEGVQYLAGFYFTPD
                     AMAVTPILKQGNVPMVVMNAATSSIVTKSPYVVRTSFTTWQTSTPIARVALDKGVKKV
                     ISVVSDYGPGVDAENAFKAAFTDAGGEVVEAIRMPLATNDFSPIMQRIKDSGAQGVFA
                     FLPSDPTTLGFMKAYVDNGLKSSGIQLFAPGDLTQESDLPALGENALGVLTTFHYAVS
                     HDSPENRKFVEEARKAIGNPAELSFPSVGAYDGMHVIYKMIEATGGKKDAAKAVEAVK
                     GMEWVSPRGPVSIDPESRHITQNIYLREVAKADDGTYYNKEIQTFEKQGDPGLKAQ"
     gene            630028..630897
                     /locus_tag="BSVBI22_RS13075"
                     /old_locus_tag="BSVBI22_B0642"
     CDS             630028..630897
                     /locus_tag="BSVBI22_RS13075"
                     /old_locus_tag="BSVBI22_B0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_006192020.1"
                     /db_xref="GI:493203857"
                     /translation="MQTVLSIAVDALAYGMVLFVISIGLSVTMGLMRVVNLAHGAFAM
                     IGGYFASYAAQQLGLNYGFAIIIAVVGTMIIAVPVERLLYRRIYGAPELTQVLMTIGV
                     TFCIIGITNYIFGPTLKTIPLPEMLRGSVDLGFHAIAKHRIFAIGCGLAVAVGLWYAV
                     ERTAFGVKLRAAVDNANMAAALGVRTEIVYAVSFALAIGLAAFGGVVGAELLPVEPYY
                     ALRYMVTFLVVVSVGGAGSIPGALVACLLLGAIDTTGRYLAPEYGEFFFYLAVIVIVT
                     LFPRGLAGRLARK"
     gene            630894..631880
                     /locus_tag="BSVBI22_RS13080"
                     /old_locus_tag="BSVBI22_B0643"
     CDS             630894..631880
                     /locus_tag="BSVBI22_RS13080"
                     /old_locus_tag="BSVBI22_B0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_006192021.1"
                     /db_xref="GI:493203858"
                     /translation="MTELTQPLPQTRHSYAGLIGIVAIIAASVVGWFLFPDNLALLTR
                     IIAIALLVLSLDLVTGYCGIATLGHAALFGAGAYGAGIAAAHFGVTDPILMTVIGLLA
                     GAVTGLVSGAVILRATGLAQLVLSIAVVHLFHEAANKASGWTGGSDGLSGISPDPIFG
                     IFEFDLYGRTVYIYAVILLLISFIFLRYVVRSPFGMLCRGVKEDPIRIHAMGASVQGA
                     QLRMYVISGAVAGIGGALNAISTQVVGLDSLSFTMSAEALVMLVLGGAGSLFGGLVGT
                     VVFMWFEDVVSTANPFHWLTMVGALLIAVVLFAPRGLYGTLAYYFEKKARRK"
     gene            631877..632626
                     /locus_tag="BSVBI22_RS13085"
                     /old_locus_tag="BSVBI22_B0644"
     CDS             631877..632626
                     /locus_tag="BSVBI22_RS13085"
                     /old_locus_tag="BSVBI22_B0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006145262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin III"
                     /protein_id="WP_002965986.1"
                     /db_xref="GI:489055840"
                     /translation="MSTVFEVSKLRKNFGGLAVTNDVSLSMAKGDRVALIGPNGAGKT
                     TFVNLVTGNLAATSGTVTLGGENVSKLNAMQRVRRGLVRSFQVTRLFFDMTPEEHVAL
                     AILQREGKTGRILGNYRRMPQVMDEARDILHMLGLLPLAQLRVSEIAYGQQRLLEIAL
                     ALALRPKVLLLDEPAAGVPQSDTGRIEEALDRLPPDLAVLMIEHDMDLVFRFAKRVVV
                     LAAGTVIFDGLPQAVVQDARVREAYLGSYAQ"
     gene            632623..633339
                     /locus_tag="BSVBI22_RS13090"
                     /old_locus_tag="BSVBI22_B0645"
     CDS             632623..633339
                     /locus_tag="BSVBI22_RS13090"
                     /old_locus_tag="BSVBI22_B0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter"
                     /protein_id="WP_004692224.1"
                     /db_xref="GI:490830138"
                     /translation="MSAASLEIRNLSSGYGPTRVIEDVSFKAEPGSRLAILGRNGVGK
                     TSLFATIAGQTRRYGGEILLDGRNIATLPSAARALAGLGYVPQTRDIFPTLTVEENLF
                     VGLKNRPKDALEEAYAMFPRLKERRRNLGSQLSGGEQQMLSTARSILGQPTVLLLDEP
                     LEGLAPVICEELMAAFSALAQKGDMTILLVEQRIQSAPDFADHVIILERGRIAWSGTA
                     AELADNQQTVEELLGVGGLH"
     gene            complement(633340..635139)
                     /locus_tag="BSVBI22_RS13095"
                     /old_locus_tag="BSVBI22_B0646"
     CDS             complement(633340..635139)
                     /locus_tag="BSVBI22_RS13095"
                     /old_locus_tag="BSVBI22_B0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine deaminase"
                     /protein_id="WP_006192022.1"
                     /db_xref="GI:493203859"
                     /translation="MIADAQMQAPVENQVYCGLRHCDSFCELIPMKGCEAMLEWMIDQ
                     GAGREPADIVLKGGRFLDLITGELVESDIAICEDRIVGTFGTYRGKHEIDVSGRIVVP
                     GFIDTHLHIESSQVTPHEFDRCVLPQGVTTAICDPHEIANVLGAEGIRFFLDSALETV
                     MDIRVQLSSCVPATHMETSGVELLIDDLLPFADHPKVIGLAEFMNFPGVLAKDPECMA
                     KLRAFQGRHIDGHAPLLRGLDLNGYIAAGIRTEHEATNAEEALEKLRKGMYVLVREGS
                     VSKDLKALMPIITERHAQFLALCTDDRNPLDIADQGHLDYLIRTAIAGGVEPLAIYRA
                     ASVSAARAFGLFDRGLVAPGQRADLVVVDSLEGCHAEIVLSAGRVVSEALFAARKPVA
                     EVGRNSVKAPRVTASNFRSQSNSGKTRAIGIVPGKIITQNLEFDLKVGPNGVEPDLER
                     DVVKVAVIERHGKNGNIATGFVHGFGLKAGAIASTVSHDSHNICVVGASDEDIATAAN
                     RLGEIEGGFVVVRDGKVLAEMPLPIAGLMSTEPYETVREALRKLRHAAEDLGSVLEEP
                     FLQLAFIALPVIPHLKITDRGLVDVDKFEFVGN"
     gene            635244..636284
                     /locus_tag="BSVBI22_RS13100"
                     /old_locus_tag="BSVBI22_B0647"
     CDS             635244..636284
                     /locus_tag="BSVBI22_RS13100"
                     /old_locus_tag="BSVBI22_B0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_006192023.1"
                     /db_xref="GI:493203860"
                     /translation="MATEQTIKVFDGHNDVLLRLWSSNQPEPENRFLEDESSGHIDLP
                     RARKGGLGGGLCAVYVPSPSHDLDADGNLPTPSQQDALKTTLAMSAILQNIERKSEGQ
                     VRICRTAADIRDAFAKDIFASVYHIEGVEAFDADLDALYVLHAAGLRSLGPVWSRPNI
                     FAHGIPFRFPSSPDIGPGLTDHGKALIRACNELKVMIDLSHMNEKGFWDIAALSDAPL
                     VASHSNAHVLCQQSRNLTDRQLDAIRDTGGLVGLNFGVSFLREDGKHDPDTKLEELVR
                     HADYIVGRIGIDHVAFGSDFDGTIISSTLRDVADLQLVIETFRKHGYDDASLVKLAHG
                     NWIDVLERTWGK"
     gene            636617..637918
                     /locus_tag="BSVBI22_RS13105"
                     /old_locus_tag="BSVBI22_B0648"
     CDS             636617..637918
                     /locus_tag="BSVBI22_RS13105"
                     /old_locus_tag="BSVBI22_B0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006161953.1"
                     /note="with UgpACE is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate-binding periplasmic
                     protein UgpB"
                     /protein_id="WP_004686048.1"
                     /db_xref="GI:490823958"
                     /translation="MFTRLITTSALTGAIALTIGSQAFAQTELAWWHGMTGANNEMVN
                     ELSKEFNESQSEYKIVPVYKGNYPETLNAGIAAFRSKQPPAILQVFDAGSGVMMAAEG
                     AIVPAAEVLEKGGYKFDKSQYLPGIVAYYSKPDGTMLSFPYNSSSPILYYNKDAFKKA
                     GLDENKPPKTWPEVFEAAKKIKASGASPCGFTSTWLTWIQTENFAAWNNVPYGTNENG
                     LAGTDVKLEINSPLYVEHFQAIADLAKDGTFRYGGRTSEAKQLFTSGECAMLTESSGG
                     LGDVVKSGINYGIGQLPYYEGHGPQNTIPGGASLWVFAGLSDDQYKGIAEFFNFLSQT
                     KIQVKLHEKSGYLPVTLAAYEETKKSDFYEKNPGRETPILQMMGKEPTENSKGVRLVN
                     LPQVRDILNEEFEAMLGGKQDAKTALDNAVKRGNAAIAAAQ"
     gene            637991..638872
                     /locus_tag="BSVBI22_RS13110"
                     /old_locus_tag="BSVBI22_B0649"
     CDS             637991..638872
                     /locus_tag="BSVBI22_RS13110"
                     /old_locus_tag="BSVBI22_B0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138483.1"
                     /note="with UgpEC is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate transport system
                     permease protein UgpA"
                     /protein_id="WP_004687240.1"
                     /db_xref="GI:490825150"
                     /translation="MQKVTFPNKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMREDA
                     FGLKSTFVELANFTAVLSDPNYLHSVQVTVVFNVLTALLAMGVALLLATAADRVIRGQ
                     TFYRTLLIWPYAVAPAVAGMLWLFMFNPAMGTFAYLLRRNGIAWDPLLDGNQAMGLVV
                     VAAAWKQISYNFLFFVAGLQAIPKSLIEAAAIDGARGARRFWTIVFPLLAPTSFFLLV
                     VNTVYAFFDTFGIIHAVTGGGPAKATETLVYKVYNDGFVNLNLGSSSAQSVILMAIVI
                     ALTAFQFRFVEKRVHYS"
     gene            638884..639732
                     /locus_tag="BSVBI22_RS13115"
                     /old_locus_tag="BSVBI22_B0650"
     CDS             638884..639732
                     /locus_tag="BSVBI22_RS13115"
                     /old_locus_tag="BSVBI22_B0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769372.1"
                     /note="with UgpABC is involved in uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate transport system
                     permease protein UgpE"
                     /protein_id="WP_006192024.1"
                     /db_xref="GI:493203861"
                     /translation="MIEQRPVSNLIGHLILILGIIIVAFPIYYTFVASLMTSTQIIRP
                     PISLLPGDHLVENYREAIFGGVERVVGVSLERLLWNSFVVAMAIAVGKIIISFMSAFA
                     IVFFRFPMRMFFFWMIFITLMLPVEVRILPTYKVIVDLGMIDTYAGLTLPLMASATAT
                     FLFRQFFLTIPGELVEAARIDNAGPFRFMRDILLPLSKTNIAALFVILSIYGWTQYLW
                     PLLVTNDAKMNTIIIGLRRMVDWADASTSWNYVMVTAILAIIPPILVVVLMQRWFVKG
                     LVETEK"
     gene            639732..640787
                     /locus_tag="BSVBI22_RS13120"
                     /old_locus_tag="BSVBI22_B0651"
     CDS             639732..640787
                     /locus_tag="BSVBI22_RS13120"
                     /old_locus_tag="BSVBI22_B0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate import ATP-binding
                     protein UgpC"
                     /protein_id="WP_002967281.1"
                     /db_xref="GI:489057160"
                     /translation="MSKIVLDNVRKSYGGNIEVIKGVSLEIADGEFVVLVGPSGCGKS
                     TLLRMIAGLESITSGTISIGERVVNNVEPAERDIAMVFQNYALYPHMTVRENLAYGLK
                     NRKTPKEEIERRIAKAAKALEIEQFLERKPRQLSGGQRQRVAMGRAIVREPAAFLFDE
                     PLSNLDAKLRVQMRVEIKRLQRSLGTTSVYVTHDQMEAMTMADRLVVLNAGHIEQVGT
                     PIELYEKPASTFVATFIGSPSMNLLQSPESAAWQPGRAITLPSGGYTFGVRPEDIRIL
                     EEGDQDADGFNAQVRIEAVELVGAESYIHAALSDGKPLIFRVAGRSTHNIDEMVRVGA
                     SATDVHIFGADGRRVSD"
     gene            641045..642820
                     /locus_tag="BSVBI22_RS13125"
                     /old_locus_tag="BSVBI22_B0652"
     CDS             641045..642820
                     /locus_tag="BSVBI22_RS13125"
                     /old_locus_tag="BSVBI22_B0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_029643051.1"
                     /db_xref="GI:658385200"
                     /translation="MDDPSEILSFTVIALMMGAFIWGKFRYDVVALCALLLAIAVGVV
                     PFDRAFSGFSDDIVIIVGSALIVSAGVARSGVMQVAVQRFLPEMSSVRLQLAVLVALV
                     TVLSAFVKNVGALAIMIPVAFQFARRSNVSPSTFLMPMAFGALLGGLMTQVGTSPNIV
                     VSCIRGEMVGTPFTMFDFTPVGAVLSVVGLIYLVLFYWLVPQRTRENISLNEAIKIKN
                     YASEARVTKTSTMVGKRVTDLIKTAEGEAMVTSIVRRNQRLTPLPDMILHEGDVILLE
                     GDPKALDTIISAGKLTLSENRNPSDTSGSSDIEAVEAVIGKNSRLIGLTAQRLDLYAR
                     YDVNLLAVSRPGERITERLSEVVLRFGDVVVLQGRQANLSNFLPEFELLPLARRKLML
                     GSVRRGLIPLAILIAAVAATAFSIMPVAVAFFAAAVAMLVFKVIPLNEVYDEIDGPIL
                     VMLAALIPVSDALRTTGGTEIIAQGLASLGQQLPPAGALALILVAAMMVTPFPNNAAT
                     VLVMAPIATSFAAGLGFRPEAFLMAVAIGAGCDFLTPIGHQCNTLVMGPGGYKFSDYP
                     RLGLPLSIIIAIVTVPTLMFFWPLK"
     gene            complement(642898..643497)
                     /locus_tag="BSVBI22_RS13130"
                     /old_locus_tag="BSVBI22_B0653"
     CDS             complement(642898..643497)
                     /locus_tag="BSVBI22_RS13130"
                     /old_locus_tag="BSVBI22_B0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="WP_004681939.1"
                     /db_xref="GI:490819842"
                     /translation="MQPEELNLLERLIDVIEQDIIPLTERGVAEGNKVFGAALLRKSD
                     LSLVLAETNNETENPLWHGEVHTLKRFYEMPEKERPDTKDMVFLSTHEPCSMCLSAIT
                     WSGFDNFYYLFSHEDSRDAFSIPHDLKILKEVFTLEPGGYNRDNAFWHSHSIPKMVAS
                     LAEPDRSRLEKRLNAIRARYDAMSGTYQAGKEGNAIPLS"
     gene            complement(643558..644850)
                     /locus_tag="BSVBI22_RS13135"
                     /old_locus_tag="BSVBI22_B0654"
     CDS             complement(643558..644850)
                     /locus_tag="BSVBI22_RS13135"
                     /old_locus_tag="BSVBI22_B0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009362833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine permease"
                     /protein_id="WP_006134676.1"
                     /db_xref="GI:493098610"
                     /translation="MFEKLFKLQEHGTSARTEIIAGVTTFLTMSYIIFVNPDILSTTG
                     MDRNAVFVATCLAAALGSIIMALVANWPIGMAPGMGLNAFFAFTVVGAMGFSWQQALG
                     AVFISGVIFLLLTVTGVRRWLVDGIPHSLRSAIAAGIGMFLALIGLKSAGVVVGNQAT
                     LVGMGDLTQSGPLLAIAGFFIIAILDALKVRGAILIGILVITVASIALGISQFGGIFS
                     APPSLAPTFLQLDIMGALHTGILHVILVFVLVEVFDATGTLIGVAKRGGLIETGKPNN
                     LGRALFADSGAILAGSLIGTSSTTAYVESAAGVQAGGRTGLTALVVGILFLAALFISP
                     LAGSVPAYATAPALVYVACLMMRELTEIEWHEVTEAAPAALTALAIPFTYSIANGLAF
                     GFISYVVMKTFTGKVREIHAATWLVAALFVIRFVFFAE"
     gene            complement(645288..645793)
                     /locus_tag="BSVBI22_RS13140"
                     /old_locus_tag="BSVBI22_B0656"
                     /note="membrane protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            645976..646158
                     /locus_tag="BSVBI22_RS13145"
                     /old_locus_tag="BSVBI22_B0657"
     CDS             645976..646158
                     /locus_tag="BSVBI22_RS13145"
                     /old_locus_tag="BSVBI22_B0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012243416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965973.1"
                     /db_xref="GI:489055827"
                     /translation="MSHLEARFDLIESDRNAEHAGRKGLKQQKRQDWRPTLSLLYFKF
                     IPDFKFNPGGLSKAAP"
     gene            complement(646162..646299)
                     /locus_tag="BSVBI22_RS13150"
                     /old_locus_tag="BSVBI22_B0658"
     CDS             complement(646162..646299)
                     /locus_tag="BSVBI22_RS13150"
                     /old_locus_tag="BSVBI22_B0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965972.1"
                     /db_xref="GI:489055826"
                     /translation="MNIRQKVMQYVSRRRALRELGAMDDHLLADIGVSRSQIQSAVFG
                     R"
     gene            646558..647475
                     /locus_tag="BSVBI22_RS13155"
                     /old_locus_tag="BSVBI22_B0659"
     CDS             646558..647475
                     /locus_tag="BSVBI22_RS13155"
                     /old_locus_tag="BSVBI22_B0659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_004687235.1"
                     /db_xref="GI:490825145"
                     /translation="MLYGILLAFASYAAFAVSDACVKFLDGTLSPYEIAFYGAVLGLL
                     AIPFTKKADDAWLDMFRTGNIKMWLLRTVTAAMGVIGSVAAFTYLSMAEAFALIFLLP
                     AYVTILSVIFLKEQVGWRRWSAVAIGFAGVLVVLRPGFRELSIGHLGALAAGMGGATS
                     IIIFRVMGKNEKRISLYTSGLVGPILICGALMAPSYQAPGTMQWVYLAGYGLLAALAN
                     ILLMLAAQRAPASAIASPQYSQMIWAILFGYFVFHDHIDMPMLIGIVLITISGLFTFI
                     RERQRGVEGPPAVAAEPTPALVQEKAGYF"
     gene            647594..648450
                     /locus_tag="BSVBI22_RS13160"
                     /old_locus_tag="BSVBI22_B0660"
                     /note="aminotransferase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            648623..649384
                     /locus_tag="BSVBI22_RS13165"
                     /old_locus_tag="BSVBI22_B0662"
     CDS             648623..649384
                     /locus_tag="BSVBI22_RS13165"
                     /old_locus_tag="BSVBI22_B0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_006192034.1"
                     /db_xref="GI:493203871"
                     /translation="MIEHTPLFLTVAVIAAFLVGLSKGSLPTVGTLSVPLMALVISPV
                     TAAALLLPIYVVSDMFGLYLYRHHFSARNLAILTPSAIVGVGIGWLFSSHLSSTFIGM
                     LVGLVGLLFCFNAWVGARYRKKTRKADIPGGIFWGILTGLTSFVSHSGAPPFQMYVLP
                     QHLEKLVFAGTSTILFAIVNAVKLVPYWELNQFSNLDLSLGLWLVPAAVIGTYAGAIF
                     TRIMPDGPFFLLVQLTLFGLSIKLVADWIVPFFFA"
     gene            649456..651111
                     /locus_tag="BSVBI22_RS13170"
                     /old_locus_tag="BSVBI22_B0663"
     CDS             649456..651111
                     /locus_tag="BSVBI22_RS13170"
                     /old_locus_tag="BSVBI22_B0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687233.1"
                     /note="proposed role in polysaccahride synthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding dehydrogenase"
                     /protein_id="WP_006073777.1"
                     /db_xref="GI:492972183"
                     /translation="MADADAIIIGAGLAGLAAAHELAGAGKKVILLEQEGENSIGGQA
                     FWSLGGLFMIDSPEQRRLGVKDNLELARQDWFGSAQFDRPEDHWPKQWAEAYLQFAAG
                     EMRPWLHSLGMRWFPVVGWAERGGSHAHGHGNSVPRFHVTWGTGPGVVAPFERLLREA
                     MHQNLVTLKCRHRVNGIVTTNGRISGAHGDVLAPSSVERGQPSSREVIGDFEFSAGNI
                     IVTSGGIGGDPERVRRAWPRERLGNPPEDMVLGVPAHVDGRGIDIAVAAGGHVINGDR
                     MWHYTEGLRNWNPIWPNHGIRILPGPSSMWFDAQGNRLPAPYLPGFDTLATLKHILST
                     GYGYSWFILTEKIIRKEFSLSGSEQNPDLTGKDWKLLVKSRLGKTPPQPVKAFIDKGE
                     DFITAQTLEELVAGMNRLTGENLLDAAHIRTQIEARDREIANRYSKDAQIMAIRNARA
                     YLGDRLTRAVPLHALLDPANGPLIAVKLHILTRKTLGGLHTNLQSAVLDASGKPVPGL
                     YAAGEAAGFGGGGYHGYNALEGTFLGGCIFSGRAAGRAAASTI"
     gene            651240..651644
                     /locus_tag="BSVBI22_RS13175"
     CDS             651240..651644
                     /locus_tag="BSVBI22_RS13175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006016198.1"
                     /db_xref="GI:492868022"
                     /translation="MVELANNIENLEFIISKAREYDVQVPAVDEDSGSNPGDDRDVDI
                     LDASIGNPTRKELFAAISSLNEDERIELLALMWVGRGDFSATEWEEALSTASERHNGR
                     EAKYLIGTPLLGDYIEEGLVALGFDVETYDNE"
     gene            651789..653216
                     /locus_tag="BSVBI22_RS13180"
                     /old_locus_tag="BSVBI22_B0665"
     CDS             651789..653216
                     /locus_tag="BSVBI22_RS13180"
                     /old_locus_tag="BSVBI22_B0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_029643052.1"
                     /db_xref="GI:658385201"
