GenomeNet

Database: RefSeq
Entry: NC_016797
LinkDB: NC_016797
Original site: NC_016797 
LOCUS       NC_016797            2108637 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Brucella suis VBI22 chromosome I, complete sequence.
ACCESSION   NC_016797
VERSION     NC_016797.1  GI:376279704
DBLINK      Project: 83617
            BioProject: PRJNA83617
KEYWORDS    RefSeq.
SOURCE      Brucella suis VBI22
  ORGANISM  Brucella suis VBI22
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Brucellaceae; Brucella.
REFERENCE   1  (bases 1 to 2108637)
  AUTHORS   Tae,H., Shallom,S., Settlage,R., Hawkins,G.N., Adams,L.G. and
            Garner,H.R.
  TITLE     Complete Genome Sequence of Brucella suis VBI22 Isolated from
            Bovine Milk
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2108637)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2108637)
  AUTHORS   Tae,H., Shallom,S., Settlage,R., Hawkins,G.N., Adams,L.G. and
            Garner,H.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-NOV-2011) Virginia Bioinformatics Institute, Virginia
            Tech, Washington Street, MC 0477, Blacksburg, VA 24061, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003128.
            DNA material is available from Dr. Gregory Hawkins at Texas Animal
            Health Commission.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2108637
                     /organism="Brucella suis VBI22"
                     /mol_type="genomic DNA"
                     /strain="VBI22"
                     /db_xref="taxon:1112912"
                     /chromosome="I"
     gene            784..2274
                     /gene="dnaA"
                     /locus_tag="BSVBI22_A0001"
                     /db_xref="GeneID:11729475"
     CDS             784..2274
                     /gene="dnaA"
                     /locus_tag="BSVBI22_A0001"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiation protein"
                     /protein_id="YP_005153711.1"
                     /db_xref="GI:376279705"
                     /db_xref="GeneID:11729475"
                     /translation="MKMDSAVSEEAFERLTAKLKARVGGEIYSSWFGRLKLDDISKSI
                     VRLSVPTAFLRSWINNHYSELLTELWQEENPQILKVEVVVRGVSRVVRSAAPAETCDN
                     AEAKPAVTPREKMVFPVGQSFGGQSLGEKRGSAVVAESAAATDAVLGSPLDPRYTFDT
                     FVDGASNRVALAAARTIAEAGSSAVRFNPLFIHASVGLGKTHLLQAIAAAALQRQEKA
                     RVVYLTAEYFMWRFATAIRDNNALSFKEQLRDIDLLVIDDMQFLQGKSIQHEFCHLLN
                     TLLDSAKQVVVAADRAPSELESLDVRVRSRLQGGVALEVAAPDYEMRLEMLRRRLASA
                     QCEDASLDIGEEILAHVARTVTGSGRELEGAFNQLLFRQSFEPNISIDRVDELLGHLT
                     HAGEPKRIRIEEIQRIVARHYNVSKQDLLSNRRTRTIVKPRQVAMYLAKMMTPRSLPE
                     IGRRFGGRDHTTVLHAVRKIEDLVGADTKLAQELELLKRLINDQAA"
     misc_feature    808..2262
                     /gene="dnaA"
                     /locus_tag="BSVBI22_A0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    808..999
                     /gene="dnaA"
                     /locus_tag="BSVBI22_A0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    1237..1911
                     /gene="dnaA"
                     /locus_tag="BSVBI22_A0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     misc_feature    1987..2256
                     /gene="dnaA"
                     /locus_tag="BSVBI22_A0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(2056..2058,2080..2085,2104..2106,2122..2130,
                     2155..2169,2176..2178,2185..2190)
                     /gene="dnaA"
                     /locus_tag="BSVBI22_A0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            2503..3696
                     /gene="dnaN"
                     /locus_tag="BSVBI22_A0002"
                     /db_xref="GeneID:11729477"
     CDS             2503..3696
                     /gene="dnaN"
                     /locus_tag="BSVBI22_A0002"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_005153712.1"
                     /db_xref="GI:376279706"
                     /db_xref="GeneID:11729477"
                     /translation="MRLIDKGRLPLGCSRPGPSERVRFKMRVTLERSNLLKSLNHVHR
                     VVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATAAMVEQAGATTVPAHLLYDI
                     VRKLPDGAEVMLSTNPDGGSMSVISGKSSFRLQCLPQSDFPELTAGAFTHSFRIEAQA
                     LKRLIDRTQFAISTEETRYYLNGIFFHAIESDGALKLRAVATDGHRLARAELEAPSGT
                     EGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLTSKLIDGTFPDYQ
                     RVIPSGNDKKLTIDRQDFAASVDRVSTISSERGRAVKLSIADGQLTLTVNNPDSGSAT
                     DELAADYDGDPLDIGFNSKYLLDITGQLSGTDAVFMLADAGSPTLVRDTGDEDVLYVL
                     MPMRV"
     misc_feature    2578..3693
                     /gene="dnaN"
                     /locus_tag="BSVBI22_A0002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    2578..3690
                     /gene="dnaN"
                     /locus_tag="BSVBI22_A0002"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(2647..2649,2791..2793,2812..2814,3187..3189)
                     /gene="dnaN"
                     /locus_tag="BSVBI22_A0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2794..2796,2803..2805,2887..2889,2893..2895,
                     3409..3411,3502..3507)
                     /gene="dnaN"
                     /locus_tag="BSVBI22_A0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(3106..3108,3112..3123,3553..3555,3679..3690)
                     /gene="dnaN"
                     /locus_tag="BSVBI22_A0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(3106..3108,3112..3117,3334..3336,3439..3441,
                     3478..3483,3562..3564,3679..3690)
                     /gene="dnaN"
                     /locus_tag="BSVBI22_A0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            3878..5032
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /db_xref="GeneID:11729480"
     CDS             3878..5032
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="Required for DNA replication; binds preferentially
                     to single-stranded, linear DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein F"
                     /protein_id="YP_005153713.1"
                     /db_xref="GI:376279707"
                     /db_xref="GeneID:11729480"
                     /translation="MEAKDHIERRPDRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGE
                     NGSGKTNLIEAISFLSPGRGLRRAAYDDVARANAEGGFAIHAALDCMIYGDAEIGTGT
                     AGGGEGGRKVRINGIAASADDLLDYARILWVVPSMDGLFTGGASDRRRFLDRMVLAID
                     TAHGKRVLDYEKAMRSRNRLLNDGSNDDQWLDAIENQMAELGTAIAAARAQAMRLIAA
                     MIERLPAEGPFPKADCFLEGALESRIGVEAALDLEEDFRRTLRDGRARDRAAGRTLDG
                     PHRTDLIVQHRPKSMPAALCSTGEQKALLIGLILAHARLTAELSGMAPILLLDEIAAH
                     LDMGRRAALFGILDELGGQAFMTGTDRALFDALAGDAQFFNVSAGQLTGI"
     misc_feature    3917..5023
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    3923..5023
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="ATP-binding cassette domain of RecF; Region:
                     ABC_RecF; cd03242"
                     /db_xref="CDD:213209"
     misc_feature    4004..4027
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213209"
     misc_feature    order(4013..4018,4022..4030,4232..4234,4862..4867,
                     4952..4954)
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213209"
     misc_feature    4223..4234
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213209"
     misc_feature    4763..4792
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213209"
     misc_feature    4850..4867
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213209"
     misc_feature    4874..4885
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213209"
     misc_feature    4940..4960
                     /gene="recF"
                     /locus_tag="BSVBI22_A0003"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213209"
     gene            5070..5852
                     /gene="moeB"
                     /locus_tag="BSVBI22_A0004"
                     /db_xref="GeneID:11729483"
     CDS             5070..5852
                     /gene="moeB"
                     /locus_tag="BSVBI22_A0004"
                     /note="ATP-dependent adenylate transferase, transfers
                     adenyl moiety to the MoeD subunit of molybdopterin
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoeB"
                     /protein_id="YP_005153714.1"
                     /db_xref="GI:376279708"
                     /db_xref="GeneID:11729483"
                     /translation="MFAGMNASSRPFSPEELERYARHIVLPVIGGPGQQKLKAARVLV
                     VGAGGLGAPALQYLAAAGVGTLGIVDDDTVSLSNLQRQIIHDTDSIGQPKVESALASI
                     ARINPHVKVEGHQLRLDAHNAEALIAGFDVVVDGSDNFATRYVLADAAAKVGRPLVTG
                     AMGRFDGTVTVLMPYANGPDGAKNPSYRDLFPDAPLPGTVPSCAEAGVLGVLPGVIGS
                     LQAMEVIKLVTGIGEPLVGRLLLYNALNVRFETIRYKARKPK"
     misc_feature    5100..5843
                     /gene="moeB"
                     /locus_tag="BSVBI22_A0004"
                     /note="molybdopterin biosynthesis protein MoeB;
                     Provisional; Region: PRK05690"
                     /db_xref="CDD:180204"
     misc_feature    5124..5828
                     /gene="moeB"
                     /locus_tag="BSVBI22_A0004"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    order(5205..5207,5211..5213,5217..5219,5277..5279,
                     5283..5285,5310..5312,5349..5351,5475..5477,5493..5495)
                     /gene="moeB"
                     /locus_tag="BSVBI22_A0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    order(5217..5219,5478..5486,5496..5498,5550..5555,
                     5565..5567,5571..5573,5784..5786,5796..5798,5817..5819,
                     5823..5828)
                     /gene="moeB"
                     /locus_tag="BSVBI22_A0004"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
     gene            complement(5869..6825)
                     /locus_tag="BSVBI22_A0005"
                     /db_xref="GeneID:11729485"
     CDS             complement(5869..6825)
                     /locus_tag="BSVBI22_A0005"
                     /note="identified by similarity to EGAD:90750; match to
                     protein family HMM PF02826"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase
                     family protein"
                     /protein_id="YP_005153715.1"
                     /db_xref="GI:376279709"
                     /db_xref="GeneID:11729485"
                     /translation="MSDTKGNILLATTDWDPEIWLKTFKESASNRKVVTERAENDPSI
                     EYALVWKQKPGSLANLPNLKVIFSLGAGVDHVFRDPQVPDVPLVRIISDDLTMRMTEY
                     VVWQVLDHHRLGSRYRKQQQNHVWHEDRRQPAAHEVTVGIMGLGVLGRDAAEKLKILG
                     FNITGWSRRPQKIDGVKTYHGGDGFTEFLKTADIFVCLLPLTPDTKGILSMSMFAQLK
                     SDGPLGEPVLINAGRGSLQNEPDILAALDRGLLSAVTLDVFNQEPLPANSPLWDHPKV
                     TITPHVAAISSATVLVPQIIRQIEAFERDGTLEHVVDRSTQY"
     misc_feature    complement(5872..6804)
                     /locus_tag="BSVBI22_A0005"
                     /note="Phosphoglycerate dehydrogenase and related
                     dehydrogenases [Amino acid transport and metabolism];
                     Region: SerA; COG0111"
                     /db_xref="CDD:223189"
     misc_feature    complement(5881..6804)
                     /locus_tag="BSVBI22_A0005"
                     /note="Putative glycerate dehydrogenase and related
                     proteins of the D-specific 2-hydroxy dehydrogenase family;
                     Region: GDH_like_2; cd12164"
                     /db_xref="CDD:240641"
     misc_feature    complement(order(5983..5985,6127..6129,6541..6543,
                     6610..6618,6673..6675))
                     /locus_tag="BSVBI22_A0005"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240641"
     misc_feature    complement(order(5974..5979,5983..5985,6052..6057,
                     6127..6135,6211..6216,6226..6234,6313..6315,6319..6330,
                     6382..6396,6529..6531,6541..6543,6559..6561,6610..6615))
                     /locus_tag="BSVBI22_A0005"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240641"
     misc_feature    complement(order(5965..5967,5977..5982,5986..5994,
                     5998..6000,6007..6009,6013..6018,6028..6030,6034..6042,
                     6049..6051,6061..6063,6349..6351,6421..6423,6430..6432,
                     6442..6444,6448..6453,6463..6468,6472..6477,6484..6486,
                     6490..6492,6499..6504,6511..6516,6520..6528,6532..6534))
                     /locus_tag="BSVBI22_A0005"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240641"
     misc_feature    complement(order(5983..5985,6040..6042,6127..6129))
                     /locus_tag="BSVBI22_A0005"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240641"
     gene            complement(6822..8447)
                     /locus_tag="BSVBI22_A0006"
                     /db_xref="GeneID:11729487"
     CDS             complement(6822..8447)
                     /locus_tag="BSVBI22_A0006"
                     /note="identified by similarity to SP:P33916; match to
                     protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_005153716.1"
                     /db_xref="GI:376279710"
                     /db_xref="GeneID:11729487"
                     /translation="MNNVLLSVRDLSVAFHQDGEDRIAVNRISFDIAEGETVALVGES
                     GSGKSVSALSVLKLLPYPAASHPSGEILFNGTDLMRASEPELRRVRGNDITMIFQEPM
                     TSLNPLHTIERQVSEILRVHQGMGEQAARARTLQLLHEVGIREPEKRLNAFPHQLSGG
                     QRQRVMIAMALANKPKLLIADEPTTALDVTVQAQILNLLAELKAAQGMSMLFITHDLG
                     IVRKIADKVCVMNKGEIVEAGRTRDIFDNPQHPYTKHLLAAEPKGEPPLADPTAKVVM
                     EGKDIRVWFPIKKGFMRRTVDHVKAVDGINVNLRAGQTLGVVGESGSGKTTLGLALSR
                     MISSRGEIRFEGRDIARFSFKDMRPLRREMQIVFQDPFGSLSPRMTIADIIAEGLLVH
                     EPRLSADDRDARVIAALNEVNLDPETRFRYPHEFSGGQRQRIAIARAMVLNPKFVMLD
                     EPTSALDMSVQAQVVDLLRALQKKHDLAYLFISHDLKVVRALANDVLVMRNGKMVEYG
                     PAKDIFANPQTDYTKALMAAAFHMETREGGIKQ"
     misc_feature    complement(6849..8447)
                     /locus_tag="BSVBI22_A0006"
                     /note="ABC-type uncharacterized transport system,
                     duplicated ATPase component [General function prediction
                     only]; Region: COG4172"
                     /db_xref="CDD:226641"
     misc_feature    complement(7731..8435)
                     /locus_tag="BSVBI22_A0006"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(8301..8324)
                     /locus_tag="BSVBI22_A0006"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(7803..7805,7902..7907,8151..8153,
                     8298..8306,8310..8315))
                     /locus_tag="BSVBI22_A0006"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(8151..8162)
                     /locus_tag="BSVBI22_A0006"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(7950..7979)
                     /locus_tag="BSVBI22_A0006"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(7902..7919)
                     /locus_tag="BSVBI22_A0006"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(7884..7895)
                     /locus_tag="BSVBI22_A0006"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(7797..7817)
                     /locus_tag="BSVBI22_A0006"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<7629..7742)
                     /locus_tag="BSVBI22_A0006"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     misc_feature    complement(6924..7625)
                     /locus_tag="BSVBI22_A0006"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(7470..7493)
                     /locus_tag="BSVBI22_A0006"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(6996..6998,7095..7100,7341..7343,
                     7467..7475,7479..7484))
                     /locus_tag="BSVBI22_A0006"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(7341..7352)
                     /locus_tag="BSVBI22_A0006"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(7143..7172)
                     /locus_tag="BSVBI22_A0006"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(7095..7112)
                     /locus_tag="BSVBI22_A0006"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(7077..7088)
                     /locus_tag="BSVBI22_A0006"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(6990..7010)
                     /locus_tag="BSVBI22_A0006"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<6843..6935)
                     /locus_tag="BSVBI22_A0006"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(8471..9610)
                     /locus_tag="BSVBI22_A0007"
                     /db_xref="GeneID:11727350"
     CDS             complement(8471..9610)
                     /locus_tag="BSVBI22_A0007"
                     /note="identified by similarity to GP:17983985; match to
                     protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005153717.1"
                     /db_xref="GI:376279711"
                     /db_xref="GeneID:11727350"
                     /translation="MTDTALTPAAKPVKRPWLSPLNKRRWQNFKAHRRGYWSLWIFLF
                     LLAAALCSEFIANDRPILVSYKGELLMPVFVDYPEDKFGGFYAITDYRDPVIQDEINA
                     HGWAIWPPVRYSYNTVNNEIPEAAPSKPFWLYSPQVRCQRYPLGINDPNCRFGNFNLL
                     GTDDQARDVFARALYGFRISVLFGLILTFFSAIIGVTAGAVQGYFGGWVDLLFQRFIE
                     IWSSIPVLYLLLIIAAILPPGFWVLLGIMLLFSWVAFVGVVRAEFLRARNFEYVNAAR
                     ALGVKNGTIMWRHLLPNAMVATLTFLPFILNGSITTLTSLDFLGFGLPPGSASLGELL
                     AQGKNNLQAPWLGITGFVVISAMLSLLIFIGEATRDAFDPRKAFL"
     misc_feature    complement(8477..9568)
                     /locus_tag="BSVBI22_A0007"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG4239"
                     /db_xref="CDD:226690"
     misc_feature    complement(8528..9082)
                     /locus_tag="BSVBI22_A0007"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(8528..8533,8540..8545,8552..8557,
                     8561..8566,8573..8578,8606..8611,8657..8662,8669..8680,
                     8699..8701,8708..8713,8753..8755,8804..8806,8813..8818,
                     8828..8830,8834..8839,8846..8848,8852..8854,8858..8863,
                     8912..8914,8918..8923,8930..8959,8963..8974,9002..9004,
                     9017..9022,9029..9034))
                     /locus_tag="BSVBI22_A0007"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(8663..8680,8912..8956))
                     /locus_tag="BSVBI22_A0007"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(8576..8578,8606..8608,8615..8617,
                     8660..8662,8876..8878,8912..8914))
                     /locus_tag="BSVBI22_A0007"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(8732..8734,8744..8749,8765..8803))
                     /locus_tag="BSVBI22_A0007"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(9610..10707)
                     /locus_tag="BSVBI22_A0008"
                     /db_xref="GeneID:11727394"
     CDS             complement(9610..10707)
                     /locus_tag="BSVBI22_A0008"
                     /note="identified by similarity to SP:P33914; match to
                     protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005153718.1"
                     /db_xref="GI:376279712"
                     /db_xref="GeneID:11727394"
                     /translation="MGAYILRRLLLMIPTLLGIMAISFAVVQFAPGGPVERVIAQLSG
                     QGGDALDRLSGAGSDFGQSAIDSGSVSSKYRGAQGLDPQFIADLEKQFGFDKPPLERF
                     GQMLWNYMRFDFGRSYFRDISVIDLIKEKMPVSISLGLWLTFLSYMISIPLGIRKAIK
                     DGSRFDTWTSAVIIIGYAIPSFLFAILLIVVFAGGSFFDWFPLRGLTSPDFAQMTWFE
                     KIKDYLWHMVLPVTALVLSAFATTTLLTKNSFLEEIRKQYVTTARAKGLTENQVLYRH
                     VFRNAMLIVIAGFPGAFISAFFTGSLLIETIFSLDGLGLLGYQSVINRDYPVVFANLF
                     IFSLIGLLVGLLSDLTYTWIDPRIDFDRRDV"
     misc_feature    complement(9616..10707)
                     /locus_tag="BSVBI22_A0008"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG4174"
                     /db_xref="CDD:226642"
     misc_feature    complement(9673..10314)
                     /locus_tag="BSVBI22_A0008"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(9673..9678,9685..9690,9697..9702,
                     9706..9711,9718..9723,9751..9756,9790..9795,9802..9813,
                     9835..9837,9844..9849,9889..9891,9940..9942,9949..9954,
                     9964..9966,9970..9975,9982..9984,9988..9990,9994..9999,
                     10141..10143,10147..10152,10159..10188,10192..10203,
                     10234..10236,10249..10254,10261..10266))
                     /locus_tag="BSVBI22_A0008"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(9796..9813,10141..10185))
                     /locus_tag="BSVBI22_A0008"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(9721..9723,9751..9753,9760..9762,
                     9793..9795,10012..10014,10141..10143))
                     /locus_tag="BSVBI22_A0008"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(9868..9870,9880..9885,9901..9939))
                     /locus_tag="BSVBI22_A0008"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(10819..12633)
                     /locus_tag="BSVBI22_A0009"
                     /db_xref="GeneID:11729465"
     CDS             complement(10819..12633)
                     /locus_tag="BSVBI22_A0009"
                     /note="identified by similarity to SP:P33913; match to
                     protein family HMM PF00496"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter periplasmic substrate-binding
                     protein"
                     /protein_id="YP_005153719.1"
                     /db_xref="GI:376279713"
                     /db_xref="GeneID:11729465"
                     /translation="MGLSGSAALVACLPGQAFADQPTGKALHGLSAFGDLKYGPDFSH
                     FDYANPDAPKGGCFTLAPSGWIWNQNTLTFNTLNTLTLKGDAPPRMELTFDSLMVSAL
                     DEPDSVYGLIAESVTLSKDRKTCTFKLRKEARFHDGSPIEASDVAFTYKTFKEKGHPT
                     LRQSLAGLQKVEATAKHEVQMHFAAGRGPNAILDAVTLPIISEKWFKGRNFEATSMEP
                     VLGSGAYKVGNFSAGHFIEYDRVEDYWAKDLPVQKGSNHFDRIRIEFFHDRQPAFEAF
                     KKGSIDFREENVAKNWATAYDFPAIHQKKVIRRTFPREKRPLMQAWAVNQRRERFRDP
                     RVREAIGLCFDFEWSNKNLFYEAYTRSQSCFNGSDFQANGLPSPDEMKILARYRGKLP
                     EAVFGEAVLVPVSDGTGRDRKQFTQAIKLMEEAGFERRHGHFHDHDGSNFALEILCNS
                     EAVTRIYNPFAQKLRAIGIDTSLRLVDASQYQARLQDFQFDMVGVALQFSATPTKESL
                     AGIFGSDSARIPGSHNLPGTNDPLIDALIEDAGKAESREELVATLRVLDRYLRIRRDW
                     IPNWTAANHFVAYWDRFGFKEPKPDYGFPVETLWWIKA"
     misc_feature    complement(10822..12630)
                     /locus_tag="BSVBI22_A0009"
                     /note="ABC-type oligopeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     OppA; COG4166"
                     /db_xref="CDD:226636"
     misc_feature    complement(10879..12513)
                     /locus_tag="BSVBI22_A0009"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_14; cd08497"
                     /db_xref="CDD:173862"
     gene            complement(12680..14548)
                     /locus_tag="BSVBI22_A0010"
                     /db_xref="GeneID:11728830"
     CDS             complement(12680..14548)
                     /locus_tag="BSVBI22_A0010"
                     /note="identified by match to protein family HMM PF00496"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter periplasmic substrate-binding
                     protein"
                     /protein_id="YP_005153720.1"
                     /db_xref="GI:376279714"
                     /db_xref="GeneID:11728830"
                     /translation="MKAFWVSAFAVAMLASAMPASRADNAEPQWRYSSSLLDEPKYPA