                     /translation="MQKTQFYIDGAWRSPVEEKTIEVMNPADEKPYAVISAGSAADID
                     LAVAAARRAFPAWSETPAEERIAYIRRIAEIYESRLDEMAKTISMEMGAPIKLARESQ
                     AAAGLSHTKAFIAACENFEVEEVLSPKYPNQTAVHEPIGVCGLITPWNWPMNQITLKV
                     IPAIAVGCTVVLKPSEIAPMSAMLFAEFVDQAGLPKGVFNLVNGEGPVVGEALSQHPE
                     VDMMSFTGSTRAGTAVSRAAAATVKRVSLELGGKSPNIVFADSDLEKAISRSLAHCFE
                     NTSQSCNAPTRMLVERSVYDKAVELAKKAAESTKVGDPAQEGDHIGPLSSSIQFEKVQ
                     ALIQKGIDEGARLVAGGTGRPEGFTEGDYVKPTVFADVNNNMTIAREEIFGPVLAMIP
                     FDTEEEAIAIANDTPYGLAAYIQTGSPERAKRVARKLRAGMIQINGTSRAPGSPFGGY
                     KQSGNGREGGKWGLEDFMEVKLISG"
     gene            complement(653206..653391)
                     /locus_tag="BSVBI22_RS13185"
     CDS             complement(653206..653391)
                     /locus_tag="BSVBI22_RS13185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002970636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002970636.1"
                     /db_xref="GI:489060582"
                     /translation="MAEGYVDLRYTNIAGGNLARFGSFRELSVFTGEFFYWLLYEESA
                     GNPALSIWLCGWMKISR"
     gene            653694..654641
                     /locus_tag="BSVBI22_RS13190"
                     /old_locus_tag="BSVBI22_B0667"
     CDS             653694..654641
                     /locus_tag="BSVBI22_RS13190"
                     /old_locus_tag="BSVBI22_B0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_004692218.1"
                     /db_xref="GI:490830132"
                     /translation="MKGSNIMLTFRQKITRLCGVAAMALALSSAAYAADITVKHAQGE
                     TAVPASPEKVVVFDLASLDNLDRLGVKVTGVPSGVPFPEYLKKYQGDDYAKVGTLFEP
                     DYEAVNAAEPDLIIVGGRSAAKYAALKKIAPTVDLTVDARNFIADTEANIEKLGQIFG
                     KEAEAKAEAEKLNKELAALHEKAAGKGTGLLILTSGGKISAYGPGSRFGVLHDSFGVK
                     PAAPNLSIGNHGQPISSEFILETNPDWLFVIRRDAAIGREGNSAKQLLDNELVRQTNA
                     WKKDRVVYLDAQNWYLVGGGFSALHNTIRQLSEAFDKSK"
     gene            654698..655660
                     /locus_tag="BSVBI22_RS13195"
                     /old_locus_tag="BSVBI22_B0668"
     CDS             654698..655660
                     /locus_tag="BSVBI22_RS13195"
                     /old_locus_tag="BSVBI22_B0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_004681948.1"
                     /db_xref="GI:490819851"
                     /translation="MKGLAAAVIVVAVLAVISLFIGVSDVSLHTLFGKASTDRATEVL
                     LISRIPRTLAIILAGMSMAVAGMIMQMLTRNRFVEPSTAGTVESASLGILLVILFAPE
                     TPVFGKMLVASVSALAGTALFLRILRSIPLRSVLVVPLVGIMLGGVINAITTFIAYRF
                     DLLQSLNSWTTGDFSGVLRGRYELLWIAFALTVVAYVAADRFTVAGLGEDFTTNLGLN
                     YRRVVTLGLVIVSMVSASVVVTVGMIPFLGLIVPNVVSMFIGDNMRRAVPWVALLGAG
                     LVLACDIVGRLIRFPYEIPIGTMMGVVGSAIFLYLLLRRGSRLA"
     gene            655653..656606
                     /locus_tag="BSVBI22_RS13200"
                     /old_locus_tag="BSVBI22_B0669"
     CDS             655653..656606
                     /locus_tag="BSVBI22_RS13200"
                     /old_locus_tag="BSVBI22_B0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin ABC transporter permease"
                     /protein_id="WP_004690244.1"
                     /db_xref="GI:490828154"
                     /translation="MHKRPAIVIALLGALTLLACVAFMTLGAKGSWSFVLSFRGTKLA
                     AMVLVAYSVAVSTVLFQTVTNNRILTPSIMGFDALYILIQTLVVFFFGAVQIDWLGPN
                     ARFLAETAIMVVFAGTLYYWLFSGAARSLHLIMLVGIVCGVFFRSISNLMQRMLYPNL
                     FAILQDRFFASFNAINADILVISAIVVAAVSLYGLRYLYVLDVLSLGRDPAINLGVDH
                     ARVVRKILFIVTVLVSVSTALVGPITFFGLLVANLAYMISGSARHRIVLPVAVLLAVL
                     CIVGGQTLLERVLAFNTALSVIIEFLGGLFFIILLVRGNAR"
     gene            656603..657361
                     /locus_tag="BSVBI22_RS13205"
                     /old_locus_tag="BSVBI22_B0670"
     CDS             656603..657361
                     /locus_tag="BSVBI22_RS13205"
                     /old_locus_tag="BSVBI22_B0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_004692217.1"
                     /db_xref="GI:490830131"
                     /translation="MIEISQVSKSYNGTLVVDDVTLRLPARGITSIIGPNGAGKSTLL
                     SMVSRLLPMDKGSVTVDGLDITTTSGDVLARRLSILRQENAINSRLTVRDLVTFGRYP
                     YSKGRPNSEDRKHVEQAIGYLGLEGLSERFLDELSGGQRQRAFVAMVLCQDTDYVLLD
                     EPLNNLDMKHSASMMKLLRRAADELGKTIVLVLHDINFASCYSDHIVAMRHGKVVHQG
                     SPDELIHPEILSEIYEMEIGVEIIGGKRIGVYYL"
     gene            complement(657414..658022)
                     /locus_tag="BSVBI22_RS13210"
                     /old_locus_tag="BSVBI22_B0671"
     CDS             complement(657414..658022)
                     /locus_tag="BSVBI22_RS13210"
                     /old_locus_tag="BSVBI22_B0671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002965961.1"
                     /db_xref="GI:489055815"
                     /translation="MGRMRKTGDGPEAPVDPREAGFEDVTLPKHLRPVASIGPIVSSA
                     HLAEGGSPAMSEVEYGLILASHAFSRWMVRCMAAAGLPGLSPIEILILHSIRHRDREK
                     KLADICLVLDIEDTHIATYAIRKLEKAGLLTTGKAAKEKTVKITAKGAEACAHYAQIR
                     ERLLVDSTANARPSEETLSELAALLRFMSGAFNQATRSAITL"
     gene            658148..661747
                     /locus_tag="BSVBI22_RS13215"
                     /old_locus_tag="BSVBI22_B0673"
     CDS             658148..661747
                     /locus_tag="BSVBI22_RS13215"
                     /old_locus_tag="BSVBI22_B0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192042.1"
                     /db_xref="GI:493203879"
                     /translation="MMSAAWDFWIDRGGTFTDVIGRDPEGHLHARKVLSENPSAYKDA
                     AVHGIRLHLGLKTGEPVPAGIIGEVRMGTTVATNALLERKGERLALVTTKGFRDALKI
                     GYQERKNIFATEIIKPEALYDKVVELDERVRADGTVEKALALAEAEKALRALKAEGYK
                     SIAIALMRAYKFPAHEIEIARIARDLGFEQVSVSHEVSPLIKLVGRGDTTVVDAYLSP
                     VLRRYVAQVSDELDVERTGARVMFMMSSGGLTAADLFQGKDAILSGPAGGVVGLARTG
                     ETAGFGQVIGFDMGGTSTDVAHFDGEYERAFETEVAGVRVRAPMMLIHTVAAGGGSIL
                     HYEAGRFRVGPDSAGANPGPACYRNGGPLAVTDANVMLGKLLPEFFPAIFGPQQNQPL
                     DVARVRELFTALAGEIGDGRSPEAVADGFIRIAVANMVEAIKKISVQRGYDVTRYALN
                     CFGGAGGQHACLVADALGMKNILLHPMSGLLSAYGMGLADIRATRQKALGVALDPAAP
                     KALKELGEELADECVAELAAQGIETDAMKQHLRAHIRYAGTDTALSIEATFPAEDDAA
                     RLRAEFEAAHKRRFGFIAENKALVIDAVEVEAVGGGAGEMENAQSLDSDQEAKPAKLT
                     RFFSQGEFHEAGVVLREAMQRGQTVTGPAIIIEKNQTIVIEDGWQARLTAHDHVVLTR
                     IKALPARTAIGTEADPVMLEIFNNLFMSIAEQMGVTLQNTAYSVNIKERLDFSCAVFD
                     AEGNLVANAPHMPVHLGSMDASVATAIRENKDIKPGDVFLINAPYNGGTHLPDLTVCT
                     PVFDDAGHQIRFWVASRGHHADIGGIAPGSMSPLAVNIEQEGVYIDNFKLVDRGTFRE
                     EALAALLTGATYPVRNLTQNVNDLKAQIAANEKGVAELKKMIGLFGEDVVKAYMGHVQ
                     DNAAESVRRVLDRLPDGHFIYEMDQGCQIEVRVTIDREKREATVDFTGTSEQRPDNFN
                     APEPVTRAAVLYVFRVLVEGDIPMNAGCLRPIRIIVPQGSMLSPRYPAAVVAGNVEVS
                     QAVTNCLFGATGAMAAAQGTMNNLTFGNDEYQYYETICSGAPAGPGFNGADAVHTHMT
                     NSRLTDPEILETRFPVLLEDFHIRKGLGGKGKWHAGDGTRRTIRVLEKLDFAILSGHR
                     RVRPFGLKGGKPGETGRKDGSVEVLKGCDQTLLEAGEAFTVITPTGGGYGEPE"
     gene            662033..662806
                     /locus_tag="BSVBI22_RS13220"
                     /old_locus_tag="BSVBI22_B0674"
     CDS             662033..662806
                     /locus_tag="BSVBI22_RS13220"
                     /old_locus_tag="BSVBI22_B0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006107928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_004689042.1"
                     /db_xref="GI:490826952"
                     /translation="MKFAQILATAGIIQAVLFTGAMAGENLDAIKSAGVLKIGTEGTY
                     APFTYHDKDNKLVGFDVEIGEAIAGKLGVKPEFVEGKWDGLIAGLDANRYDAVINQVG
                     ITEERKKKFNFSNPYIVSKVVLIVNDKNDTIKDFADLKGKKAAQSLTSNYGRLAKEAG
                     AKLVATDGFDQSIQLVLTGRADATLNDSLSYLDFRKHQPKAPVKVVAEKDEATASGII
                     VRKGDDELVAAINKALDEIKADGTYNKISQKYFGQDVSK"
     gene            662986..663666
                     /locus_tag="BSVBI22_RS13225"
                     /old_locus_tag="BSVBI22_B0675"
     CDS             662986..663666
                     /locus_tag="BSVBI22_RS13225"
                     /old_locus_tag="BSVBI22_B0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine ABC transporter permease"
                     /protein_id="WP_006192043.1"
                     /db_xref="GI:493203880"
                     /translation="MPDWLQLMADSLPTLLWAGLIFTIPLTLLSFTFGLALGLLTALV
                     RLFAPVWLSSVARFYVWIFRGTPLLVQLFVIFYGLPSIGIYLDAFPAALISFTLNIGA
                     YSSEIIRAVISSVPKGQWEAAYSIGMSWRQALIRTILPQATRTAVPPLSNTFISLIKD
                     TSLAAAITVPELFQSAQRIVATTYEPLILYIEAALIYLALSSILSALQVRLERRFGRY
                     GGTLETNA"
     gene            663663..664424
                     /locus_tag="BSVBI22_RS13230"
                     /old_locus_tag="BSVBI22_B0676"
     CDS             663663..664424
                     /locus_tag="BSVBI22_RS13230"
                     /old_locus_tag="BSVBI22_B0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006134682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_004681962.1"
                     /db_xref="GI:490819865"
                     /translation="MIELQHIVKRFDDAVILNDINITIAEGTVTALVGPSGGGKSTLL
                     RCINLLEIPTSGTLLLGGQSITFEPNRKPSWQTIQSIRRQTGMVFQNFQLFPHQTAIQ
                     NVMEGLVTVLKWPKNKARERAMELLTKVGMAHKADAWPSTLSGGQQQRIAIARALAPS
                     PRVLLCDEPTSALDPELASEVVDVLSKLAQEGTTMVIATHDLRLASKIAKNVVFLETG
                     NVVETGSAHDVFTHPTRERTKQFVATINAAHSYDI"
     gene            664633..666162
                     /locus_tag="BSVBI22_RS13235"
                     /old_locus_tag="BSVBI22_B0677"
     CDS             664633..666162
                     /locus_tag="BSVBI22_RS13235"
                     /old_locus_tag="BSVBI22_B0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192045.1"
                     /db_xref="GI:493203882"
                     /translation="MKNPEERTADTVHQGASGGQSGTIQARNPSEGGKRKLRKNAAAE
                     AGNARSAPDSGRPKTQNEAEAKGSPGQRKRARRRHRGKASRGTEAASAKPPAAEAAHA
                     EARPCGKISNRRRRARKKKQQARQQNGQPAHVAESAAKAAHHTPRTENHAPAPQAKRK
                     AGTPQPARHAHGEAPLYAALDLGTNNCRLLVASPTRPGQFRVVDAFSRIVRLGEGLST
                     TGALSDNAMHRAVEALKICRDKLAGKKIRRSRLIATEACRSAANGEEFLARVREETGL
                     ELEIVDRQTEARLAVSGCGTLVTSDTDAVVLFDIGGGSSEIALIDVSQRRSPRLAEHI
                     TAWTSLPVGVVTLAERFGGRNVTEESFGAMVDHVTELLSRFAERNCLGPLAASPRFHL
                     LGTSGTVTTLAGIHLGLERYDRRRVDGMWMGADDVTQMTNRLLSWDFEARVAKPCIGA
                     DRADLVLAGCAILDAIRKVWPSEKLLVADRGLREGILTELMSRDGAWRHNRASGARNR
                     H"
     gene            666164..666886
                     /locus_tag="BSVBI22_RS13240"
                     /old_locus_tag="BSVBI22_B0678"
     CDS             666164..666886
                     /locus_tag="BSVBI22_RS13240"
                     /old_locus_tag="BSVBI22_B0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YCD5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA large subunit methyltransferase E"
                     /protein_id="WP_002965955.1"
                     /db_xref="GI:489055809"
                     /translation="MSKAGGNKGGSRTGGRGGAGSSNLHVRVKKKAGTIKESSRRWLE
                     RHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARIV
                     GSTDENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDALGDKPDLVISDMAAPT
                     TGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENELLALLKQKFRSVHH
                     VKPPASRAESVELYLLARDFKG"
     gene            complement(667085..668494)
                     /locus_tag="BSVBI22_RS13245"
                     /old_locus_tag="BSVBI22_B0679"
     CDS             complement(667085..668494)
                     /locus_tag="BSVBI22_RS13245"
                     /old_locus_tag="BSVBI22_B0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_006192050.1"
                     /db_xref="GI:493203887"
                     /translation="MNRIIPLVLAIALFMEQMDSNVISTSLPAIAADIGTSPIALKLA
                     LTAYLVALAVFIPVSGWMADRFGAKNVFRAAIAVFVVGSIACAASNSLPAFVIAHFLQ
                     GMGGAMMTPVGRLVLIRSTPRNELVSAMAWLTIPAMVGPLVGPPVGGFITTFLTWHWI
                     FLINVPIGMIGIWFATHFLPDNEERIIKRLDWPGFFLSGFAMSGVVFGLSVVSLPALP
                     PVIGFATLAVGMLCTVLYVLHARRTPDPLLNLRLFDNQVFRSAVFGGSIFRFGIGAIP
                     FLLPLMFQLGFGLTPFQSGMMTFVSAIGAISMKFGAKRIFTRISFRRALMGGSLISAA
                     FIAVNGTFTPATPYWIIIGFLLVGGFARSLFFTGVNALAFAEIPNEKTSQATPLTAVA
                     QQVSIAIGVALAGGILEISTMLRGAPLALVDFHIGFFVVACVSVLAFFWFARLAPDAG
                     KELATPSVTRHHGKPVTTA"
     gene            668834..668935
                     /locus_tag="BSVBI22_RS13250"
                     /old_locus_tag="BSVBI22_B0681"
     CDS             668834..668935
                     /locus_tag="BSVBI22_RS13250"
                     /old_locus_tag="BSVBI22_B0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006107923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002970632.1"
                     /db_xref="GI:489060578"
                     /translation="MNDITRTAIIYGMMIISLNTALAIGLLGIDFLR"
     gene            complement(669056..670170)
                     /locus_tag="BSVBI22_RS13255"
                     /old_locus_tag="BSVBI22_B0682"
                     /note="sugar ABC transporter ATPase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(670189..671070)
                     /locus_tag="BSVBI22_RS13260"
                     /old_locus_tag="BSVBI22_B0683"
     CDS             complement(670189..671070)
                     /locus_tag="BSVBI22_RS13260"
                     /old_locus_tag="BSVBI22_B0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002965950.1"
                     /db_xref="GI:489055804"
                     /translation="MSVQSQDNAIKSGKLTRALIYSALIFFAFYYLLPLYVMLVNSFK
                     PLEEIRQGGMLNLPQQWTIEPWLSAWSTAQIGVQPTGLKPFFINSILMVVPAVAISTI
                     VGALNGYVLTKWRFRGSNIFFGLLLLSCFIPFQIVLIPMARVLGILGIAGTIWGLILV
                     HVVYGLGFTTLYFRNYYEAFPTELVRAAQIDGASFFQIFWRILLPSSGPIIVVSVIWQ
                     FTNIWNDFLFGASFSGAHSTPMTVALNNLVSSSTGVKEYNVHFAGAILAALPTLIVYI
                     VSGRYFVRGLMSGAVKG"
     gene            complement(671067..671948)
                     /locus_tag="BSVBI22_RS13265"
                     /old_locus_tag="BSVBI22_B0684"
     CDS             complement(671067..671948)
                     /locus_tag="BSVBI22_RS13265"
                     /old_locus_tag="BSVBI22_B0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006104968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_006016215.1"
                     /db_xref="GI:492868068"
                     /translation="MQRNNRLQALVPKLVLGPSFLIVLVFVYGFIIYTGVLSLTNSRM
                     LPSYGFVGLTNYTKLWALPHWWRAITNLAIFASLYIIICSVIGLFLAILLDQKIRGEG
                     ILRPIYLYPMALSFIVTGTAWKWFLDPGIGLEHTMHLWGWESFSFNWIKSNTMAIYCL
                     VIAAVWQSSGFVMAMFLAGLRGVDNEIIKAAQIDGASTGTIYRRIIIPLMRPVFLSAF
                     VVLAHLAIKAYDLVIALTGGGPGQATELPATFMYSYTFTRNQMGIGASSAIIMLAMIF
                     SIIIPYLYSEIRGGSRP"
     gene            complement(672224..673489)
                     /locus_tag="BSVBI22_RS13270"
                     /old_locus_tag="BSVBI22_B0685"
     CDS             complement(672224..673489)
                     /locus_tag="BSVBI22_RS13270"
                     /old_locus_tag="BSVBI22_B0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O06875.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative sugar-binding periplasmic protein"
                     /protein_id="WP_004690251.1"
                     /db_xref="GI:490828161"
                     /translation="MHKLLKLAAMGTAACALLAGMAPVANAQEKQNVEVLHWWTSGGE
                     ASALEVLKKDLESKGISWTDMPVAGGGGTEAMTVLRARVTAGNAPTAVQMLGFDIRDW
                     AKQGALGNLDTVASKEGWEKVIPAPLQEFAKYDGHWIAAPVNIHSTNWMWINKAALDK
                     AGGKEPTNWDELIALLDNFKAQGITPIAHGGQPWQDATIFDAVVLSFGPDFYKKAFID
                     LDPEALGSDTMKQAFDRMSKLRTYVDDNFSGRDWNLASAMVIEGKAGVQFMGDWAKGE
                     FLKAGKKPGEDFVCMRYPGTQGAVTFNSDMFAMFKVSEDKVPAQLEMASAIESPAFQS
                     AFNVVKGSAPARTDVPDTAFDACGKKAIADVKEANSKGTLLGSMAHGYANPAAVKNAI
                     YDVVTRQFNGQLSSEDAVKELVAAVEAAK"
     misc_binding    674136..674299
                     /note="FMN riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="flavin mononucleotide"
     gene            674376..674852
                     /locus_tag="BSVBI22_RS13275"
                     /old_locus_tag="BSVBI22_B0687"
     CDS             674376..674852
                     /locus_tag="BSVBI22_RS13275"
                     /old_locus_tag="BSVBI22_B0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006151836.1"
                     /note="RibE; 6,7-diimethyl-8-ribityllumazine synthase;
                     DMRL synthase; lumazine synthase; beta subunit of
                     riboflavin synthase; condenses
                     5-amino-6-(1'-D)-ribityl-amino-2,4(1H,3H)-pyrimidinedione
                     with L-3,4-dihydrohy-2-butanone-4-phosphate to generate
                     6,6-dimethyl-8-lumazine (DMRL); riboflavin synthase then
                     uses 2 molecules of DMRL to produce riboflavin (vitamin
                     B12); involved in the last steps of riboflavin
                     biosynthesis; forms a 60mer (icosahedral shell) in both
                     Bacillus subtilis and Escherichia coli; in Bacillus
                     subtilis this 60mer is associated with the riboflavin
                     synthase subunit (alpha) while in Escherichia coli it is
                     not; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase 2"
                     /protein_id="WP_002965946.1"
                     /db_xref="GI:489055800"
                     /translation="MNQSCPNKTSFKIAFIQARWHADIVDEARKSFVAELAAKTGGSV
                     EVEIFDVPGAYEIPLHAKTLARTGRYAAIVGAAFVIDGGIYRHDFVATAVINGMMQVQ
                     LETEVPVLSVVLTPHHFHESKEHHDFFHAHFKVKGVEAAHAALQIVSERSRIAALV"
     gene            complement(674853..675137)
                     /locus_tag="BSVBI22_RS13280"
     CDS             complement(674853..675137)
                     /locus_tag="BSVBI22_RS13280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014315852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase family accessory protein
                     FdhD"