                     DFKHYDYVNPDAPKGGTLNLVAVGTFDNLNPYVVQGVSAAGLSDFGGGMLYDTLMADS
                     QDQGSTQYPLIASALQYPDDFSWVKFKLNPDAKWHDGQPITVDDVIWSFNVLKKQSPM
                     YNKYYSDVESAEKTGEHEVKFTFSRKGNRELPQIMGQLAILPKHWWTAKDARGKQRDI
                     TRPTLEIPLGSSAYKIESMKPGHSIIWARVEDYWGKDLPVNVGRNNFDHVAYEYYFNE
                     DATWEAFKKGGQYDYRNENRAQRWAEQYNFPAVQRGDVVKASFPFHAVGRMQGYFLNT
                     RRDKFKDPKVREALTYAFDFESMNRLMFYNQYKRINSYFAGNELALSGPPTPAEQAIL
                     ETVKDALPADALTKEFKLPVYDTPQATRENLRTALKLFSQAGWTLKGNTLVDAKGNPF
                     TIEFLGQDPTDERIYNPFAASLRKIGINATVRIVDAAQYQARVNDFDYDVITAVIAQT
                     ASPGNEQRDMWGSKAADFKGSRNYAGIRNPAIDKLIDLVVYAKDHEELEAAAHALDRA
                     LLWNHYVIPQWYSDHINVAYWNKFGMPEKQPDYLGIDPYSWWIDPAKEAKLKTGGA"
     misc_feature    complement(12704..14548)
                     /locus_tag="BSVBI22_A0010"
                     /note="ABC-type oligopeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     OppA; COG4166"
                     /db_xref="CDD:226636"
     misc_feature    complement(12770..14416)
                     /locus_tag="BSVBI22_A0010"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_14; cd08497"
                     /db_xref="CDD:173862"
     gene            complement(14779..15102)
                     /locus_tag="BSVBI22_A0011"
                     /db_xref="GeneID:11728831"
     CDS             complement(14779..15102)
                     /locus_tag="BSVBI22_A0011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153721.1"
                     /db_xref="GI:376279715"
                     /db_xref="GeneID:11728831"
                     /translation="MLESLRQSPKGGATETVSASTILLLLRSSGQFGATELFGICHIS
                     EMQRSYLGQQIGIYSRFHLEFSLEGSDHGCTGATRVKAEGRVAPRPFSFSERASFTAG
                     IFSPA"
     gene            complement(15148..15348)
                     /locus_tag="BSVBI22_A0012"
                     /db_xref="GeneID:11728832"
     CDS             complement(15148..15348)
                     /locus_tag="BSVBI22_A0012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153722.1"
                     /db_xref="GI:376279716"
                     /db_xref="GeneID:11728832"
                     /translation="MQRYRFDDKRILTEAIVELLNQGIELEDLDLVLSRIGPVDLDLM
                     QECLIEVWNYNHPELAATQMAA"
     gene            complement(15388..15738)
                     /locus_tag="BSVBI22_A0013"
                     /db_xref="GeneID:11728833"
     CDS             complement(15388..15738)
                     /locus_tag="BSVBI22_A0013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153723.1"
                     /db_xref="GI:376279717"
                     /db_xref="GeneID:11728833"
                     /translation="MFLRIIRRIEARPEISPLDWLLHVGASYFFWKCSKKQDYEINSL
                     ENFRLDSRKNTIITWMILYMMKSRILLLLHKYFTFILGALPKMFNLDFSYFQMVRAKP
                     HRLSRLKLRLTMID"
     gene            complement(16003..17109)
                     /locus_tag="BSVBI22_A0014"
                     /db_xref="GeneID:11728834"
     CDS             complement(16003..17109)
                     /locus_tag="BSVBI22_A0014"
                     /note="identified by similarity to SP:P02917; match to
                     protein family HMM PF01094"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="YP_005153724.1"
                     /db_xref="GI:376279718"
                     /db_xref="GeneID:11728834"
                     /translation="MNLKLLSSLAFAATIGFASAAYADITIGVIAPLTGPVAAFGDQV
                     KKGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGPVTTG
                     VAVPVSDVLSENGVLMVTPTATGPDLTARGLENVFRTCGRDDQQAEVMADYVLKNMKD
                     KKVAVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGAEV
                     VYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATK
                     NPAAKDAIQALKAKNIPAEAFTMNAYAAVEVIKAGIERAGSTDDSAAVAKALHDGKPI
                     ETAIGTLTYSETGDLSSPSFDIFKWDDGKIVGLE"
     misc_feature    complement(16033..17034)
                     /locus_tag="BSVBI22_A0014"
                     /note="Type I periplasmic ligand-binding domain of ABC
                     (Atpase Binding Cassette)-type active transport systems
                     that are involved in the transport of all three branched
                     chain aliphatic amino acids (leucine, isoleucine and
                     valine); Region: PBP1_ABC_LIVBP_like; cd06342"
                     /db_xref="CDD:107337"
     misc_feature    complement(order(16237..16239,16327..16332,16339..16341,
                     16348..16350,16411..16413,16963..16965,16972..16974,
                     16984..16986,17011..17013))
                     /locus_tag="BSVBI22_A0014"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107337"
     misc_feature    complement(16030..16983)
                     /locus_tag="BSVBI22_A0014"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     misc_feature    complement(order(16366..16368,16438..16440,16594..16596,
                     16741..16746,16807..16815))
                     /locus_tag="BSVBI22_A0014"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107337"
     gene            17381..17581
                     /locus_tag="BSVBI22_A0015"
                     /db_xref="GeneID:11728835"
     CDS             17381..17581
                     /locus_tag="BSVBI22_A0015"
                     /note="identified by similarity to OMNI:NTL02ML1891"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153725.1"
                     /db_xref="GI:376279719"
                     /db_xref="GeneID:11728835"
                     /translation="MQAPSTRNYNENRLLPKSESLFQKPPCRSANGAFQRSGAHVRSV
                     HSAPVLENHHFRLGLPLFDSDS"
     gene            complement(17578..18372)
                     /locus_tag="BSVBI22_A0016"
                     /db_xref="GeneID:11728836"
     CDS             complement(17578..18372)
                     /locus_tag="BSVBI22_A0016"
                     /note="Catalyzes the reversible hydration of unsaturated
                     fatty acyl-CoA to beta-hydroxyacyl-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_005153726.1"
                     /db_xref="GI:376279720"
                     /db_xref="GeneID:11728836"
                     /translation="MNDFETLHIAVDQRGVARLTLNRPEQHNALSGRMIDELTTAALH
                     LADNEAVRIVILTGAGTSFCAGGDLGWMREQVNATRAQRIEEARKLALMLKALRDLPK
                     PLIGRINGQAYGGGVGLISVCDAAISISGARFGLTETKLGLIPATISPYVVARIGEAN
                     ALRTFTSARLFDAEEGRRIGLLHDVVEAERLDAAVEAEIKPYFSTAPAAVAASKRLVH
                     ALGAPIDEAVIDMTLTRLADTWETPEAAEGIAAFFAKRAPAWKGGD"
     misc_feature    complement(17584..18369)
                     /locus_tag="BSVBI22_A0016"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK07468"
                     /db_xref="CDD:180987"
     misc_feature    complement(17773..18330)
                     /locus_tag="BSVBI22_A0016"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(17950..17952,17959..17964,18028..18036,
                     18040..18042,18166..18180,18190..18192,18286..18288,
                     18292..18294))
                     /locus_tag="BSVBI22_A0016"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(18028..18030,18172..18174))
                     /locus_tag="BSVBI22_A0016"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(17779..17781,17824..17826,17833..17835,
                     17866..17868,17875..17880,17884..17889,17893..17898,
                     17911..17916,17920..17928,17932..17934,17947..17958,
                     17992..18003,18064..18066,18088..18090))
                     /locus_tag="BSVBI22_A0016"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            complement(18369..19231)
                     /gene="mvaB"
                     /locus_tag="BSVBI22_A0017"
                     /note="3-hydroxy-3-methylglutarate-CoA lyase, authentic
                     frameshift; this gene contains a frame shift which is not
                     the result of sequencing error;identified by similarity to
                     EGAD:19426"
                     /pseudo
                     /db_xref="GeneID:11728837"
     gene            complement(19224..21245)
                     /locus_tag="BSVBI22_A0018"
                     /db_xref="GeneID:11728838"
     CDS             complement(19224..21245)
                     /locus_tag="BSVBI22_A0018"
                     /note="identified by match to protein family HMM PF00289;
                     match to protein family HMM PF00364; match to protein
                     family HMM PF02785; match to protein family HMM PF02786"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin carboxylase"
                     /protein_id="YP_005153727.1"
                     /db_xref="GI:376279721"
                     /db_xref="GeneID:11728838"
                     /translation="MRKSVKRFSARIPRGKNAMFQKILIANRGEIACRVIRTARKLGI
                     ATVAIYSDADARALHVEMADEAVRVGPAASAQSYLNVDAIIKAAKETGAEAIHPGYGF
                     LSENPAFVDAVEEAGLIFIGPSAKAIRAMGLKDAAKALMEKAGVPVVPGYHGDNQDGA
                     FLKSEADRITYPVLIKARAGGGGKGMRRVDSAADFAAALESARREAEASFGDGAVLVE
                     KYMAKPRHIEVQVFGDNHGNAVHLFERDCSLQRRHQKVIEEAPAPGMTEEMRAAMGEA
                     AVKAALTIGYSGAGTVEFIADVSEGLRPDRFFFMEMNTRLQVEHPVTEAITGRDLVEW
                     QLRVASGEALPKRQDELSINGWAFEARLYAEDPARDFLPATGKLALFVPPENARVDSG
                     VRTGDTITPFYDPMIAKIITHGATRDEALNRLDAALNKTRIAGLVTNRQFLSALCNLE
                     AFRTGDVDTGLIGRETAALFTDAQPSDIAFALAALGALDLLDAPEKSDPWSGLRGFRL
                     WGEASRSVLIEHHGERRTVSFTARGDRHFGFAFGTMDIRAHKNGLVRFAIDGRVSEAS
                     VSRIGHDVTVQIEGHDTIFHHVLATGAEEDASSESRILSPMPGLVRLVSVVEGASVAK
                     GDPLVTMEAMKMELSLTAPRDGKVASVTVAAGDQVNEGALLVELEEQHG"
     misc_feature    complement(19236..21191)
                     /locus_tag="BSVBI22_A0018"
                     /note="Acetyl/propionyl-CoA carboxylase, alpha subunit
                     [Lipid metabolism]; Region: COG4770"
                     /db_xref="CDD:227111"
     misc_feature    complement(20865..21188)
                     /locus_tag="BSVBI22_A0018"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(20211..20846)
                     /locus_tag="BSVBI22_A0018"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    complement(19860..20171)
                     /locus_tag="BSVBI22_A0018"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; pfam02785"
                     /db_xref="CDD:251532"
     misc_feature    complement(19242..19439)
                     /locus_tag="BSVBI22_A0018"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(19317..19319,19338..19346,19371..19373))
                     /locus_tag="BSVBI22_A0018"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(19341..19343)
                     /locus_tag="BSVBI22_A0018"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            complement(21257..22864)
                     /locus_tag="BSVBI22_A0019"
                     /db_xref="GeneID:11728839"
     CDS             complement(21257..22864)
                     /locus_tag="BSVBI22_A0019"
                     /note="identified by match to protein family HMM PF01039"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyl transferase family protein"
                     /protein_id="YP_005153728.1"
                     /db_xref="GI:376279722"
                     /db_xref="GeneID:11728839"
                     /translation="MPVLKSEISTRSASFEANRKAMLAAIDVVAEASRIAIDGGGEKA
                     RDRHVSRGKLLPRERVAQLLDPGSPFLELGLTAAHGTYGGAAPAAGIITGIGRVSGRE
                     CMIVCNDATVKGGTYYPMTVKKHLRAQEIAGENRLPCIYLVDSGGANLPNQDEVFPDR
                     DHFGRIFYNQAQMSAAGIPQVAVVMGSCTAGGAYVPAMSDETVIVRGQGTIFLAGPPL
                     VKAATGEVVSAEDLGGGDVHTRLSGVADHLANDDAHALQIARAIAANLASEKRSFIPR
                     GDGAAPLYDPEELLGVVSADTRIPYDVREVIARLVDGSDFDEFKARYGTTLVCGFASV
                     YGMPVGIIANNGVLFSEAALKGAHFIELCCQRNIPLVFLQNITGFMVGRKYEAEGIAK
                     HGAKLVTAVATANVPKITMLIGASYGAGNYGMAGRAYSPRFLWTWPNSRIAVMGGEQA
                     AGVLATVKRDGIERTGGTWSAEEEAEFKRPTLEMFERQSHPLYASARLWDDGIVDPRK
                     SREVLGLPLSATLNAPVEPTRFGIFRM"
     misc_feature    complement(21260..22858)
                     /locus_tag="BSVBI22_A0019"
                     /note="3-methylcrotonyl-CoA carboxylase, beta chain;
                     Region: PLN02820"
                     /db_xref="CDD:178415"
     misc_feature    complement(21935..22696)
                     /locus_tag="BSVBI22_A0019"
                     /note="malonate decarboxylase subunit beta; Reviewed;
                     Region: PRK07189; cl17682"
                     /db_xref="CDD:248236"
     gene            complement(22864..24012)
                     /gene="ivd"
                     /locus_tag="BSVBI22_A0020"
                     /db_xref="GeneID:11728840"
     CDS             complement(22864..24012)
                     /gene="ivd"
                     /locus_tag="BSVBI22_A0020"
                     /note="identified by match to protein family HMM PF00441;
                     match to protein family HMM PF02770; match to protein
                     family HMM PF02771"
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl-CoA dehydrogenase"
                     /protein_id="YP_005153729.1"
                     /db_xref="GI:376279723"
                     /db_xref="GeneID:11728840"
                     /translation="MNFGLGEEIEALRDTVRRFAESRIAPLAAETDRNNQFPMHLWRE
                     FGELGVLGITAPEDYGGAGMGYLAHCIAMEEISRASASIGLSYGAHSNLCVNQITRNG
                     SPEQRAKYLPKLISGEHVGALAMSEPGAGSDVVSMKLAAEKRGDRYVLNGNKMWITNG
                     PDADVLVVYAKTDLSAGPRGISAFIIEKGFKGFSTAQKLDKLGMRGSNTCELVFEDCE
                     VPAENLLGTEGKGVNVLMSGLDYERVVLAGGPLGIMAACLDVVVPYVHERKQFDQPIG
                     EFQLMQCKLADMYVTFNASRAYVYAVAAACDRGETTRKDAAGCILYSAENATQMALQA
                     IQSLGGNGYINDYPTGRLLRDAKLYEIGAGTSEIRRMLIGRELFQETR"
     misc_feature    complement(22876..24003)
                     /gene="ivd"
                     /locus_tag="BSVBI22_A0020"
                     /note="Isovaleryl-CoA dehydrogenase; Region: IVD; cd01156"
                     /db_xref="CDD:173845"
     misc_feature    complement(22873..23994)
                     /gene="ivd"
                     /locus_tag="BSVBI22_A0020"
                     /note="isovaleryl-CoA dehydrogenase; Region: PLN02519"
                     /db_xref="CDD:215284"
     misc_feature    complement(order(22921..22929,22936..22941,23275..23277,
                     23284..23286,23293..23295,23314..23316,23476..23478,
                     23539..23541,23617..23619,23734..23736,23746..23748,
                     23758..23760))
                     /gene="ivd"
                     /locus_tag="BSVBI22_A0020"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173845"
     misc_feature    complement(order(22912..22914,22918..22920,23539..23541,
                     23545..23547,23617..23622,23635..23640,23644..23646))
                     /gene="ivd"
                     /locus_tag="BSVBI22_A0020"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:173845"
     misc_feature    complement(23287..23289)
                     /gene="ivd"
                     /locus_tag="BSVBI22_A0020"
                     /note="catalytic base [active]"
                     /db_xref="CDD:173845"
     gene            complement(24189..26177)
                     /locus_tag="BSVBI22_A0021"
                     /db_xref="GeneID:11728841"
     CDS             complement(24189..26177)
                     /locus_tag="BSVBI22_A0021"
                     /note="AcsA; in Sinorhizobium meliloti this enzyme is
                     required for acetoacetate activation; similar to
                     acetyl-CoA synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoacetyl-CoA synthetase"
                     /protein_id="YP_005153730.1"
                     /db_xref="GI:376279724"
                     /db_xref="GeneID:11728841"
                     /translation="MSTEAISRQSSHDNPLWQPDGARIAASNLEQFRIRAERHTGLSL
                     PDYAALHRWSVEDRAGFWQLVWDFCSVIGERGNTALTDRGHMRAAKFFPEARLNFAEN
                     LLRHKGDGEAIVFRGENKVERRLTWNDLHALVSKLQQFMLSEGVQPGDRVAGMMPNMP
                     EAVALMLAASSIGAVWSSCSPDFGVQGVLDRFGQIEPKLFFACDGYWYNGKRIAVADK
                     VAEVTAKLPGLKRAVIVTYLGEAEAVADKAEKGIALYAALEPFKAKPVEFTQLPFDHP
                     LYILFSSGTTGIPKCIVHRAGGVLLQHLKEHRLHADLRDGDRFFYFTTCGWMMWNWLA
                     SGIASGATLMLYDGSPFYPDGNVLFDYAAAEGMTYFGTSAKFIDAVLKAGLKPGETHD
                     LSALRTISSTGSPLSPEGFAFVYDAIKKDVHLASISGGTDIVSCFVLGVPTEPVWQGE
                     IQGAGLGMAVDVWNDDGKPVRGEKGELVCTKAFPSMPLQFWNDAQGEKYQAAYFERFD
                     NIWCHGDFAEWTEHGGIVIHGRSDATLNPGGVRIGTAEIYNQVEQMPEIAEALCIGQD
                     WDRDVRVVLFVRLAEGVVLDDDLKARIRTKIRTGATPRHVPAKIIAVRDIPRTKSGKI
                     VELAVRDIVHGREVKNREALANPEALEFYRDIAELQQD"
     misc_feature    complement(24192..26135)
                     /locus_tag="BSVBI22_A0021"
                     /note="acetoacetyl-CoA synthetase; Provisional; Region:
                     PRK03584"
                     /db_xref="CDD:235134"
     misc_feature    complement(24219..26060)
                     /locus_tag="BSVBI22_A0021"
                     /note="Acetoacetyl-CoA synthetase (acetoacetate-CoA
                     ligase, AACS); Region: AACS; cd05943"
                     /db_xref="CDD:213308"
     misc_feature    complement(order(25308..25313,25317..25334,25341..25343))
                     /locus_tag="BSVBI22_A0021"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213308"
     misc_feature    complement(order(24309..24311,24555..24557,24588..24590,
                     24597..24599,24633..24635,24885..24902,24969..24974,
                     25332..25334))
                     /locus_tag="BSVBI22_A0021"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213308"
     misc_feature    complement(order(24366..24368,24555..24566,24588..24590,
                     24597..24599,24633..24635,24885..24902,24969..24974,
                     25050..25052,25059..25064,25068..25070,25206..25211,
                     25332..25334))
                     /locus_tag="BSVBI22_A0021"
                     /note="putative active site [active]"
                     /db_xref="CDD:213308"
     misc_feature    complement(order(24366..24368,24384..24386,24558..24566,
                     24972..24974,25050..25052,25059..25064,25209..25211))
                     /locus_tag="BSVBI22_A0021"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213308"
     gene            complement(26362..26796)
                     /locus_tag="BSVBI22_A0022"
                     /db_xref="GeneID:11728842"
     CDS             complement(26362..26796)
                     /locus_tag="BSVBI22_A0022"
                     /note="identified by similarity to OMNI:NTL02ML1269"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153731.1"
                     /db_xref="GI:376279725"
                     /db_xref="GeneID:11728842"
                     /translation="MKYRFILLLGIASVFTMPAMAEVLHFKAELTPQAEVPAVHNSRG
                     KGSVEVHFDTRTRRLVWQSEQSGLSGPATMAHFHGPADPTKNANVQIPVSAGQLGHKG
                     RGDVKLTNEQAKQLMDGLWYFNYHTKAHPGGEIRGQVLRVKQ"
     misc_feature    complement(26374..26724)
                     /locus_tag="BSVBI22_A0022"
                     /note="A domain in the BMP inhibitor chordin and in
                     microbial proteins; Region: CHRD; smart00754"
                     /db_xref="CDD:214804"
     gene            complement(26973..28094)
                     /locus_tag="BSVBI22_A0023"
                     /db_xref="GeneID:11728843"
     CDS             complement(26973..28094)
                     /locus_tag="BSVBI22_A0023"
                     /note="identified by similarity to OMNI:CC1521; match to
                     protein family HMM PF01757"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153732.1"
                     /db_xref="GI:376279726"
                     /db_xref="GeneID:11728843"
                     /translation="MKRLPDFDGLRFVLCLGIACFHYSFRIPVKNEALQGFILTFAYF
                     TDVFFIVSGLFLARRRNYIWDARHYVAFVGKRLARIYPLHVAAFSCYALLSILTAKGL
                     LHPSTPPNMSWWDGLTQLLLIHDWGMGKTFSYNYVSWSLSALFFMYLAFPFFDLLCRR
                     LGNGVLAVVVVAALGGEYLAGLLGASTITRIQLADIGVFRTLPSFLFGMWIAHSQPTR
                     MPKWSIRAGLAICLAIFLFCHPANSTDGNGTLEGPWRLGFLYCCTYLLYAASTQNIST
                     PFRWNIFVKNARYSFTIFILHPLVALFFFKATPEQWGETTAGALMLIGAGAFASVLTA
                     IAAYHLFENPVHRWLVTRIDQWLNREEPQPAVLSHTGSA"
     misc_feature    complement(27024..28094)
                     /locus_tag="BSVBI22_A0023"
                     /note="Predicted acyltransferases [Lipid metabolism];
                     Region: COG1835"
                     /db_xref="CDD:224748"
     gene            complement(28319..28391)
                     /locus_tag="BSVBI22_At01"
                     /db_xref="GeneID:11728844"
     tRNA            complement(28319..28391)
                     /locus_tag="BSVBI22_At01"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:11728844"
     gene            complement(28617..29000)
                     /locus_tag="BSVBI22_A0024"
                     /db_xref="GeneID:11728845"
     CDS             complement(28617..29000)
                     /locus_tag="BSVBI22_A0024"
                     /note="identified by similarity to GP:15073181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153733.1"
                     /db_xref="GI:376279727"
                     /db_xref="GeneID:11728845"
                     /translation="MAKAELGTKRIDPETGKKFYDLNRDPIISPYTGISYPRSYFEAT
                     VESRAAEEEAEEEELDTALEKPEFVSLEDADDETKGSDDLPDLDDDVDLGDDDDDTFL
                     EEEEDEDDDVSGILGGGVGGDDEEG"
     misc_feature    complement(<28758..29000)
                     /locus_tag="BSVBI22_A0024"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4530"
                     /db_xref="CDD:226907"
     gene            29385..30737
                     /gene="aroA"
                     /locus_tag="BSVBI22_A0025"
                     /db_xref="GeneID:11728846"
     CDS             29385..30737
                     /gene="aroA"
                     /locus_tag="BSVBI22_A0025"
                     /note="catalyzes the formation of
                     5-O-(1-carboxyvinyl)-3-phosphoshikimate from
                     phosphoenolpyruvate and 3-phosphoshikimate in tryptophan
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="YP_005153734.1"
                     /db_xref="GI:376279728"
                     /db_xref="GeneID:11728846"
                     /translation="MSHSACPKPATARHSQALTGEIRIPGDKSISHRSFMFGGLASGK
                     TRITGLLEGEDVINTGRAMQAMGARIRKEGDVWIINGVGNGCLLQPEAPLDFGNAGTG
                     ARLTMGLVGTYDMKTSFIGDASLSKRPMGRVLNPLREMGVQVEAAEGDRMPLTLIGPR
                     TANPIAYRVPMASAQVKSAVLLAGLNTPGVTTVIEPVMTRDHTEKMLQGFGADLTVET
                     DKDGVRHIRIVGQGKLTGQTIDVPGDPSSTAFPLVAALLVEGSDVTIRNVLMNPTRTG
                     LILTLQEMGADIEIIDPRLAGGEDVADLRVRASKLKGVVVPPERAPSMIDEYPVLAIA
                     ASFAEGETVMDGLDELRVKESDRLAAVARGLEANGVDCTEGEMSLTVRGRPGGKGLGG
                     GTVATHLDHRIAMSFLVMGLASEKPVTVDDSTMIATSFPEFMGMMAGLGAKIAESGAE
                     "
     misc_feature    29409..30716
                     /gene="aroA"
                     /locus_tag="BSVBI22_A0025"
                     /note="3-phosphoshikimate 1-carboxyvinyltransferase;
                     Provisional; Region: PRK02427"
                     /db_xref="CDD:235037"
     misc_feature    29436..30704
                     /gene="aroA"
                     /locus_tag="BSVBI22_A0025"
                     /note="EPSP synthase domain. 3-phosphoshikimate
                     1-carboxyvinyltransferase
                     (5-enolpyruvylshikimate-3-phosphate synthase) (EC
                     2.5.1.19) catalyses the reaction between
                     shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP)
                     to form...; Region: EPSP_synthase; cd01556"
                     /db_xref="CDD:238797"
     misc_feature    order(29454..29465,30105..30116)
                     /gene="aroA"
                     /locus_tag="BSVBI22_A0025"
                     /note="hinge; other site"
                     /db_xref="CDD:238797"
     misc_feature    order(29466..29471,29481..29483,29676..29678,29682..29687,
                     29766..29768,29901..29909,29970..29972,29979..29981,
                     30360..30362,30429..30431,30441..30446,30453..30455,
                     30585..30590,30666..30668)
                     /gene="aroA"
                     /locus_tag="BSVBI22_A0025"
                     /note="active site"
                     /db_xref="CDD:238797"
     gene            30734..31393
                     /gene="cmk"
                     /locus_tag="BSVBI22_A0026"
                     /db_xref="GeneID:11728847"
     CDS             30734..31393
                     /gene="cmk"
                     /locus_tag="BSVBI22_A0026"
                     /note="Catalyzes the formation of (d)CDP from ATP and
                     (d)CMP"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="YP_005153735.1"
                     /db_xref="GI:376279729"
                     /db_xref="GeneID:11728847"
                     /translation="MKSFVVAPFIVAIDGPAASGKGTLARRIATHYGMPHLDTGLTYR
                     AVAKALLDKGLSLDDEALATDAALSLDLLAMDKAVLSAHAIGEAASKVAVMPAVRRAL
                     VEAQRHFANALPSSVLDGRDIGTVVCPDAAIKLFVTASPEVRARRRFDEVLARGDTAD
                     FAEILADLKKRDERDMNRTDSPLRPAEDAHLLDTSEMSIEAAFLAAKKLIDHALAQHR
                     G"
     misc_feature    30755..31381
                     /gene="cmk"
                     /locus_tag="BSVBI22_A0026"
                     /note="cytidylate kinase; Provisional; Region: cmk;
                     PRK00023"
                     /db_xref="CDD:234579"
     misc_feature    30761..31318
                     /gene="cmk"
                     /locus_tag="BSVBI22_A0026"
                     /note="Cytidine monophosphate kinase (CMPK) catalyzes the
                     reversible phosphorylation of cytidine monophosphate (CMP)
                     to produce cytidine diphosphate (CDP), using ATP as the
                     preferred phosphoryl donor; Region: CMPK; cd02020"
                     /db_xref="CDD:238978"
     misc_feature    order(31028..31030,31094..31099,31265..31267)
                     /gene="cmk"
                     /locus_tag="BSVBI22_A0026"
                     /note="CMP-binding site; other site"
                     /db_xref="CDD:238978"
     misc_feature    order(31244..31246,31256..31258)
                     /gene="cmk"
                     /locus_tag="BSVBI22_A0026"
                     /note="The sites determining sugar specificity; other
                     site"
                     /db_xref="CDD:238978"
     gene            31609..33309
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /db_xref="GeneID:11728848"
     CDS             31609..33309
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="in Escherichia coli this protein is involved in
                     binding to the leader sequence of mRNAs and is itself
                     bound to the 30S subunit; autoregulates expression via a
                     C-terminal domain; in most gram negative organisms this
                     protein is composed of 6 repeats of the S1 domain while in
                     gram positive there are 4 repeats; the S1 nucleic
                     acid-binding domain is found associated with other
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="YP_005153736.1"
                     /db_xref="GI:376279730"
                     /db_xref="GeneID:11728848"
                     /translation="MSQSNPTRADFESLLAESFAEHDLAEGYVVKGRIVAIEKDMAII
                     DAGLKVEGRVPLKEFGAKGKDGTLKPGDEVEVYVERIENALGEAVLSREKARREESWV
                     KLEQKFANGERVDGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVTPLMHVPQPF
                     EILKMDKRRGNIVVSRRTVLEESRAEQRSEIVQNLEEGQVVEGVVKNITDYGAFVDLG
                     GIDGLLHVTDMAWRRVNHPSEILTIGQTVKVQIIRINQETHRISLGMKQLESDPWDGI
                     GAKYPIGKKITGTVTNITDYGAFVEIEPGIEGLIHVSEMSWTKKNVHPGKILSTTQEV
                     EVVVLEVDPVKRRISLGLKQTLDNPWTTFAQKYPVGTVVEGEVKNKTEFGLFIGLDGD
                     VDGMVHLSDLDWNRPGEQVIEEYNKGEVVKAVVLDVDVEKERISLGIKQLSGDKVGEA
                     AASGELRKNAVVTCEVTAVTDGGLEVRLVDHDLDSFIRRSDLSRDRDEQRPERFTVGQ
                     KVDARVIAFDKKTRKLQVSIKALEIAEEKEAVAQYGSSDSGASLGDILGAALKKQEKN
                     "
     misc_feature    31609..33297
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="30S ribosomal protein S1; Reviewed; Region: rpsA;
                     PRK06299"
                     /db_xref="CDD:235775"
     misc_feature    31687..31887
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec1_hs1;
                     cd05687"
                     /db_xref="CDD:240192"
     misc_feature    order(31711..31713,31735..31737,31765..31767,31771..31773)
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240192"
     misc_feature    31939..32139
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec2_hs2;
                     cd04465"
                     /db_xref="CDD:239911"
     misc_feature    order(31963..31965,31987..31989,32014..32016,32020..32022)
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239911"
     misc_feature    32197..32400
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_ec3; cd05688"
                     /db_xref="CDD:240193"
     misc_feature    order(32224..32226,32248..32250,32275..32277,32281..32283)
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240193"
     misc_feature    32446..32661
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(32479..32481,32503..32505,32533..32535,32539..32541)
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    32716..32922
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(32740..32742,32764..32766,32794..32796,32800..32802)
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    32983..33204
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_ec6; cd05691"
                     /db_xref="CDD:240196"
     misc_feature    order(33007..33009,33031..33033,33064..33066,33070..33072)
                     /gene="rpsA"
                     /locus_tag="BSVBI22_A0027"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240196"
     gene            complement(33727..34737)
                     /locus_tag="BSVBI22_A0028"
                     /db_xref="GeneID:11728849"
     CDS             complement(33727..34737)
                     /locus_tag="BSVBI22_A0028"
                     /note="identified by similarity to GP:15155628; match to
                     protein family HMM PF03601"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153737.1"
                     /db_xref="GI:376279731"
                     /db_xref="GeneID:11728849"
                     /translation="MTYSKIQNILPGLGLSVAITAAAMVLEKIEEHYAGRAWLEALVI
                     AILLGTAVRSLARPGPRFNKGINFSAKLLLEIAVALLGASISASAVIEAGSGLIFGIA
                     AVVAVAITLSYGIGRLLKLPHRMAVLVACGNSICGNSAIAAMAPVIGAESEDVAASIA
                     FTAILGVIVVLTLPLLVPLLGLSFTQYGILAGLTVYAVPQVLAATAPVSLLSVQLGTL
                     VKLVRVLMLGPVILVFALISGNKNADVKPGFFQLVPWFIIGFLAMMALHSLHLIPEAI
                     LPAIQYASMLLTIISMAALGLGVDIRSVASAGGRVTLTAILSLIALCCISLGLIHMLG
                     VA"
     misc_feature    complement(33736..34737)
                     /locus_tag="BSVBI22_A0028"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2855"
                     /db_xref="CDD:225411"
     gene            34853..35752
                     /locus_tag="BSVBI22_A0029"
                     /db_xref="GeneID:11728850"
     CDS             34853..35752
                     /locus_tag="BSVBI22_A0029"
                     /note="identified by match to protein family HMM PF00126;
                     match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005153738.1"
                     /db_xref="GI:376279732"
                     /db_xref="GeneID:11728850"
                     /translation="MTLEQLRIFIEVAEREHLTRASEALHLTPSAVSSAIRNLEERYG
                     ATLFNRIGRRIELTGDGRMFLDEARATLARAHSAERMLSELGGGKRGFLAIHASQTIA
                     SYWLPPFLARFHAAFPLIDVRLTLGNTESVTGATQEGAADIGFVEGSVQVPSLSIAKV
                     ATDRLILVTRPDHAWSRSGKLTWDRLFEGNWILREQGSGTRSVFEDAIRASGYDPARL
                     NVALELPSNEAICSAVRSGHYVTAISELVAAPHLIAGALVKADFALPQRQFLMLMHND
                     RYKTKAIEMLSRYIMEDRVDFHY"
     misc_feature    34853..35728
                     /locus_tag="BSVBI22_A0029"
                     /note="putative DNA-binding transcriptional regulator;
                     Provisional; Region: PRK10837"
                     /db_xref="CDD:182768"
     misc_feature    34859..35038
                     /locus_tag="BSVBI22_A0029"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    35129..35722
                     /locus_tag="BSVBI22_A0029"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(35171..35176,35180..35185,35192..35194,35204..35206,
                     35210..35230,35513..35530,35546..35551,35555..35560)
                     /locus_tag="BSVBI22_A0029"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(35746..36321)
                     /locus_tag="BSVBI22_A0030"
                     /db_xref="GeneID:11728851"
     CDS             complement(35746..36321)
                     /locus_tag="BSVBI22_A0030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153739.1"
                     /db_xref="GI:376279733"
                     /db_xref="GeneID:11728851"
                     /translation="MSSSVDVAINANDTFNHIRIVNGIGVGLCFSRFLLFCAEFIQHP
                     KKHKISLIHFGWLFFSFTMVIAYWWSILNESSNSLYGPPLYIVSLLNIFCLYFIIVIL
                     TPEDIDEYGGYERYFISRRLWIFSFIILFIILNDVYEVINRNDDYYAPTYIIFNAILL
                     FIIIRIKNKYIHISLLFLLNIIYIVDLIFNQ"
     gene            complement(36357..37640)
                     /locus_tag="BSVBI22_A0031"
                     /db_xref="GeneID:11728852"
     CDS             complement(36357..37640)
                     /locus_tag="BSVBI22_A0031"
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="YP_005153740.1"
                     /db_xref="GI:376279734"
                     /db_xref="GeneID:11728852"
                     /translation="MAAGHWKHSLKIVLGLVAGLALSLAISPALSPAIAAPSKAQVES
                     QYRHWLETDIWPEAKAAGVSRAAFDQAFAGVSINWKLPDLVIPGEKPSTPKEQKQAEF
                     GAPGKYFNTKTIASVTSGGKARYGQYASLLKRIEQKYGVPGPILLAVWGRESGFGTVR
                     IPYNAFEVLGTKAFMATRKDMFRKELIAALQIASKGYIDETAMKSSWAGALGQPQFMP
                     TSYLKHAVDFDGDGKRDIWNSVPDALASIANYLKLHGWRKGRDWGFEVNVPQNVSCSL
                     EGPDQGKTIAEWARLGITRANGKPFPASEMKGEGYLLMPAGRYGPAFIVTPNFYVLKD
                     YNMSDLYALFIGHVGDRIAYGAGDFSHGWDDVGSMYRSDIGAMQKRMQAQGYDVGKPD
                     GLPGFKTRRSIGIWQAKNGSPSTCFPLSNMLNRIK"
     misc_feature    complement(36582..37508)
                     /locus_tag="BSVBI22_A0031"
                     /note="lytic murein transglycosylase; Region: MltB_2;
                     TIGR02283"
                     /db_xref="CDD:233810"
     misc_feature    complement(36591..37508)
                     /locus_tag="BSVBI22_A0031"
                     /note="Transglycosylase SLT domain; Region: SLT_2;
                     pfam13406"
                     /db_xref="CDD:257731"
     misc_feature    complement(<36849..37034)
                     /locus_tag="BSVBI22_A0031"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(order(36891..36893,36990..36992))
                     /locus_tag="BSVBI22_A0031"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     gene            complement(37656..38261)
                     /gene="recR"
                     /locus_tag="BSVBI22_A0032"
                     /db_xref="GeneID:11728853"
     CDS             complement(37656..38261)
                     /gene="recR"
                     /locus_tag="BSVBI22_A0032"
                     /note="involved in a recombinational process of DNA
                     repair, independent of the recBC complex"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="YP_005153741.1"
                     /db_xref="GI:376279735"
                     /db_xref="GeneID:11728853"
                     /translation="MSKRIAGPEIERLIQLLARVPGLGPRSARRAALHLIKKKEALLV
                     PLGGAMQEAAEKVRICSCCGNVDTSDPCTICTDERRDPATLIVVEDVSDLWALERAGT
                     MNVRYHVLGGRLSPLDGIGPDDLNIKGLVERVASGAIKEVILAVNATVEGQTTAHYIT
                     DQLSNFDVRVTRLAHGVPVGGELDYLDEGTLAAALRARTTL"
     misc_feature    complement(37659..38246)
                     /gene="recR"
                     /locus_tag="BSVBI22_A0032"
                     /note="recombination protein RecR; Reviewed; Region: recR;
                     PRK00076"
                     /db_xref="CDD:234616"
     misc_feature    complement(38019..38129)
                     /gene="recR"
                     /locus_tag="BSVBI22_A0032"
                     /note="RecR protein; Region: RecR; pfam02132"
                     /db_xref="CDD:251108"
     misc_feature    complement(37680..38012)
                     /gene="recR"
                     /locus_tag="BSVBI22_A0032"
                     /note="TOPRIM_recR: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in Escherichia coli RecR.  RecR participates in the RecFOR
                     pathway of homologous recombinational repair in
                     prokaryotes. This pathway provides a...; Region:
                     TOPRIM_recR; cd01025"
                     /db_xref="CDD:173775"
     misc_feature    complement(order(37809..37811,37815..37817,37821..37823,
                     37983..37985,37992..37997))
                     /gene="recR"
                     /locus_tag="BSVBI22_A0032"
                     /note="putative active site [active]"
                     /db_xref="CDD:173775"
     misc_feature    complement(order(37821..37823,37995..37997))
                     /gene="recR"
                     /locus_tag="BSVBI22_A0032"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173775"
     misc_feature    complement(order(37680..37688,37692..37694,37698..37700,
                     37713..37715,37719..37754,37782..37784,37818..37820,
                     37827..37829,37833..37835,37839..37841,37962..37967,
                     37971..37979))
                     /gene="recR"
                     /locus_tag="BSVBI22_A0032"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173775"
     gene            complement(38392..38715)
                     /locus_tag="BSVBI22_A0033"
                     /db_xref="GeneID:11728854"
     CDS             complement(38392..38715)
                     /locus_tag="BSVBI22_A0033"
                     /note="identified by similarity to OMNI:NTL02ML4268; match
                     to protein family HMM PF02575; match to protein family HMM
                     TIGR00103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153742.1"
                     /db_xref="GI:376279736"
                     /db_xref="GeneID:11728854"
                     /translation="MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLS
                     GKGTLSALKIDPSLMKEDEVEILEDLIIAAHNDAKAKLEAAMAEKTQSLTAGLPIPPG
                     FKLPF"
     misc_feature    complement(38407..38715)
                     /locus_tag="BSVBI22_A0033"
                     /note="hypothetical protein; Validated; Region: PRK00153"
                     /db_xref="CDD:234669"
     gene            complement(38740..40548)
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /db_xref="GeneID:11728855"
     CDS             complement(38740..40548)
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /note="catalyzes the DNA-template-directed extension of
                     the 3'-end of a DNA strand; the tau chain serves as a
                     scaffold to help in the dimerizaton of the alpha,epsilon
                     and theta core complex; the gamma chain seems to interact
                     with the delta and delta' subunits to transfer the beta
                     subunit on the DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunits gamma and tau"
                     /protein_id="YP_005153743.1"
                     /db_xref="GI:376279737"
                     /db_xref="GeneID:11728855"
                     /translation="MDTQSADGAYRVLARKYRPQNFDDLIGQEPMVRTLRNAFETGRI
                     AQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLSTPGEHCQAIMEGRHVDVI
                     EMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSTAAFNGLLKTLEEPPPH
                     VKFIFATTEIRKVPITVLSRCQRFDLHRIESGTLAQHLRRIAEAEKIEVDDASLAMIA
                     RAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLFEMLMRGDVAGAL
                     TEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERVRGREFAQTLS
                     IRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIRGLDNGSVSA
                     PRPQPSATPRPNGGSAPQAHGAADAVGSSALAPAAGGPATAMRIVETPPIQVSAPKPS
                     EAAPQPSVPINSLQDIVALADKYRDMQFKILVKNCVRPASIAPGRLEIGLTDDAPKSL
                     PSDIAQHLLNWTGIRWVVTVARDVAGQTIAEAEAERRDNLVTDARADPDVAAILAAFP
                     GAKIIDVRIAVPDKSEDEDIDLDAVAEVPDVLPEDD"
     misc_feature    complement(38743..40548)
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK09111"
                     /db_xref="CDD:236382"
     misc_feature    complement(40000..40473)
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(40372..40395)
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(40045..40047,40138..40140,40369..40392))
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(40135..40152)
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(40009..40011)
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(39394..39822)
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /note="DNA polymerase III subunits gamma and tau domain
                     III; Region: DNA_pol3_gamma3; pfam12169"
                     /db_xref="CDD:256887"
     misc_feature    complement(38827..39177)
                     /gene="dnaX"
                     /locus_tag="BSVBI22_A0034"
                     /note="DNA polymerase III gamma and tau subunits C
                     terminal; Region: DUF3646; pfam12362"
                     /db_xref="CDD:257007"
     gene            40829..41233
                     /locus_tag="BSVBI22_A0035"
                     /db_xref="GeneID:11728856"
     CDS             40829..41233
                     /locus_tag="BSVBI22_A0035"
                     /note="identified by similarity to OMNI:NTL02ML4266; match
                     to protein family HMM PF01230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153744.1"
                     /db_xref="GI:376279738"
                     /db_xref="GeneID:11728856"
                     /translation="MEQFVLDKRLHADTFYVARLGLCELRLMNDRRWPWLILVPRRPG
                     LTEIHQMTPLDQTMLTFEAGIVAHALKTVTACRKINTGALGNVVRQLHVHVIARNEGD
                     AGWPGPVWGHGVRETYDEKDAQKLIAEVRAAL"
     misc_feature    40829..41218
                     /locus_tag="BSVBI22_A0035"
                     /note="Diadenosine tetraphosphate (Ap4A) hydrolase and
                     other HIT family hydrolases [Nucleotide transport and
                     metabolism / Carbohydrate transport and metabolism /
                     General function prediction only]; Region: Hit; COG0537"
                     /db_xref="CDD:223611"
     gene            41262..42209
                     /locus_tag="BSVBI22_A0036"
                     /db_xref="GeneID:11728857"
     CDS             41262..42209
                     /locus_tag="BSVBI22_A0036"
                     /note="identified by similarity to OMNI:NTL02ML4265; match
                     to protein family HMM PF00293"
                     /codon_start=1
                     /transl_table=11
                     /product="MutT/nudix family protein"
                     /protein_id="YP_005153745.1"
                     /db_xref="GI:376279739"
                     /db_xref="GeneID:11728857"
                     /translation="MAFRLYDLPEMEPSRFVGFAGNRIERLSEKRPDDSAFTALELPE
                     TRIMILGDHKLLLDYGQEDAPRALFSLEEAHQFVLDLCEPVLLGLQDGTPLVALTATL
                     YPEALPAPFRLQDYRSVYTEGLVPADLLGALAQTAALTAWHESHRFCGRCGTKTEMRA
                     GGAKRLCPQCGAEHFPRTDPVAIMLPVRGEKCILARGPHFVAGSYSCLAGFIEHGETI
                     EAAVRRESFEEMKLAIGRVAYHASQPWPFPYSLMIGCHAEVLSDDFTVDRSELEDGRW
                     FSKAEVRTMLEGTHENGLRVPPCGAIATHLIKAWAYDAG"
     misc_feature    41331..42197
                     /locus_tag="BSVBI22_A0036"
                     /note="NTP pyrophosphohydrolases containing a Zn-finger,
                     probably nucleic-acid-binding [DNA replication,
                     recombination, and repair]; Region: NPY1; COG2816"
                     /db_xref="CDD:225373"
     misc_feature    41391..41654
                     /locus_tag="BSVBI22_A0036"
                     /note="NADH pyrophosphatase-like rudimentary NUDIX domain;
                     Region: NUDIX-like; pfam09296"
                     /db_xref="CDD:255270"
     misc_feature    41694..41786
                     /locus_tag="BSVBI22_A0036"
                     /note="NADH pyrophosphatase zinc ribbon domain; Region:
                     zf-NADH-PPase; pfam09297"
                     /db_xref="CDD:255271"
     misc_feature    41799..42194
                     /locus_tag="BSVBI22_A0036"
                     /note="NADH pyrophosphatase, a member of the Nudix
                     hydrolase superfamily, catalyzes the cleavage of NADH into
                     reduced nicotinamide mononucleotide (NMNH) and AMP. Like
                     other members of the Nudix family, it requires a divalent
                     cation, such as Mg2+ or Mn2+, for...; Region:
                     NADH_pyrophosphatase; cd03429"
                     /db_xref="CDD:239521"
     misc_feature    order(41802..41804,41886..41894,41994..41996,42003..42005,
                     42009..42011,42015..42017)
                     /locus_tag="BSVBI22_A0036"
                     /note="putative NADH binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239521"
     misc_feature    order(41889..41894,41898..41900,41934..41936,41943..41948,
                     41994..41996,42003..42005,42009..42011,42015..42017)
                     /locus_tag="BSVBI22_A0036"
                     /note="putative active site [active]"
                     /db_xref="CDD:239521"
     misc_feature    41889..41957
                     /locus_tag="BSVBI22_A0036"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239521"
     misc_feature    order(41934..41936,41943..41948,42069..42071)
                     /locus_tag="BSVBI22_A0036"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239521"
     gene            complement(42210..43073)
                     /gene="pheA"
                     /locus_tag="BSVBI22_A0037"
                     /db_xref="GeneID:11728858"
     CDS             complement(42210..43073)
                     /gene="pheA"
                     /locus_tag="BSVBI22_A0037"
                     /note="catalyzes the formation of phenylpyruvate from
                     prephenate in phenylalanine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="YP_005153746.1"
                     /db_xref="GI:376279740"