                     /protein_id="WP_006192069.1"
                     /db_xref="GI:493203907"
                     /translation="MREDIGRHNALDKLIGAVAREGLLAEEGIVAITSRVSVEMVQKA
                     VMLGVPVLAAISAPTALAIRTAEATNLTLVALVRDEEFDIYTHCGRIIEG"
     gene            complement(675095..675661)
                     /locus_tag="BSVBI22_RS13285"
     CDS             complement(675095..675661)
                     /locus_tag="BSVBI22_RS13285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase family accessory protein
                     FdhD"
                     /protein_id="WP_006192071.1"
                     /db_xref="GI:493203909"
                     /translation="MTNQKISRDVHHLAHRMSGFQESSRIVPEEAPIAMSYNGTTQAV
                     MMATPGDLEDFAIRFSLTENIVTRIEEIEALDIVAFESGIDIQMKLAKQPEQRLSARR
                     RFMAGPVGCGLCGIDSIEQALRPLHPLEECSTTFTTRDIAAAVASLGAAQALNAKTHA
                     THGAGFFGRVRGFLPCARISGGTMRSTS"
     gene            675771..676115
                     /locus_tag="BSVBI22_RS13290"
                     /old_locus_tag="BSVBI22_B0689"
     CDS             675771..676115
                     /locus_tag="BSVBI22_RS13290"
                     /old_locus_tag="BSVBI22_B0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002971220.1"
                     /db_xref="GI:489061180"
                     /translation="MEIRQIDDNYSVTGQINPDDVRDIAAEGFQTIICNRPDGEGGEE
                     QPDFEEIARVAEKAGLAAYYIPVVGGQLTQENVDDMAAALAEAEGPVLAYCRSGARST
                     NIYGIVQNQKRG"
     gene            complement(676185..676586)
                     /locus_tag="BSVBI22_RS13295"
     CDS             complement(676185..676586)
                     /locus_tag="BSVBI22_RS13295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004690253.1"
                     /db_xref="GI:490828163"
                     /translation="MVAGLSVVRNDLNWMMETMLTSQQWLPVELLNIGLAAAVFFACL
                     VHSLWKAVFDELNPVFWRRTAALLWAGVVIVALTGGMDTFNWPQALGWLLIAGGVCAT
                     VWRAGMGYYRQYCAHNSHGLHARRTRLSSGR"
     gene            complement(676764..678533)
                     /locus_tag="BSVBI22_RS13300"
                     /old_locus_tag="BSVBI22_B0691"
     CDS             complement(676764..678533)
                     /locus_tag="BSVBI22_RS13300"
                     /old_locus_tag="BSVBI22_B0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_006171189.1"
                     /db_xref="GI:493166189"
                     /translation="MGNAGVVKHRRCDIERLMAETVAVPESKTLRPPRAGRAWLWLSA
                     VVTVLVLFPVLALALEALQGSAGLWSHLAFTTLPAAFADTVILLSGVGLIAAVLGTSM
                     AWLVTAYDFRGRAVLEWALLLPLAVPTYIIAYAYLDLLHPVGPVQGAVRFLLGYDSPR
                     QFRLPDIRSMGGCIVLLGFVLYPYVYIPTRAMFLTQSASLIEAARTLGVSRKGIFWRV
                     ALPLARPAVAVGVSLALMETLNDVGAAEFLGVRTLTVSIYTTWITRSDLPGAAQLALA
                     LLFLVVALVSIERWARRKQRFASNIRHSRGFDPLKVSGFHGAWLFCLCAIPVMIGFVL
                     PAFYLAVEAIKRMRFAGISPRLAGEALNTVALASVATVLVLICGMLVAYAVRLFPAAF
                     SRWCYRFSTMGYAAPGTVIAIGILVVSGGFDRLLNQFTMQFFGFSAGLVLIGTGAAVV
                     YAYVVRFLAISAGGIDAGLERIPLSLDHASRTLGRSVTETFRAVHLPLSRTAIVAAGL
                     LVFVDCVKELPATLLLRPLNVETFATHLYGEAARGTYEEASIAALAIVITGILPVILL
                     ARVGRRLGRKEKLSAPQGPVRAG"
     gene            complement(678554..679570)
                     /locus_tag="BSVBI22_RS13305"
                     /old_locus_tag="BSVBI22_B0692"
     CDS             complement(678554..679570)
                     /locus_tag="BSVBI22_RS13305"
                     /old_locus_tag="BSVBI22_B0692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_006192075.1"
                     /db_xref="GI:493203913"
                     /translation="MSIIARSALALVAVTLVTGAAHADEVNLYTTREPGLIQPLLDAF
                     KSSTGITVNTVFLKDGLAERVASEGENSPADILMTVDAGNLVDLKDKGLTQPIDSKML
                     KEAVPAQLRDADGDWYALSMRARVVYADKDMEIDKITYEELSDPKWKGKICIRAGQHP
                     YNTALFADYIAHHGVAKTEEWLAGLKANLARKAAGGDRDGAKDIVGGICDLAVANSYY
                     VGLMRSGKGGEDQKVWGEGIKVLLPTFQGGGTQVNISGAAVAKHAPHKEEAVKLLEYL
                     VSDEAQQIYAKANYEYPVKPGAPLDPIVESFGELKIDTVPLSEIVSHRKQASELVDKV
                     GFDN"
     gene            complement(679696..680799)
                     /locus_tag="BSVBI22_RS13310"
                     /old_locus_tag="BSVBI22_B0693"
     CDS             complement(679696..680799)
                     /locus_tag="BSVBI22_RS13310"
                     /old_locus_tag="BSVBI22_B0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_006192077.1"
                     /db_xref="GI:493203915"
                     /translation="MDARNLQDERPGEEKCRQHSGTALSLSGICRQFGTMQALNHVSL
                     DVEPGEIICLVGHSGCGKTSLLRIIAGIDAPDSGTLTMGGKTLVSNGIFVEPEKRNVG
                     VVFQDYALFPHLTVRENVRFGLSRMRRSEANARAGELLDLVGLGHMADRYPHMLSGGE
                     QQRVALIRALAPKPHVLLMDEPFSNLDCGLRARVRRETVSLLRALGTTAIIVTHEAEE
                     ALSTGDRVVLMRSGQIVQSGSPRDLHDCPVNRYAADFFCDFNAIPAEVHGDTLVTPFG
                     TIKKEAGFPSGSRVVVYLRPCDIAVLGADDGNLSLHGRIEARTYLGESEELVVKAGDM
                     PLRLHVRGEAPIPSGLADVSLCPHWEKALVFPD"
     gene            681036..682364
                     /locus_tag="BSVBI22_RS13315"
                     /old_locus_tag="BSVBI22_B0694"
     CDS             681036..682364
                     /locus_tag="BSVBI22_RS13315"
                     /old_locus_tag="BSVBI22_B0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid oxidase"
                     /protein_id="WP_006192080.1"
                     /db_xref="GI:493203918"
                     /translation="MGPITDKVATAESLPQETRIAIIGGGVIGVSTALFLAERGIPVT
                     LFEKGEIAGEQSSRNWGWCRRTGRDSREMPLIVESMRLWEGMNARTGRETGFRVKGIV
                     YAAEKEEQMARYAEWIKIARQHGIETHLLNGEQAEALAPGLTRRLAGGMSTPLDGRAE
                     PQKAVPAMAAKAQEDGAVILQNCAVRGIETTNGRVSAVLTEKGRVRCEAVVVAGGAWS
                     RLIISGFKAHLPQLKVRSSVFRTAPIEGGVEPAIAFSDFALRKRLDGGYTVASLSSSI
                     ADIVPDSFRFFRDFIPSLSTEWRSLRFRLGERFFEEAFQWKLRPADQMSIFEKIRTLD
                     PAPHHTANVQVLAQLKKAIPAFAPAVIAQEWAGLIDTMPDIIPVISPLPGVEGLIVAT
                     GFSGHGFGIGPGAGRLVADMVCNETPLVDPSPFHISRFSDGTKIRIENWE"
     gene            complement(682622..683143)
                     /locus_tag="BSVBI22_RS13320"
                     /old_locus_tag="BSVBI22_B0695"
     CDS             complement(682622..683143)
                     /locus_tag="BSVBI22_RS13320"
                     /old_locus_tag="BSVBI22_B0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase [Cu-Zn]"
                     /protein_id="WP_002972093.1"
                     /db_xref="GI:489062065"
                     /translation="MKSLFIASTMVLMAFPAFAESTTVKMYEALPTGPGKEVGTVVIS
                     EAPGGLHFKVNMEKLTPGYHGFHVHENPSCAPGEKDGKIVPALAAGGHYDPGNTHHHL
                     GPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIKQRSLMVHVGGDNYSDKPEPL
                     GGGGARFACGVIE"
     gene            complement(683419..685023)
                     /locus_tag="BSVBI22_RS13325"
                     /old_locus_tag="BSVBI22_B0696"
     CDS             complement(683419..685023)
                     /locus_tag="BSVBI22_RS13325"
                     /old_locus_tag="BSVBI22_B0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multicopper oxidase"
                     /protein_id="WP_004690254.1"
                     /db_xref="GI:490828164"
                     /translation="MTGITRRRLLALGASAACVAALRPLGAFAQDAHQHMRHGAVDAP
                     VLKAPPLPLPPLVEPDASGIVRLKVQKGRHSFAKGSTAASAGINGAYLGPLVRLMSGE
                     SVTLSVENAMDEETTLHWHGLFVPSHLDGGPHNVIAPGAKWEPKVAVNQPASFNWFHP
                     HLHGHTARQAHMGIAGLMIVRDGKDAERGLPETYGVDDLPLVLQDRRVIEGDAVYAPD
                     IMDLIHGFRGDWLIVNGAIAPEARVPAAMVRLRLLNGANARNFHIRFADGRPLLVIAS
                     DGGFISQPVSIEQLTISPGERYEVLVDFSNGEAVDLVTYGDNGSGDGLHLMRFAVDPA
                     LEGRVAKPPVSLDGPAAPDEKLSVQRRSFFFDERMAENMKLMMRQPSSNPHASGDDMD
                     HMEMGSMAGMDHDMHGSRSAADAGPALDALTSGVQMAIADKPFDMERIDVEAKLGSWE
                     IWELTSREMAHPFHIHGASFRILSMNGKKPPAHQTGWKDTALIDGKAEILVHFDREAA
                     RSHPFMFHCHLLEHEDVGMMAQFVTV"
     gene            complement(685083..685478)
                     /locus_tag="BSVBI22_RS13330"
                     /old_locus_tag="BSVBI22_B0697"
     CDS             complement(685083..685478)
                     /locus_tag="BSVBI22_RS13330"
                     /old_locus_tag="BSVBI22_B0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006120483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968479.1"
                     /db_xref="GI:489058381"
                     /translation="MSFVKRDIGVRMTARGHAVLRLPSRAVVLLFSLLFLVSAQLCYG
                     MAHDMPPREAAWDCHMNKPQAKTPQPVEHGAKAPNMCVMMACGGIVRPAGGFSTCAPA
                     QDFGLPPLVSALSGSNPHGVLRPPIVLHA"
     gene            685732..687012
                     /locus_tag="BSVBI22_RS13335"
                     /old_locus_tag="BSVBI22_B0698"
     CDS             685732..687012
                     /locus_tag="BSVBI22_RS13335"
                     /old_locus_tag="BSVBI22_B0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_004687208.1"
                     /db_xref="GI:490825118"
                     /translation="MTVAEAVAPQANSVRRVLTASMIGTTIEFFDFYIYATAAVIVFP
                     HLFFPASDGNSALLQSFATFAIAFFARPVGAAIFGHFGDKIGRKATLVAALMTMGLST
                     VAIGFLPTYASIGVAAPLLLALCRLGQGLGLGGEWGGAVLLATENAPEGKRTWYGMFP
                     QLGAPAGFILATGIFLLLAETMTEEQFFAYGWRVPFIASAILVAVGLFIRLRIAETPE
                     FQKAIDKAERVAVPAAQLFRHHKMNLFLGTIGTMATFVLFYLMTVFSLGWGTRALGYS
                     REEFLVLQMIGVIFFGLTIPLSALLSDRYGMRTIMVIVTVLIGLYGFIMAPLFAAGTA
                     GVLGFLIIGFGLMGMTYGPIGAVLAEPFPTSVRYTGASLAFNLAGILGASLAPYIATW
                     LATDYGFAYVGYYMVAAAIISLIGFVFITLKDKK"
     gene            complement(687090..687617)
                     /locus_tag="BSVBI22_RS13340"
                     /old_locus_tag="BSVBI22_B0699"
     CDS             complement(687090..687617)
                     /locus_tag="BSVBI22_RS13340"
                     /old_locus_tag="BSVBI22_B0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YCF2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase AhpD"
                     /protein_id="WP_004690255.1"
                     /db_xref="GI:490828165"
                     /translation="MSIDDLKSKIPDFAKDVRLNLSSMASNETLTPQQKYGLFVACGI
                     ASRNADVRKALVAEAAGKVDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPAR
                     LRMNVISNPGVDKVDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFAS
                     IIQSAAIALEAADTE"
     gene            complement(687697..688251)
                     /locus_tag="BSVBI22_RS13345"
                     /old_locus_tag="BSVBI22_B0700"
     CDS             complement(687697..688251)
                     /locus_tag="BSVBI22_RS13345"
                     /old_locus_tag="BSVBI22_B0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009762448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase"
                     /protein_id="WP_002965933.1"
                     /db_xref="GI:489055786"
                     /translation="MLGIGDKLPSFKVTGVKPGFNHHEENGVSAFEEVTEQSFPGKWK
                     VIFFYPKDFTFVCPTEIAEFARLASEFEDRDAVVLGGSTDNEFVKLAWRRDHKDLNKL
                     PIWSFADTNGSLVDGLGVRSPDGVAYRYTFVVDPDNVIQHVYATNLNVGRAPKDTLRV
                     LDALQTDELCPCNREVGGETLKAA"
     gene            688377..689282
                     /locus_tag="BSVBI22_RS13350"
                     /old_locus_tag="BSVBI22_B0701"
     CDS             688377..689282
                     /locus_tag="BSVBI22_RS13350"
                     /old_locus_tag="BSVBI22_B0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_004690256.1"
                     /db_xref="GI:490828166"
                     /translation="MLNISVRQLHYFLALVQAGSFSRAAEAIGVTQSTLSAAIQALEA
                     ELGATLIDRTGRRMQMLPAGEDFLARARDIVALIEELPEHARQAERPLTTRLRMGVIP
                     SIAPFLLPKVLPATAKAFPELQLTVREGLTRSLLESLRSGTLDVALVAHPYDFDEFEI
                     AEIGRDPFLLAVRRDHALANRDSVEASDIDDQPFLLLETGHCLREHVMAAIGSKPAQM
                     SGDVHATSIMTLVQLVQFGMGVTLLPQLAIKAGVTRGTDLSVVPYEGKYNFRSLVLAW
                     RTNAARRNEFQLFANHLRSNCLQDV"
     gene            complement(689312..690436)
                     /locus_tag="BSVBI22_RS13355"
                     /old_locus_tag="BSVBI22_B0702"
     CDS             complement(689312..690436)
                     /locus_tag="BSVBI22_RS13355"
                     /old_locus_tag="BSVBI22_B0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004690257.1"
                     /db_xref="GI:490828167"
                     /translation="MPLQTSPLAKRGIQLRYADMAYDLNNLPLEAFFVPVSAATAALA
                     RLDERLARSPIRDGMVQRLHMHDAVASMWVEGELVHMEDLVLHDALMDSRTPSHALTI
                     AHGVLRMRRQIASRAASWALSPAGMQQLLGRPLEAFAPRDAERPETDEDDPLLDDIDA
                     LLARTDALLEGIAANRRKPEAVPRDQLLYDDDWDEDARLQEWRDCCAATADLPPLLRA
                     AIMHDAWFSLEVVQRSAWVGRLLTAAFLRQSGLAANHLPAISLGLRNKRPDERRSSNR
                     VIRLKTFLAAIEEAAEAIMKEHDRLMLAREQMQRKLKGRRSNSRLPQLMELILRTPLV
                     SSQLVEKELQVTQQGALKLIGELNLREITGRGRFRAWGIL"
     gene            complement(690477..691469)
                     /locus_tag="BSVBI22_RS13360"
                     /old_locus_tag="BSVBI22_B0703"
     CDS             complement(690477..691469)
                     /locus_tag="BSVBI22_RS13360"
                     /old_locus_tag="BSVBI22_B0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol 2-dehydrogenase"
                     /protein_id="WP_006192084.1"
                     /db_xref="GI:493203922"
                     /translation="MVTRLALLGAGHIGKVHAGAIASDRRARLVAVADANEDAAKAIA
                     DASGAQVRSIDEIERASDVDAVLICTPTNTHADLIERFARAGKAVFCEKPIDLDIARV
                     HACLAVIRETGAKVMLGFNRRFDPHFVAVRKAIDDGRIGKVEMVTITSRDPGAPPADY
                     IKVSGGIFRDMTIHDFDMARFLLGEEIESVAASASVLVDPKIGELGDYDSASVILTTA
                     SGRQCVISNSRRASYGYDQRIEVYGSLGAVSAENQRPVSIEIASKDGYNRPPLHDFFM
                     TRYTAEIGAFIDALDSGKAPMPSAEDGLKALALAEAALRSVKEGRTVKVAEILP"
     gene            691643..692473
                     /locus_tag="BSVBI22_RS13365"
                     /old_locus_tag="BSVBI22_B0704"
     CDS             691643..692473
                     /locus_tag="BSVBI22_RS13365"
                     /old_locus_tag="BSVBI22_B0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_002965929.1"
                     /db_xref="GI:489055782"
                     /translation="MDSTPSPSPAPASIKEFEARLLEVADRLPKRLKQCADYVAANQD
                     RIAVSTVAEMAEGAGVQSSAFMRFCQILGFSGFSEMQRLFRETYAGGWPDYSTRLLHL
                     RETAAGRAPALLAEFAEAGRTSLEGLLKTIEPEALEKAVELLASANTIHIIGIRRAFP
                     VASYLAYALEKMAVPAMLHSAVGKLENLHAIRKGDVLLAITFSPYSPETIGMTEAVAA
                     RGIDVIGITDTIVSPMSKVARQTLLVSEVDFGAFRSLSATLCLAIAIAVAVGTARQAG
                     "
     gene            692565..694468
                     /locus_tag="BSVBI22_RS13370"
                     /old_locus_tag="BSVBI22_B0705"
                     /note="5-dehydro-2-deoxygluconokinase; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            694501..696324
                     /locus_tag="BSVBI22_RS13375"
                     /old_locus_tag="BSVBI22_B0706"
     CDS             694501..696324
                     /locus_tag="BSVBI22_RS13375"
                     /old_locus_tag="BSVBI22_B0706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate decarboxylase"
                     /protein_id="WP_004690260.1"
                     /db_xref="GI:490828170"
                     /translation="MKTVRLTAAQALVRYLANQMTPEGDTFIAGVWAIFGHGNVAGLG
                     EALYGAREHMPTWRGHNEQTMAHAAIAYTKQLGRRRACAVTSSIGPGATNMVTAAALA
                     HVNRLPVLFVPGDVFANRGPDPVLQQIEDFNDGTMTVNDCFRPVSRYFDRITRPEQLL
                     TALPRAFRTMTDPADCGPVTLAFCQDVQAQAYDWPEEFFTPKVWHWRRPPPDERELET
                     AAAAIKTALKPVIVAGGGVHYSGAHEVLRAFVETHGIPVIETQAGKSALPWDHPLNFG
                     PVGVTGADSANAVAAEADLVIGVGTRFQDFTTGSWALFRHPGRRLLSLNVQPYDGAKH
                     NSLPLVADAKIGLEALSGAIGAYRRQAVDASLKNRWFAAADRFTAAPSDGNALPTDMQ
                     VIGAVQRQARENSVVMCAAGTMPGELHQLWKAGRPMSYHMEYGFSCMGYEIAGGLGIK
                     MAEPDRDVIVMVGDGSYMMANSELAISIMMGQKITVVVTDNRGFGCINRLQMATGGAE
                     FNNLLDHAAHVNPSQIDFAAHAAAMGADAKKVGSIRELEGALAEARDSLRTTVIVIDT
                     DPYPTPETGGWWWDVAVPEVSERDEVRAARKNYEAQIKERN"
     gene            696328..697230
                     /locus_tag="BSVBI22_RS13380"
                     /old_locus_tag="BSVBI22_B0707"
     CDS             696328..697230
                     /locus_tag="BSVBI22_RS13380"
                     /old_locus_tag="BSVBI22_B0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192094.1"
                     /db_xref="GI:493203932"
                     /translation="MILYGTNPIAWSNDDDRSLGAHITLDQCLDEAAKIGFDGIEKGH
                     KFPQEAAVLKAVLEPRGLRYVSGWHSLNLLVNSVEEEKAAMQPALDLLKAMGSKVIIV
                     CETSNAIHGDNDKPLQERPVLEDARWEAFGLGVEALAAHAAAQGITLVYHHHMGTIVE
                     TEDEIDRLMRFTGPHTRLLLDTGHCLFGRGNPERVAQKHIARVGHIHAKNIRRDIVQD
                     VRDQNLSFLEGVRRGVFTVPGDTEGSVDFVPVLKIAAEHGYQGWLVIEAEQDPDVRNP
                     FEYQSLGLKSLKAFAREAGLDKGV"
     gene            697234..698044
                     /locus_tag="BSVBI22_RS13385"
                     /old_locus_tag="BSVBI22_B0708"
                     /note="5-deoxyglucuronate isomerase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(698076..698876)
                     /locus_tag="BSVBI22_RS13390"
                     /old_locus_tag="BSVBI22_B0709"
     CDS             complement(698076..698876)
                     /locus_tag="BSVBI22_RS13390"
                     /old_locus_tag="BSVBI22_B0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_006192098.1"
                     /db_xref="GI:493203936"
                     /translation="MTAHSRQDLETRLALAEKIVQEAGAKALDYFNRRETLVIETKRD
                     PQDVVSIADRDVEQLIRARVSESFPQDGFLGEEYGLNAGSSGYTWVVDPIDGTSPFVN
                     GMPNWCVSIAVLKDGEPVVGVILAPCFNELYVSAKGQGATLNGRKLALDPSRNIRNAV
                     TGIGANNYVTPQLVTKVVENLLEAGGTFIRNGSGALMIAYVAAGRLVGYYEPYMHAWD
                     CMAGFCLVREAGGYIYPFPTDGENLTKGNRVFAAAPGAVDDLKKVAGL"
     gene            complement(698897..699958)
                     /locus_tag="BSVBI22_RS13395"
                     /old_locus_tag="BSVBI22_B0710"
     CDS             complement(698897..699958)
                     /locus_tag="BSVBI22_RS13395"