                     /db_xref="GeneID:11728858"
                     /translation="MKTNRISFQGEAGANSDTACRNMFPDMEPLPCPTFEDAFNAVET
                     GAADLAMIPIENTLAGRVADIHYLLPLADMHIVGEYFLPIHFQLMVLPGVRREEIKTV
                     HSHIHALGQCRNVIRQNGWKGVIAGDTAGAARLVADVKDRSMAALAPRLAADLYGLDI
                     LEENVEDSENNVTRFVVLSKNKQWAARPENDERIVTTFVFRVRNVPAALYKALGGFAT
                     NGVNMTKLESYQLGGRFIATQFYADIEGHPEERSVQLALEELRFFTKEVRILGVYKGS
                     DIRGTQLLAAE"
     misc_feature    complement(42234..43073)
                     /gene="pheA"
                     /locus_tag="BSVBI22_A0037"
                     /note="prephenate dehydratase; Provisional; Region:
                     PRK11899"
                     /db_xref="CDD:237014"
     misc_feature    complement(42528..43058)
                     /gene="pheA"
                     /locus_tag="BSVBI22_A0037"
                     /note="Prephenate dehydratase; Region: PDT; pfam00800"
                     /db_xref="CDD:250142"
     misc_feature    complement(42252..42488)
                     /gene="pheA"
                     /locus_tag="BSVBI22_A0037"
                     /note="C-terminal ACT domain of the bifunctional
                     chorismate mutase-prephenate dehydratase (CM-PDT) enzyme
                     and the prephenate dehydratase (PDT) enzyme; Region:
                     ACT_CM-PDT; cd04905"
                     /db_xref="CDD:153177"
     misc_feature    complement(order(42384..42395,42444..42455))
                     /gene="pheA"
                     /locus_tag="BSVBI22_A0037"
                     /note="putative L-Phe binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153177"
     gene            complement(43162..43917)
                     /gene="kdsB"
                     /locus_tag="BSVBI22_A0038"
                     /db_xref="GeneID:11728859"
     CDS             complement(43162..43917)
                     /gene="kdsB"
                     /locus_tag="BSVBI22_A0038"
                     /note="CMP-2-keto-3-deoxyoctulosonic acid synthetase;
                     catalyzes the formation of
                     CMP-3-deoxy-D-manno-octulosonate from CTP and
                     3-deoxy-D-manno-octulosonate which is incorporated into
                     LPS"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase"
                     /protein_id="YP_005153747.1"
                     /db_xref="GI:376279741"
                     /db_xref="GeneID:11728859"
                     /translation="MLQTMKTLTLIPTRLGSTRLPNKPLADICGKPMIVHVADRAAAA
                     KLGRTVIATDSEEIFKVVAAHGHEAIMTRGDHESGSDRIYEALAKLDPSGEIDAVVNV
                     QGDLPTIDPDTIRRALLPLEDGPADIATLGVEITVEEEKTNPNVVKIVGSPLAGNRRL
                     RALYFTRATAPYGEGPLYHHIGLYAYRRSALERFVKLGPSPLEKREKLEQLRALEAGM
                     RIDVEIVKTVPLGVDTQADLDRARTFCSQAGTI"
     misc_feature    complement(43192..43902)
                     /gene="kdsB"
                     /locus_tag="BSVBI22_A0038"
                     /note="CMP-KDO synthetase catalyzes the activation of KDO
                     which is an essential component of the lipopolysaccharide;
                     Region: CMP-KDO-Synthetase; cd02517"
                     /db_xref="CDD:133010"
     misc_feature    complement(order(43603..43605,43609..43611,43681..43683,
                     43762..43764,43876..43884))
                     /gene="kdsB"
                     /locus_tag="BSVBI22_A0038"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133010"
     misc_feature    complement(order(43267..43278,43297..43305,43312..43317,
                     43390..43392,43402..43422,43426..43431,43447..43449,
                     43465..43470,43486..43488,43537..43539))
                     /gene="kdsB"
                     /locus_tag="BSVBI22_A0038"
                     /note="oligomer interface; other site"
                     /db_xref="CDD:133010"
     gene            44295..44903
                     /locus_tag="BSVBI22_A0039"
                     /db_xref="GeneID:11728860"
     CDS             44295..44903
                     /locus_tag="BSVBI22_A0039"
                     /note="identified by similarity to EGAD:14195; match to
                     protein family HMM PF00034"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c, membrane-bound"
                     /protein_id="YP_005153748.1"
                     /db_xref="GI:376279742"
                     /db_xref="GeneID:11728860"
                     /translation="MNSTRNNKFIMAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIE
                     VAQGSGGGESAAAPAKEEVSIATLLQSADPARGEVVFKRCQACHTGDKGGANKVGPHL
                     WGVVGRPAASVEGFSYSAAMKEFGAAGNKWDFEHLNKFLTSPKGFIKGTAMGFAGDKK
                     DNERADLIAYLRTLSDNPVPLPAADAAPADSDKKPAEAAPAN"
     misc_feature    44403..44831
                     /locus_tag="BSVBI22_A0039"
                     /note="Cytochrome c2 [Energy production and conversion];
                     Region: COG3474"
                     /db_xref="CDD:226005"
     gene            complement(44948..45913)
                     /locus_tag="BSVBI22_A0040"
                     /db_xref="GeneID:11728861"
     CDS             complement(44948..45913)
                     /locus_tag="BSVBI22_A0040"
                     /note="identified by similarity to GP:14021137; match to
                     protein family HMM PF00994"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153749.1"
                     /db_xref="GI:376279743"
                     /db_xref="GeneID:11728861"
                     /translation="MIFGELPLDRAEDAILAHTINIDALSLRKGTVLARSDIAALRQA
                     GIDRVLAARLESGDIGEDAAALAIGRLLAGNGIEPGPATTGRVNLFASPDGVFCTDTA
                     GIDAINMHDPRISVATIRNHARVEAGQMVATIKIIPFAVPGVLIEEIRAVVHGRPLLQ
                     VEKFRNMQVGLIQSRLPSIRETVLDRTLELMHKRVTRNGGAVVTQERVAHHDEALATA
                     IAKVGSACDLIVIFSASAVADEADIVPRAIRRAGGEILRIGMPVDPGNLLVLGKMGRK
                     YIIAAPGSARSARENSLDRVLDRLMAGMELDATHLARMGVGGLLL"
     misc_feature    complement(44954..45913)
                     /locus_tag="BSVBI22_A0040"
                     /note="Molybdopterin biosynthesis enzyme [Coenzyme
                     metabolism]; Region: MoeA; COG0303"
                     /db_xref="CDD:223380"
     misc_feature    complement(44957..45874)
                     /locus_tag="BSVBI22_A0040"
                     /note="MoeA_like. This domain is similar to a domain found
                     in a variety of proteins involved in biosynthesis of
                     molybdopterin cofactor, like MoaB, MogA, and MoeA. There
                     this domain is presumed to bind molybdopterin. The exact
                     function of this subgroup is...; Region: MoeA_like;
                     cd03522"
                     /db_xref="CDD:239599"
     misc_feature    complement(order(45044..45046,45053..45055,45065..45070,
                     45203..45211))
                     /locus_tag="BSVBI22_A0040"
                     /note="putative MPT binding site; other site"
                     /db_xref="CDD:239599"
     gene            45969..46277
                     /locus_tag="BSVBI22_A0041"
                     /db_xref="GeneID:11728862"
     CDS             45969..46277
                     /locus_tag="BSVBI22_A0041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153750.1"
                     /db_xref="GI:376279744"
                     /db_xref="GeneID:11728862"
                     /translation="MFESRLTHILAGGFLDSKICSMPEPRDANVGIRHPSQSRFFPGL
                     PLQKGGGGRIEPPRLGALHIVFWCVQPDFGLTYRPPNASHAVFLDLETGDMLQKDRFD
                     "
     gene            46440..47465
                     /gene="cyoA"
                     /locus_tag="BSVBI22_A0042"
                     /db_xref="GeneID:11728863"
     CDS             46440..47465
                     /gene="cyoA"
                     /locus_tag="BSVBI22_A0042"
                     /note="identified by similarity to EGAD:20044; match to
                     protein family HMM TIGR01433"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol oxidase subunit II"
                     /protein_id="YP_005153751.1"
                     /db_xref="GI:376279745"
                     /db_xref="GeneID:11728863"
                     /translation="MERQMKHGTPRTIVSFAVLALSAFLAGCQNQVLLDPKGQVGLEE
                     RDLILFATGIMLLVVVPVILATLFFAWKYRATNEKADYQPDWHHSTKIELAVWLIPMA
                     IIVVLGTVTWISTHKLDPYRPLESNVKPINVEVVALDWKWLFIYPDQGIATVNEMAMP
                     VNVPVNFKLTSSNLMNSFFIPQLGSQVYTMRSMQTKLHLIANQEGDFAGISANYSGQG
                     FAQMRFKAHAFDQAGFDKWVADVKAQAAAKGEDLDRARYASLVQPSEKHAVQYFNYGD
                     KALFHDIVNRCWDGKSVCLDDEMHRQQMIREARASLRKSSPIDFSQWANDIICTVQPP
                     RLSQLEN"
     misc_feature    46485..47165
                     /gene="cyoA"
                     /locus_tag="BSVBI22_A0042"
                     /note="cytochrome o ubiquinol oxidase subunit II; Region:
                     CyoA; TIGR01433"
                     /db_xref="CDD:213620"
     misc_feature    46830..47123
                     /gene="cyoA"
                     /locus_tag="BSVBI22_A0042"
                     /note="The cupredoxin domain of Ubiquinol oxidase subunit
                     II; Region: CuRO_UO_II; cd04212"
                     /db_xref="CDD:259874"
     misc_feature    47178..47315
                     /gene="cyoA"
                     /locus_tag="BSVBI22_A0042"
                     /note="COX Aromatic Rich Motif; Region: COX_ARM;
                     pfam06481"
                     /db_xref="CDD:253759"
     gene            47545..49524
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /db_xref="GeneID:11728864"
     CDS             47545..49524
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="identified by similarity to EGAD:14783; match to
                     protein family HMM PF00115"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol oxidase subunit I"
                     /protein_id="YP_005153752.1"
                     /db_xref="GI:376279746"
                     /db_xref="GeneID:11728864"
                     /translation="MFGKLTLEAIPYHEPIIMVTLAAVAGGALAILAAITYYRKWVPL
                     WNDWLTSVDHKRIGVMYIVLALVMLFRGFSDAVMMRAQQALASGANEGFLPPHHYDQI
                     FTAHGVIMIFFVAMPFIVGLMNFVVPLQIGARDVAFPYLNSLSFWLTVAGAILVNISL
                     GVGEFAKTGWLAYPPLSGKAFSPDVGMDYYLWALNISGMGTLLSAVNLITTIIKMRAP
                     GMGMMQLPVFTWTALCSNVLIVAAFPILTVTLSLLTLDRYLDFHFFTNDAGGNPMMYV
                     NLIWIWGHPEVYILVLPCFGIYSEIIATFSGKRLFGYTSMVYATVAITVLSFLVWAHH
                     FFTMGGGASVNSFFGVATMIISIPTGAKVFNWLFTMYKGRVRMETPVMWTIGFMCTFV
                     IGGMTGVLLAVPPADFVLHNSVFLIAHFHNVIISGVLFGCFAGVVYWWPKAFGFKLNE
                     RLGKSAFWCWLVGFMLAFMPLYVLGLMGMTRRLNHTENPAWHIYLIIAAIGVAVILCG
                     IVCQILQIMVSIRDRDKLRDTNGDTWGSGRTLEWSISSPPPFYNFAETPTVRDHDAWW
                     DMKQNGYVRRTEKFARIHMPKNTATGFLVGILSIPFGFAMIWHIWWLAIASALAMFVV
                     AIAHSFNNDRDYYVSADEVQRVEDARTRQLTAQEA"
     misc_feature    47656..49368
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 1 [Energy production and conversion]; Region:
                     CyoB; COG0843"
                     /db_xref="CDD:223913"
     misc_feature    47686..49203
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="Ubiquinol oxidase subunit I.  Ubiquinol oxidase,
                     the terminal oxidase in the respiratory chains of aerobic
                     bacteria, is a multi-chain transmembrane protein located
                     in the cell membrane.  It catalyzes the reduction of O2
                     and simultaneously pumps protons...; Region:
                     Ubiquinol_Oxidase_I; cd01662"
                     /db_xref="CDD:238832"
     misc_feature    order(47725..47727,47917..47919,47947..47949,47968..47970,
                     47977..47979,48142..48147,48163..48165,48175..48177)
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238832"
     misc_feature    order(47755..47757,47767..47769,47776..47781,47836..47838,
                     47845..47853)
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="Putative ubiquinol binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238832"
     misc_feature    order(47860..47862,48805..48807,48817..48819,48943..48945,
                     49057..49059)
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="Low-spin heme (heme b) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238832"
     misc_feature    order(48355..48357,48370..48375,48763..48765,48775..48780,
                     48985..48987)
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238832"
     misc_feature    order(48394..48396,48541..48546,48799..48801)
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="Binuclear center (heme o3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238832"
     misc_feature    order(48394..48396,48406..48408,48439..48441,48541..48546,
                     48619..48621,48628..48630)
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238832"
     misc_feature    order(48544..48546,48775..48780,48985..48990)
                     /gene="qoxB"
                     /locus_tag="BSVBI22_A0043"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238832"
     gene            49528..50157
                     /locus_tag="BSVBI22_A0044"
                     /db_xref="GeneID:11728865"
     CDS             49528..50157
                     /locus_tag="BSVBI22_A0044"
                     /note="identified by similarity to EGAD:13682; match to
                     protein family HMM PF00510"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol oxidase subunit III"
                     /protein_id="YP_005153753.1"
                     /db_xref="GI:376279747"
                     /db_xref="GeneID:11728865"
                     /translation="MSAIQHTAAPYLGGNDHPAHEDHHDAGSTTLVGFWIYLMSDCIL
                     FSGLFATYAVLAHQFAGGPTGRELFDLQFVLVETMLLLVSSLTYGLATLSMYKNNRSG
                     VLGWLGVTFLLGAAFLAMEIYEFHHLIVEGAGPDRSSFLSAFFTLVGTHGLHITSGLI
                     WILVLSAMLLRDGLTERNRTRVMCLSLFWHFLDIIWIGVFTLVYLLGVL"
     misc_feature    49594..50148
                     /locus_tag="BSVBI22_A0044"
                     /note="Ubiquinol oxidase subunit III subfamily. Ubiquinol
                     oxidase, the terminal oxidase in the respiratory chains of
                     aerobic bacteria, is a multi-chain transmembrane protein
                     located in the cell membrane.  It catalyzes the reduction
                     of O2 and simultaneously...; Region:
                     Ubiquinol_oxidase_III; cd02863"
                     /db_xref="CDD:239214"
     misc_feature    order(49609..49614,49624..49626,49633..49635,49654..49659,
                     49666..49671,49678..49680)
                     /locus_tag="BSVBI22_A0044"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239214"
     misc_feature    order(49630..49632,49654..49656,49765..49767,49774..49776,
                     49786..49791,50074..50076,50095..50097)
                     /locus_tag="BSVBI22_A0044"
                     /note="Subunit III/IV interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239214"
     gene            50157..50522
                     /gene="qoxD"
                     /locus_tag="BSVBI22_A0045"
                     /db_xref="GeneID:11728866"
     CDS             50157..50522
                     /gene="qoxD"
                     /locus_tag="BSVBI22_A0045"
                     /note="identified by similarity to EGAD:20825; match to
                     protein family HMM PF03626"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol oxidase subunit IV"
                     /protein_id="YP_005153754.1"
                     /db_xref="GI:376279748"
                     /db_xref="GeneID:11728866"
                     /translation="MSSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTP
                     ATTAVIVLAIAAVQILVHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYH
                     LDTNMMPMYMTPDNVRNLP"
     misc_feature    50160..50486
                     /gene="qoxD"
                     /locus_tag="BSVBI22_A0045"
                     /note="Heme/copper-type cytochrome/quinol oxidase, subunit
                     4 [Energy production and conversion]; Region: CyoD;
                     COG3125"
                     /db_xref="CDD:225667"
     gene            complement(50519..50797)
                     /locus_tag="BSVBI22_A0046"
                     /db_xref="GeneID:11728867"
     CDS             complement(50519..50797)
                     /locus_tag="BSVBI22_A0046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153755.1"
                     /db_xref="GI:376279749"
                     /db_xref="GeneID:11728867"
                     /translation="MTLNFYYKLNKVLCELPATRNIKKRPGNIRGATRLLGGERGIKP
                     RCRAVRPVIGKTRLAGTRPPEHFLSQKCPALPCAKPVKALISLRPNAH"
     gene            50973..51560
                     /locus_tag="BSVBI22_A0047"
                     /db_xref="GeneID:11728868"
     CDS             50973..51560
                     /locus_tag="BSVBI22_A0047"
                     /note="identified by similarity to GP:3511221"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153756.1"
                     /db_xref="GI:376279750"
                     /db_xref="GeneID:11728868"
                     /translation="MSLFKGMLANNRLLGAAVLAAAVFIPAIASAAPAVVSASVNVRS
                     GPGAHFTRLAAIPAWTRVNAGPCRNGWCRIGNGSGYGWISARYVRFASYAGGYAAQPP
                     TTVIVNNGGYDDWGPALGWGLGIGWASSNWGPYWGPGWGGYRGGPNYIHGCIGRNCQS
                     GWGPGRRGWNPHWGRGPQRRAQWGRGWPQHVNRPF"
     misc_feature    51093..51236
                     /locus_tag="BSVBI22_A0047"
                     /note="Bacterial SH3 domain; Region: SH3_3; pfam08239"
                     /db_xref="CDD:254683"
     gene            52156..54075
                     /locus_tag="BSVBI22_A0048"
                     /db_xref="GeneID:11728869"
     CDS             52156..54075
                     /locus_tag="BSVBI22_A0048"
                     /note="identified by similarity to OMNI:NTL02ML1304; match
                     to protein family HMM PF01103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153757.1"
                     /db_xref="GI:376279751"
                     /db_xref="GeneID:11728869"
                     /translation="MLLLAAHFSSFALSPALAFEIFGIHLWGKDKKQDPDIIDPKTYS
                     VDVTTTGDRKNADGKEADLKSVIEGASGLVSDADKPASGSAGLLAKARGDYRRILSAL
                     YGEGRYGGTISIKVDGREANDIPPDTEIPNNAKVAITVDPGPQFLFSRTAISNIAPPP
                     GNRRDKVQTPEEAGFAPGQEAKSGTILKAERLAVEAWRQEGYAKARVTGEDVVADHAD
                     NRVSADIALDPGRKAYYGPVSVVGTARMDPQFVAWMTGLKPGQEYDPDDIENAKKRLG
                     RMEVFRAMTFEEADKIEPDGSLPITLNVQERKPRRFGFGAEYSTIDGFGVTSYWMHRN
                     LFGRGERLRFDAKVSGIGGSQDNSFDPKNYTYLLGASFAKPGVYTPDTDFVATLDAKR
                     EVLDAYTETSINAKTGFTQIFSDELSGALYANASQGHFVDDVFGKRDFTTAGLEGNLL
                     YDSRNNKPDPSSGFYLVGNIQPFYEFHYGNFATRFTAEGRTYHGFGQTDRVVLAGRLK
                     VGSIVGGSIADLPPSQLFLAGGGGSVRGYGYRNIGVSAGNGNIIGGRSLVEANGEVRT
                     RITDSIGAVAFVDAGYVGEKSFPDFSEQMRVGVGGGLRYLTSLGPIRLDVAVPLNRRS
                     GDPNYGFYVGIGQAF"
     misc_feature    52192..54072
                     /locus_tag="BSVBI22_A0048"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane]; Region: COG0729"
                     /db_xref="CDD:223801"
     misc_feature    52852..53076
                     /locus_tag="BSVBI22_A0048"
                     /note="Surface antigen variable number repeat; Region:
                     Surf_Ag_VNR; pfam07244"
                     /db_xref="CDD:254121"
     misc_feature    53155..54072
                     /locus_tag="BSVBI22_A0048"
                     /note="Surface antigen; Region: Bac_surface_Ag; pfam01103"
                     /db_xref="CDD:250364"
     gene            54264..58811
                     /locus_tag="BSVBI22_A0049"
                     /db_xref="GeneID:11728870"
     CDS             54264..58811
                     /locus_tag="BSVBI22_A0049"
                     /note="identified by similarity to GP:15076022; match to
                     protein family HMM PF04357; match to protein family HMM
                     TIGR01612"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153758.1"
                     /db_xref="GI:376279752"
                     /db_xref="GeneID:11728870"
                     /translation="MENKLSAPNRRISISGISGVLSSEATVGSITVADREGVWLRIEN
                     VKLDWSRTALFLGRLSVQSLTAERIDVIRKPLPDKGLPSPESSSFSLPELPISINLEQ
                     LDVARLHFGPTIFGLESDVSLKGSLSLADGSLNSNFDIKRLDGPGGNFALRAAYANAD
                     QKLDLDLKVSEPANGIVANLLKIDGRPPVDLTLTGAGTLDDLKVALALDTNGSRTLTG
                     EFTLDRQGKGPDGGRVFAARFNGPIAVLVPPVFRDFFGAETVLSADGLVKDGGGFRLD
                     DLALTSAALKLKASAETDNDHFLDKLRIDAAIADESKGRVLLPVKGAETYIDNARFQV
                     AYGDRPTNDWTGMLSINGLKNATLSASAIALDMGGLAENLNDPASRHITFSVNGGMDG
                     ISSPRADIAEALGSKITLAVNGAWRAGSPVELAQADIEGNGLSLDLKGKINDFAFNGD
                     IAAKVASLAPFGALANRNLAGSIDVKATGMVRPISGAFQLDFDGTAENVRTGTEAVDR
                     ILDGAVNLSGALGRSSEGFSARNFRIGNALSEITANGSLASDKADFDFGVMLSDLKLL
                     SDKASGPMTVKGSARGDDKLIALALRADVPQGTLAGRKLSNGGLDFNALLDGNATTGV
                     ALSGKLDGGALLNGERVDLGSLIDIAHDEKRLTNLMFNAGGAHLSGNVTQSAKGLLSG
                     ALKLDAPDISTAAALFLADATGAANADITLDASDGRQNATVTANASGIRINGNHIASA
                     DIALTAKDLLGVPVVDGNAAARDIMVGTFGIDSFDASANASGSKTDFTANTRLKIGTV
                     ANAAGSLEPKDGGFELALATADVKQGALSAHLAAPATISMKGDEITFGDIVVNTGDGQ
                     VRINGLVDGRLDLSVALTNLPLALANTFKPELGLGGTVNGTARITGTKEAPDIAFDMT
                     ARDVMAAELKKQGLGALNAEAKGTSANERLNIDARVTGGAASGTGIDVRANGAVPLGK
                     GDLALDVNLTNLPLVLLNGVVKGQDLAGNVTGTARITGPLTNPAANFNLRGSGLAAKP
                     LRESGLAPLTLQAAGKYAAKAVDLSSLQLDGPGGLNVTANGKIPFSGQGLGVNVNGNV
                     PLALANRFLADRGAQASGTLSLTANVSGGFQKSQLRGMFSTNGATFVDPETNLRFVNI
                     NVMGSMEGETITLRQVNANLSSGGSLSASGTISTNAVANFPANIEVKFNRARYADGKL
                     VVATIDGGVSITGPLMRDPLISGRIDVDKAEITVPENLGGGAAYVPVHHKNTPKNVQV
                     TLDRARVETRKNKVPTPVARPTVPRLDVVVSAPNQIFVRGRGLDTELGGRVRLTGPIT
                     NIRPVGSFDLIRGRISILGQRITFDEGHVTLVGDLNPQLNFVARSEGDGITAIVTVTG
                     TVDDLNIVFSSSPELPQDEVLAQLIFKRSIGELSAFQIAQLAAAAAELAGGSNNSLIN
                     KLRQGTGLDDLDVVTNSKGETSVRAGRYIRDNIYLGVEAGARGTTKGTVNLDISRNLK
                     VKGAFGAEDDSSGGIFYEKDY"
     misc_feature    54267..58808
                     /locus_tag="BSVBI22_A0049"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2911"
                     /db_xref="CDD:225463"
     misc_feature    56763..57308
                     /locus_tag="BSVBI22_A0049"
                     /note="AsmA-like C-terminal region; Region: AsmA_2;
                     pfam13502"
                     /db_xref="CDD:257822"
     misc_feature    57813..58808
                     /locus_tag="BSVBI22_A0049"
                     /note="Family of unknown function (DUF490); Region:
                     DUF490; pfam04357"
                     /db_xref="CDD:252545"
     gene            58956..59681
                     /locus_tag="BSVBI22_A0050"
                     /db_xref="GeneID:11728871"
     CDS             58956..59681
                     /locus_tag="BSVBI22_A0050"
                     /note="identified by similarity to GP:15160041; match to
                     protein family HMM PF03734; match to protein family HMM
                     TIGR01409"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_005153759.1"
                     /db_xref="GI:376279753"
                     /db_xref="GeneID:11728871"