                     /old_locus_tag="BSVBI22_B0710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe(3+) ions import ATP-binding protein FbpC"
                     /protein_id="WP_006192100.1"
                     /db_xref="GI:493203938"
                     /translation="MTAIRPGSVTFENVTKKFGNFTALPNLSLTVEPGTLVTLLGPSG
                     CGKTTTLRLLAGLEHPTSGRILVGGKDVTNLPANERDVSMVFQSYALFPHMTSLENVA
                     YGLESSGFKKNEARERAEEGLKLVGLGGMGHRLPAELSGGQQQRVAVARALVLEPQVL
                     LLDEPLSNLDARLRRRVRTEIRELQQRLGFTADYVTHDQDEALAVSDTIIVMKEGGIA
                     QKGSPRDLYEAPASAFIADFMGEANVVPCEVISAENGEAVIRVAGLTHRVPARNAQPR
                     PAQLAIRPNAVTLQPQAGGGFSGTVAHSAYLGDHIEYEIETEHGKLFIVDPAVEQSLP
                     LQTDVSIQFKTRGLAIINQ"
     gene            complement(699955..702180)
                     /locus_tag="BSVBI22_RS13400"
                     /old_locus_tag="BSVBI22_B0711"
     CDS             complement(699955..702180)
                     /locus_tag="BSVBI22_RS13400"
                     /old_locus_tag="BSVBI22_B0711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_004692207.1"
                     /db_xref="GI:490830121"
                     /translation="MTQHNRRLDAVLAIALIAFALLPWYRIEDGFLHFSWIEVLFSES
                     AEAPGILQIFVFGRSWIGAIALLMLICAVARFFLPVGKRSGVLIAASLVGFIFLALQG
                     LAIGFSGWNWTISETLFGPLSDGQPSFGAGAILTGLCFLLIFSFGLAERGVMKGDAFV
                     VSSITLLVALVGVFVFYPVLSMFVGSVQDFDGSFNPDGFIGNIQDSSIWSLACVVGEG
                     RCGVAWRTLWLALMTATGSTILGLAFALVATRTNFPFKKGLRLLTILPIITPPFVVGL
                     ALTLLFGRAGVVTEQISSLFGVEPGRWLYGLTGIWIAQVLSFTPISFLVLIGVVEGVS
                     PSMEEASQTLRADRWRTFKRVSLPLMAPGLANAFLIAFIESMADFGNPMVLGGSHGVL
                     STEIFFAVVGAQNDPSRAAVLAIVLLCFTLSAFLVQRLWLSGKNFATVTGKGDSGIHA
                     GLPRGLKIGVYALVIPWMFFTVVVYVMILVGGFVRQWGLDNSLTLEHYARAFSVSWTD
                     GGLAWTGVAWNSFWTTMEISLMSAPLTAAVGLLTAYLIVRQRFVGRNVFEFALMLSFA
                     IPGTVIGVSYIIAFNLPPLEMTGTALILIACFVFRNMPVGVRGGIAAMSQLDQSLDEA
                     SLTLRAGSFRTIRKVILPLLRPAITAALVYSFVRAITSISAVIFLVSAQYNMATAYIV
                     GLVENGEFGVAIAYSSMLIVVMVVVITSFQLLVGERRLRRENRVAAAAPVKSVRQEKT
                     A"
     gene            complement(702315..703340)
                     /locus_tag="BSVBI22_RS13405"
                     /old_locus_tag="BSVBI22_B0712"
     CDS             complement(702315..703340)
                     /locus_tag="BSVBI22_RS13405"
                     /old_locus_tag="BSVBI22_B0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_006192103.1"
                     /db_xref="GI:493203941"
                     /translation="MRSAFMVAALAAGVSSFAFSAQAAGNLNLICSADVVICEQMKNM
                     FEKDTGIKVNMVRLSSGETYAKVRAEARNPKTDIWWAGTGDPHLQAASEGLTLEYKSP
                     MLDQLNDWAKKQAESSGFRTVGVYAGALGWGYNTDIFAKKNLKEPKCWADLLDPSYKG
                     EIQMANPNSSGTAYTALATLVQIMGEDKAFDYLKKLNANVSQYTKSGSAPVKSAARGE
                     TGIGIVFMHDAVAMTADGFPIKSVAPCEGTGYEIGSMSIIKGAKNLENAKKWYDWALT
                     AEVQSHMKDAKSFQLPSNKSAEVPKESPHFKDIKLIDYDFKTYGEPAKRKELLERWDK
                     EVGAVAN"
     gene            complement(703570..707253)
                     /gene="putA"
                     /locus_tag="BSVBI22_RS13410"
                     /old_locus_tag="BSVBI22_B0714"
     CDS             complement(703570..707253)
                     /gene="putA"
                     /locus_tag="BSVBI22_RS13410"
                     /old_locus_tag="BSVBI22_B0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510302.1"
                     /note="proline utilization protein A; multifunctional
                     protein that functions in proline catabolism in the first
                     two enzymatic steps resulting in the conversion of proline
                     to glutamate; in Escherichai coli this protein also
                     self-regulates transcription via a DNA-binding domain at
                     the N-terminus; forms dimers and is a peripherally
                     membrane-associated protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional proline
                     dehydrogenase/pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="WP_004689056.1"
                     /db_xref="GI:490826966"
                     /translation="MTDNIPVSKVAVFQNFAPPIREQSALRQAITAAYRRPEAECVSA
                     LAEQATLPEETRQQIRSTARKLIEALRAKHKGTGVEGLVHEYSLSSQEGVALMCLAEA
                     LLRIPDMATRDALIRDKISNGDWKSHIGGGRSLFVNAATWGLVVTGKLTNTVNDRGLS
                     AALTRLIARCGEPVIRRGVDMAMRMMGEQFVTGETIDEALKRAKELEERGFRYSYDML
                     GEAATTAADAERYYKDYETAIHAIGRASAGRGIYDGPGISIKLSALHPRYTRAQSERV
                     MGELLPKVKALAAIAKSYNIGLNIDAEEADRLELSLDLLQSLCEDPDLAGWDGIGFVV
                     QAYGKRCPFVLDFIIDLARRTKRRVMVRLVKGAYWDAEIKRAQVDGLEDFPVYTRKVH
                     TDVSYIACARKLLAATDVIFPQFATHNAQTLATIYHLAGPDFKTGKFEFQCLHGMGEP
                     LYDEVVGPEKLGRPARIYAPVGTHETLLAYLVRRLLENGANSSFVNRIGDKNVSVDEL
                     IADPVEVVRSMAVVGARHDQIALPENLYGARRNSAGFDLSNEVTLAELSKTLKETAGR
                     AWTAEPQVAGAKVKGVSRPVLNPGDRNDVVGTVTEIAEADVAKAMKAAQTATTSWSAV
                     APAERAACLERAADIMQRDMPALLGLVMREAGKSMPNAIAEVREAIDFLRYYAEQTRR
                     TLGVGHKALGPVVCISPWNFPLAIFTGQIAAALVAGNPVLAKPAEETPLIAAEGVRIL
                     HEGGIPADALQLLPGDGRIGAALVAAPETCGVMFTGSTEVARLIQAQLASRLLPNGKP
                     VPLIAETGGQNAMIVDSSALAEQVVFDVIASAFDSAGQRCSALRVLCLQEDVADRILT
                     MLKGALRELSIGRTDQLKVDIGPVITDEAKNTIEKHIQAMRDLGRKVEQLPLGPETQN
                     GTFVAPTIIEIESLRDLKREVFGPVLHVVRYKRDDMESLIDDINSTGYGLTFGLHTRL
                     DETIANVADRIRVGNIYINRNIIGAVVGVQPFGGRGLSGTGPKAGGPLYLGRLVETAP
                     IPPRHASVHTDAALKDFARWLGNRGMNDLAQAARDTGSASALGLELELPGPVGERNLY
                     ALHPRGRVLLVPQTEIGLYRQLTAVLATGNTAVIDEACGLRAVLKDLPETVAARAIWT
                     GDWQADAPFAGALIEGDSARIKEVNSRIAALPGPLVLTQAASPEDLAANQDAYCLNWL
                     LEEVSTSINTTAAGGNASLMAIG"
     gene            707416..707910
                     /locus_tag="BSVBI22_RS13415"
                     /old_locus_tag="BSVBI22_B0715"
     CDS             707416..707910
                     /locus_tag="BSVBI22_RS13415"
                     /old_locus_tag="BSVBI22_B0715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_002971218.1"
                     /db_xref="GI:489061178"
                     /translation="MRKIDSLDDMDQFDRRILEVLSEDGRIPVTELSKRVGLSKTPCQ
                     ARLKRLVDEGYILGFRAAIDPEKLGLDHIAFTTVKLSDTREAALEAFNVAVRKIREVE
                     ECHMIASSFDYLLKVRTPNIRRYREVLGEKISSLPNVASTSTFVVMESVKDNRPVRVY
                     PGAL"
     gene            complement(708941..711739)
                     /locus_tag="BSVBI22_RS13420"
                     /old_locus_tag="BSVBI22_B0717"
     CDS             complement(708941..711739)
                     /locus_tag="BSVBI22_RS13420"
                     /old_locus_tag="BSVBI22_B0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P62920.2"
                     /note="acts in conjunction with GvcH to form
                     H-protein-S-aminomethyldihydrolipoyllysine from glycine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine dehydrogenase (decarboxylating)"
                     /protein_id="WP_004690267.1"
                     /db_xref="GI:490828177"
                     /translation="MTEFLPFVARHIGPRHEDERAMLAALGLPSMETLITQAVPASIR
                     LNRALNLPAALSEADALAELGTIMGRNVVKKSFIGAGYHGVHTPPVIQRNLFENPAWY
                     TAYTPYQSEISQGRLELLFHFQTLVAELTGLPVACASLLDEATAVAEAIGVACRHHRD
                     KRSRILLAGELHPQTVDVVNTRAEPLGWEIATGSDVDDNTAAIVVPWPDTRGVYGDFA
                     KVIADAKAKGALVIAVADPLALTIMEAPARWGADMAVGSMQRYGVPMGFGGPHAAYLA
                     VSEALTRIIPGRIVGQSVDAHGRAAYRLALQTREQHIRRDKATSNICTAQALLANMAA
                     AFAIWHGPAGLQAIATRVAALAARFAAALKAAGVEIAGESLFDTVTAKVPGKAAAIAA
                     EADKGGRLIRIIDADTVGVTFDETSTEEDLTALASLFGAKPVGGDTVLVPGKERGEGF
                     LTQEVFHSHRSETEMMRFLRRLADKDLALDRAMIPLGSCTMKLNAAAEMMPVSWNTVA
                     NLHPFAPAEQVQGYAKMTSDLEAWLCEITGFAGVSLQPNAGSQGEYAGLMAIRHYHQA
                     WGQGHRNICLIPSSAHGTNPASASMAGMSVVVVNCRPDGDIDIDDLKAKAEKHRDNLA
                     AFMITYPSTYGVFEEGIKAFCEIVHDNGGQVYFDGANLNALVGLARPADIGADVCHMN
                     LHKTFCIPHGGGGPGVGPIGVAKHLVPYLPGHVEAGSEHAVAAAQFGSASILVITWMY
                     IRMMGGAGLKKATEAAILNANYIAHRLKGVYPILYTGAHDRVAHECIVDTRVLKDSAG
                     ITVEDVAKRLIDYGFHAPTMSWPVAGTLMIEPTESEPKLEIDRLCDAMIAIAGEAKKV
                     ADGVWPADDNPLANAPHTASDTLATEWKHPYTREEAVFPGGAFDPTAKYWPPVSRVDN
                     VGGDRNLICSCPPVAAYG"
     gene            complement(711744..712112)
                     /locus_tag="BSVBI22_RS13425"
                     /old_locus_tag="BSVBI22_B0718"
     CDS             complement(711744..712112)
                     /locus_tag="BSVBI22_RS13425"
                     /old_locus_tag="BSVBI22_B0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006149574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein H"
                     /protein_id="WP_002968488.1"
                     /db_xref="GI:489058390"
                     /translation="MANILFTEDHEWINVENGVATVGITIHAQEQLGDLVFVELPEVG
                     RTVAKGDGVVVVESVKAASDVYAPVDGEVVEVNDAVASDPSLINQAAEGEGWLFKLKL
                     ADEGQLTGLLDKAGYEKLIG"
     gene            complement(712118..713221)
                     /locus_tag="BSVBI22_RS13430"
                     /old_locus_tag="BSVBI22_B0719"
     CDS             complement(712118..713221)
                     /locus_tag="BSVBI22_RS13430"
                     /old_locus_tag="BSVBI22_B0719"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein T"
                     /protein_id="WP_002968489.1"
                     /db_xref="GI:489058391"
                     /translation="MGDTAHLNTLPLQDLHEKAGARFGGFAGWNMPITYPLGVMKEHL
                     HTRDHAGLFDISHMKLVEVSGADAAALLAETCPLDPTILKTGQSKYTFFLNDNGGVLD
                     DLIVTRLGEDRFMVVANAGNADADIEHLNEAASGKAVKVNPLDRVFLALQGPEAEAVI
                     TDAGLPGADLAFMSGFEPKQGWFMTRSGYTGEDGFEIGLPADEARALAEKLLADERVE
                     WIGLAARDSLRLEAGLCLHGQDITPETDPVSAGLTWAITKAVREKAAFNGAKAVLDAI
                     AKGASAKRVGLKPEGRQPVRAGADLFDESGRQIGTVTSGGFGPSAGFPVAMGYVEASL
                     ATPGTRVFADVRGNKVPVDVHALPFTPHRYRKG"
     misc_binding    complement(713268..713370)
                     /note="glycine riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="glycine"
     misc_binding    complement(713373..713453)
                     /note="glycine riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="glycine"
     gene            713875..714021
                     /locus_tag="BSVBI22_RS13435"
                     /old_locus_tag="BSVBI22_B0720"
     CDS             713875..714021
                     /locus_tag="BSVBI22_RS13435"
                     /old_locus_tag="BSVBI22_B0720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965914.1"
                     /db_xref="GI:489055767"
                     /translation="MNLIRSYNNWRRYRNTVNELSRLSPRELNDLGILPSEIPFVARK
                     AAAR"
     gene            complement(714203..715432)
                     /locus_tag="BSVBI22_RS13440"
                     /old_locus_tag="BSVBI22_B0721"
     CDS             complement(714203..715432)
                     /locus_tag="BSVBI22_RS13440"
                     /old_locus_tag="BSVBI22_B0721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_006192105.1"
                     /db_xref="GI:493203943"
                     /translation="MDDRCIIIGAGHAGSQAAVSLRQEGYAGEIILINDETDIPYHKP
                     PLSKSYLKAPEKGSLVLRPESAYRDNNIEMLFGAHVDAVSIAERTVTLGDGRVLPWSE
                     LVFATGARARIPDVPGVALEGVVTLRRMEDARRIAAMMPDVRNVVIIGGGFIGLEMAH
                     SAIALGKKTVLIEAAPRVLGRSVAAPVSAHVEARSRAADITLLTGLGIASIEGENGRA
                     IGVTAGDGTFFPADLVVIGTGAVPNVELAAKAGLSIDNGIRVDEHMRTSAPHVYAIGD
                     CASYAHFHAGRHVRLESVQNATDQAKHVARTIVGRETPYREVAWFWSDQGDMKLQTAG
                     LSFDADRHVLSGEPEENAFSVFHFKGDRLVAVDSINRPADHMIARRLLAAGISPSEAD
                     IMAGMPRLKELLAVVAR"
     gene            complement(715544..716386)
                     /locus_tag="BSVBI22_RS13445"
                     /old_locus_tag="BSVBI22_B0722"
     CDS             complement(715544..716386)
                     /locus_tag="BSVBI22_RS13445"
                     /old_locus_tag="BSVBI22_B0722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_004690268.1"
                     /db_xref="GI:490828178"
                     /translation="METAAPMSASVAELINERIDAMPAGERSAAQMLIANYPMLGLKT
                     VAEFSTQAGVSSPTILRFVNRLGFQSYPDFQARLQDELAAQLQSPHHRNEQPDKRPDA
                     ADPGVEHTLENIRETFRHLGEKQLHQVVASLSLAKGNVYLIGGRFTDPIAQYMTAHMS
                     IVCARVFHLGGQESMWRDRLLDMGKRDILVVFDIRRYQESLLALAEKARSRGVEVVLV
                     TDQWLSPIARVARHVLAGRIAVPSAWDSSAALFVLAETIIREMTRMLEKDSAARIAEL
                     EALR"
     gene            716515..717312
                     /locus_tag="BSVBI22_RS13450"
                     /old_locus_tag="BSVBI22_B0723"
     CDS             716515..717312
                     /locus_tag="BSVBI22_RS13450"
                     /old_locus_tag="BSVBI22_B0723"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="WP_004687194.1"
                     /db_xref="GI:490825104"
                     /translation="MANEREDRAASCEPVFVINEGGESPYLLVCEHASNHMPESFAGL
                     GLDAETRKTHIAWDPGAVEVARELSKALDAPLVEAGLSRLLIDCNRPLDAPDLIPEIS
                     ETTLVPGNHGLNTAERMARIDLSHRPFHRRIEEVIAMRAARGQPSWIVTVHSFTPVYR
                     GVSRPWQIGIIHDEDDRIARPLIAALRQDMGLHIGVNEPYSPADRVYYTLERHARPRN
                     APCVMIEIRNDEITDAGTQTAWGRKLTAILKKYQETMRSAGGAYPYA"
     gene            717376..718743
                     /locus_tag="BSVBI22_RS13455"
                     /old_locus_tag="BSVBI22_B0724"
     CDS             717376..718743
                     /locus_tag="BSVBI22_RS13455"
                     /old_locus_tag="BSVBI22_B0724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006171157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_004687193.1"
                     /db_xref="GI:490825103"
                     /translation="MAGQLTFDELKKAVAEGRIDTVLACIVDMQGRLIGKRFYGQFFV
                     ESGYDETHGCNYLLADDIDMEPVPGYEAAGWDKGYGDFVMKPDLSTLRLAPWLEKTAI
                     VLCDVLDHHHDDLSHSPRAVLKKQVQRLHERGYRAYFASELEFYIFDETYKSARAKRW
                     HEMETASPYVQDYVIHLTTREEPVLRAMRNHLADAGIPVENSKGEWGPGQQELNVRYC
                     KALEMADRHVIMKNAMKEIAEAHGKCITFMAKYDYARAGSSSHVHNSIWSADGKEPLF
                     FDPKAPYTMTPLMRSWVAGQIKYATDYTYFLAPYINSYKRFQAGTFAPTKIMWSQDNR
                     TAGFRLCGEGTKGIRIECRIGGADINPYLAFAALIAAGLKGVDEKLELDEPFVGDAYS
                     AVRLKEIPYTLREAAAALKGSAFLKEAFGEDVVNHYTHTAHWEQIEYDRRVTDWELYR
                     GFERY"
     gene            718844..720013
                     /locus_tag="BSVBI22_RS13460"
                     /old_locus_tag="BSVBI22_B0726"
     CDS             718844..720013
                     /locus_tag="BSVBI22_RS13460"
                     /old_locus_tag="BSVBI22_B0726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_004690269.1"
                     /db_xref="GI:490828179"
                     /translation="MTTLTAKWNFPTTVLFGPGHIKELPAVLKAAGIEHPLFVTDPGL
                     AKLPVVASTLAVLDAAGVQYGVFSDVKPNPVESNLHAGVKVFREGRHDGVIAFGGGSA
                     LDLGKLIAFQAGQTRPVWDFEDIGDWWTRADSNAIAPVIAVPTTAGTGSEVGRAGVLT
                     NESIHTKKVIFHPKMLPVTVIADPELSTGMPPFITVGTGMDALAHCLEAYCAPGFHPM
                     ADGIAVEGIRLVFENLPKAYANGGDIEARANMMAAAAMGATAFQKGLGAIHSLSHPIG
                     ALYDTHHGMTNAVFMPYVLHHNRAAIEKRIARLADYLGIEGGFDGFADAIMKLRAELG
                     VPRTLPDLIKNLQMDNARKELIAEMAVADPTAGGNPVELTKNDALKLLNAALEGR"
     gene            720195..720638
                     /locus_tag="BSVBI22_RS13465"
                     /old_locus_tag="BSVBI22_B0727"
     CDS             720195..720638
                     /locus_tag="BSVBI22_RS13465"
                     /old_locus_tag="BSVBI22_B0727"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lectin-like protein BA14k"
                     /protein_id="WP_002965908.1"
                     /db_xref="GI:489055761"
                     /translation="MNSFRKTCAGALALIFGATSIVPTVAAPMNMDRPAINQNVIQAR
                     AHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLAAFGAGAIIGGAISQPR
                     PVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYSR"
     gene            721047..721946
                     /locus_tag="BSVBI22_RS13470"
                     /old_locus_tag="BSVBI22_B0729"
     CDS             721047..721946
                     /locus_tag="BSVBI22_RS13470"
                     /old_locus_tag="BSVBI22_B0729"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002968494.1"
                     /db_xref="GI:489058397"
                     /translation="MSHTTIPTPVLSSQQRWAMIALITGGIAIGSSPIFVRLSEVGPL
                     ATGFWRLALAVLPLLLMDGRERHERKDAAPLTLADCLRLALPGFFIAADLGAWHLSLH
                     STSVANATLLANMAPIFVTIGAWLLFRSRVSSSFIVGLVVAVAGVIVLKGGPGELLHS
                     RSSGDAMALLAAVFYAGYILSVGRLRSRFSTMRIMLWSSAIAAIFSLPVAYFMEGHIL
                     PATLYGWLVLAGLAWLTHAAGQSMIAYALAFLPASFSSLTLLLQPVVAAFLAWTILSE
                     PIGLMQAIGGVIVISGILIARRG"
     gene            complement(721992..722858)
                     /locus_tag="BSVBI22_RS13475"
                     /old_locus_tag="BSVBI22_B0730"
     CDS             complement(721992..722858)
                     /locus_tag="BSVBI22_RS13475"
                     /old_locus_tag="BSVBI22_B0730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006282913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_004687190.1"
                     /db_xref="GI:490825100"
                     /translation="MLGKLTRFGLAAVVAGTMTMGAAFAQDGKTVKIGWAPWSDAEFV
                     TKLARKLIEDNLGQKVELVQTDVAPLYQGVSRGDIDAMMMAWLPETHADYYKRVEGKV
                     ENLGPLYEGAKLGWIVPDYIPESEISSIEDLKKPEVREKLKGEIQGIDPGAGLTRLSQ
                     EAIKKYGLDYKLNISSEAAMLTTVDRANRSEGWFVATSWSPHWMFGKYKLRYIADPKG
                     ALGGAEHIDAVARKGFKEDNPKVAALLAKMSIPINELEAAMFDAQETSYEKAVDKYIA
                     DHPDRIKEWLSQ"
     gene            complement(722912..723817)
                     /locus_tag="BSVBI22_RS13480"
                     /old_locus_tag="BSVBI22_B0731"
     CDS             complement(722912..723817)
                     /locus_tag="BSVBI22_RS13480"
                     /old_locus_tag="BSVBI22_B0731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006145244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane component"