                     /translation="MSKLNDDLSRRRFLLGTGAVLLTGAAGCSQTMDMSAFQMNIDPM
                     STGGISPMRPQISVDKAITTPDVMYASVTEGPYALPAIPYEKVPKQFRRQIVPDPTGQ
                     APGTIVVSLKDHFLYYVLPGGEALRYGVGIGKAGFEWQGRANVEYKKQWPRWTPPPEM
                     IQRKPELEKYRNGQEPGPTNPLGARALYIYQNGRDTGYRIHGSPEWWSIGQSMSSGCI
                     RLMNQDIIDLYNRVQGKAPIIVG"
     misc_feature    58974..59675
                     /locus_tag="BSVBI22_A0050"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: ErfK; COG1376"
                     /db_xref="CDD:224294"
     misc_feature    59265..59675
                     /locus_tag="BSVBI22_A0050"
                     /note="L,D-transpeptidase catalytic domain; Region: YkuD;
                     pfam03734"
                     /db_xref="CDD:252135"
     gene            complement(59732..59947)
                     /locus_tag="BSVBI22_A0051"
                     /db_xref="GeneID:11728872"
     CDS             complement(59732..59947)
                     /locus_tag="BSVBI22_A0051"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153760.1"
                     /db_xref="GI:376279754"
                     /db_xref="GeneID:11728872"
                     /translation="MQARTERNLGFVAALLLTAAAFAAPGLSTQIAHNDMAYEEQIQL
                     ALTGDMPIELRHFVDLNETMPEQPYRD"
     gene            complement(60017..60520)
                     /locus_tag="BSVBI22_A0052"
                     /db_xref="GeneID:11728873"
     CDS             complement(60017..60520)
                     /locus_tag="BSVBI22_A0052"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153761.1"
                     /db_xref="GI:376279755"
                     /db_xref="GeneID:11728873"
                     /translation="MRISQLNGANSTGYFDRVPEKLVLEGYRRWTAGFETGSIIPWEM
                     TWSLYLEELGPSEATRAVAELSQFIRVLRHCAACPLRAFPFDSHHVCREECLTLGLIS
                     GMQNQDALLIDTCLQAIACVRRCDNVAWAARNFADALADFGQTLLPIPIHAIDAALNR
                     VHCATFH"
     gene            complement(60857..61063)
                     /locus_tag="BSVBI22_A0053"
                     /db_xref="GeneID:11728874"
     CDS             complement(60857..61063)
                     /locus_tag="BSVBI22_A0053"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153762.1"
                     /db_xref="GI:376279756"
                     /db_xref="GeneID:11728874"
                     /translation="MGGWLSRHEKPDAGSGLTTGFQADRHRLALSRSTGPECAIFSPL
                     IDASLRPFAATAAACDGCVPSMLL"
     gene            complement(61074..62078)
                     /locus_tag="BSVBI22_A0054"
                     /db_xref="GeneID:11728875"
     CDS             complement(61074..62078)
                     /locus_tag="BSVBI22_A0054"
                     /note="identified by similarity to GP:15074483; match to
                     protein family HMM PF04314"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153763.1"
                     /db_xref="GI:376279757"
                     /db_xref="GeneID:11728875"
                     /translation="MKNHRLFASAISVFALCASAGIASAHCSLDQKEAKAGTFYKAAL
                     RIPHGCEGKATTKVTVDLPEGFIMAQPQAKAGWKIETTKGDYAHGYKLHGKEVTSGVK
                     QISWSDGNLPSDFYDEFVVVGQLAPFDKDTTLSFPVTQFCGDAASVAWTEIAKDGQNP
                     HDLKHPAPQLRVLAAASTDEHAGHDAMSEHMNHAAMPTKVGDLVITDPSVRAMVPGAK
                     VAGGFLTIANDGKKADKLVSVSAPGVKRVEIHEMTMQDQIMKMRKLEGGLDLPAGKTM
                     QLKSGSYHLMFIEPEHPYEEGETVPVTLEFKKAGKVEINFPVTAKKGQTKDHSEHSSH
                     "
     misc_feature    complement(61551..62012)
                     /locus_tag="BSVBI22_A0054"
                     /note="Reeler-like domain of YcnI and similar proteins;
                     Region: YcnI_like; cd08545"
                     /db_xref="CDD:260082"
     misc_feature    complement(61077..61553)
                     /locus_tag="BSVBI22_A0054"
                     /note="Copper(I)-binding protein [Inorganic ion transport
                     and    metabolism]; Region: COG2847"
                     /db_xref="CDD:225403"
     gene            complement(62213..62611)
                     /locus_tag="BSVBI22_A0055"
                     /db_xref="GeneID:11728876"
     CDS             complement(62213..62611)
                     /locus_tag="BSVBI22_A0055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153764.1"
                     /db_xref="GI:376279758"
                     /db_xref="GeneID:11728876"
                     /translation="MKLSARQLRTRLAIRILSVLALVFVGFAHKPIDLTAPDSYLIAQ
                     YKLPDGSYSALRIGNRSSDATDHGSDQHPNKNGCDACRLSSAFLCPAPANSTGAMPLI
                     AMVDGSIPPQPILRQNVYPPSAPPQAPPFA"
     gene            complement(62856..63251)
                     /locus_tag="BSVBI22_A0056"
                     /db_xref="GeneID:11728877"
     CDS             complement(62856..63251)
                     /locus_tag="BSVBI22_A0056"
                     /note="identified by match to protein family HMM PF00903"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase family protein"
                     /protein_id="YP_005153765.1"
                     /db_xref="GI:376279759"
                     /db_xref="GeneID:11728877"
                     /translation="MAKAIHTMIRVLDADKSVAFYNQAFGLDIAERIDFETFTLIYLR
                     NEEADFEVELTVNKGRTEPYNLGDGYGHLAVAVDDVDAEHARFRELGFKVGNLVDFRN
                     NGALLARFFFVEDPDGYKIEVLQRAGRYV"
     misc_feature    complement(62880..63239)
                     /locus_tag="BSVBI22_A0056"
                     /note="Glyoxalase I catalyzes the isomerization of the
                     hemithioacetal, formed by a 2-oxoaldehyde and glutathione,
                     to S-D-lactoylglutathione; Region: Glyoxalase_I; cd07233"
                     /db_xref="CDD:176659"
     misc_feature    complement(order(62886..62888,62895..62897,62994..62996,
                     63018..63047,63078..63083,63093..63098,63102..63104,
                     63117..63119,63129..63131,63153..63158,63165..63167,
                     63174..63176,63183..63188,63195..63200,63207..63212,
                     63222..63224,63228..63239))
                     /locus_tag="BSVBI22_A0056"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176659"
     misc_feature    complement(order(62886..62888,62892..62894,62916..62918,
                     62922..62924,62949..62951,63036..63038,63081..63083,
                     63087..63089,63093..63095,63132..63134,63138..63140,
                     63147..63149,63222..63224,63234..63236))
                     /locus_tag="BSVBI22_A0056"
                     /note="active site"
                     /db_xref="CDD:176659"
     misc_feature    complement(order(62886..62888,63036..63038,63093..63095,
                     63234..63236))
                     /locus_tag="BSVBI22_A0056"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:176659"
     misc_feature    complement(order(62892..62894,62916..62918,62922..62924,
                     62949..62951,63081..63083,63087..63089,63132..63134,
                     63138..63140,63147..63149,63222..63224))
                     /locus_tag="BSVBI22_A0056"
                     /note="glutathione binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176659"
     gene            63448..64611
                     /locus_tag="BSVBI22_A0057"
                     /db_xref="GeneID:11728878"
     CDS             63448..64611
                     /locus_tag="BSVBI22_A0057"
                     /note="identified by match to protein family HMM PF01883"
                     /codon_start=1
                     /transl_table=11
                     /product="mrp-related protein"
                     /protein_id="YP_005153766.1"
                     /db_xref="GI:376279760"
                     /db_xref="GeneID:11728878"
                     /translation="MAGVTREQVLERLKTVTGPDFKSDVVSLGLVSDIFIADGKVFFS
                     ITVPAERAEALEPMRLAAEKVVKDIPGITGALVTLTAEKKGGRTSDDAPPPPRPQARP
                     AAASQHRHPPQPRPAAKPGVPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGI
                     LDADIYGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMV
                     MSALTQMLREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDAR
                     KGLNMFRKVDVPLLGIVENMSYFIAPDTGTRYDIFGHGGARREAERLNVPFLGEVPLH
                     MDVRAYSDNGTPITVKEPDSEHAKIYRDIARKVWENMKSGKGAGKPAPEIVFD"
     misc_feature    63463..63678
                     /locus_tag="BSVBI22_A0057"
                     /note="Domain of unknown function DUF59; Region: DUF59;
                     pfam01883"
                     /db_xref="CDD:250939"
     misc_feature    63829..64548
                     /locus_tag="BSVBI22_A0057"
                     /note="cell division ATPase MinD, archaeal; Region:
                     minD_arch; TIGR01969"
                     /db_xref="CDD:131024"
     misc_feature    63829..64452
                     /locus_tag="BSVBI22_A0057"
                     /note="MRP (Multiple Resistance and pH adaptation) is a
                     homologue of the Fer4_NifH superfamily. Like the other
                     members of the superfamily, MRP contains a ATP-binding
                     domain at the N-termini. It is found in bacteria as a
                     membrane-spanning protein and functions...; Region:
                     MRP-like; cd02037"
                     /db_xref="CDD:238994"
     misc_feature    63847..63870
                     /locus_tag="BSVBI22_A0057"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238994"
     gene            complement(64776..66407)
                     /gene="pgm"
                     /locus_tag="BSVBI22_A0058"
                     /db_xref="GeneID:11728879"
     CDS             complement(64776..66407)
                     /gene="pgm"
                     /locus_tag="BSVBI22_A0058"
                     /note="catalyzes the interconversion of alpha-D-glucose
                     1-phosphate to alpha-D-glucose 6-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucomutase"
                     /protein_id="YP_005153767.1"
                     /db_xref="GI:376279761"
                     /db_xref="GeneID:11728879"
                     /translation="MTVKTIATTPYQDQQPGTSGLRKKVPVFQQPNYAENFIQSIFDV
                     LEGFKGKTLVVGGDGRFYNREVIQKLIKIAAANGFGRIMVGQGGILSTPAASNMIRKY
                     KAFGGMILSASHNPGGPTQDFGIKYNIGNGGPAPEKITEAIFARSKVIDQYKIADAAD
                     IDIDKIGTSKIGDTEVVIFDPVADYAELMESLFDFAAIRAMIKGGFQMKFDAMHAVTG
                     PYAKEIFERRLGAPEGSVVNFVPLPDFGGHHPDPNLVYAKDLYDLLMSSHAPDFGAAS
                     DGDGDRNLILGRGIFITPSDSLAMLAANAHLAPGYKGGIKGIARSMPTSAAADRVAEK
                     LGIGMYETPTGWKFFGNLLDSGKVTICGEESSGTGSDHVREKDGLWAVLLWLNILAVR
                     KESVKAIADDHWARFGRNYYTRHDYEAVDSDIATKLVADLRGKLAGLPGTSVNGLRIE
                     KADDFAYHDPVDGSTSEHQGIRIYFEGGARIVLRLSGTGTSGATIRIYIERYEADPAK
                     HNLDTQATLAPLIDAAEQIAEVKKRSGRTEPSVVT"
     misc_feature    complement(64779..66407)
                     /gene="pgm"
                     /locus_tag="BSVBI22_A0058"
                     /note="phosphoglucomutase; Region: PLN02307"
                     /db_xref="CDD:177942"
     misc_feature    complement(64779..66398)
                     /gene="pgm"
                     /locus_tag="BSVBI22_A0058"
                     /note="Phosphoglucomutase 1 (PGM1) catalyzes the
                     bidirectional interconversion of glucose-1-phosphate
                     (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose
                     1,6-diphosphate intermediate, an important metabolic step
                     in prokaryotes and eukaryotes. In one direction; Region:
                     PGM1; cd03085"
                     /db_xref="CDD:100087"
     misc_feature    complement(order(64920..64922,64944..64952,64956..64958,
                     65307..65309,65313..65315,65319..65321,65370..65372,
                     65376..65378,65439..65441,65562..65564,66069..66071,
                     66351..66353))
                     /gene="pgm"
                     /locus_tag="BSVBI22_A0058"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100087"
     misc_feature    complement(order(65346..65348,66015..66023,66099..66101,
                     66258..66263,66273..66275))
                     /gene="pgm"
                     /locus_tag="BSVBI22_A0058"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100087"
     misc_feature    complement(order(64920..64922,64944..64952,64956..64958,
                     65280..65282,65370..65372,65562..65567,65571..65573,
                     65577..65579,66063..66071))
                     /gene="pgm"
                     /locus_tag="BSVBI22_A0058"
                     /note="active site"
                     /db_xref="CDD:100087"
     misc_feature    complement(order(65565..65567,65571..65573,65577..65579,
                     66069..66071))
                     /gene="pgm"
                     /locus_tag="BSVBI22_A0058"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100087"
     gene            complement(66463..66648)
                     /locus_tag="BSVBI22_A0059"
                     /db_xref="GeneID:11728880"
     CDS             complement(66463..66648)
                     /locus_tag="BSVBI22_A0059"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153768.1"
                     /db_xref="GI:376279762"
                     /db_xref="GeneID:11728880"
                     /translation="MRHYAIANKAHPENRRHFRETCFRANRTCVSSAIQDFFGKQSPM
                     CTLCYFQTTSLIYLVLQ"
     gene            complement(66623..67516)
                     /locus_tag="BSVBI22_A0060"
                     /db_xref="GeneID:11728881"
     CDS             complement(66623..67516)
                     /locus_tag="BSVBI22_A0060"
                     /note="identified by match to protein family HMM PF00126;
                     match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005153769.1"
                     /db_xref="GI:376279763"
                     /db_xref="GeneID:11728881"
                     /translation="MQNENLRDLNAFVAVAETGSFTRAAAQLGVSQSALSQTIRNLEE
                     RVGIRLLNRTTRYVSPTEAGERLLAQVGPALAEIASGFAQIGELRERPSGTVRLSADE
                     YAIQSVLWPALERFLAEFPDIHIELTTDYGRSDVVRERQDAGVRRGKLVSRDMIALRI
                     SPDIPMATVATPAFLEKGGKPKRPQDLSDHDCINLRLPTHGEFFAWTYSRHGKDIRIT
                     TQGRLVFTSIAQVLQACLAGFGLAYLPRDYAARHIESGALVEVLADWRKTFEGYHLYY
                     PNRRQHPPALAALIEALRYRE"
     misc_feature    complement(66635..67504)
                     /locus_tag="BSVBI22_A0060"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(67322..67501)
                     /locus_tag="BSVBI22_A0060"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(66638..67243)
                     /locus_tag="BSVBI22_A0060"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_5; cd08474"
                     /db_xref="CDD:176163"
     misc_feature    complement(order(66701..66703,66782..66784,66833..66835,
                     67025..67027,67034..67036,67076..67078,67193..67195,
                     67205..67207))
                     /locus_tag="BSVBI22_A0060"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176163"
     misc_feature    complement(order(66806..66808,66815..66820,66839..66853,
                     66944..66946,67130..67150,67154..67156,67166..67168,
                     67175..67180,67184..67189,67199..67204))
                     /locus_tag="BSVBI22_A0060"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176163"
     gene            67641..68564
                     /locus_tag="BSVBI22_A0061"
                     /db_xref="GeneID:11728882"
     CDS             67641..68564
                     /locus_tag="BSVBI22_A0061"
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase domain-containing
                     protein"
                     /protein_id="YP_005153770.1"
                     /db_xref="GI:376279764"
                     /db_xref="GeneID:11728882"
                     /translation="MKSVTFKNKNWDIAAHLHTPAGFDEAKKYPAIVVAHPISSCKEQ
                     TAAIYAAKLAELGYVALAFDASTQGASGGLGKYLEDPASRVEDFRCAADYLVTLDFVD
                     ENRIGVLGICGGGGYAVNAAMTDRRFKVVSTVVGANYGRLLREGDMSPDAAIKAMEAI
                     SQQRTAEARGGEVAITSYIPQSVDALKASGITDIDVTEAVDYYTTPRGQKPGSPNKLN
                     VTSTGAAFNWDAFHLADQLLTQPLQIIIGGGQPGIFGSFRDGYELFDKARSQTKNLFI
                     VPGATHYDLYDKPEYVDQAVARLKEFYSEYL"
     misc_feature    67641..68561
                     /locus_tag="BSVBI22_A0061"
                     /note="Hydrolases of the alpha/beta superfamily [General
                     function prediction only]; Region: COG1073"
                     /db_xref="CDD:223999"
     gene            68637..69335
                     /gene="frcK"
                     /locus_tag="BSVBI22_A0062"
                     /db_xref="GeneID:11728883"
     CDS             68637..69335
                     /gene="frcK"
                     /locus_tag="BSVBI22_A0062"
                     /note="identified by similarity to GP:11066210"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fructose transport system kinase"
                     /protein_id="YP_005153771.1"
                     /db_xref="GI:376279765"
                     /db_xref="GeneID:11728883"
                     /translation="MPLIKGQDESRKPDMTPFDMRPIEREALPSEILARLAKTEGRLI
                     VAIAGPPGAGKSTLSDYLLHAINKGGNAPSIIVPMDGFHIDDVILEQRGLLDRKGSPP
                     TFDCAGFSSLLQRLKGAEEEIFIPVFDRSLEFSRAAASVVGPEHRILLVEGNYLLLDR
                     EPWSRLAPFFDMTVYLDVPFAVLERRLTDRWLGFGFDAETARNRALSNDIPNAELVAA
                     QSRKAGFVVTFDAR"
     misc_feature    68676..69332
                     /gene="frcK"
                     /locus_tag="BSVBI22_A0062"
                     /note="nucleoside triphosphate hydrolase domain-containing
                     protein; Reviewed; Region: PRK09270"
                     /db_xref="CDD:236442"
     misc_feature    order(68781..68783,68796..68807)
                     /gene="frcK"
                     /locus_tag="BSVBI22_A0062"
                     /note="active site"
                     /db_xref="CDD:238977"
     gene            69435..70124
                     /locus_tag="BSVBI22_A0063"
                     /db_xref="GeneID:11728884"
     CDS             69435..70124
                     /locus_tag="BSVBI22_A0063"
                     /note="identified by match to protein family HMM PF01557"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="YP_005153772.1"
                     /db_xref="GI:376279766"
                     /db_xref="GeneID:11728884"
                     /translation="MTTYVFAPRPQTFLPVKGTDARFPVHRIYCVGQNYADHAIEMGG
                     DPTRNPPFFFQKNPDCLVIEGGDFPYPPKTEDVHHEIELVVALKSGGSDIPVEKALDH
                     VYGYAVGIDMTRRDLQAVAKKAGRPWEVAKAFEHSAPCSAVVPAAETGHPEQAAISLA
                     INGEMRQSGNLNQMIWKVPETISYLSSLFDLQPGDLIFTGTPAGVGPVKRGDRLEGKV
                     DGVGILSVTVV"
     misc_feature    69435..70121
                     /locus_tag="BSVBI22_A0063"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    69513..70121
                     /locus_tag="BSVBI22_A0063"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            70144..70335
                     /locus_tag="BSVBI22_A0064"
                     /db_xref="GeneID:11728885"
     CDS             70144..70335
                     /locus_tag="BSVBI22_A0064"
                     /note="identified by similarity to GP:15073555"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153773.1"
                     /db_xref="GI:376279767"
                     /db_xref="GeneID:11728885"
                     /translation="MSTYLPEDVHDALERFIAERYSGLNQTEAITLILRKWLTHERYL
                     SAEPEQGTPPEELNATNDD"
     gene            70397..70612
                     /locus_tag="BSVBI22_A0065"
                     /db_xref="GeneID:11728886"
     CDS             70397..70612
                     /locus_tag="BSVBI22_A0065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153774.1"
                     /db_xref="GI:376279768"
                     /db_xref="GeneID:11728886"
                     /translation="MTMAKQPQNGAGRKTALGRRLLILMIVAILLVIALVWMSIYLFD
                     PDGGINFDDLGIFAYDFNALIEWVARI"
     gene            70778..70966
                     /locus_tag="BSVBI22_A0066"
                     /db_xref="GeneID:11728887"
     CDS             70778..70966
                     /locus_tag="BSVBI22_A0066"
                     /note="identified by similarity to OMNI:NTL02ML3554"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153775.1"
                     /db_xref="GI:376279769"
                     /db_xref="GeneID:11728887"
                     /translation="MAFEDIKAEIALLFEQMVNQPQDAHEIRETVREKLNELKAAGLP
                     LPEDLVELEKRIEQDFDS"
     gene            70981..71844
                     /locus_tag="BSVBI22_A0067"
                     /db_xref="GeneID:11728888"
     CDS             70981..71844
                     /locus_tag="BSVBI22_A0067"
                     /note="identified by match to protein family HMM PF01464"
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="YP_005153776.1"
                     /db_xref="GI:376279770"
                     /db_xref="GeneID:11728888"
                     /translation="MRFALSSSSAAFARKGFMLVGCAVALSACNTTNDGNAVKTALIT
                     QTDNKAAAPGEQPSSAPLAAASDEAAPQTQTVAALPDPVLPDVVPIPGIRGQSEPMMA
                     YAGAQAAASPASIAANMAFETPESAPKDLDALITKYSVAYDVPERLVRRVVHRESRFN
                     PGARNGPYWGLMQISHPTARGMGYTGSAKGLLDAETNLKYAVRYLSGAYKVAGGDESQ
                     AVRYYARGYYYDAKRKGLLQETGLDGSWKRNGPTREAAASIQPASLPEGAAIPIPGVA
                     PIQASYAAAGQ"
     misc_feature    <71356..71691
                     /locus_tag="BSVBI22_A0067"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    71419..>71661
                     /locus_tag="BSVBI22_A0067"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    order(71446..71448,71503..71505,71590..71592,71647..71649)
                     /locus_tag="BSVBI22_A0067"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    71446..71448
                     /locus_tag="BSVBI22_A0067"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            72030..72686
                     /locus_tag="BSVBI22_A0068"
                     /db_xref="GeneID:11728889"
     CDS             72030..72686
                     /locus_tag="BSVBI22_A0068"
                     /note="identified by similarity to EGAD:38000; match to
                     protein family HMM PF03006"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin III family channel protein"
                     /protein_id="YP_005153777.1"
                     /db_xref="GI:376279771"
                     /db_xref="GeneID:11728889"
                     /translation="MNVRLPHPVKWKYDRAELWADGVIHVLGVGLALAGAIAMLFYFL
                     PNMPAVTSISSGVYLASLVAALGISAVYNIWPVSPTKWFLRRFDHSAIYLLIAGTYTP
                     FAIHMGDRALPLLLFVWSVAFVGIMLKLFMPGRFDRLSILLYLALGWSGVMVYDTMVQ
                     SLPPAVFWLIAAGGMVYSLGVIFHVWERLRFQNAIWHGFVVVGAALHYCAVFFVGAWN
                     "
     misc_feature    72030..72683
                     /locus_tag="BSVBI22_A0068"
                     /note="Predicted membrane protein, hemolysin III homolog
                     [General function prediction only]; Region: COG1272"
                     /db_xref="CDD:224191"
     gene            complement(72827..76060)
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /db_xref="GeneID:11728890"
     CDS             complement(72827..76060)
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="DNA polymerase involved in damage-induced
                     mutagenesis and translesion synthesis. It is not the major
                     replicative DNA polymerase."