                     /protein_id="WP_002968496.1"
                     /db_xref="GI:489058399"
                     /translation="MDLNFSVGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNAL
                     IAVPPFAGVAILSLLALWRVGWKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIA
                     VVIGIPLGIAMARSDAVASIVRPILDLMQTMPAFVYLIPAAMFFGLGAVPGTIATVIF
                     AMPPVVRLTNLGIRQVHAEFVEAGLAFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLS
                     LSMVVIASMIGAGGLGNTVLTGIQRLNVGLGFEGGLAVVILAVILDRITQSFGKGGTG
                     LLKRLAFLKRAAGEQPASSFRKQEA"
     gene            complement(723880..725046)
                     /locus_tag="BSVBI22_RS13485"
                     /old_locus_tag="BSVBI22_B0732"
     CDS             complement(723880..725046)
                     /locus_tag="BSVBI22_RS13485"
                     /old_locus_tag="BSVBI22_B0732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006104927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_006192113.1"
                     /db_xref="GI:493203951"
                     /translation="MKSPAKTKISLNGVFKVFGDNPMRAMRELGAGKSKAQIHSDLGA
                     TIGVDNATFDIREGEVFVIMGLSGSGKSTLLRLLNRLIEPTAGSIEVEGRDIVKMSKR
                     ELIDLRRRDMSMVFQSFALFPNRSVLNNAAFGLEVAGMGEVERHQKALKALAAVGLEP
                     YAHSMPDQLSGGMKQRVGLARALASEPTVLLMDEAFSALDPLIRTEMQDELKRLQAQH
                     SRTIVFVSHDLDEAMRIGDRICIMQHGKVVQVGTPNEIISAPANDYVRSFFRNVDVSR
                     VFKAADVARDDELIVFEAEQLATALERFDASGKAYGVLVDADRTYRGLVSRDALAAGQ
                     RLNDFAAIEADAPLSGLLVHVAKSPWPVPVTDRQNRYVGAISRSVLLEMLGRAG"
     gene            complement(725259..725444)
                     /locus_tag="BSVBI22_RS13490"
                     /old_locus_tag="BSVBI22_B0733"
     CDS             complement(725259..725444)
                     /locus_tag="BSVBI22_RS13490"
                     /old_locus_tag="BSVBI22_B0733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965902.1"
                     /db_xref="GI:489055755"
                     /translation="MSQVVEYLSQLVPAIDFRGITITIGLAGCFLLSTVLYGPKICCV
                     TFQKIIQGDGEQRGEPG"
     gene            complement(725607..726080)
                     /locus_tag="BSVBI22_RS13495"
                     /old_locus_tag="BSVBI22_B0734"
     CDS             complement(725607..726080)
                     /locus_tag="BSVBI22_RS13495"
                     /old_locus_tag="BSVBI22_B0734"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004689060.1"
                     /db_xref="GI:490826970"
                     /translation="MKGAVNPFAGDKDREQIWEMFVRRDIEAFIAQDWSMVADDFDEA
                     RFLGIHAHNNPDPDKWDAGFPTLASYRDEWLRQAAESAAIEYAEPLAEGIFRATDLSV
                     IDITGDVALARKKFDGTIARKDGTQDRLNWQTLYFCRRDGNFWKITGFVGYMAYR"
     gene            complement(726094..727161)
                     /locus_tag="BSVBI22_RS13500"
                     /old_locus_tag="BSVBI22_B0735"
     CDS             complement(726094..727161)
                     /locus_tag="BSVBI22_RS13500"
                     /old_locus_tag="BSVBI22_B0735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_004682061.1"
                     /db_xref="GI:490819964"
                     /translation="MPIKPKNICEVDTPAILVDVDRVVANIEKAQAHADAAGVKLRPH
                     IKTHKLPFFARMQVKAGAVGITCQKLGEAEVMADAGLTDIFLPYNILGQEKLDRLHAL
                     HRRITISVTVDNKTSLAGLAQHFMNEKRPLKVLVECDTGMGRCGVQTPGQARELAHII
                     EKSAGLCFGGLMTYPATGRGDEAERWLREARDLLAADGIACETISSGGTPDMWRIPAE
                     TVVTEYRPGTYIYFDRYQVAEGAATINDCALTVLATVVSHPTPERAIIDAGSKALSSD
                     TLGLADFGELMDRPLARVTGLSEEHGKVTGDVANLNIGDRVRVIPDHVCVVSNLFDEV
                     HLVSGEEVIDILPVAARGKLR"
     gene            complement(727166..728047)
                     /locus_tag="BSVBI22_RS13505"
                     /old_locus_tag="BSVBI22_B0736"
     CDS             complement(727166..728047)
                     /locus_tag="BSVBI22_RS13505"
                     /old_locus_tag="BSVBI22_B0736"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_004682063.1"
                     /db_xref="GI:490819966"
                     /translation="MSKVADIITRLHVVAQEGSKSDRRLAGLVLADPHYASKAAISEI
                     AARAGVSEPTVTRFCRALGCDGVRDFKFFLAQALAIGGQYLTAEIPARDVRESRIATA
                     VTDAAIAAIQRAGDGVDMGVLMKVAERLAAGGPVLCLGSGGMSSMLATEMENRLFRLG
                     IPVNAQVDGQLQRMYAAVTTHETTVLAFSVSGFARSVVEAVLVARQYGAETVAITAAG
                     SDLARAADMLIPFQPNEDGNIYKPTSARYGLLAILDMIATAAAEARGPKVLESLRRIK
                     HSLNTLTIDDPRLPLGD"
     gene            complement(728055..729107)
                     /locus_tag="BSVBI22_RS13510"
                     /old_locus_tag="BSVBI22_B0737"
     CDS             complement(728055..729107)
                     /locus_tag="BSVBI22_RS13510"
                     /old_locus_tag="BSVBI22_B0737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006264759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_004690273.1"
                     /db_xref="GI:490828183"
                     /translation="MKEVSLRGISKTFGQLTVLDRIDLEIHSGEFLVLVGPSGCGKST
                     LLRMVAGLEPISGGDLVIGGERANELPPQKRNIAMVFQSYALFPHMTARENIGFGPRI
                     RGEKAAETAAKVDHAASILNLHSYLDRYPRQLSGGQRQRVAMGRAIVREPSVFLFDEP
                     LSNLDAQLRVQMRTEIKALHQRLKSTVIYVTHDQIEAMTMADRIVVMNQGKIQQIGAP
                     LDLYDRPANKFVAGFIGSPSMSFIPGTVADGFFCTGEGKKIAVSAAAKGARAAEAGIR
                     PENFVIAREGAGLTLVVEVIEPTGPETHIYGRIAGEPVRAVFRERIQLAPGEQVPVTA
                     GSEHIHLFDKESGLPL"
     gene            complement(729112..729885)
                     /locus_tag="BSVBI22_RS13515"
                     /old_locus_tag="BSVBI22_B0738"
     CDS             complement(729112..729885)
                     /locus_tag="BSVBI22_RS13515"
                     /old_locus_tag="BSVBI22_B0738"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catenin"
                     /protein_id="WP_002965897.1"
                     /db_xref="GI:489055750"
                     /translation="MDHSGEFAGRSVLVTGAGGGLGRALAALFAARGARVIGCDVSMD
                     LMAASDFASRHVFDLLDRAELAAAANKLILADGVPDIVINNAGWTRAETFEGLEQDRI
                     EVEIDLNLTGVASFSNIMAQAMATRGHGAFVFVSSVNSLQHFGNPAYAAAKAGINAFA
                     RGIAVEFGQRGVRANVVCPGSIRTPAWDHRIAQDPSVLDRLQRLYPLGRIVNVGEVAE
                     AVAFLASERASGITGAVLPVDAGLTAGCRPFIEDILGGN"
     gene            730065..731300
                     /locus_tag="BSVBI22_RS13520"
                     /old_locus_tag="BSVBI22_B0740"
     CDS             730065..731300
                     /locus_tag="BSVBI22_RS13520"
                     /old_locus_tag="BSVBI22_B0740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bicyclomycin resistance protein"
                     /protein_id="WP_002965896.1"
                     /db_xref="GI:489055749"
                     /translation="MLIRKWKAGLLAGLSILALASSADAGEVRMTVAEYSAKTGPYFE
                     EVKKAFEAENPGITLNFEVVPWDVLLQKLTTDISAGTNADLSIIGTRWLIDFVQQGIA
                     EPLDGYMNDEFKGRFIETFLSPSVLDGKTYGLPIAASARAMYYNKDLFEKAGIKNPPA
                     NWDELKADAAKIKALGGENYGFGLQGKEIETDVYYYYAMWSYGTEILNKDGTSGLSTP
                     GALEAAKLYKSMIDDGLTQPGVTSYAREDVQNLFKQGKVGMMITAPFLSNQIKEEAPN
                     LKYGVAAIPAGPTGARGTYGVTDSVIMFQNSKNKEEAWKVLDFLFQKDWRAKFTQNEG
                     FLPVNKEEAKMDYYVNNADLAAFTALLPDARFAPVIPGWEEIADITSNAMQSIYLGKG
                     EPDAVLKDAAAKADAILKK"
     gene            731373..732242
                     /locus_tag="BSVBI22_RS13525"
                     /old_locus_tag="BSVBI22_B0741"
     CDS             731373..732242
                     /locus_tag="BSVBI22_RS13525"
                     /old_locus_tag="BSVBI22_B0741"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004687185.1"
                     /db_xref="GI:490825095"
                     /translation="MQNRTLPYFLILPSLLLAAVVIFWPVVHLFEIATHDVNRFGQLR
                     EFNDGANFTALFATAEFMNALWRTAVWTVAVVGGALVLSIPVAIILNMDFYGRSVARV
                     IIMLPWAVSLTMTAIVWRWALNGESGMLNSALHGLGLIDTNIQWLASAATAFPMQILV
                     GILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQFREITFPLLKPFVNIAIVLN
                     TIYVFNSFPIIWVMTQGGPANSTDILVTHLYKLAFRLGKLGEASAVSLIMLAILLVFT
                     VIYIRISTRSEQS"
     gene            732239..733066
                     /locus_tag="BSVBI22_RS13530"
                     /old_locus_tag="BSVBI22_B0742"
     CDS             732239..733066
                     /locus_tag="BSVBI22_RS13530"
                     /old_locus_tag="BSVBI22_B0742"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002965894.1"
                     /db_xref="GI:489055747"
                     /translation="MMSAKLKRTVVAWAVLSPLIVLTLFPFAVMFLTAVKPAQEVLSP
                     NWWPSTFRWQNFSEMWVATNFGNALLNSIYVSVIASVGAIIISIPAAYAMSRFRFAAH
                     GAFRQFLLVSQMISPIVLVLGLFRLLAAYGLIESVSAVGAVYMAFNIAFTVWMLQSYF
                     DTIPRDLEEAAWMEGAGRGKTLVKVFLPLCLPAIAVTAIFTFINAWNEFVVALTMLRR
                     QESYTLPIQVFSLVAGRYTVEWHYVMAATFLATLPVAILFIWLQRYLIKGLALGAVK"
     gene            733079..733450
                     /locus_tag="BSVBI22_RS13535"
                     /old_locus_tag="BSVBI22_B0743"
     CDS             733079..733450
                     /locus_tag="BSVBI22_RS13535"
                     /old_locus_tag="BSVBI22_B0743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation inhibitor"
                     /protein_id="WP_004689064.1"
                     /db_xref="GI:490826974"
                     /translation="MSRKQVFGASHVPLSPAVRAGDMVYVSGQVPVGPNGQIVEGGIE
                     AQTRQVLENIKAALALAGAAMEDVVKTTVWLEDARDFGRMNAVYGTYFPKEPPARTTV
                     ESRLMIDIKIEIEAVAYAPQK"
     gene            733477..734946
                     /locus_tag="BSVBI22_RS13540"
                     /old_locus_tag="BSVBI22_B0744"
     CDS             733477..734946
                     /locus_tag="BSVBI22_RS13540"
                     /old_locus_tag="BSVBI22_B0744"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004690277.1"
                     /db_xref="GI:490828187"
                     /translation="MRIFTASLATETNTFSPVPTDRASFEMAFYAAPGKHPETPTLCS
                     SPIVALRKRAAAEGLTVIEGTATWAEPGGLLQRQAFEELRDEILDQLKAAMPVDAVVL
                     GLHGAMVAQGYDDCEGDLLERARAIVGPGVLVASEFDPHSHLTPKRVQNLNIFASFLE
                     FPHTDFYERGEHVVELALDALKGRTKPVISTFDCRMIAVLPTSKEPMRSFVDRIKALQ
                     GKDGILSISVIHGFMAADVPEMGTRILVVTDNDPQKGAALAEKLGRELIAMREQTSMA
                     MLDTDQGIDRALAAHAANPSKPAVIADVWDNPGGGVAGDGTYILRRLIERGVNNAGIA
                     TIWDPIAVTFCHAAGEGAVIDLRFGGKSGPLGGEPIDARVTVLKVANEGWQSFGPSRV
                     TLGPSAVVRIEDTGIDIILNTNRTQTFEPDIFFNLGIDPMTKNVLVVKSTNHFHAGFA
                     PVAAEIIYVDAPSSYPSNPRTTNYRKLNRAIWPRVEDPW"
     gene            complement(735407..736204)
                     /locus_tag="BSVBI22_RS13545"
                     /old_locus_tag="BSVBI22_B0746"
     CDS             complement(735407..736204)
                     /locus_tag="BSVBI22_RS13545"
                     /old_locus_tag="BSVBI22_B0746"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphatase"
                     /protein_id="WP_004690278.1"
                     /db_xref="GI:490828188"
                     /translation="MMLSARNVCWAAGCAEILHDVSLDVVKGEFLGIIGPNGSGKTTL
                     LSLLSGIRRPRSGTVLLGNAPIQKFNRREIARRLALVEQQAETTERITARQAVELGRT
                     PYLGALSPWSAADDAIVGKALENVDMAHLAGRCWHTLSGGERQRLHIARALAQEPQIL
                     LLDEPTNHLDIGHQIGLLDLVSRQGGLTVVAALHDLNHAAMFCDRIAVMDTGQLVALG
                     SPREVLSAESIRAVFGVEVDVEYHGVRGCHIRYRLPDRPSLELRCLA"
     gene            complement(736201..737244)
                     /locus_tag="BSVBI22_RS13550"
                     /old_locus_tag="BSVBI22_B0747"
     CDS             complement(736201..737244)
                     /locus_tag="BSVBI22_RS13550"
                     /old_locus_tag="BSVBI22_B0747"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006214298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002970609.1"
                     /db_xref="GI:489060555"
                     /translation="MTVRAAAIRFSMKSRMGAGVLALVLLFVALWLGAAIGETSIPLD
                     VVAKTVANRLWYAGYPLDPIDEGIVWSYRLSRAVVAACCGAALALSGVVLQSLLRNSL
                     ADPYILGISAGASTGAVSVAILGIGAGILTLSFGAFIGAIVAFALVAMLAMRAGRGNS
                     AIILAGIAGSQLFNALTSFIVTKAANAEQARGIMFWLLGNLSGVRWPDVALALPVCLA
                     GLAVCLWHARALDAFTFGAESAASLGIPVRRIYAVLIGASAMMTAVMVSIVGSIGFIG
                     LVIPHAARMIVGVRHDVLLPAAALIGAIFMILADILSRTIIPGQVLPIGVITALFGAP
                     AFALLLGQKRGHP"
     gene            complement(737241..738275)
                     /locus_tag="BSVBI22_RS13555"
                     /old_locus_tag="BSVBI22_B0748"
     CDS             complement(737241..738275)
                     /locus_tag="BSVBI22_RS13555"
                     /old_locus_tag="BSVBI22_B0748"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_004687181.1"
                     /db_xref="GI:490825091"
                     /translation="MKIIKNRPFLAAFYSFAFLVTGFSGSSLAGETRYPLTLKNCGRE
                     VTFHHAPQRAVAIGQSSAEILYNLGLGDRVVGTAVWFGPVMKGYEEVNARVKRLADND
                     PSLESVLAQKPDMVAAQFQWHVGPEGIVAKPEQFEELGIPVYTAPADCIGKVNSGKGD
                     GVRHTVFTMDLIYQEIRELAEIFNVQDRGEKVIADLKAREEAARKKIASANGRLSAVV
                     WFSSAQMDIDPYVAGKNGAPAYILSALGIRNVIGSEEEWPTVGWETIAKSDPTMIIAG
                     KMDRRRYPADDIAVKRKFLETDPVASLMPAVKDGHVFDMDAQAMNPTIRTIEGIETLA
                     DAIAAAGLNK"
     misc_binding    complement(738475..738707)
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            complement(738826..739692)
                     /locus_tag="BSVBI22_RS13560"
                     /old_locus_tag="BSVBI22_B0750"
     CDS             complement(738826..739692)
                     /locus_tag="BSVBI22_RS13560"
                     /old_locus_tag="BSVBI22_B0750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD"
                     /protein_id="WP_004690281.1"
                     /db_xref="GI:490828191"
                     /translation="MKKLLAHSGRVFLTLVMVVMAGLLGWHLWDYYMNAPWTRDGKIR
                     ADVVRIAPDVSGLVSEVLVHDNQTVHKGDVIFRIDQARYKLALQTAEAKADSSKAALD
                     MANRDLVRYRQLNDTTVTRQKLEQVETADQQAEAAHRQAELDRDLAALNMERSSIKAP
                     VNGVITNFSLQPGDYVSAGSAVTALVDTDSYYVSGYFEENKLERIHIGDPVVVDVMGS
                     KVQLKGKVEGIAGGIEDRERSDSQSLLANVSPTFNWVRLAQRVPVRVKLEDVPQGIHL
                     VAGRTVSVSVVD"
     gene            complement(739689..739898)
                     /locus_tag="BSVBI22_RS13565"
                     /old_locus_tag="BSVBI22_B0751"
     CDS             complement(739689..739898)
                     /locus_tag="BSVBI22_RS13565"
                     /old_locus_tag="BSVBI22_B0751"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002965885.1"
                     /db_xref="GI:489055738"
                     /translation="MHPEFDIYGIYIPSLGLLALAAYFANTLMQRLLARVHFYRFVWH
                     RPLFDAAMYFCILGVAAVLLNGIPL"
     gene            complement(739925..742021)
                     /locus_tag="BSVBI22_RS13570"
                     /old_locus_tag="BSVBI22_B0752"
     CDS             complement(739925..742021)
                     /locus_tag="BSVBI22_RS13570"
                     /old_locus_tag="BSVBI22_B0752"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein"
                     /protein_id="WP_004689066.1"
                     /db_xref="GI:490826976"
                     /translation="MTKLAETTPKFWDVVFSLKTFAAAMLALWIGLMANLPNPYWSVA
                     AVYIVAHPLSGATTSKGFYRLIGTIIGGAVTVVFVPHLVNSPEILTLAIGLWMGLCLV
                     ISLLDGTPRSYLFMLAGYTVAIASFAVVQAPETTFDYALGRVEEIAVGIICAAVVNRL
                     VFPRHSGPVLVGRIDNWLRDGSKLAVASMRGEGDSPEFRRDRQRLAADTLELRNLTTH
                     VAYDTSSIRNVAPLLHVLQQRMVAVLPIISSLHDVLLLKPGEGEKPWHPAVQQLLDEV
                     CDWLQSGENLTEERRAVFLRLIEEIDRHSRDASTWGELLPFNLSARIRDLVQIWSDCL
                     TLKQDISSGSRHSLRWRRYDAHLKGRPMHRDYGMALLSGFSSFLATCVATALWVASGW
                     AQGSAAAMMAGIFCCIFATMDDPVPVIRKFNWLLMVVIAAAFVFEFALLPLVNGFMPL
                     VLVLGLFLVPAGMLLVIPSQFLLGMVLCVNLPNMLMLQSHLTLDFPSFANANLATVLG
                     IVIAAVVTSIVRSVGAEWSVRRLVKAGWSDIVLATERRPGRYRREHMNRLLLRMIDRI
                     GMMAPRLALIPDADVAKVDLLRDLRNGMNTIDLQQYRAKLPAPCREAVDEVLDGVGAH
                     YRALSNKTRDTVEHIDERLLAAIDKAIATIIENGSPAVARRPRIALVALRFNLFPKAP
                     PFVLPPLPQLEFAQAA"
     gene            complement(742064..742501)
                     /locus_tag="BSVBI22_RS13575"
                     /old_locus_tag="BSVBI22_B0753"
     CDS             complement(742064..742501)
                     /locus_tag="BSVBI22_RS13575"
                     /old_locus_tag="BSVBI22_B0753"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_006192119.1"
                     /db_xref="GI:493203957"
                     /translation="MKQAWVEFAPLLASAARRWRKAFDAAMAEHGLSDAKAIPLITLL
                     RHGDCIPQGVLAERVGIEGATIVRIVDELEKDGLIQRIVDDADRRVKLIQLTEDGRAV
                     ATQVEKSAARLRAQFLGGFDLQEVDVAMEVLRKLNEKFQNQPS"
     gene            742751..743497
                     /locus_tag="BSVBI22_RS13580"
                     /old_locus_tag="BSVBI22_B0754"
     CDS             742751..743497
                     /locus_tag="BSVBI22_RS13580"
                     /old_locus_tag="BSVBI22_B0754"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011069161.1"
                     /db_xref="GI:499381590"
                     /translation="MRANYRMQRPYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEV
                     LVFNGRDGEWKASLQPEGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGQLDYMMQKA
                     VEMGAGVLQPVITQHTQVPRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQW
                     DTSRRLIFCDEGHESDDPLSILTGLEPGPSGLLIGPEGGFSEEERQLLHRLPFVTAIP
                     LGPRILRADTAAVAAMALVQAVLGDWRNAA"
     gene            743597..744970
                     /locus_tag="BSVBI22_RS13585"
                     /old_locus_tag="BSVBI22_B0755"
     CDS             743597..744970
                     /locus_tag="BSVBI22_RS13585"
                     /old_locus_tag="BSVBI22_B0755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_004690284.1"
                     /db_xref="GI:490828194"
                     /translation="MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYT
                     ANNSPVPYGGPRGIKAILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFEL
                     SGAPLSTIHQTCREVNAHLSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIM
                     TNYMPKVGHEGLDMMYRTSTIQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTE
                     GKPNGLLSWRSSIWRDTDNQRSGVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHD
                     CTHVTFRQFMNGALKGEVSDPVPNMGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRI
                     CALPAYWVGLLYDEEALAAAELLTKDWTYEEVLALRNEVPTKALKTDFRGKPLELIAR
                     ETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAAATTDAERMLNAYHSVWAGSVDP
                     IFLEYVY"
     gene            complement(745036..746571)
                     /locus_tag="BSVBI22_RS13590"
                     /old_locus_tag="BSVBI22_B0756"
     CDS             complement(745036..746571)
                     /locus_tag="BSVBI22_RS13590"
                     /old_locus_tag="BSVBI22_B0756"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease 7 large subunit"
                     /protein_id="WP_006192123.1"
                     /db_xref="GI:493203961"
                     /translation="MASDSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEIS
                     GYRGPHSSGHAYFALKDDRARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSK
                     YQIVIEQMEPAGAGALMALLEERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAV
                     IRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVAR
                     GGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDWTLIDLAADMRAPTPTGAAEMA
                     VPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARAMPSADQLLALPRRRFDEAA
                     SRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGVTMLGQRLPRALEAFLRE
                     RRTAFTHRANRLSPEPILRRTRLTGSTLEQLDRRRDQAVRLLIERVKRRSQELDRLMR
                     TLSYESVLERGFAVVFDAQGKPVKQAAAVLPGDALSVRFRDGDVGVVARAGLTIPDPT
                     KGQ"
     gene            complement(746640..747608)
                     /locus_tag="BSVBI22_RS13595"
                     /old_locus_tag="BSVBI22_B0757"
     CDS             complement(746640..747608)
                     /locus_tag="BSVBI22_RS13595"
                     /old_locus_tag="BSVBI22_B0757"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006277687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002968505.1"
                     /db_xref="GI:489058408"
                     /translation="MGAPLDLDQLQTFVAIADAGSFTRAADAVFKTQSAVSMQMRRLE
                     ERIGKPLFDRDGRTNRLTEDGERLLLYARRMMHLNSETIAAFDDTQLEGHVRIGTPDD
                     YADRFLPEIMARFARSNPRVELSVVCEPTVNLDEMIRRGTLDIALVTQCDDKRRSEVV
                     RTEPLLWVTSTNHAVHEEAMLPLAVGRPTCIWRHAAIDVLEAARRDYRIIITSWSATV
                     LAAAVLSGLAVSVLPECALRPGMRVLGEADGFGMLPEIGIGIMRGHSKQNAAVDALAQ
                     HIIESLDNISSPQPGGLAGAMSSAEISPFPAVRTRRVRTNELLPGW"
     gene            747775..748077
                     /locus_tag="BSVBI22_RS13600"
                     /old_locus_tag="BSVBI22_B0758"
     CDS             747775..748077
                     /locus_tag="BSVBI22_RS13600"
                     /old_locus_tag="BSVBI22_B0758"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965878.1"
                     /db_xref="GI:489055731"
                     /translation="MIATSNFTATDLPAGSGRVSAFTQLVKVIFAPALRRWTFSKGKR
                     QVMSLSDFDDHMLHDIGLRREDIYTAMRDRRVEDPTRILSELAIARLRMEAARHIC"
     gene            748071..748325
                     /locus_tag="BSVBI22_RS13605"
                     /old_locus_tag="BSVBI22_B0759"
     CDS             748071..748325
                     /locus_tag="BSVBI22_RS13605"
                     /old_locus_tag="BSVBI22_B0759"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965876.1"
                     /db_xref="GI:489055729"
                     /translation="MLIIENLAGATFTCRAPSRPACPLPGQSFTGRAFFIVSKGKNIK
                     LRQSHLRGPNKNDPCPQKRKGPFVKSACHSYHINIEMIFW"
     gene            748329..749759
                     /locus_tag="BSVBI22_RS13610"
                     /old_locus_tag="BSVBI22_B0760"
     CDS             748329..749759
                     /locus_tag="BSVBI22_RS13610"
                     /old_locus_tag="BSVBI22_B0760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_004682096.1"
                     /db_xref="GI:490819999"
                     /translation="MSADTTEKKATRTPRRRTPAYVKSLRGVKNWKQATEWLAWRDIE
                     DIECITPDQAGVARGKMMPSKKFTSNTSLALPSAVFMTTISGAYPEDGYGFHYPEDDG
                     DLKLLPDLTTLSAVPWETDSTAQVICDLVYQDGRAVEFTPRNVLRNVIAAYSKRGLKP
                     VVAPEIEFYLVRKNPDPDYPLTPPVGRSGRAIGGGQGYSIAGVNEFDELIDDIYHFSE
                     GQGLEIDTLIHEEGAGQLEINLRHGDPVELADQVFMFKRTIREAALKHDMYATFMAKP
                     IQGQPGSAMHIHQSIVDKKTGRNIFTNEDGSESQAFHHFLGGMQRHVPNALVMFAPYV
                     NSYRRLTPDASAPVNVKWGYDNRTTAFRVPRSDPSARRVENRIPSSDANPYLALAASL
                     ACGLIGLVNKIEPEQPATTSVNTKEVELPRGLIDAVELFEEDAELRNLFGSSFMTTYA
                     AIKRAEFETFMEVISPWEREFLLLNV"
     gene            749819..750181
                     /locus_tag="BSVBI22_RS13615"
                     /old_locus_tag="BSVBI22_B0761"
     CDS             749819..750181
                     /locus_tag="BSVBI22_RS13615"
                     /old_locus_tag="BSVBI22_B0761"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968953.1"
                     /note="crystal structure of protein from Xanthomonas shows
                     pentameric toroidal structure; physiological function is
                     unknown; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965874.1"
                     /db_xref="GI:489055727"
                     /translation="MSINSYRDILVWQQAMELVTAIYKSTETWPREEIYGLTSQIRRA
                     AVSIPANIAEGYGRDTRGAYQQFLRIAQGSLKEMETHLLIAEQLGFIAKERAEPIMAM
                     GESIGKLLRLLIRKLSET"
     gene            750235..751521
                     /locus_tag="BSVBI22_RS13620"
                     /old_locus_tag="BSVBI22_B0762"
     CDS             750235..751521
                     /locus_tag="BSVBI22_RS13620"
                     /old_locus_tag="BSVBI22_B0762"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004689070.1"
                     /db_xref="GI:490826980"
                     /translation="MPYQSPISPGYSWYEANTPDRPQYPELDGSQQADVVVIGGGYTG
                     LSAAYHLAKQGTDVVLIEAARLGDGASGRNGGQFGTGQRTWAEDLETEYGYERAKALF
                     NVAEEAKSYLLAFAEEHAIDMEYVQGHISVVHKPRYLKSYERHVEQMASRFNYPHLRF
                     LDRAETAELLGTSRYHGGVYDSATGHIHPMKLLIGTAKAAHTAGAKLFEDTKATKIST
                     ASGRVEVETTRGTIRARHAFIAVNAYGGRLEPVSASHVMPIRSFIGATAPLGDDSPVI
                     PGGESVDDSRFVVRYFRRSKDGRLLFGGREAYTADNPRDISAHIRRQITEIYPALENV
                     EITHAWGGSVGITMPRQPFVREVMPGVISAGGYSGHGVMLANYVGKLYADTLAGRREK
                     LKLFEELRIPPFPGGRTFRSPLLILALSWYALMDRI"
     gene            complement(751532..751969)
                     /locus_tag="BSVBI22_RS13625"
                     /old_locus_tag="BSVBI22_B0763"
     CDS             complement(751532..751969)
                     /locus_tag="BSVBI22_RS13625"
                     /old_locus_tag="BSVBI22_B0763"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_004689071.1"
                     /db_xref="GI:490826981"
                     /translation="METKNHVLTDIDYQVLAEWRYRSRRFMSFSATAAEAEGLPPQQH
                     QALLAIKASGPDKLMTVGTLAERLVVAPHTATELTGRLVAAGLVARVVDLADRRRHTL
                     ELTIEAEHILERLSPVHLAEIRELAPKFIDVLIKLNKMANEPE"
     gene            complement(752258..753058)
                     /locus_tag="BSVBI22_RS13630"
                     /old_locus_tag="BSVBI22_B0764"
     CDS             complement(752258..753058)
                     /locus_tag="BSVBI22_RS13630"
                     /old_locus_tag="BSVBI22_B0764"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006155726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192127.1"
                     /db_xref="GI:493203965"
                     /translation="MSSELNGHSPRNRARRHFLGVAAAAAARVAILGALVSSSLPARA
                     MGNKWWHHGGHGSRCLLKGTLVTTPNGPVAVEKLCVGDLVTTVSGECLPIKWIGWQNY
                     RAGEADWNESVMPIRVRRHALDGRTPHRDLYLSPNHALFIDGVLIRVKDLVNGRSIMR
                     IPVERTLDYYNIVLDRHAVVLAEGAAVETFLMRGDGYRGFTNFSEYERLYPDEAEIVM
                     QPCAPAMGYEGARQHMRALLGLSGIVPVRDVVEETYRRLAARAGSYAA"
     gene            complement(753317..753775)
                     /locus_tag="BSVBI22_RS13635"
                     /old_locus_tag="BSVBI22_B0765"
     CDS             complement(753317..753775)
                     /locus_tag="BSVBI22_RS13635"
                     /old_locus_tag="BSVBI22_B0765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073879.1"
                     /db_xref="GI:492972285"
                     /translation="MKLDEIDKKILRALQRNGRIANNDLAREVGLSPSPCLRRVKLLE
                     EAGVIDRYVAVLNPAKIGKGLTFFTRIRLDQQDEETLQKFANEIMRLPQVLECYFILG
                     DYDAMIRGVATDIEDYRRFQSEYLSRIKGVQNLKTDVPSQIVKQISEMPL"
     gene            754157..754897
                     /locus_tag="BSVBI22_RS13640"
                     /old_locus_tag="BSVBI22_B0766"
     CDS             754157..754897
                     /locus_tag="BSVBI22_RS13640"
                     /old_locus_tag="BSVBI22_B0766"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_002965869.1"
                     /db_xref="GI:489055722"
                     /translation="MDILQVYAPQKGKPAWRSEFRRGIVSGFPVLLGMIPFALVLGAQ
                     AAHTGLTLAEVSMMTGLNFAGGSEFAAFRLWSSPPDVLLIAAITFLVNSRHLLMGAAL
                     APFLRHFPKRTAFLTLFLMCDESWAVSLADAKRRQAKGVNAALNLAYYMGVAIPFYLA
                     WVMSATLGAVFGPMIGDLHPYGFDMAIPAVFLVLIAGMWKGFAAARPWFVSLVAAAAT
                     HVFVPGAWYVASGAISGLAAAYLLTGEK"
     gene            754894..755193
                     /locus_tag="BSVBI22_RS13645"
                     /old_locus_tag="BSVBI22_B0767"
     CDS             754894..755193
                     /locus_tag="BSVBI22_RS13645"
                     /old_locus_tag="BSVBI22_B0767"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002965868.1"
                     /db_xref="GI:489055721"
                     /translation="MIDPRVALTILAMASVTYLTRIGGYVLLRNRTLSNRAMAVMEAA
                     PGCVLISVIAPDFVSDKPANLIALAVTVFAATRFSMLPTVLIGMGAASICRYLIG"
     gene            755393..756430
                     /locus_tag="BSVBI22_RS13650"
     CDS             755393..756430
                     /locus_tag="BSVBI22_RS13650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006203782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192129.1"
                     /db_xref="GI:493203967"
                     /translation="MSTTQAAAGDASQMETPHPNGSFTQSNADENHEQYRKQNLVICL
                     LGSFTTLIAMSLLLPFLPLYVEQLGVISHAAIVQWSGIAYGATFLAAAFVAPLWGRLG
                     DRYGRKLMLIRASLGMAVAMSLIGMVTSVWQLVALRLFVGIAGGYSSGSMILVATQTP
                     KDKTGWALGALSAGIMAGNLAGPLLGGALPPLIGIRATFWLAGGVIFLTFLATTFLIR
                     EERKPPKPTREEKTQSIWAAIPDKGPVVAMLVTGILLLFANMSIEPILTIYVMQLMDD
                     QTKVTLVSGVVMAAAALGSILSSSRLGQLADRIGHTRVIIGALAVSALLLVPQAFVTD
                     AWQLIGLRFLM"
     gene            756431..756679
                     /locus_tag="BSVBI22_RS13655"
     CDS             756431..756679
                     /locus_tag="BSVBI22_RS13655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006075580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily transporter"
                     /protein_id="WP_014315845.1"
                     /db_xref="GI:504081851"
                     /translation="MALGGLLPCITSVIRHNVPDRVAGGILGYSVSAQYVGQVAGPVA
                     GGFVGGHFGMRAVFLGTCLMMAAGAIYNWAVLRNSKTR"
     gene            complement(756768..757517)
                     /gene="fabG"
                     /locus_tag="BSVBI22_RS13660"
                     /old_locus_tag="BSVBI22_B0769"
     CDS             complement(756768..757517)
                     /gene="fabG"
                     /locus_tag="BSVBI22_RS13660"
                     /old_locus_tag="BSVBI22_B0769"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443435.1"
                     /note="Catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_004690289.1"
                     /db_xref="GI:490828199"
                     /translation="MNRLQDKVAIITGAGSGFGLGMARRFAAEGARVVLADVNVKRVQ
                     DGLADISSNGISIQADVSRKDDMERVARTAFEEFGRIDIMVNNAGFTHRNMPLTDVDE
                     HNFDLIVAVNMKALYYSTQLVVPIMEHQGGGVIINTASATGLHPRKGLTWYCASKGWV
                     VSATKAMALELAERNIRVNCLCPAESDGEGLKMFLAEDTPEARAALKSTIPLGRFSTP
                     KDVAEAALWLASDDASMVTGVALGIDGGYSI"
     gene            757788..759263
                     /locus_tag="BSVBI22_RS13665"
                     /old_locus_tag="BSVBI22_B0770"
     CDS             757788..759263
                     /locus_tag="BSVBI22_RS13665"
                     /old_locus_tag="BSVBI22_B0770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006199945.1"
                     /note="catalyzes the formation of D-glucono-1,5-lactone
                     6-phosphate from D-glucose 6-phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="WP_004690290.1"
                     /db_xref="GI:490828200"
                     /translation="MTSQTIPVDPFDCIVFGGTGDLAERKLIPALYQRQRAGQLSDPT
                     RIIGASRSQMTDDKYRTFAGNAIKEHVKPEEVDQAEVEIFLKRLHYVAVDAKSDEGWD
                     ALKTLIGKKPEKIRAFYLAVSPTLFGDIATRLKAHGLITRDTRIVVEKPIGRDLDSAK
                     ALNDTLGSVFREDQIFRIDHYLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAE
                     AVGLEGRAGYYDKAGALRDMVQNHILQLLCLVAMEPPSSIEADAVHDEKVKVLRSLQP
                     ISTHNVEELTVRGQYRAGASAGGPVKGYLEDLESDTSNTETFVALKAEIANWRWAGVP
                     FYLRTGKRLATRVSEIVVTFKPIPHSIFGESAGKVIANQLVIRLQPDEGVKQWLMIKD
                     PGPGGMRLRHMPLDMSFAESFEDRNPDAYERLIMDVVRGNQTLFMRRDEVEAAWRWID
                     PILQAWEFNSQPVQGYTAGTWGPSSSIALIERDGRTWHESL"
     gene            759392..760090
                     /locus_tag="BSVBI22_RS13670"
                     /old_locus_tag="BSVBI22_B0771"
     CDS             759392..760090
                     /locus_tag="BSVBI22_RS13670"
                     /old_locus_tag="BSVBI22_B0771"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconolactonase"
                     /protein_id="WP_002968509.1"
                     /db_xref="GI:489058412"
                     /translation="MSIERHDFISATELAQSLSEAIANKLATAIAERGQAVLAVSGGT
                     TPLKLFEVLSRKMIDWNLVTITLVDERFVPVENERSNEKLVRDHLLRDHAGVARFVGL
                     YNPAATAETAALAAASRIDALRRPFDVVVLGMGNDGHTASFFPNADRLDQAINPATRA
                     LVLPIHAEGAGEKRLTLTLPLIAEAEMLVLHIEGAAKQATLEKALAGDDEREMPVRAV
                     FHHARAPIQLYWAS"
     gene            760126..761950
                     /locus_tag="BSVBI22_RS13675"
                     /old_locus_tag="BSVBI22_B0772"
                     /note="phosphogluconate dehydratase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(762042..762941)
                     /locus_tag="BSVBI22_RS13680"
                     /old_locus_tag="BSVBI22_B0773"
     CDS             complement(762042..762941)
                     /locus_tag="BSVBI22_RS13680"
                     /old_locus_tag="BSVBI22_B0773"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein FolD"
                     /protein_id="WP_002967255.1"
                     /db_xref="GI:489057133"
                     /translation="MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDP
                     ASQVYVASKSRKAKECGFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPG
                     HIDSGRVIQTIAPEKDVDGFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLS
                     GLNAVVIGRSNIVGKPMFNLLLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMV
                     KGDWVKPGATVIDVGINRIPAPERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMT
                     IAMLMANTLTAACRSAGMKKPVF"
     gene            763262..764077
                     /locus_tag="BSVBI22_RS13685"
                     /old_locus_tag="BSVBI22_B0774"
     CDS             763262..764077
                     /locus_tag="BSVBI22_RS13685"
                     /old_locus_tag="BSVBI22_B0774"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="WP_004682112.1"
                     /db_xref="GI:490820015"
                     /translation="MQDKVVLVGCGNMGFAMLRGWLDSGILKAGDVHVVEPAEALRER
                     AALAHVHVYADAADLPADLQPRMVLVAVKPQMMANVLPAYKRFAPASTFVSVAAGIPV
                     ALFESHLGKDVAVIRCMPNTPAAIGKGMLVTFKNANVSDANEAFVTSLLKTSGKVASV
                     DEEGLMDAVTAVSGSGPAYIFHFIEALTDAGVNLGLPRETAALLAMQTVMGAGALADA
                     STDSPSKLREQVTSPNGTTAAALDVLMGGDRLKELVAEAVKAAHKRSVELGKS"
     gene            complement(764168..764920)
                     /locus_tag="BSVBI22_RS13690"
     CDS             complement(764168..764920)
                     /locus_tag="BSVBI22_RS13690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_004682115.1"
                     /db_xref="GI:490820018"
                     /translation="MAEPLLQARNLVFRYGGNLALNDVSFDMASGETLALVGPSGSGK
                     STLARALLRLHPLASGAIRFEGENWLALSGSALRRRRAHMQLVFQDPLSAFNPRASLR
                     DLLYEPLRIHGIKRDIGELLQKVGLDSALAQRGVHEVSGGQRQRVAIARALATSPSLI
                     VLDEAVSALDVTVRGAILKLLREVQKAENTAYLFITHDLGVAAQMADRIAVMEHGRIV
                     ECRPTQELIATPHAPITRALIEAVPRLERFRF"
     gene            complement(764913..765668)
                     /locus_tag="BSVBI22_RS13695"
     CDS             complement(764913..765668)
                     /locus_tag="BSVBI22_RS13695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_002971212.1"
                     /db_xref="GI:489061171"
                     /translation="MSKLVRLEKLSVRYGREMALQNIDLDIASGEILAVIGESGSGKS
                     TLALALASLLPAGAHVTGGMEWAAGRLQPGRDIGFIFQDPASSFDPLMTVGAQLVETI
                     RAHENSGRGQARAKAIALLERVHIPAPDESFHRYPHQFSGGQKQRIAVALAIAANSRL
                     LIADEPTSALDTIVQKEITALLQRLVREDGMTLVFITHDIALASGLADRIAVFRHGRL
                     IETGSAAFIVAKPQTDYTKALIAAVPDLEAVHG"
     gene            complement(765665..766495)
                     /locus_tag="BSVBI22_RS13700"
                     /old_locus_tag="BSVBI22_B0776"
     CDS             complement(765665..766495)
                     /locus_tag="BSVBI22_RS13700"
                     /old_locus_tag="BSVBI22_B0776"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_006192132.1"
                     /db_xref="GI:493203970"
                     /translation="MSGLKRYFATGEGMAGAAILVLLILAALCAPLFFPGDPLSIVST
                     PLMQPFENGDFLFGTDRLGRDVLAELFYGARTSLLVGLAAAFAAIVLGSIVGTLAGFA
                     GGFIDEALMRVAEAFQTVPGFLLALALVSIAGPSLPVLIAAIALSSWTQATRLTRAQV
                     LSIRESDYVAAARVIGMHPLEIAFRQILSNALPPVLALVPVIVASAILTEAALSFLGL