                     /codon_start=1
                     /transl_table=11
                     /product="error-prone DNA polymerase"
                     /protein_id="YP_005153778.1"
                     /db_xref="GI:376279772"
                     /db_xref="GeneID:11728890"
                     /translation="MVPYFEMAAASNFSFLCGASHPQELVERAHALDLSGIGIADRNT
                     LAGVVRAHAQWKDIRKESGFRLFIGCRLSFIDGTPDMVVYPRDRAAYGQLCRLLTEGK
                     HRAAIKGECHLEWADLLFRARQFQIAVFPPDEDEPDFAARLTEIAQAAPGSVWLALTM
                     PHQGQDGRRAERIARFAAQAGVPLIATNDVLYHHPDRRPLQDVLTATRHHTTVFAAGR
                     LLEKNAERHLKPPHEMVRLFRDYPEAIAATADFVAPITFQLDELKYAYPDEPIPPGKT
                     AQQHLYDLVWEGAARHYGADIIPPKVQGLINKELALIARLEYEPYFLTVYDIVTHARE
                     KGILCQGRGSAANSVVCFCLGITGVNPTQVDLLFERFISAERKEPPDIDVDFEHERRE
                     EVMQYVYDRYSRDRAAIVATVISYRSRSAIRDVGKALGLSEDVTAALANTVWGLSGGG
                     IDRQHIRQAGLDPDNPIIQRAVELAITLIGFPRHLSQHVGGFVLARDRLDETVPIGPA
                     AMDKRSFIEWDKDDIDEVGLMKVDVLSLGMLTCIRKAFDLIHQHKPQLYGGEKLTLAS
                     LPREDKAVYDMLCKGDSLGVFQVESRAQMNMLPRLRPQEFYDLVIEVAIVRPGPIQGD
                     MVHPYLRRRSGQEPCTLPSPSPQHGPANELQQILGKTKGVPLFQEQAMRIAMEAAKFT
                     PEEANQLRRAMATFRKMGTIHTMEKKMIDGMVNRGYDRTFAENCFNQIKGFGEYGFPE
                     SHAASFAHLVYISAWLKCHHPEVFAAALLNSQPMVFYAPAQIVRDAREHGVTVLPVDV
                     NFSQWDNILEETPDVHLALRLGFRQIDGFSKRDTELLIADRQEPYRTIEDMHRRLRLD
                     RRAFTLLADADAFGSLDIDRRAALWAVRRLPNDETLPLFRAAAASELAQEPRTKLPEM
                     AASEHVIADYETTRLSLKGHPLQYLREGLAAEGVSTCRAVQEGADGRRMKVAGVVTVR
                     QRPGSAKGVVFLTIEDETGIANIVIWPKIMKVFRREVMSARLIHIEGRIQRSLEGVVH
                     LVAAKLQDRSAALIEMSGREAQRLIAPSQMAHHPRNVRVMPNSRDFH"
     misc_feature    complement(72830..76060)
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="error-prone DNA polymerase; Validated; Region:
                     dnaE2; PRK05672"
                     /db_xref="CDD:235553"
     misc_feature    complement(75260..76051)
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="Polymerase and Histidinol Phosphatase domain of
                     alpha-subunit of bacterial polymerase III at DnaE2 gene;
                     Region: PHP_PolIIIA_DnaE2; cd07434"
                     /db_xref="CDD:213989"
     misc_feature    complement(order(75488..75490,75494..75496,75848..75850,
                     75935..75937,76010..76012,76031..76033,76037..76039))
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="putative active site [active]"
                     /db_xref="CDD:213989"
     misc_feature    complement(order(75293..75295,75863..75871,75893..75895))
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="putative PHP Thumb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213989"
     misc_feature    complement(73910..75226)
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="Bacterial DNA polymerase III alpha subunit; Region:
                     DNA_pol3_alpha; pfam07733"
                     /db_xref="CDD:254393"
     misc_feature    complement(73421..73693)
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="Helix-hairpin-helix motif; Region: HHH_6;
                     pfam14579"
                     /db_xref="CDD:258717"
     misc_feature    complement(72923..73171)
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="DnaE_OBF: A subfamily of OB folds corresponding to
                     the C-terminal OB-fold nucleic acid binding domain of
                     Thermus aquaticus and Escherichia coli type C replicative
                     DNA polymerase III alpha subunit (DnaE). The DNA
                     polymerase holoenzyme of E. coli contains...; Region:
                     DnaE_OBF; cd04485"
                     /db_xref="CDD:239931"
     misc_feature    complement(order(72950..72952,73007..73009,73013..73015,
                     73019..73021,73169..73171))
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239931"
     misc_feature    complement(order(72965..72973,72995..73003,73022..73024,
                     73067..73069,73073..73081,73097..73099,73103..73114,
                     73148..73156))
                     /gene="dnaE2"
                     /locus_tag="BSVBI22_A0069"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239931"
     gene            complement(76060..77511)
                     /locus_tag="BSVBI22_A0070"
                     /db_xref="GeneID:11728891"
     CDS             complement(76060..77511)
                     /locus_tag="BSVBI22_A0070"
                     /note="identified by similarity to GP:14523587"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153779.1"
                     /db_xref="GI:376279773"
                     /db_xref="GeneID:11728891"
                     /translation="MTERTANALRLTAVDGEAAKLGLFPGMALTDARARVERLDVAAA
                     APEHDTALLKRLAQWCERYTPLVAFDEPHGLMLDITGCAHLFGGPAAMRADALCRFER
                     AGLHVQAAIADNSFAARLLARGTKGGVFSQAEADRLLPRLPLSALELAQAAETGLKRA
                     GLKRIGDVMALPRSALTARFGTDLATRLDRLARRERAPISPLRILPLRTVERRLSEPV
                     TAMELVEHILRELAQALFAQLEMEGKGALLLEASFFRVDGEVRHIRIETGQPLRDDRI
                     FLRLARERLGALTDPLDAGFGFDMIRLAALRSSTVAQRQTGLDQHEEDEAGFSQLIDR
                     LSARLGQDRVLVSFPRDTHMPERAYGLAPALHGSRKTEADYRSQAELPGDSPARPIKL
                     FRPPQLIETVAEVPDSPPSFFLWRRVRHQVRLAEGPERIEPEWWCAIGQDVPELRDYY
                     RVEDENGQRFWIFREGLYDGANHPRWFLHGLFA"
     misc_feature    complement(76591..77490)
                     /locus_tag="BSVBI22_A0070"
                     /note="DNA Polymerase Y-family; Region: PolY_like;
                     cd03468"
                     /db_xref="CDD:176458"
     misc_feature    complement(order(77134..77136,77290..77295,77455..77457,
                     77464..77466))
                     /locus_tag="BSVBI22_A0070"
                     /note="active site"
                     /db_xref="CDD:176458"
     misc_feature    complement(76204..77370)
                     /locus_tag="BSVBI22_A0070"
                     /note="Nucleotidyltransferase/DNA polymerase involved in
                     DNA repair [DNA replication, recombination, and repair];
                     Region: DinP; COG0389"
                     /db_xref="CDD:223466"
     misc_feature    complement(order(76690..76692,76696..76710,76786..76788,
                     76879..76896,76966..76968,77053..77073,77290..77292,
                     77299..77301))
                     /locus_tag="BSVBI22_A0070"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176458"
     gene            complement(77537..78400)
                     /locus_tag="BSVBI22_A0071"
                     /db_xref="GeneID:11728892"
     CDS             complement(77537..78400)
                     /locus_tag="BSVBI22_A0071"
                     /note="identified by similarity to GP:15076199"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153780.1"
                     /db_xref="GI:376279774"
                     /db_xref="GeneID:11728892"
                     /translation="MSGINIAALRRMVTGIEGNDPQGSFANGRGRETGSGKGSGFGRA
                     RSFTLGFAPADAAFPHGLAGDALHEIFAENPGAHMVATGFALAFAARAAKPQRPIIWI
                     EEESAAQEYGWLYPPGLHAFGIDPARLLIVRCPTAQDVLKAANDALEAGSGGKASHLV
                     SGIVASITGQPKCLDLTVSRRLLLATEAAQLPVILLRSHRTAVQSAAVSRWRVAPAPS
                     RSSGANAPGKPAFSAVLERNRHGTCGQWIMEWNNETLEFGARERDGRTLVSRPLVSVS
                     ADRPASPRRSA"
     misc_feature    complement(77540..78367)
                     /locus_tag="BSVBI22_A0071"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG4544"
                     /db_xref="CDD:226918"
     gene            78919..81141
                     /locus_tag="BSVBI22_A0072"
                     /db_xref="GeneID:11728893"
     CDS             78919..81141
                     /locus_tag="BSVBI22_A0072"
                     /note="identified by similarity to SP:P10858; match to
                     protein family HMM PF03895; match to protein family HMM
                     PF05658; match to protein family HMM PF05662"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_005153781.1"
                     /db_xref="GI:376279775"
                     /db_xref="GeneID:11728893"
                     /translation="MFGLSVNHAYAGPGIFINDGTDDGCIWTFDKEDYSPIGDYFGNT
                     APADKDSAGRNSPASVKYHIPSIQQLGGAATLKCLSKDRDTQTDRVLFYGNSKEQGSI
                     SLTLGGELFVNNGNLGLGGGTDTKAMRIGSMATLTGPSGLRSLAIGAGEIATVASGDD
                     AIAIGTAAQAAHVGSIALGLQSTTELPSLVKDVTINGIKLSAFAGSNPASVLSIGNDT
                     LKRSITNVGAGRVSKDSTDAVNGRQLFAVSEQAASGWSLTVNGMDKSRVGPGDTVDLS
                     NSDGNLVLSKKGKDVTFNLASDLKVTSLVAGNTFLDTNGLVITGGPSMTVSGIDAGQL
                     KISHVADGAVTVTSTDAVNGSQLHRVAHTIAEHLGGDAHVNADGSVIGPQYTVQKKRY
                     KTIYDAFGGVDENLANINDILHDIESGGGIKYFHANSIGADSRALGTNSIAVGSDSVA
                     SGEGSISVGNGAQASAHGSVALGENAAAPDANSVALGAGSKTSEVVATKGTTINGQYY
                     DFAGDAPSGTVSVGDKGAERTITNVAAGRISVESTDAVNGSQLNAVNQAIENLAAGVT
                     ENDKFSVKYDRHSDGTKKNSMTLQGWDSATPVVLANVADGVHKNDAVNVSQLKAGLST
                     TLGEAKAYTDQTALQTLDQANAYTDKKFGKLNEDIVATRIEARQAAAIGLAAASLRYD
                     DRPGKISAAIGGGFWRGEGAVALGLGHTSEDQRMRSNLSAATSGGNWGMGAGFSYTFN
                     "
     misc_feature    79354..81135
                     /locus_tag="BSVBI22_A0072"
                     /note="Autotransporter adhesin [Intracellular trafficking
                     and secretion / Extracellular structures]; Region: Hia;
                     COG5295"
                     /db_xref="CDD:227614"
     misc_feature    <80194..80397
                     /locus_tag="BSVBI22_A0072"
                     /note="Left-handed beta-roll, including virulence factors
                     and various other proteins; Region: LbR-like; cl17507"
                     /db_xref="CDD:248061"
     misc_feature    order(80194..80196,80200..80202,80206..80208,80212..80214,
                     80236..80238,80242..80244,80248..80250,80254..80256,
                     80278..80280,80284..80286,80290..80298,80320..80322,
                     80326..80328)
                     /locus_tag="BSVBI22_A0072"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240610"
     misc_feature    80500..80571
                     /locus_tag="BSVBI22_A0072"
                     /note="Coiled stalk of trimeric autotransporter adhesin;
                     Region: YadA_stalk; pfam05662"
                     /db_xref="CDD:114389"
     misc_feature    80902..81135
                     /locus_tag="BSVBI22_A0072"
                     /note="YadA-like C-terminal region; Region: YadA_anchor;
                     pfam03895"
                     /db_xref="CDD:252233"
     gene            81350..81898
                     /locus_tag="BSVBI22_A0073"
                     /db_xref="GeneID:11728894"
     CDS             81350..81898
                     /locus_tag="BSVBI22_A0073"
                     /note="identified by similarity to GP:15073388"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153782.1"
                     /db_xref="GI:376279776"
                     /db_xref="GeneID:11728894"
                     /translation="MRKNKQPPAPPSVYTQTPGFAVKSTEIMVPDGVSAGEYRRITHP
                     FPNWTLVCDENLKAKKRVCNITQTIMHEKGLVVFSWSLAAAENGKPYMIMRIPAVVGA
                     RQEIRLDFGDGTPIIVSKTHGCEGAVCIAYLPVGPRLRVYIAKGSVPKVSYPVPDIRR
                     GSADWLMFYAPLSGLAHALAAI"
     misc_feature    81482..81895
                     /locus_tag="BSVBI22_A0073"
                     /note="Invasion associated locus B (IalB) protein; Region:
                     IalB; cl02207"
                     /db_xref="CDD:261215"
     gene            complement(81977..83197)
                     /gene="argG"
                     /locus_tag="BSVBI22_A0074"
                     /db_xref="GeneID:11728895"
     CDS             complement(81977..83197)
                     /gene="argG"
                     /locus_tag="BSVBI22_A0074"
                     /note="catalyzes the formation of
                     2-N(omega)-(L-arginino)succinate from L-citrulline and
                     L-aspartate in arginine biosynthesis, AMP-forming"
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate synthase"
                     /protein_id="YP_005153783.1"
                     /db_xref="GI:376279777"
                     /db_xref="GeneID:11728895"
                     /translation="MSKWKDVKKVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQ
                     GEELEPARKKAEMLGIKEIFIEDVREEFVRDFVFPMFRANAVYEGVYLLGTSIARPLI
                     SKHLIDIAKKTGADAIAHGATGKGNDQVRFELSAYALNPDIKIIAPWRDWSFKSRTQL
                     LEFAEQHQIPVAKDKKGEAPFSVDANLLHSSSEGKVLEDPSQEAPEYVHMRTISPETA
                     PDKATIIKIGFEKGDAVSINGERLSPATLLAKLNDYGRDNGIGRLDLVENRFVGMKSR
                     GVYETPGGTILLAAHRAIESITLDRGAAHLKDELMPRYAELIYYGFWFSPEREMLQAA
                     IDHSQHHVEGEVTLKLYKGNVMVIGRESAKSLYSDKLVTFEDDQGAYDQKDAAGFIKL
                     NALRLRTLAARDRK"
     misc_feature    complement(82010..83170)
                     /gene="argG"
                     /locus_tag="BSVBI22_A0074"
                     /note="Argininosuccinate synthase. The Argininosuccinate
                     synthase is a urea cycle enzyme that catalyzes the
                     penultimate step in arginine biosynthesis: the
                     ATP-dependent ligation of citrulline to aspartate to form
                     argininosuccinate, AMP and pyrophosphate .  In...; Region:
                     Argininosuccinate_Synthase; cd01999"
                     /db_xref="CDD:238957"
     misc_feature    complement(order(82649..82654,82802..82804,82835..82837,
                     82901..82903,83066..83068,83078..83080,83084..83086,
                     83138..83140,83159..83161))
                     /gene="argG"
                     /locus_tag="BSVBI22_A0074"
                     /note="ANP binding site [chemical binding]; other site"
                     /db_xref="CDD:238957"
     misc_feature    complement(order(82241..82243,82361..82363,82397..82399,
                     82619..82621,82625..82627,82646..82654,82805..82807,
                     82817..82819,82910..82915,82925..82927))
                     /gene="argG"
                     /locus_tag="BSVBI22_A0074"
                     /note="Substrate Binding Site II [chemical binding]; other
                     site"
                     /db_xref="CDD:238957"
     misc_feature    complement(order(82814..82822,82829..82834))
                     /gene="argG"
                     /locus_tag="BSVBI22_A0074"
                     /note="Substrate Binding Site I [chemical binding]; other
                     site"
                     /db_xref="CDD:238957"
     gene            83294..84043
                     /locus_tag="BSVBI22_A0075"
                     /note="amino acid efflux protein, LysE family, putative,
                     authentic point mutation; this gene contains a premature
                     stop which is not the result of sequencing
                     error;identified by similarity to OMNI:NTL02ML3358"
                     /pseudo
                     /db_xref="GeneID:11728896"
     gene            complement(84047..84550)
                     /locus_tag="BSVBI22_A0076"
                     /db_xref="GeneID:11728897"
     CDS             complement(84047..84550)
                     /locus_tag="BSVBI22_A0076"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153784.1"
                     /db_xref="GI:376279778"
                     /db_xref="GeneID:11728897"
                     /translation="MNDTFDYIMRFAIVVFSYCCAVLAVGWFLAAILFRNLGIDSMMN
                     DFVFMANDAGVGPFWAETSFWSSVFVSGFVMATIAGGFSFIPAVIIIILAEARGYRES
                     LFYCVAGALIGLAAAGAAVPFSSSSGLPEMSIWIAATTGAGIVGGFVYWLLAGRNAGR
                     LLSRPTD"
     gene            complement(84584..85819)
                     /locus_tag="BSVBI22_A0077"
                     /db_xref="GeneID:11728898"
     CDS             complement(84584..85819)
                     /locus_tag="BSVBI22_A0077"
                     /note="identified by similarity to OMNI:NTL02ML3355; match
                     to protein family HMM PF04055; match to protein family HMM
                     TIGR00048"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153785.1"
                     /db_xref="GI:376279779"
                     /db_xref="GeneID:11728898"
                     /translation="MSISFDLTIDDTRDQLARHARASLEAKPSLIGMSREEMAAALIA
                     AGVPERQVKMRISQLWHWLYVRGVSDFADMRNISKDLRAMLAQHFTIARPEVVEEQIS
                     QDGTRKWLFRFPPRGAGRPVEIESVYIPEEGRGTLCISSQVGCTLTCSFCHTGTQKLV
                     RNLTSEEILAQLLTARDRLGDFPDKDTPDGAMVPAEGRKITNIVMMGMGEPLYNFEEV
                     KKALLIASDGDGPSLSKRRITLSTSGVVPEIYRTGDEIGVMLAISLHAVRDELRDILV
                     PINKKYPLAELIKACREYPGLSNAKRITFEYVMLKDINDSLDDAKLLVKLLQGIPAKI
                     NLIPFNPWPGTNYQCSDWEQIEKFADYVNAAGYASPIRTPRGRDILAACGQLKSESER
                     LRKSERLALEAMMIAGHGE"
     misc_feature    complement(84635..85741)
                     /locus_tag="BSVBI22_A0077"
                     /note="Predicted Fe-S-cluster redox enzyme [General
                     function prediction only]; Region: COG0820"
                     /db_xref="CDD:223890"
     misc_feature    complement(84761..85390)
                     /locus_tag="BSVBI22_A0077"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(84803..84808,84896..84898,85031..85033,
                     85091..85099,85190..85195,85199..85201,85361..85369,
                     85373..85375,85379..85381,85385..85387))
                     /locus_tag="BSVBI22_A0077"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            85763..85954
                     /locus_tag="BSVBI22_A0078"
                     /db_xref="GeneID:11728899"
     CDS             85763..85954
                     /locus_tag="BSVBI22_A0078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153786.1"
                     /db_xref="GI:376279780"
                     /db_xref="GeneID:11728899"
                     /translation="MAGKLVARIINGKVERNGHLFSTIAGRPRSRAPIKLPDYLGRLH
                     EYMGSIIFPCEMRTRWRGS"
     gene            85939..86133
                     /locus_tag="BSVBI22_A0079"
                     /db_xref="GeneID:11728900"
     CDS             85939..86133
                     /locus_tag="BSVBI22_A0079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153787.1"
                     /db_xref="GI:376279781"
                     /db_xref="GeneID:11728900"
                     /translation="MARLLAQNNPLVIPHEIWRVVQDCGDGRKRKKPGTKPGFEVLPD
                     LLDYLHFWIAASAAEMPFRE"
     gene            complement(86079..86582)
                     /locus_tag="BSVBI22_A0080"
                     /db_xref="GeneID:11728901"
     CDS             complement(86079..86582)
                     /locus_tag="BSVBI22_A0080"
                     /note="identified by similarity to GP:15076241"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153788.1"
                     /db_xref="GI:376279782"
                     /db_xref="GeneID:11728901"
                     /translation="MLGKSIVAASVFTIAMAGSALAQTPSQIKQFDAWGAYSYQSGNG
                     KVCYALSVPTQKAPANVDHGDNFFLVSQKPGQNVSFEPQFMAGYELNPNAKVIVTIGN
                     RNFTMFVNGKSGWIENAAEEPQLVAAMRGGADMKVQAQSKRGTKTSYTYSLKGISAAL
                     AAIQKCK"
     misc_feature    complement(<86103..86537)
                     /locus_tag="BSVBI22_A0080"
                     /note="Protein of unknown function (DUF1176); Region:
                     DUF1176; pfam06674"
                     /db_xref="CDD:253852"
     misc_feature    complement(86094..>86216)
                     /locus_tag="BSVBI22_A0080"
                     /note="Invasion associated locus B (IalB) protein; Region:
                     IalB; cl02207"
                     /db_xref="CDD:261215"
     gene            complement(87014..87397)
                     /locus_tag="BSVBI22_A0081"
                     /db_xref="GeneID:11728902"
     CDS             complement(87014..87397)
                     /locus_tag="BSVBI22_A0081"
                     /note="identified by similarity to GP:15076242"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153789.1"
                     /db_xref="GI:376279783"
                     /db_xref="GeneID:11728902"
                     /translation="MDDVKIGEILEPGDESRFRKRSERVKQGFWKAVRRAGRMVPFMD
                     EVVAAYYCALDQKTPMRVRMTLMAALAYFVLPFDAIPDILAGIGFTDDVAVLMAALTA
                     VRAHITPAHRLAARQALEDEAAVGQ"
     misc_feature    complement(87017..87361)
                     /locus_tag="BSVBI22_A0081"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3339"
                     /db_xref="CDD:225876"
     gene            complement(87485..87778)
                     /gene="phhB"
                     /locus_tag="BSVBI22_A0082"
                     /db_xref="GeneID:11728903"
     CDS             complement(87485..87778)
                     /gene="phhB"
                     /locus_tag="BSVBI22_A0082"
                     /note="4-alpha-hydroxytetrahydrobiopterin dehydratase
                     activity; catalyzes the formation of
                     (6R)-6-(L-erythro-1,2-dihydroxypropyl)-7,
                     8-dihydro-6H-pterin from
                     (6R)-6-(L-erythro-1,2-dihydroxypropyl)-5,6,7,
                     8-tetrahydro-4a-hydroxypterin; functions in recycling
                     tetrahydrobiopterin (BH4) in phenylalanine hydroxylase
                     reaction"
                     /codon_start=1
                     /transl_table=11
                     /product="pterin-4-alpha-carbinolamine dehydratase"
                     /protein_id="YP_005153790.1"
                     /db_xref="GI:376279784"
                     /db_xref="GeneID:11728903"
                     /translation="MARNRLTESEMNEALRALDGWQKVDGREAITRSFKFKDFSTAFG
                     FMAQAALYAEKLDHHPEWFNAYNRVDVTLATHSENGVTELDIKMARKMNAIAG"
     misc_feature    complement(87494..87721)
                     /gene="phhB"
                     /locus_tag="BSVBI22_A0082"
                     /note="PCD_DCoH: The bifunctional protein
                     pterin-4alpha-carbinolamine dehydratase (PCD), also known
                     as DCoH  (dimerization cofactor of hepatocyte nuclear
                     factor-1), is both a transcription activator and a
                     metabolic enzyme.  DCoH stimulates gene expression by...;
                     Region: PCD_DCoH_subfamily_b; cd00914"
                     /db_xref="CDD:238456"
     misc_feature    complement(order(87551..87553,87593..87595,87602..87604,
                     87650..87652,87662..87664))
                     /gene="phhB"
                     /locus_tag="BSVBI22_A0082"
                     /note="aromatic arch; other site"
                     /db_xref="CDD:238456"
     misc_feature    complement(order(87581..87604,87617..87619,87662..87664))
                     /gene="phhB"
                     /locus_tag="BSVBI22_A0082"
                     /note="DCoH dimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:238456"
     misc_feature    complement(order(87614..87619,87626..87628,87635..87640,
                     87656..87661))
                     /gene="phhB"
                     /locus_tag="BSVBI22_A0082"
                     /note="DCoH /HNF-1 dimer interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238456"
     misc_feature    complement(order(87614..87616,87626..87628,87635..87640,
                     87659..87661))
                     /gene="phhB"
                     /locus_tag="BSVBI22_A0082"
                     /note="DCoH tetramer interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238456"
     misc_feature    complement(order(87548..87553,87557..87559,87602..87610))
                     /gene="phhB"
                     /locus_tag="BSVBI22_A0082"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238456"
     gene            88005..88610
                     /locus_tag="BSVBI22_A0083"
                     /db_xref="GeneID:11728904"
     CDS             88005..88610
                     /locus_tag="BSVBI22_A0083"
                     /note="identified by match to protein family HMM PF01451"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotyrosine protein phosphatase"
                     /protein_id="YP_005153791.1"
                     /db_xref="GI:376279785"
                     /db_xref="GeneID:11728904"
                     /translation="MCRNALVKINFTAVVSPVQKQNTLAPNHMLIRHYSLAPTSVLFV
                     CAGNICRSPLAEGVMGYVLEKRGIRHVLIDSAGTNGYHTGEEPDERSIQVAAHHGLDI
                     SAQRCRQLTMADFSRFDLILGMDRYNMRMITQRQPARITARIGLFTEVAEGKPVEIPD
                     PYYGEIGDFELVYRMVLTASTALADQFWPERAIKGQASSTI"
     misc_feature    88119..88559
                     /locus_tag="BSVBI22_A0083"
                     /note="Low molecular weight phosphatase family; Region:
                     LMWPc; cd00115"
                     /db_xref="CDD:238063"
     misc_feature    order(88137..88139,88143..88148,88152..88160)
                     /locus_tag="BSVBI22_A0083"
                     /note="active site"
                     /db_xref="CDD:238063"
     gene            complement(88520..89110)
                     /locus_tag="BSVBI22_A0084"
                     /db_xref="GeneID:11728905"
     CDS             complement(88520..89110)
                     /locus_tag="BSVBI22_A0084"
                     /note="identified by similarity to OMNI:NTL02ML3347"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153792.1"
                     /db_xref="GI:376279786"
                     /db_xref="GeneID:11728905"
                     /translation="MPRLFTALEIPRDAALSLSLLRGGLPGARWIDVENYHITLRFIG
                     DVEGHMADEIANALDRVRRPEFMLNLSGVDAFGSKKPHSIYAGVSPSPGLNALQAEIE
                     RICQRLRLPADPRKFTPHVTLARLKNARIEDVVHYLSGRANFATLPFKVGRFVLMSSR
                     DSVGGGPYIVEEAWPLMARSGQNWSASAVEAVRTIR"
     misc_feature    complement(88583..89107)
                     /locus_tag="BSVBI22_A0084"
                     /note="2'-5' RNA ligase; Region: 2_5_ligase; TIGR02258"
                     /db_xref="CDD:233802"
     misc_feature    complement(88856..>89032)
                     /locus_tag="BSVBI22_A0084"
                     /note="LigT like Phosphoesterase; Region: LigT_PEase;
                     pfam02834"
                     /db_xref="CDD:251562"
     misc_feature    complement(88619..88846)
                     /locus_tag="BSVBI22_A0084"
                     /note="LigT like Phosphoesterase; Region: LigT_PEase;
                     pfam02834"
                     /db_xref="CDD:251562"
     gene            complement(89291..90016)
                     /locus_tag="BSVBI22_A0085"
                     /db_xref="GeneID:11728906"
     CDS             complement(89291..90016)
                     /locus_tag="BSVBI22_A0085"
                     /note="identified by match to protein family HMM PF00657"
                     /codon_start=1
                     /transl_table=11
                     /product="lipase/acylhydrolase domain-containing protein"
                     /protein_id="YP_005153793.1"
                     /db_xref="GI:376279787"
                     /db_xref="GeneID:11728906"
                     /translation="MMRFKLQIPAAAMLKALLVSLLALFVAAASASAQEEPTGLEDAL
                     PTEQLSQVKIVGFGDSLMAGYLLPSNAAFPQQLEKALNDKGYEVTVENAGVSGDTTTG
                     GLSRIDWSIPDGTNLVILELGANDALRGIQPDITEKNLDEMLAKLKARGISVILAGMV
                     APPNMGKDYAGKFNPIYPRLARKYDVPLYPFFLDGVATRKGLLLEDGMHPNEKGVETI
                     VANFMPSVEKALKNLQNTGTSGG"
     misc_feature    complement(89336..89863)
                     /locus_tag="BSVBI22_A0085"
                     /note="Lysophospholipase L1-like subgroup of
                     SGNH-hydrolases. The best characterized member in this
                     family is TesA, an E. coli periplasmic protein with
                     thioesterase, esterase, arylesterase, protease and
                     lysophospholipase activity; Region:
                     Lysophospholipase_L1_like; cd01822"
                     /db_xref="CDD:238860"
     misc_feature    complement(order(89390..89392,89399..89401,89642..89644,
                     89726..89728,89837..89839))
                     /locus_tag="BSVBI22_A0085"
                     /note="active site"
                     /db_xref="CDD:238860"
     misc_feature    complement(order(89390..89392,89399..89401,89837..89839))
                     /locus_tag="BSVBI22_A0085"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238860"
     misc_feature    complement(order(89642..89644,89726..89728,89837..89839))
                     /locus_tag="BSVBI22_A0085"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238860"
     misc_feature    complement(89621..89638)
                     /locus_tag="BSVBI22_A0085"
                     /note="switch loop; other site"
                     /db_xref="CDD:238860"
     gene            90163..90891
                     /locus_tag="BSVBI22_A0086"
                     /db_xref="GeneID:11728907"
     CDS             90163..90891
                     /locus_tag="BSVBI22_A0086"
                     /note="identified by match to protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_005153794.1"
                     /db_xref="GI:376279788"
                     /db_xref="GeneID:11728907"
                     /translation="MTEKLVGPIIELEDVHLTLGHAASSVHVLKGVSLHIAPGQSVGI
                     VGPSGSGKSTLLMVLAGLEHVDNGIVKIAGETISQMSEDQAAAFRGANIGIVFQSFHL
                     IPNMTALENVAVPLELAGRRDAFDVAERELRAVGLGERLTHYPSELSGGEQQRVAIAR
                     ALAPSPKILIADEPTGNLDTATGRQIADLLFAKQRENGLTMVLVTHDPSLAARCDREI
                     PVRSGRIAEPVQGAGIPETQAVRA"
     misc_feature    90187..90849
                     /locus_tag="BSVBI22_A0086"
                     /note="Predicted ABC-type transport system involved in
                     lysophospholipase L1 biosynthesis, ATPase component
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG4181"
                     /db_xref="CDD:226647"
     misc_feature    90190..90837
                     /locus_tag="BSVBI22_A0086"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    90298..90321
                     /locus_tag="BSVBI22_A0086"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    order(90307..90312,90316..90324,90454..90456,90676..90681,
                     90778..90780)
                     /locus_tag="BSVBI22_A0086"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    90445..90456
                     /locus_tag="BSVBI22_A0086"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    90604..90633
                     /locus_tag="BSVBI22_A0086"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    90664..90681
                     /locus_tag="BSVBI22_A0086"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    90688..90699
                     /locus_tag="BSVBI22_A0086"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    90766..90786
                     /locus_tag="BSVBI22_A0086"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            90888..93437
                     /locus_tag="BSVBI22_A0087"
                     /db_xref="GeneID:11728908"
     CDS             90888..93437
                     /locus_tag="BSVBI22_A0087"
                     /note="identified by match to protein family HMM PF02687"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005153795.1"
                     /db_xref="GI:376279789"
                     /db_xref="GeneID:11728908"
                     /translation="MNSARSFSLALRFALREMRGGLSGFYIFLACIALGVAAIGGVNS
                     VARSVSSGITAQGQSILGGDISFALNQREVTPAERAFIEKQGKMAASATMRSMARMPD
                     GSDQSLVEVKAVNDAYPLYGTLKVSPQQSLADMTREKDGAYGAAVSRDFLDRMGLSLG
                     ARVLLGSQTFELRALIENEPDLLSSGFNFAPRFLVSLEGLHAAGLVQPGSLVNHIYKV
                     ALPDGAPDAAIANVRRQAATGFPDAGWNIRTRANAAPALSANVERFSRFLTLVGLTAL
                     IVGGVGVANAVRAYLDGKRGVIATFKSLGAPARFAVLVYLIQIMVIGLIGIAIGLVLA
                     AIIPYATGAALAAYLPVAAGGGFFPGALALAAIFGLVTTLAFAIIPLGRARDIPATAL
                     FREQGGEQRGRPALFYLGLAILLIAALAGLALYVAYDRHIAAIFIVSAIAAFGVLRLV
                     ADGIRWLARRAPRVRSTALRLAVGNIHRPGALTPSVVLSLGLGLTLMVAIALIDGNLR
                     RQVTENIPAQAPDFFFVDIQNKDMGDFTKLVRGIVPDGKLTSGPMLRGRIVAFNGQNV
                     RDMKIPPEAAWVLRGDRGITFAEKVPENATLSEGAWWPADYSGEPLVSFSGREGKELG
                     LKLGDRVTVNVLGRNITAKIASFREVQWETLAMNFVMVFSPNTFAGAPATWLATLTIP
                     DGEKNLAPDVLRQVTKTWPAITTVSVSDALDVANNLLSQLATAIRAAASIALAASVLV
                     LGGALAAGNRARVHDAVVLKTLGATRATLIAAYVMEYMLLGLATAIFALVAGGVAGWY
                     VVVEIMKLKAIFLPDVALMTVVIALVLTVGFGLAGTWRVLGQKPAQVLRSL"
     misc_feature    90906..93434
                     /locus_tag="BSVBI22_A0087"
                     /note="Predicted ABC-type transport system involved in
                     lysophospholipase L1 biosynthesis, permease component
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG3127"
                     /db_xref="CDD:225669"
     misc_feature    91695..92051
                     /locus_tag="BSVBI22_A0087"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     misc_feature    <93159..93413
                     /locus_tag="BSVBI22_A0087"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            93671..94408
                     /locus_tag="BSVBI22_A0088"
                     /db_xref="GeneID:11728909"
     CDS             93671..94408
                     /locus_tag="BSVBI22_A0088"
                     /note="identified by similarity to GP:15076248; match to
                     protein family HMM PF01027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153796.1"
                     /db_xref="GI:376279790"
                     /db_xref="GeneID:11728909"
                     /translation="MADFRNIQAQQRPVGGARADAGIDQGLRSYMLGVYNMMAIGLAV
                     TGLAAFGTAVLAQSNPAFQQLLFASPLRWVIMLAPLAAVFFLSFRIQSLSVGTAQAIF
                     WGYAALVGLSLSSIFIVFTGQSIVRTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMG
                     LFGLILASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQEIKEMYYEGDAADTQGRK
                     IVMGALRLYLDFINMFMFLLQFMGNRE"
     misc_feature    93746..94396
                     /locus_tag="BSVBI22_A0088"
                     /note="Bacterial BAX inhibitor (BI)-1/YccA-like proteins;
                     Region: BI-1-like_bacterial; cd10432"
                     /db_xref="CDD:198414"
     gene            94523..95062
                     /gene="pat"
                     /locus_tag="BSVBI22_A0089"
                     /db_xref="GeneID:11728910"
     CDS             94523..95062
                     /gene="pat"
                     /locus_tag="BSVBI22_A0089"
                     /note="identified by similarity to EGAD:8993; match to
                     protein family HMM PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphinothricin N-acetyltransferase"
                     /protein_id="YP_005153797.1"
                     /db_xref="GI:376279791"
                     /db_xref="GeneID:11728910"
                     /translation="MPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRF
                     AAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLL
                     RELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVL
                     MQLPLNGGRSTEPGPSPLS"
     misc_feature    94529..94942
                     /gene="pat"
                     /locus_tag="BSVBI22_A0089"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    94682..94873
                     /gene="pat"
                     /locus_tag="BSVBI22_A0089"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    <94778..95017
                     /gene="pat"
                     /locus_tag="BSVBI22_A0089"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     misc_feature    order(94778..94786,94814..94819)
                     /gene="pat"
                     /locus_tag="BSVBI22_A0089"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(95082..95483)
                     /locus_tag="BSVBI22_A0090"
                     /db_xref="GeneID:11728911"
     CDS             complement(95082..95483)
                     /locus_tag="BSVBI22_A0090"
                     /note="identified by similarity to GP:15076253"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153798.1"
                     /db_xref="GI:376279792"
                     /db_xref="GeneID:11728911"
                     /translation="MDISSAANEDSSSLSSHTSETAKVVPLDRPRPTPSTISFDRHEL
                     GKILNIYGRMVATGAWRDYAIDHLSDRAVFSIFRRASEVPLFRIEKNPKLQQKQGAYS
                     VIAASGLIMKRGHELERVLRVFDKSLKLVET"
     misc_feature    complement(95121..95375)
                     /locus_tag="BSVBI22_A0090"
                     /note="Protein of unknown function (DUF2794); Region:
                     DUF2794; pfam10984"
                     /db_xref="CDD:204571"
     gene            complement(96033..96767)
                     /locus_tag="BSVBI22_A0091"
                     /db_xref="GeneID:11728912"
     CDS             complement(96033..96767)
                     /locus_tag="BSVBI22_A0091"
                     /note="identified by similarity to GP:15076254"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153799.1"
                     /db_xref="GI:376279793"
                     /db_xref="GeneID:11728912"
                     /translation="MGLTFTGCVFIQGSARAQDGNKATAVLELYTSQGCKSCPPADKN
                     FAKYADDPNVLALSFHVNYWDYMGWRDTLATQDNTDRQNSYRNAFHAKMIYTPQAIIN
                     GAVEANGRNGAAINAKIAANKLDVPVSIQQLNDGRLSIDIGAGKKPRDPVHVVLFYFR
                     DSATIPITEGENAGKAVTYRNTVSDIDTIGMWDGKPLKIELPASELKRKDVTGCAVVL
                     QETRSDNSLGPMHGAAMFKQKRPVSF"
     misc_feature    complement(96042..96767)
                     /locus_tag="BSVBI22_A0091"
                     /note="Uncharacterized secreted protein [Function
                     unknown]; Region: COG5429"
                     /db_xref="CDD:227716"
     gene            complement(96920..97060)
                     /locus_tag="BSVBI22_A0092"
                     /db_xref="GeneID:11728913"
     CDS             complement(96920..97060)
                     /locus_tag="BSVBI22_A0092"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153800.1"
                     /db_xref="GI:376279794"
                     /db_xref="GeneID:11728913"
                     /translation="MTSSLNQTRNKNGEPPEKSGGFSFGAPNMGTTMAIAARPAPSLT
                     AT"
     gene            complement(97044..99731)
                     /gene="acnA"
                     /locus_tag="BSVBI22_A0093"
                     /db_xref="GeneID:11728914"
     CDS             complement(97044..99731)
                     /gene="acnA"
                     /locus_tag="BSVBI22_A0093"
                     /note="Catalyzes the conversion of citrate to isocitrate"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="YP_005153801.1"
                     /db_xref="GI:376279795"
                     /db_xref="GeneID:11728914"
                     /translation="MSQIDSFKCRKTLSVGGKEYVYYSLTEAEKNGLAGISSLPFSMK
                     VLLENLLRFEDDRSVKKSDIENVAKWLADRGKAGAEIAYRPTRVLMQDFTGVPAVVDL
                     AAMRDGIKALGGDPEKINPLVPVDLVIDHSVIVDDFGNPLAFQHNVDLEYQRNGERYR
                     FLKWGQQAFKNFRVVPPGTGICHQVNLEYLAQAVWTKEEDGVTLAYPDTCVGTDSHTT
                     MVNGLGVLGWGVGGIEAEAAMLGQPVSMLLPEVIGFRLTGKLKEGVTATDLVLTVTQM
                     LRKKGVVGKFVEFFGAGLDNMSLADRATIGNMGPEYGATCGFFPVDQETLKYMNMTGR
                     DEHRLELVEAYCRAQGMWRDSSSADPVFTDVLELDMGDVVPSMAGPKRPEGRIPLENI
                     GSGFATSLETEYKKTTGQSTRYPVEGENFDLGHGDVVIAAITSCTNTSNPSVLIAAGL
                     LARNAVAKGLKTKPWVKTSLAPGSQVVAAYLEDAGLQKDLDALGFNLVGFGCTTCIGN
                     SGPLPAPISKTINEKGLIAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAHALAGTVT
                     KDLTKEPLGEDKDGNPVYLRDIWPSTQEIQDFIAKNVTRKLFSEKYADVFKGDANWQT
                     VQVPAGQTYAWDDNSTYVQNPPYFVGMGKTAGMIGDVKGARILGLFGDKITTDHISPA
                     GSIKAQSPAGKYLLDHGVAVADFNQYGTRRGNHEVMMRGTFANIRIRNHMLGENGREG
                     GYTIHYPSKKEMSIYDAAMEYKAEGVPLVVFAGVEYGNGSSRDWAAKGTNLLGVKAVI
                     AQSFERIHRSNLVGMGIVPFVFEEGTSWQSLGLKGDEIVTIEGLADVRPRQRVEASIT
                     YADGTVKKVPLICRIDTLDELDYMKNGGILQTVLRDLVA"
     misc_feature    complement(97047..99731)
                     /gene="acnA"
                     /locus_tag="BSVBI22_A0093"
                     /note="aconitate hydratase; Validated; Region: PRK09277"
                     /db_xref="CDD:236445"
     misc_feature    complement(98037..99473)
                     /gene="acnA"
                     /locus_tag="BSVBI22_A0093"
                     /note="Aconitase A catalytic domain; Region: AcnA_IRP;
                     cd01586"
                     /db_xref="CDD:153136"
     misc_feature    complement(order(98112..98114,98127..98129,98214..98216,
                     99087..99092,99450..99452,99459..99461))
                     /gene="acnA"
                     /locus_tag="BSVBI22_A0093"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153136"
     misc_feature    complement(order(98130..98132,98214..98219,98226..98228,
                     98424..98426,99084..99086))
                     /gene="acnA"
                     /locus_tag="BSVBI22_A0093"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153136"
     misc_feature    complement(97209..97727)
                     /gene="acnA"
                     /locus_tag="BSVBI22_A0093"
                     /note="Aconitase A swivel domain. This is the major form
                     of the TCA cycle enzyme aconitate hydratase, also known as
                     aconitase and citrate hydro-lyase. It includes bacterial
                     and archaeal aconitase A, and the eukaryotic cytosolic
                     form of aconitase. This group...; Region: AcnA_IRP_Swivel;
                     cd01580"
                     /db_xref="CDD:238812"
     misc_feature    complement(97386..97394)
                     /gene="acnA"
                     /locus_tag="BSVBI22_A0093"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238812"
     gene            100075..100722
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /db_xref="GeneID:11728915"
     CDS             100075..100722
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="ATP-binding protein; required for proper cytochrome
                     c maturation"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis protein CcmA"