                     GDPNRVTWGGMIAEGRTVLRSAPWLSILPGAALALTVVGVYLAGEGLTEAMSRREAQP
                     "
     gene            complement(766492..767490)
                     /locus_tag="BSVBI22_RS13705"
                     /old_locus_tag="BSVBI22_B0777"
     CDS             complement(766492..767490)
                     /locus_tag="BSVBI22_RS13705"
                     /old_locus_tag="BSVBI22_B0777"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965857.1"
                     /db_xref="GI:489055710"
                     /translation="MYLADVKQILALLRKRLVGSMVVLLIVVIGCFFMLESAPGDAVD
                     AYGVTFGGDAGQIAEMRARWGLDQSVWHRLGAYLAALAQGNLGWSVSFNRPIFDVISE
                     RLPNTLLLMGAATALSFAVGSFLGVVAGARPGSFRDRFLSVASLVLYAVPGFWLALVL
                     VILFSIKLRWLPSSGIETIASGKHGLARASDIARHLILPVVSLAVIYLALYLRVMRAA
                     MADIWRMDFVRALRARGISRPRIVLFHVARNALLPLVTVLGVQAASMLGGSVVIESVF
                     AVPGLGRLAQEAVASRDTPLLLGVIITSALMVILVNFVIDLVYLWLDPRIAAGGRA"
     gene            complement(767508..769121)
                     /locus_tag="BSVBI22_RS13710"
                     /old_locus_tag="BSVBI22_B0778"
     CDS             complement(767508..769121)
                     /locus_tag="BSVBI22_RS13710"
                     /old_locus_tag="BSVBI22_B0778"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_006192133.1"
                     /db_xref="GI:493203971"
                     /translation="MSGFVASRRAFLVGSTSLAALAFWPKATWAAQEVQKGGRLVVAA
                     DSEPRNLNPAIIASNGVFFVASKVIEPLAEAAYEGQGGLAPRLATSWEGSADGLTATF
                     RLREGVNWHDGKPFTSADVAFSAMEVWKPLQNLGRVVFKSLEKVETPDEHTAIFHFSE
                     PTPFQLIRNALPALTAVLPKHVFAGTDIAANPANEKLVGTGPFKYAEHKTGEYYRLVK
                     NADYWGEGEPYLDEVIYRVLPDRAAAADALEAGEIDLAAFSAVPLADLDRISKVPGLA
                     VISKGYEGLTYQLVVEINHRRKELADLKVRQAIAHAIDRDFAVKTIFQGFAVPSTGPV
                     PRYDGQFYTDDVPTYPFDVKKANALLDEAGYRRGKDGMRFALKLLPAPYFNETKQFGD
                     YLRQALAAIGIDAHIVNNDAAAHQKAVYTDHDFDLAIAPTVYRGDPAISTTILVESGI
                     PAGVPFSNQGGYANAELDALIAKAASTTDEKERTALYQKFQQMVEADLPLINVAEWGF
                     ITVASERVKNVSNNPRWAVSNWADTWLEP"
     gene            769476..769820
                     /locus_tag="BSVBI22_RS13715"
                     /old_locus_tag="BSVBI22_B0779"
     CDS             769476..769820
                     /locus_tag="BSVBI22_RS13715"
                     /old_locus_tag="BSVBI22_B0779"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965855.1"
                     /db_xref="GI:489055708"
                     /translation="MSSLLPPLHDGHAPIYLHHAFHEAVDACEDWPLDSAEPVVQVNG
                     KITRISVVFRRLWNCTDTVPRDTLEALKEIVPSTLVRSERWRDNSTFAEAARVMRSVL
                     EMRKARALPAYY"
     gene            769975..770628
                     /locus_tag="BSVBI22_RS13720"
                     /old_locus_tag="BSVBI22_B0780"
     CDS             769975..770628
                     /locus_tag="BSVBI22_RS13720"
                     /old_locus_tag="BSVBI22_B0780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="WP_004690295.1"
                     /db_xref="GI:490828205"
                     /translation="MKNDHSPDQRTLSELFEHNRQWAAEKQEKDPEYFSRLLSSQRPE
                     FLWIGCSDSRVPANVVTGLQPGEVFVHRNVANLVHRADLNLLSVLEFAVGVLEIKHII
                     VCGHYGCGGVRAAMDGYGHGIIDNWLQPIRDIAQANQAELDTIENTQDRLDRLCELSV
                     SSQVESLSRTPVLQSAWKDGKDIIVHGWMYNLKDGLLRDIGCDCTRNALQFACQPAE"
     gene            complement(770690..771100)
                     /locus_tag="BSVBI22_RS13725"
                     /old_locus_tag="BSVBI22_B0781"
     CDS             complement(770690..771100)
                     /locus_tag="BSVBI22_RS13725"
                     /old_locus_tag="BSVBI22_B0781"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002971209.1"
                     /db_xref="GI:489061168"
                     /translation="MKQITPQEALVYIMITTSAADTSMTDAELSSIGNVVSRLPVFQG
                     FDRDRLPKLASDCYALLAYEDGLERILDLAHEALPERLYDTAYALAVEVAAADLHVEQ
                     EELEFLQMLRDRWTLDELTVAAIERSARVRFRKL"
     gene            771295..772950
                     /gene="lysK"
                     /locus_tag="BSVBI22_RS13730"
                     /old_locus_tag="BSVBI22_B0782"
     CDS             771295..772950
                     /gene="lysK"
                     /locus_tag="BSVBI22_RS13730"
                     /old_locus_tag="BSVBI22_B0782"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012093309.1"
                     /note="class I; LysRS1; catalyzes a two-step reaction,
                     first charging a lysine molecule by linking its carboxyl
                     group to the alpha-phosphate of ATP, followed by transfer
                     of the aminoacyl-adenylate to its tRNA; in Methanosarcina
                     barkeri this enzyme charges both tRNA molecules for lysine
                     that exist in this organism (but the tRNALysUUU very
                     poorly) and in the presence of LysRS2 can charge tRNAPyl
                     with lysine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="WP_006192135.1"
                     /db_xref="GI:493203973"
                     /translation="MTSHRLPEITLTPELTAAAAEAKAWPFEEARKILKRYAKTGLPE
                     TVIFETGYGPSGLPHIGTFGEVARTSMVRHAFRILTQDKVKTRLICFSDDLDGMRKVP
                     DNVPDRAALEPYLQMPLSSVPNPFGGDYKSFAKHNNAMLCRFLDTFGFDYEFASATEY
                     YRSGRFDTVLLKAVERYDDIMKVMLPTLGEERQATYSPFLPISPKSGRVLYVPMKKVD
                     AKAGTITFDDEDGEETTLSVTGGKVKLQWKPDFGMRWAALGVDFEMFGKDHQTNAGIY
                     DRICEILGGRAPEHFVYELFLDQLGQKISKSKGNGISIDEWLAYAPTESLALYNFQKP
                     KTAKKLYFDVIPKTVDEYFTYLSAYARQEWKDRLNNPVWHIHYGNPPKADLPVTFALM
                     LNLVSASNAESPAVLWGFISRHVPGVTPENNPELDALVGYAIRYFNDFVKPTKKFRAP
                     DDVERAALEALDAKLGELPAGTDGNVIQNAILDVARAIERYQDHTKKSPEGGPGVSVS
                     FFQMLYEVLIGQERGPRFGSFVALYGIDETRALIKKALAGELA"
     gene            complement(773038..773997)
                     /locus_tag="BSVBI22_RS13735"
                     /old_locus_tag="BSVBI22_B0783"
     CDS             complement(773038..773997)
                     /locus_tag="BSVBI22_RS13735"
                     /old_locus_tag="BSVBI22_B0783"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004689078.1"
                     /db_xref="GI:490826988"
                     /translation="MMQRREKSHAHFVFGSLACLTGAVLIAAFVAPFYGALDRRVVVI
                     DSGSAEKSDKGAKNGIVVEQFDYNEPETAPELDTAQQAVPQPSQSAPAEGQPPAWKEN
                     GKANDHVNDTGMEREAPRPPLSDLGLASTPKPPEPQPPATSVDAGEQMQLLQRPVAVA
                     AGRLESQGRTIELQGIEIVPVEQTCETASGESWPCGMQARTAFRQWLRSRAVMCRLPE
                     NDSGAAVSTKCMLGNEDAAAWLVANGWAKAVPGGAYDEAGRKAVEAHLGIFGDKPDTS
                     LPNPESDSGNMLDNPSPLAPEQEPQPSSPSLQQGDFPPAPAAQ"
     gene            complement(773998..774654)
                     /locus_tag="BSVBI22_RS13740"
                     /old_locus_tag="BSVBI22_B0784"
     CDS             complement(773998..774654)
                     /locus_tag="BSVBI22_RS13740"
                     /old_locus_tag="BSVBI22_B0784"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_002967251.1"
                     /db_xref="GI:489057129"
                     /translation="MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAA
                     DGRARWPSTESLAKVMEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEA
                     GAGGYFDDAGFPAGQGWDIVEFPARTGEGVYALEVSGESMLPLYRDGDTLIVAPNAAV
                     RRGDRVVVRTRDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ
                     "
     gene            complement(774892..777108)
                     /locus_tag="BSVBI22_RS13745"
                     /old_locus_tag="BSVBI22_B0785"
     CDS             complement(774892..777108)
                     /locus_tag="BSVBI22_RS13745"
                     /old_locus_tag="BSVBI22_B0785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="WP_004690297.1"
                     /db_xref="GI:490828207"
                     /translation="MAYVNFKVETDADGIALVTWDMPEKSMNVFTVDAMQELNAIIDA
                     VIADDKIKGVVITSGKETFSGGADLTMLEGMFKEFQKQKVKDPEGAVQTLFDNVGKMS
                     GLFRKLETCGKPWVSAINGTCMGGAFEMSLACHARVASDAPGVKMALPEVKVGLFPGA
                     GGTQRVPRLANQQDALQMMTTGSSLTAQRAKAMGLVTEIAPAKKLVETAKKLIKGGLK
                     PVQPWDEKGFKLPGGAIYSAAGANLWPAATAILRRETSGNYPAALAILKSVYEGLLVP
                     FDTGLKIEQRYFTEILQTTEAGMMIRSLFVSLQELNKGARRPVDEKPTRLKKIGVIGA
                     GFMGAGIAYVTAKAGIPVVLIDRDQESADKGKAHTADLITKEMQKGHATEADKEKLLS
                     LITATPDYAQLEGADLVIEAVFEDREVKRVATEKAEEVLKSSAVFASNTSTLPITGLA
                     KVSKRPKNFIGIHFFSPVDKMMLVEVILGKKTSDKALAVALDYVRAIKKTPIVVNDTR
                     GFYVNRCVLRYMSEAYNMLVEGVPAAMIENAARMAGMPVGPLALNDETAIDLSQKILK
                     ATLADLGPKAVDPRHVELVDKLVNEFDRKGRKNGKGFYDYPAKPAKKHLWPGLKDLYP
                     QQNPDKIDVKELKERFLVTIALEAARVMEEGIVTDPREADVGSILAFGFAPYTGGTLS
                     YIDGMGAKKFVQLAKDLQKKYGAQFKAPKLLLDMAENGETFYQRFNPYKGETKKAA"
     gene            complement(777124..778332)
                     /locus_tag="BSVBI22_RS13750"
                     /old_locus_tag="BSVBI22_B0786"
     CDS             complement(777124..778332)
                     /locus_tag="BSVBI22_RS13750"
                     /old_locus_tag="BSVBI22_B0786"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643351.1"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="WP_004687161.1"
                     /db_xref="GI:490825071"
                     /translation="MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNG
                     IDTAKVDDIIFGCVDPVGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAA
                     AKVAFGSDDLVIAGGVESMSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYG
                     FSRDDVDAYAVESQKRAANSWEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALG
                     QLNPSFVMPGEMGGFNAVGIQAHPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKA
                     FDIKPRARIRAFANIGSEPALMLTGPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVL
                     RYMQAFDIPHDKINVNGGAIAMGHPLGATGAMILGTVLDELERRNLNTALVTLCIGAG
                     MGTATIIERV"
     gene            complement(778397..780190)
                     /locus_tag="BSVBI22_RS13755"
                     /old_locus_tag="BSVBI22_B0787"
     CDS             complement(778397..780190)
                     /locus_tag="BSVBI22_RS13755"
                     /old_locus_tag="BSVBI22_B0787"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014315844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_004687160.1"
                     /db_xref="GI:490825070"
                     /translation="MPSYRAPVEDTNFVLNDVLNYQRYNNLPGFAEAAPDVVEAILSE
                     GAKLAEGTLFPVNQTADREGCTRHADGSVTTPKGYKEAYNLYREGGWLGLAVPEQYGG
                     QGLPYLLHTAVGEYMSSANMALTMYPGLTQGAIAAILTHGTDEQKDTYLPKMVEGTWT
                     GTMNLTEPHCGTDLGLLRTSAAPQADGTYKISGQKIFISAGEHDMSENIIHLVLARIE
                     GAPEGVKGISLFIVPKFILDENGNPGTRNGVSCGSIEEKMGIHGNATCVMNYDEATGY
                     LIGEANKGLRAMFTMMNEARLGVALQGLSIAETAYQNAVIYARERIQGRALSGAVAPE
                     KKADPIIVHPDIRRNLMNIRAFNEAGRALILWIALHSDIAHRSGDEAERQAADDLVGL
                     LTPVLKGVLTDKGFEHAVMAQQVFGGHGYIEEQGMSQYVRDARIAMIYEGANGIQALD
                     LVGRKLALNGGRAITAFFKEVGEFCETNRENEKLSFFTKYLKKGVNDLQAATMWLMQN
                     AMAKPDNAGAASNDYMHLFGLVALGYMWARMAKVAEEKLAAGEGNKAFFEAKLVTARY
                     YFERIMPESVTHLARIQSGADSMMALNADTF"
     gene            complement(780165..780359)
                     /locus_tag="BSVBI22_RS13760"
                     /old_locus_tag="BSVBI22_B0788"
     CDS             complement(780165..780359)
                     /locus_tag="BSVBI22_RS13760"
                     /old_locus_tag="BSVBI22_B0788"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004690300.1"
                     /db_xref="GI:490828210"
                     /translation="MIGQKAAKMADFRVKRAFFCNKHVAMAIPPLCDQSCMNVVGSIF
                     RQGRKMRKVEDLDAKLSRAG"
     gene            complement(780356..780634)
                     /locus_tag="BSVBI22_RS13765"
                     /old_locus_tag="BSVBI22_B0789"
     CDS             complement(780356..780634)
                     /locus_tag="BSVBI22_RS13765"
                     /old_locus_tag="BSVBI22_B0789"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968514.1"
                     /db_xref="GI:489058417"
                     /translation="MPVFELVAPLIMANSTVLKLRQGAMSMDDFPSRTNQMQRNAMPR
                     RKEQTKATFTTATSKSVARTCEFLTFTETSKYASFGRNWIDHYTGGGK"
     gene            780889..781539
                     /locus_tag="BSVBI22_RS13770"
     CDS             780889..781539
                     /locus_tag="BSVBI22_RS13770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192140.1"
                     /db_xref="GI:493203978"
                     /translation="MDISQLRTLIYVAELGSLSKAADRLRIAQPALSRQIRLLEQELG
                     TRLFDRHGRGMIATEKGHDVLRHAQRIMAEMEEIRVLAQDENAPLRGHVSIGMPPTAS
                     DILSEPLVSTFQETHPDATLRIVNAYSGYLVDWLHRGDIDAAILYNPKNARSFHIQPL
                     LEEALSSLVLQISIRYEAVRLLSANWKRNVCFYPVSGTACGHCLKNTHKKRVSPST"
     gene            782143..783303
                     /locus_tag="BSVBI22_RS13775"
                     /old_locus_tag="BSVBI22_B0791"
     CDS             782143..783303
                     /locus_tag="BSVBI22_RS13775"
                     /old_locus_tag="BSVBI22_B0791"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_006133397.1"
                     /db_xref="GI:493096203"
                     /translation="MHVAVDDYTDIREAVSKLCQRFPGEYWPKIDREMAYPNEFVNAL
                     TEAGWLSILIPEEYGGAGLPLSAAAAVLEEIQKSGCNGGACHAQMYTMGTLLRHGSDE
                     QKACYLPKIASGELRLQAFGVTEPTSGTDTGALKTTARREGDEFIINGQKIWTSRAEY
                     SDLMLLLARTSPLTDGMKKTDGLSVLIVDMAKAKNNGLTIRPIRTMMNHATTEVFFDN
                     LRVPVSNLIGEEGKGFRYILSGMNAERILIAAECIGDAKWFTQKSVNYAKERSIFGRP
                     IGQNQGIQFPIAKAYANMRAAELMVQSALALYEAGQNPGAEANMAKMLAADASFEAAN
                     ACVQTHGGFGFAEEYDVERKFRETRLYQVAPISTNLILSYIAEHVLGMPRSY"
     gene            complement(783436..784236)
                     /gene="nikE"
                     /locus_tag="BSVBI22_RS13780"
                     /old_locus_tag="BSVBI22_B0792"
     CDS             complement(783436..784236)
                     /gene="nikE"
                     /locus_tag="BSVBI22_RS13780"
                     /old_locus_tag="BSVBI22_B0792"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510833.1"
                     /note="with NikABCD is involved with nickel transport into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel import ATP-binding protein NikE"
                     /protein_id="WP_004687156.1"
                     /db_xref="GI:490825066"
                     /translation="MSLISADNIVKIYQSHSLVGASARKTVLHDISISIGQGETVALL
                     GRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLDRSGMKAFRREVQLIFQDSPGAV
                     NARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI
                     CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKF
                     AARCLVMDEGQIVEEIKTADLDSMRHPASRLLREAVLPPLPVRAVETN"
     gene            complement(784233..785021)
                     /gene="nikD"
                     /locus_tag="BSVBI22_RS13785"
                     /old_locus_tag="BSVBI22_B0793"
     CDS             complement(784233..785021)
                     /gene="nikD"
                     /locus_tag="BSVBI22_RS13785"
                     /old_locus_tag="BSVBI22_B0793"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8FVM9.1"
                     /note="with NikABCE is involved in nickel transport into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel import ATP-binding protein NikD"
                     /protein_id="WP_004690304.1"
                     /db_xref="GI:490828214"
                     /translation="MTRKTLAIEGLTATTVIDGQQRVLVDNLSLGVQRGRILALVGAS
                     GSGKSMTCSAALGVLPPGVTASRGRVTIDGVPYAANALRGRHVATIMQNPRGAFNPVR
                     TMRDHAIETLQALGKLSSNPQDQIVHCMRAAGLEDVKTILSLHPFEMSGGMLQRMMIA
                     LALLSEAPFLFADEPTTDLDLVVQLRVLELLEKLVEERDLGILLVTHDMGVVARLAHD
                     VAVLDHGRLIEQAPVMDIFQTPGHEVTRMLVSAHLSLYGMELNA"
     gene            complement(785018..785890)
                     /gene="nikC"
                     /locus_tag="BSVBI22_RS13790"
                     /old_locus_tag="BSVBI22_B0794"
     CDS             complement(785018..785890)
                     /gene="nikC"
                     /locus_tag="BSVBI22_RS13790"
                     /old_locus_tag="BSVBI22_B0794"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006196391.1"
                     /note="with NikABDE is involved in nickel transport into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel ABC transporter permease"
                     /protein_id="WP_004692193.1"
                     /db_xref="GI:490830107"
                     /translation="MSDSASMVCASKTGFLSVPRQWPVRLACIIVLLLLVAAVAGPWI
                     TPYNPDDVDLVRRLQSPSLAHWLGTDHLGRDMLSRLIAGVRVSLGSVVITLALILAIG
                     IVIGGAAGFLGGRADQVIMRITDVFLTFPTLVLALFMVGMLGTGLVNLILAIALSHWA
                     WYARIVRGIVMSLRHREFLLAARMSGAGPVRTFWEHLLPATFSQLVVLATLDVGHIML
                     HVSGLSFLGLGVTPPTAEWGVMINDARQFVWTAPMLILWPGLALFLSVMAFNILGDAL
                     RDSLDPHLKAEHSH"
     gene            complement(785887..786831)
                     /locus_tag="BSVBI22_RS13795"
                     /old_locus_tag="BSVBI22_B0795"
     CDS             complement(785887..786831)
                     /locus_tag="BSVBI22_RS13795"
                     /old_locus_tag="BSVBI22_B0795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934568.1"
                     /note="with NikACDE is involved in nickel transport into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_002965839.1"
                     /db_xref="GI:489055692"
                     /translation="MFAFIIRRVILLVPMLFGASLVIFLMLRLGPSDPAMDYLRLSKV
                     PPTPQALESARQMLGLDRAITTQYFDWLGKALHGDFGISFATQRPVLPDLLYFLPATL
                     QLAGVALVLTLGLSIPLGMWAARHREGWQDQVVRFVAFLGVSMPNFWLGFLLVLVFSI
                     QLGWLPPMGRGGFAHMIMPAIAISFMSLSINARLLRASMLEVSGQRHVRYARLRGLSE
                     RSVERSHVLRNAWLPIITATGMHIGELIGGTLVIESIFGWPGVGRYAVSAILNRDYPV
                     IQCFTLVMVTIFVICNLIVDVVYAWADPRIRLSAEGAE"
     gene            complement(786833..788413)
                     /locus_tag="BSVBI22_RS13800"
                     /old_locus_tag="BSVBI22_B0796"
     CDS             complement(786833..788413)
                     /locus_tag="BSVBI22_RS13800"
                     /old_locus_tag="BSVBI22_B0796"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_004687154.1"
                     /db_xref="GI:490825064"
                     /translation="MLTDRLRGLMLAFAFVSVAFVSGAHADPKLNFSWPVNVGPLNPH
                     LYSPNQMFAQNMVYEPLVHYNADGTVGPWLAESWEASQDGRSYTFKLREDVKFSNGEV
                     FDAAAVKANIDTVLQNRPRHNWLELVNQMVSAEVVGPYKVRINLKKPYYPLLQELSLP
                     RPFRFIAPSQFKNGGTADGIVAPIGTGPWKLTETKLGEHDVFTRNDSYWGPKPAYEQI
                     TVKVIPDPNTRAIAFEAGEIDLIYGTEGPISPDTFERFQKMGIYNTELSEPLETRVLA
                     LNTNHGATKDLAVRKAINHAVDKDTMIATVLYGTQKRADTLFADNVPYANIGLKPYAF
                     DPALAARLLDEAGWTAKASGDIREKDGQPLAIELCFIGTDAISKSMAEIVQADLRKVG
                     IDVKLTGEEESSIYARQRDGRFDMIFNQTWGAPYDPHAFVSSMRVPSHADYQAQLGLP
                     DKAKIDAEIGQVLVSTDETARQALYKDILTRLHEEAVYLPLTSVTAMAVAKPEVGKIT
                     FGAMSSEIPFEKLTPKAN"
     gene            788680..789078
                     /locus_tag="BSVBI22_RS13805"
                     /old_locus_tag="BSVBI22_B0797"
     CDS             788680..789078
                     /locus_tag="BSVBI22_RS13805"
                     /old_locus_tag="BSVBI22_B0797"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9AL83.1"
                     /note="Inhibits transcription at high concentrations of
                     nickel; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel-responsive regulator"
                     /protein_id="WP_002965835.1"
                     /db_xref="GI:489055688"
                     /translation="MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQQAS
                     LEEGQMEACVGVLSYTYDHSARDLSKKLTNTHHDHHNISVASMHVHLDHDRCLEVSIL
                     KGKTDDVRHFADHVKAERHVTHGTLAVLPL"
     gene            complement(789089..790633)
                     /locus_tag="BSVBI22_RS13810"
                     /old_locus_tag="BSVBI22_B0798"
     CDS             complement(789089..790633)
                     /locus_tag="BSVBI22_RS13810"
                     /old_locus_tag="BSVBI22_B0798"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-galactarate dehydratase"
                     /protein_id="WP_002965834.1"
                     /db_xref="GI:489055687"
                     /translation="MKNVVAAAVAPVIILHPSDDVAVARVPVRAGDPIGIDEITAREL
                     IGRGHKVALRAIPAGREVLKYGQVIGVATRDIAPGEHVHLQNLAMLPSEHAHQFSIDI
                     EEHGMVPDAERRHFMGYDRGAGGVGTRNFIGVISSVNCSATVSRYIADYFNRMGGLDG
                     FDNVDGVVALTHGSGCALNTRSEGYRLLTRTIQGYAKHPNFGGVLLIGLGCETNQIAP
                     ILEHYRIEEGSRLRAMTIQQHGGTRKTIDAAIGEIKDMLPMVNAAKRSPQPLSNLKVA
                     LECGGSDGYSGISANPALGYASDLIVRNGGTTVLSETPEIYGAEHLLTRRAVTPAVAE
                     KLLQRIDWWRDYTARNGDELNNNPSYGNKLGGLTTILEKSLGAVAKGGSMPLKAVYEF
                     AETITEQGFVFMDTPGYDPVAVTGQVAGGCNVICFTTGRGSVSGFKPSPCIKIATNSE
                     MYEHMKEDMDINCGGIVTGNETIEEAGARIFDHILAVASGQKTLSEIYDYGDNEFVPW
                     QVGAVT"
     gene            complement(790711..791553)
                     /locus_tag="BSVBI22_RS13815"
                     /old_locus_tag="BSVBI22_B0799"
     CDS             complement(790711..791553)
                     /locus_tag="BSVBI22_RS13815"
                     /old_locus_tag="BSVBI22_B0799"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006121514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_006073923.1"
                     /db_xref="GI:492972329"
                     /translation="MIRDTSTGAKLWIAAVWAVVIFFVINLTAMIATVVLSSFSTRWL
                     GTWLPAGLTTKWYYTAWSEFQLHDVLIVTFQIVFTVVILSGLLGVTAAYAMARRNFPG
                     RNIVMLLFLLPLLVPPITFGIPLATVLYQAGIGGTFWGVVLAKLVPTVPFVILVMIPF
                     IEQVDPKVEAAARVFGANTFQLFRYVLLPMLLPGILAALLLVLVRTVAMFELTFLTAG
                     PTSQTLVVALYYSVFASGVRSVQSIDAMAVIYMITTLIWLLLALRFVNPTQIVARAKS
                     QNTN"
     gene            complement(791554..792276)
                     /locus_tag="BSVBI22_RS13820"
                     /old_locus_tag="BSVBI22_B0800"
     CDS             complement(791554..792276)
                     /locus_tag="BSVBI22_RS13820"
                     /old_locus_tag="BSVBI22_B0800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006097658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004682154.1"
                     /db_xref="GI:490820057"
                     /translation="MGQLHPFFSDPFLYNTIGTTLWLAIPVTFLSLIIAVPIAFRVRL
                     LRRQRLLTTVLVIPVTLGTVLVAEGLLNYLGPQGWFSRTLMLFGLVDAPLKLTNNYWG
                     VFASLIITGFPFTFLLTLSYVSGIDPALEQAAATHGAKSWQRFRYVLLPLLIPGLAIT
                     FCLSFVLAFAVFPSAILLGAPAGPTRVISIAAYQAAFEQYDYSMAAAIAMIMAAVQLA
                     IVVLVLGIRSLFYRGATSGGKG"
     gene            complement(792461..793528)
                     /locus_tag="BSVBI22_RS13825"
                     /old_locus_tag="BSVBI22_B0801"
     CDS             complement(792461..793528)
                     /locus_tag="BSVBI22_RS13825"
                     /old_locus_tag="BSVBI22_B0801"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192147.1"
                     /db_xref="GI:493203985"
                     /translation="MQAASLPFNEIRLERMSRAFGSHNALKSITLSISKGEFIALLGP
                     SGCGKSTALNCIAGLLATTGGGIYIDEKRIDTLKPEDRGFGMVFQNYALFPHMSVREN
                     VGFGLKMRGTPKSEIRKRVDEAIGMVRLNGQEEKLPGQLSGGQQQRVAIARAIVIEPP
                     LVLMDEPLSNLDAKLRLEMRAEIRRIHNQLGSTTIYVTHDQDEALSLADRIVVLRDGE
                     IRQVGVPSDLYERPDHLDVAEFMGYRNRLSGKVTAIDGERATISIGGSLIAGIARVPL
                     AVGQDVVLAARPDDVATGPASPAALQAKVETIEYRGRDFVGTANMSDGHNLVFHASAH
                     AELGSAVSLTVDPNRALIFPA"
     gene            complement(793591..794772)
                     /locus_tag="BSVBI22_RS13830"
                     /old_locus_tag="BSVBI22_B0802"
     CDS             complement(793591..794772)
                     /locus_tag="BSVBI22_RS13830"
                     /old_locus_tag="BSVBI22_B0802"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006104897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_004682158.1"
                     /db_xref="GI:490820061"
                     /translation="MRLTRRQALGGMAALAAFPASRVWAQTKPAMPASPVTLNIVDVA
                     GNLALTQPAFEAYAKANPDKVSKITFTKAPAPELPGKLKAQQAANRLDIDVVLTGTDA
                     LSAGHELGLWVKLLPEYSTSLPDLKTLYQEPAWRMQEAQGKQHGLAIVYYPSGPLLEY
                     MPDKVKTVPRNLDELLVWAKENPNKFLYARPANSGPGRTFLMGLPYMLGDADPKDPMK
                     GWDKTWAYLKELHKYIEYYPTGTGALMKELGEGTRYMTVTTTGWDINPRVLGVVPKEA
                     AVSKLDGFHWVADAQFMAVPKGIGDDKLAVILDLMNYMLTPEAQAVTYDQGYFYPGPV
                     VKDVPITMAPQSSQDAIAEFGRAEYADWIANNPIELPLEPAAMVAAFRRWDEDVASQP
                     K"
     gene            complement(794932..795819)
                     /locus_tag="BSVBI22_RS13835"
     CDS             complement(794932..795819)
                     /locus_tag="BSVBI22_RS13835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192149.1"
                     /db_xref="GI:493203987"
                     /translation="MIVQFAGCTDTDLAHYIEETVAFPSTMVDRIVPATTDEDRISIS
                     RTLKVLDQWPITTEPFSQWVIEDRFPTGRPAWEIAGATFVQDVAAFELMKLRLLNGSH
                     STLAYLGFLAGHRTVSQTMAAPGFKQLIKALMEIESAPTLPKLEGFDLSSYQAALIHR
                     FENHALHHLTSQIAMDGSQKLPQRLLNTIQERLDGGGSIDRLALGVAAWMRYVTGKDE
                     AGTPIDVRDPLSGQLLDQTQGKFAPDEIMDALLSFQQIFTARLAANELFREKLRLALG
                     SLYAVGSAETVRRYAEIAM"
     gene            complement(795816..796424)
                     /locus_tag="BSVBI22_RS13840"
     CDS             complement(795816..796424)
                     /locus_tag="BSVBI22_RS13840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006204792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006073936.1"
                     /db_xref="GI:492972342"
                     /translation="MRTSEPRLSNRTMSGLPSSVKVPAYDRSRITTGIAHLGIGAFHR
                     AHQAAYTDAVLTSGSNEWGIVGVSLRRPDTRDALQIQDELYTLAIRDGDSEKLQVIGS
                     IQNILVAPEDPQAVLDIMSHPDTRIVSLTITEKGYCRDAAVSGLDRSHPDIIYDLAHP
                     ATHARPSASSQKHSGGGAPRERRRLPFFPVIICLPMAKPAKT"
     gene            complement(796436..797836)
                     /locus_tag="BSVBI22_RS13845"
                     /old_locus_tag="BSVBI22_B0804"
     CDS             complement(796436..797836)
                     /locus_tag="BSVBI22_RS13845"
                     /old_locus_tag="BSVBI22_B0804"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uronate isomerase"
                     /protein_id="WP_004687147.1"
                     /db_xref="GI:490825057"
                     /translation="MALNPDRLFSAEPGTREIARRLFASVEKLPIISPHGHTEPIWYA
                     RNEAFPDPASLFVKPDHYITRMLYSQGHSLESLGIASRDGRPSETDARKIWRLFATNW
                     YLFRATPSRLWFEHAMETVFGITERLSQENADRIFDAIADQLTQPHMRPRALYDRFNI
                     EAISTTDAATDPLIYHDEVIASGWHGRIIPAYRPDAAVDAGRPDFASEVEKLVGVAGT
                     PLTWQGYLDAHRNRREYFKRRGATSSDHGHPTAQTADLSAGDASRLFDRVIKGNASTS
                     DAEMFRAQMLTEMARMSIDDGLVMQIHPGSFRNHNPTVFERFGLDKGADIPRQTGFVD
                     QLKPLLDAFGNDPRLTVILFTLDETAYSRELAPLAGHYPALKLGPAWWFFDSPEGILR
                     YRKLTTETAGFYNTVGFNDDTRAYLSIPARHDMARRVDCAYLAGLVADHRLEEDEAYE
                     VAHDLAYRLAKQTYKL"
     gene            798165..798938
                     /locus_tag="BSVBI22_RS13850"
                     /old_locus_tag="BSVBI22_B0805"
     CDS             798165..798938
                     /locus_tag="BSVBI22_RS13850"
                     /old_locus_tag="BSVBI22_B0805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_006192153.1"
                     /db_xref="GI:493203991"
                     /translation="MRGRSAQPALEKQKNVADTESGAATGVKARTLPSRVAGVQRVTT
                     AKLIYHELQQQIIRMELLPGTPLNEKALTEKYGVSRTPVREALIRLAEDRLVDVFPQS
                     GTFVARIPVDAIPEAVVIRQALEGETAERAAANSTTAAIEKLDELIHLQTFYARKDKP
                     GPFHETDDAFHETIAEIAGYPGIWQHLKPVKMQIDRARRMTMPILGRMEQVLREHHAI
                     RDAISARDVHAAREAMKHHLSAVLPDIDELRKSRPDYFA"
     gene            798999..800204
                     /locus_tag="BSVBI22_RS13855"
                     /old_locus_tag="BSVBI22_B0806"
     CDS             798999..800204
                     /locus_tag="BSVBI22_RS13855"
                     /old_locus_tag="BSVBI22_B0806"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967247.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-gluconate from mannonate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannonate dehydratase"
                     /protein_id="WP_004690313.1"
                     /db_xref="GI:490828223"
                     /translation="MRQAWRWFGPEAGVPLDAVRQAGATDIVSALHEVPIGQEWTSAQ
                     IVERKNLIESTPTGRHPLTWSVVESIPVSDDIKRSGKAARHDIGAWIASMEALARNDI
                     KVICYNFMPVVDWCRTDLDYITSTGATAMRFDQDRFAAFDLHILQRKGAEKDYSEEDR
                     IAARAIFEAMDETEIEQLIVNIASALPGSTTEPLTIPAFREKLETYASIDAAHLRRNL
                     VEFLEAVTPVADSLGVKLTLHPDDPPRSLFGLPRIASTEADYAAIFAAVPAQSNGMCF
                     CTGSLGVRADNDLPAIARRFASRIHFSHLRATTREGDGRTFHEAAHLEGDVDMVGILR
                     ILLEEDRKRDAGQTIIFRSDHGHRMMDDLEKKVTPGYPVIGRMRGLAELRGIITALDA
                     CALEYDPNV"
     gene            complement(800388..803467)
                     /locus_tag="BSVBI22_RS13860"
                     /old_locus_tag="BSVBI22_B0807"
                     /note="acriflavine resistance protein B; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            complement(803490..804476)
                     /locus_tag="BSVBI22_RS13865"
                     /old_locus_tag="BSVBI22_B0808"
     CDS             complement(803490..804476)
                     /locus_tag="BSVBI22_RS13865"
                     /old_locus_tag="BSVBI22_B0808"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_006192156.1"
                     /db_xref="GI:493203994"
                     /translation="MLRNTVGTAVAIASTAVNSPEAGNVAVLAVKDGAIVKAGDLIAQ
                     LDDKAIHANIVKDTASLAKSQATLNDAEIQLKRTQDLVRKGVATSQSGDDALAALKVA
                     QAQLQVDQAQLAADQVTLSYTKIVAPFTGQLGVVQVSPGAYLSAGSSVATLTRMSPIY
                     AEFTLPETDLARIRAALKDGTLKTDVTVTSGEGKDVTESGCVDFIDNAVDPASGTVRL
                     RATLDNRSGNFWPGQSLRISVELGKIDDLVLVPDVAVEPQENGSISYVVKPDNSVEIR
                     PVSVALRADGMAGVRAGLQPGERVVIEGQDALSNGNRVKLVETKPDAKVSSD"
     gene            804933..805334
                     /locus_tag="BSVBI22_RS13870"
                     /old_locus_tag="BSVBI22_B0809"
     CDS             804933..805334
                     /locus_tag="BSVBI22_RS13870"
                     /old_locus_tag="BSVBI22_B0809"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q578U0.1"
                     /note="may be involved in chromosome condensation;
                     overexpression in Escherichia coli protects against
                     decondensation by camphor; overexpressing the protein
                     results in an increase in supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="camphor resistance protein CrcB"
                     /protein_id="WP_004690316.1"
                     /db_xref="GI:490828226"
                     /translation="MSVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNV
                     SGAFVIGTAAGLGARLGAIFSTTIFHEFIMVGLLGGYTTVSSFCLQSVNLMLDGEQRQ
                     ALFNIVASALLCVLAVAAGYGGIMWIMEWPG"
     gene            805331..805744
                     /locus_tag="BSVBI22_RS13875"
                     /old_locus_tag="BSVBI22_B0810"
     CDS             805331..805744
                     /locus_tag="BSVBI22_RS13875"
                     /old_locus_tag="BSVBI22_B0810"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YCQ9.1"
                     /note="may be involved in chromosome condensation;
                     overexpression in Escherichia coli protects against
                     decondensation by camphor; overexpressing the protein
                     results in an increase in supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="camphor resistance protein CrcB"
                     /protein_id="WP_002968948.1"
                     /db_xref="GI:489058867"
                     /translation="MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLW
                     GTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFVMGGLCGGLTTFSSMSLDTFLLV
                     LHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR"
     gene            805760..806119
                     /locus_tag="BSVBI22_RS13880"
                     /old_locus_tag="BSVBI22_B0811"
     CDS             805760..806119
                     /locus_tag="BSVBI22_RS13880"
                     /old_locus_tag="BSVBI22_B0811"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965821.1"
                     /db_xref="GI:489055674"
                     /translation="MELPRESTLLRIFVGEEDQTEDGKLLYEAIVNKAREMQMAGATV
                     LRGPLGFGHSSILHTAKILRLSQDLPTVIEIVDAPEKIEHFIPQVMKMTQSCLITTEK
                     VQVIHYGSNGSTKEKGD"
     gene            complement(806174..806629)
                     /locus_tag="BSVBI22_RS13885"
                     /old_locus_tag="BSVBI22_B0812"
     CDS             complement(806174..806629)
                     /locus_tag="BSVBI22_RS13885"
                     /old_locus_tag="BSVBI22_B0812"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_004690317.1"
                     /db_xref="GI:490828227"
                     /translation="MRGQTNAPRMTIADFLVGDGMKAKHEGETNGPFFRIGDLAQEFG
                     LTLRALRFYEDKGLLRPRRAGVTRLYNLNDYARLRLVIFGRRIGFTLGEISELIGLWE
                     QGLADPGQLSALRQSFIAKLTELEKKKVEIDDTIDELRTVLGGLSSLPG"
     gene            806999..809740
                     /locus_tag="BSVBI22_RS13890"
                     /old_locus_tag="BSVBI22_B0814"
     CDS             806999..809740
                     /locus_tag="BSVBI22_RS13890"
                     /old_locus_tag="BSVBI22_B0814"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006203793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006192159.1"
                     /db_xref="GI:493203997"
                     /translation="MQDLSQTLSALEEHLSELEPQKVDRAAPADARAQTSIAGLVEIA
                     DHLRRMRNPYISPDEEAAERAFQPPHRDEAFGEPPHYRRRLSDRIGTAAPEYARPQAA
                     PAEHDALHHIDGRLNEISRALIATNKLQRPSREEAERMDRIEKRLAALTAQLDSAFTR
                     EDSDALFRRLGELSQRIDALQANASLPEQIVDQLACQVQLLATQIGKVVENLSRSDYR
                     RVEARLEAISERLDAAERRAHEHHPAVMDQIDRRFAELTERLDAHYASRYGASSADSE
                     AIHNLEQQIASIAQHLAQPSRELAEIRPRLDSIERSLHSNREIVLDAAREATESVVAR
                     MLQHGPKSETAIAQQLAADMKALETLARNADDRNTKTFEAVHDTLTQVVERLAGIEKE
                     MSPKPAASAPIKAPVFSSPAAPAPVKFPQVEKAAAHTSRPHEPFFKSDFASLKPARRE
                     NPVHTQPPAVKPDVKSGPRAGDETVLDLNSIMKRVREERRQQEDGSEAPKTAATSKVD
                     FITAARRAAQLAATQSEQIEKDAAAPTEKKKASIADILHRQRKPILFAIGAVMIAIAG
                     LQVGTAFLNRDSDIDPAVNVAAEKPAAIDMASTGGIQTIPTTINRAATLATPQMPPLQ
                     AESTVDDKMPALPPEPQASAQFSPPETEQTAAPEPKKIEIPSIPEEAGPAALREAAAK
                     GDIRALFEIGNRYMEGRGVAENVKEAAKWYQLAADQGNASAMHNLAVLFATGTNGTPD
                     NAAAVRWFTEAAELGVKDSQYNLGILAAKGLGMPVNLEESYKWFALAANAGDKDAAEK
                     RDQIAKALKPEMLTRAKGAVELWKAKPLDDAANSIDVPDAWTEAKPLSTSSVDMKKAV
                     RNIQLILQKNGYDTGTADGMMGAKTRTAISAFQKANGQEPTGEVNQKLVQLLLEKNK"
     gene            810007..810927
                     /locus_tag="BSVBI22_RS13895"
                     /old_locus_tag="BSVBI22_B0815"
     CDS             810007..810927
                     /locus_tag="BSVBI22_RS13895"
                     /old_locus_tag="BSVBI22_B0815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_032448794.1"
                     /db_xref="GI:694106100"
                     /translation="MGIYLPIAELSVNMLVLLGMGAAVGFLSGLFGVGGGFLITPLLI
                     FYNIPPAIAVATGANQIIASSVSGALAHFKRRTLDIKLGLFLVAGGILGSLIGIFVFS
                     WLRDLGQLDLIVSILYVFFLGTIGDLMLVESVQALRRAKKGQGGAVRRSGQHTWIHRL
                     PFKMRFRASTIYVSVIPVLGIGFFIGLLSSVMGVGGGFIMVPALIYLLHVPTNVVVGT
                     SLFQITFVTAFTTVMQATTNQSIDIVLAFLLMVGGVIGAQYGARAGRKLRGEQLRLLL
                     ALLVLAVGMRLAFGLFVRPDNLFSISIADM"
     gene            810929..811753
                     /locus_tag="BSVBI22_RS13900"
                     /old_locus_tag="BSVBI22_B0816"
     CDS             810929..811753
                     /locus_tag="BSVBI22_RS13900"
                     /old_locus_tag="BSVBI22_B0816"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969309.1"