                     /protein_id="YP_005153802.1"
                     /db_xref="GI:376279796"
                     /db_xref="GeneID:11728915"
                     /translation="MRLEAENLAGERGGETIFSHLSFTIGTGQALVVTGPNGSGKSTL
                     LRIICGLLAPEAGEVKLTEGTQIVPVRAACHYLGHQNAMKPALSVRENLLFWQKFNGG
                     EALDIGAALEAVDLAGVEHLPFGYLSTGQKRRVSIAKLLVSHRPLWIVDEPTAGLDKA
                     SEARFAELMREHMRQDGMIIAATHIPLGLDGAISTTGNALVRSLDMAAFSVEDIA"
     misc_feature    100075..100713
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="cytochrome c biogenesis protein CcmA; Provisional;
                     Region: PRK13539"
                     /db_xref="CDD:237421"
     misc_feature    100081..100698
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="Cytochrome c biogenesis ATP-binding export protein;
                     Region: ABC_CcmA_heme_exporter; cd03231"
                     /db_xref="CDD:213198"
     misc_feature    100177..100200
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213198"
     misc_feature    order(100186..100191,100195..100203,100309..100311,
                     100525..100530,100624..100626)
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213198"
     misc_feature    100300..100311
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213198"
     misc_feature    100453..100482
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213198"
     misc_feature    100513..100530
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="Walker B; other site"
                     /db_xref="CDD:213198"
     misc_feature    100537..100548
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="D-loop; other site"
                     /db_xref="CDD:213198"
     misc_feature    100612..100632
                     /gene="ccmA"
                     /locus_tag="BSVBI22_A0094"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213198"
     gene            100722..101387
                     /gene="ccmB"
                     /locus_tag="BSVBI22_A0095"
                     /db_xref="GeneID:11728916"
     CDS             100722..101387
                     /gene="ccmB"
                     /locus_tag="BSVBI22_A0095"
                     /note="identified by match to protein family HMM PF03379;
                     match to protein family HMM TIGR01190"
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein CcmB"
                     /protein_id="YP_005153803.1"
                     /db_xref="GI:376279797"
                     /db_xref="GeneID:11728916"
                     /translation="MLALFLRDMRLGLRAGGGALIGILFFLAVISVMPFGVGPDLNLL
                     ARIGPAMLWIGALLATLLGLDRLFQADREDGSLDLLLIGADRHMLAFTVFVKCAAHWV
                     ASVLPLVVASPMLGLFMNMDATAIGATALTLLVGTPAIAFIGAVGAALAVALPRGGLL
                     VSVIVLPLTIPVLIFGVSASYGATDAVAPFFAPFLILAALTLFFAVLGPLAASAALKN
                     SAD"
     misc_feature    100722..101384
                     /gene="ccmB"
                     /locus_tag="BSVBI22_A0095"
                     /note="ABC-type transport system involved in cytochrome c
                     biogenesis, permease component [Posttranslational
                     modification, protein turnover, chaperones]; Region: CcmB;
                     COG2386"
                     /db_xref="CDD:225260"
     gene            101445..102230
                     /gene="ccmC"
                     /locus_tag="BSVBI22_A0096"
                     /db_xref="GeneID:11728917"
     CDS             101445..102230
                     /gene="ccmC"
                     /locus_tag="BSVBI22_A0096"
                     /note="identified by similarity to SP:P30962; match to
                     protein family HMM PF01578; match to protein family HMM
                     TIGR01191"
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein CcmC"
                     /protein_id="YP_005153804.1"
                     /db_xref="GI:376279798"
                     /db_xref="GeneID:11728917"
                     /translation="MKDAAKTASWLDLANPTRFLAFAGRVVPWLGLASAIFLAVGLYM
                     VFLSPDDYQQGSTVRIMYIHVPFAWLSMMCYSIMAVSSLGTLVWRHPLADVSVRAAAP
                     IGAVFTALALATGSLWGKPMWGTWWVWDARLTSVFVLFLMYLGIIALSRAMDDPARSA
                     KPVAVLTLVGFINVPIIKFSVDWWNTLHQPASVFRLDGPTIDGSMLRPLFVMAIGFTL
                     LFFTLHMMAMRNEIWRRRVASMKKLAARNVDRNRAGQVEEGAL"
     misc_feature    101589..102140
                     /gene="ccmC"
                     /locus_tag="BSVBI22_A0096"
                     /note="heme exporter protein CcmC; Region: ccmC;
                     TIGR01191"
                     /db_xref="CDD:233306"
     gene            102227..102400
                     /locus_tag="BSVBI22_A0097"
                     /db_xref="GeneID:11728918"
     CDS             102227..102400
                     /locus_tag="BSVBI22_A0097"
                     /note="identified by similarity to EGAD:15659; match to
                     protein family HMM PF04995"
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein D"
                     /protein_id="YP_005153805.1"
                     /db_xref="GI:376279799"
                     /db_xref="GeneID:11728918"
                     /translation="MSNHLGFIIASYGITVAALAVTIGWILIDQRIQKNELKRLEAQG
                     VRRRSAKAPGKAQ"
     misc_feature    102227..102361
                     /locus_tag="BSVBI22_A0097"
                     /note="heme exporter protein CcmD; Region: cytochro_ccmD;
                     TIGR03141"
                     /db_xref="CDD:213776"
     gene            102397..103008
                     /gene="cycY"
                     /locus_tag="BSVBI22_A0098"
                     /db_xref="GeneID:11728919"
     CDS             102397..103008
                     /gene="cycY"
                     /locus_tag="BSVBI22_A0098"
                     /note="identified by match to protein family HMM
                     TIGR00385"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin family thiol:disulfide interchange
                     protein"
                     /protein_id="YP_005153806.1"
                     /db_xref="GI:376279800"
                     /db_xref="GeneID:11728919"
                     /translation="MTETTEKPAAQKKRASWVALLPLLIFVGLAAVFAVQLLSGKDNS
                     IIPSVLIGKQAPLTNLPPVEGLMRDGAPVSGFNSEDLKTGPGGKLTLVNVWGSWCVPC
                     RQEHPLLMEIAKDERIRVVGINYKDQPENARRFLGDLGNPFAAVGADRAGRSAIEWGV
                     YGVPETFLVDQTGKIVYKHVGPFTLESVKNDLLPAVEKALQQR"
     misc_feature    102553..102948
                     /gene="cycY"
                     /locus_tag="BSVBI22_A0098"
                     /note="TlpA-like family, DsbE (also known as CcmG and
                     CycY) subfamily; DsbE is a membrane-anchored, periplasmic
                     TRX-like reductase containing a CXXC motif that
                     specifically donates reducing equivalents to apocytochrome
                     c via CcmH, another cytochrome c...; Region:
                     TlpA_like_DsbE; cd03010"
                     /db_xref="CDD:239308"
     misc_feature    order(102691..102693,102700..102702)
                     /gene="cycY"
                     /locus_tag="BSVBI22_A0098"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239308"
     misc_feature    102775..102843
                     /gene="cycY"
                     /locus_tag="BSVBI22_A0098"
                     /note="central insert; other site"
                     /db_xref="CDD:239308"
     gene            complement(103257..105092)
                     /gene="ilvD"
                     /locus_tag="BSVBI22_A0099"
                     /db_xref="GeneID:11728920"
     CDS             complement(103257..105092)
                     /gene="ilvD"
                     /locus_tag="BSVBI22_A0099"
                     /note="catalyzes the dehydration of
                     2,3-dihydroxy-3-methylbutanoate to 3-methyl-2-oxobutanoate
                     in valine and isoleucine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="YP_005153807.1"
                     /db_xref="GI:376279801"
                     /db_xref="GeneID:11728920"
                     /translation="MPPYRSRTTTHGRNMAGARGLWRATGMKDEDFGKPIIAVVNSFT
                     QFVPGHVHLKDLGQLVAREIESAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRELIAD
                     SVEYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVVWEDSVK
                     KLDLVDAMVAAADDHYTDEQVKAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGN
                     GSTLATHADRKRLFVEAGHLIVDLARRYYEQDDESVLPRSIATFSAFENAMTLDIAMG
                     GSTNTVLHLLAAAQEAEIDFTMADIDRLSRRVPVLCKVAPAVSSVHMEDVHHAGGIMG
                     ILGQLDNAGLLTTSIPTVHSETLAKALDHWDVTRTNSEMVHKFYSAAPGGVPTQVAFS
                     QERRFDKVDTDREKGVIRSKEHAFSQDGGLAVLYGNLAEDGCIVKTAGVDDSILKFSG
                     PARIFESQDSAVLGILNGKIKPGDIVLIRYEGPRGGPGMQEMLYPTSYLKSKGFGKAC
                     ALITDGRFSGGSSGLSIGHVSPEAAEGGTIGLVREGDIIDIDIPNRKIHLAVDDATLA
                     ERRAEQDAAGWKPAEERKRKISTALKAYAAMATSAARGAVRKLPD"
     misc_feature    complement(103260..105089)
                     /gene="ilvD"
                     /locus_tag="BSVBI22_A0099"
                     /note="dihydroxy-acid dehydratase; Provisional; Region:
                     PRK12448"
                     /db_xref="CDD:237104"
     gene            105274..105411
                     /locus_tag="BSVBI22_A0100"
                     /db_xref="GeneID:11728921"
     CDS             105274..105411
                     /locus_tag="BSVBI22_A0100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153808.1"
                     /db_xref="GI:376279802"
                     /db_xref="GeneID:11728921"
                     /translation="MSHCPTHQGGIRNQSNGLISPRRRFALLLEMLQRAAVLQTPASA
                     I"
     gene            complement(105492..105845)
                     /locus_tag="BSVBI22_A0101"
                     /db_xref="GeneID:11728922"
     CDS             complement(105492..105845)
                     /locus_tag="BSVBI22_A0101"
                     /note="identified by similarity to GP:15157523"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153809.1"
                     /db_xref="GI:376279803"
                     /db_xref="GeneID:11728922"
                     /translation="MPFACAVFSADFGAPIKNSFSPRNPSLLFDIDPPEQQQAEQGNE
                     GIALRMACQSPDAIRMELGLGPELKRADLQRCRRRFAAQNHPDRLPPQFREAAEQRMK
                     TANALLDAAMLLAHA"
     misc_feature    complement(<105540..105662)
                     /locus_tag="BSVBI22_A0101"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cl02542"
                     /db_xref="CDD:261333"
     gene            complement(105950..106327)
                     /locus_tag="BSVBI22_A0102"
                     /db_xref="GeneID:11728923"
     CDS             complement(105950..106327)
                     /locus_tag="BSVBI22_A0102"
                     /note="identified by similarity to OMNI:CC3015; match to
                     protein family HMM PF00072"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_005153810.1"
                     /db_xref="GI:376279804"
                     /db_xref="GeneID:11728923"
                     /translation="MINDLEHRRILVVEDEVFVALDVAATVEDANGTVVGPVGTVRQA
                     IDLINRQEVDAAILDVNLADGDVEPVLDRLKSRNIFVVIHTGGGLPPRLAARYPEMPV
                     FQKPIPPSVLTRTLATAFSSSVA"
     misc_feature    complement(<105977..106303)
                     /locus_tag="BSVBI22_A0102"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cl19078"
                     /db_xref="CDD:267431"
     misc_feature    complement(order(106127..106129,106151..106153,
                     106283..106288))
                     /locus_tag="BSVBI22_A0102"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(106151..106153)
                     /locus_tag="BSVBI22_A0102"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(106127..106135,106139..106144))
                     /locus_tag="BSVBI22_A0102"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     gene            complement(106502..106738)
                     /locus_tag="BSVBI22_A0103"
                     /db_xref="GeneID:11728924"
     CDS             complement(106502..106738)
                     /locus_tag="BSVBI22_A0103"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005153811.1"
                     /db_xref="GI:376279805"
                     /db_xref="GeneID:11728924"
                     /translation="MKPVFLQLQCAPGKTYEVADTLFQREIVSELYSTSGEFDLLAKI
                     YIAENEDIGKFINENVLDIPNIVRSLTTLTFTAF"
     misc_feature    complement(106514..>106729)
                     /locus_tag="BSVBI22_A0103"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    complement(106514..106723)
                     /locus_tag="BSVBI22_A0103"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            107391..107795
                     /locus_tag="BSVBI22_A0104"
                     /db_xref="GeneID:11728925"
     CDS             107391..107795
                     /locus_tag="BSVBI22_A0104"
                     /note="identified by similarity to GP:15155891"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153812.1"
                     /db_xref="GI:376279806"
                     /db_xref="GeneID:11728925"
                     /translation="MKFLPVLSPFAILLSLAAMTLPSVAMNASEKAQLERLDPATRLE
                     QRCDVEAMERISHDQAKFSVDKVLAYAFSDPVTKKNTIRADGAAFRSREHWYRLSYNC
                     KTDDEHINIQSFSYGIGSEVPQDQWDKHYLVP"
     misc_feature    107490..107792
                     /locus_tag="BSVBI22_A0104"
                     /note="Domain of Unknown Function (DUF930); Region:
                     DUF930; pfam06059"
                     /db_xref="CDD:114763"
     gene            complement(107881..108585)
                     /locus_tag="BSVBI22_A0105"
                     /db_xref="GeneID:11728926"
     CDS             complement(107881..108585)
                     /locus_tag="BSVBI22_A0105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153813.1"
                     /db_xref="GI:376279807"
                     /db_xref="GeneID:11728926"
                     /translation="MRPGSGLRGQVFSPGLGQSCDRHLQNAANGKSLQGPAAIFGASL
                     ITGKPATCADKAMAYAWPCDSRTSEKRLPMIDFKAIPVFSELLNRTSHLFYRIIRRNA
                     VSRFWPENAVGKKMTASALLAVALMPVSAHAQADEEQPPIERVDYICERSVVVPVTYI
                     RSNGAPAAAVLEVEGKMVALQWHGDLKKYVAIDEQDSYRWADRGGQATLSHLEADHTA
                     KEVTLLSACRADTAEE"
     misc_feature    complement(107956..108243)
                     /locus_tag="BSVBI22_A0105"
                     /note="Membrane-bound lysozyme-inhibitor of c-type
                     lysozyme; Region: MliC; cl01604"
                     /db_xref="CDD:261014"
     gene            108657..109475
                     /locus_tag="BSVBI22_A0106"
                     /db_xref="GeneID:11728927"
     CDS             108657..109475
                     /locus_tag="BSVBI22_A0106"
                     /note="identified by similarity to EGAD:8060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153814.1"
                     /db_xref="GI:376279808"
                     /db_xref="GeneID:11728927"
                     /translation="MFTFRKSGHVTLNLITALLVLGVFLWWGKWRKTGVLLIALAVIS
                     YGAIVSTWLPNFLMSRLQEPYSSKLAEPLEDNTVFVVFGLGTQTVNEQGHNTVEPLTF
                     SYGSIFAAARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQ
                     DDRPHNAWTTARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLT
                     VNGSTHFSTSLSFLAMDLALNEEIGAWRYVTYNLMDWNAPKAFVQTVPAPRSTQ"
     misc_feature    108888..109385
                     /locus_tag="BSVBI22_A0106"
                     /note="YdcF-like. YdcF-like is a large family of mainly
                     bacterial proteins, with a few members found in fungi,
                     plants, and archaea. Escherichia coli YdcF has been shown
                     to bind S-adenosyl-L-methionine (AdoMet), but a
                     biochemical function has not been...; Region: YdcF-like;
                     cd06259"
                     /db_xref="CDD:99750"
     misc_feature    order(109155..109157,109164..109166,109224..109226,
                     109236..109238,109245..109247,109374..109376)
                     /locus_tag="BSVBI22_A0106"
                     /note="putative active site [active]"
                     /db_xref="CDD:99750"
     gene            109753..110781
                     /locus_tag="BSVBI22_A0107"
                     /db_xref="GeneID:11728928"
     CDS             109753..110781
                     /locus_tag="BSVBI22_A0107"
                     /note="identified by similarity to GP:17983880; match to
                     protein family HMM PF01547; match to protein family HMM
                     TIGR00971"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005153815.1"
                     /db_xref="GI:376279809"
                     /db_xref="GeneID:11728928"
                     /translation="MRLSKFSFALSAFVAVASLAGMIEVGHADQTLLNVSYDPTRELY
                     KDYNAAFAEHWKAQTGENVTIRSSHGGSGKQARSVIDGVRADVVTLALESDIDAIAEF
                     SGKISKDWRKRLPNNSAPYTSTIVFLVRKGNPKGIKDWGDLVKDDVEVITPNPKTSGG
                     ARWNYLAAWAWAYRQYGGDEQKIKDYIAELFRHVPVLDTGARGATTTFVQRQLGDVLL
                     AWENEAYLSVAEFGDDAFDIVVPPQSILAEPPVAVVDRNAEENGTTKLATAYLEYLYS
                     PEGQAIAAKHFYRPSRPEIIPANQQRKFPDLTLVTIDDPIFGGWAKAQPYHFGDGGTF
                     DQIYKPGK"
     misc_feature    109759..110778
                     /locus_tag="BSVBI22_A0107"
                     /note="ABC-type sulfate transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: Sbp; COG1613"
                     /db_xref="CDD:224529"
     gene            110876..111742
                     /locus_tag="BSVBI22_A0108"
                     /db_xref="GeneID:11728929"
     CDS             110876..111742
                     /locus_tag="BSVBI22_A0108"
                     /note="identified by similarity to SP:Q01895; match to
                     protein family HMM PF00528; match to protein family HMM
                     TIGR00969; match to protein family HMM TIGR02139"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter, permease protein"
                     /protein_id="YP_005153816.1"
                     /db_xref="GI:376279810"
                     /db_xref="GeneID:11728929"
                     /translation="MSSLPAQARAGWHFRKPGVIPGFGLTFGFSVAYLTLIILIPLAA
                     LVLRSSDVGLAGFWRIVTDERTLKALETSFGTAFIAALVNVVFGVILAWVLVRYRFAG
                     RRFVDAIVDIPFALPTAVAGISLAAIYAPNGWIGGLLSPYGIRIAFTRMGIVIALIFI
                     GLPFVVRTVQPIIEEISREVEEAAATLGASRFQTIWRVLLPGLQPAIITGFALAFARG
                     IGEYGSVIFIAGNTPYKSEIAPLLIVIKLEEYDYAGATALATVILALSFAMLLFINLI
                     QTRIRRKYGHGA"
     misc_feature    110918..111730
                     /locus_tag="BSVBI22_A0108"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    111092..111676
                     /locus_tag="BSVBI22_A0108"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(111131..111136,111143..111148,111161..111163,
                     111191..111202,111206..111235,111242..111247,
                     111251..111253,111350..111355,111359..111361,
                     111365..111367,111374..111379,111383..111385,
                     111395..111400,111407..111409,111458..111460,
                     111500..111505,111512..111514,111533..111544,
                     111551..111556,111593..111598,111626..111631,
                     111638..111643,111647..111652,111659..111664,
                     111671..111676)
                     /locus_tag="BSVBI22_A0108"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(111209..111253,111533..111550)
                     /locus_tag="BSVBI22_A0108"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(111251..111253,111335..111337,111551..111553,
                     111587..111589,111596..111598,111626..111628)
                     /locus_tag="BSVBI22_A0108"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(111410..111448,111464..111469,111479..111481)
                     /locus_tag="BSVBI22_A0108"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            111732..112598
                     /gene="cysW-1"
                     /locus_tag="BSVBI22_A0109"
                     /db_xref="GeneID:11728930"
     CDS             111732..112598
                     /gene="cysW-1"
                     /locus_tag="BSVBI22_A0109"
                     /note="identified by similarity to SP:P16702; match to
                     protein family HMM PF00528; match to protein family HMM
                     TIGR00969; match to protein family HMM TIGR02140"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter, permease protein"
                     /protein_id="YP_005153817.1"
                     /db_xref="GI:376279811"
                     /db_xref="GeneID:11728930"
                     /translation="MAHEAACTRHGAVTESPPVRIALIALALAFLALFLILPVVAVFV
                     EAFRKGMSEYIAALVEPDAWAAIKLTLTVAAIAVPLNVVFGIAAAWAIAKFEFKGKAL
                     LTTLIDLPFSVSPVISGLVFVLLFSSHSLLGPWLLRHGIEILFAVPGIVLATVFVTFP
                     FVARELIPLMQEQGTGDEEAAISLGASGWQAFRYVTLPNIKWGLLYGVLLCNARAMGE
                     FGAVSVVSGHIRGLTNTMPLHVEILYNEYNFVGAFAVASLLAFLALLTLAIKAVLELR
                     YGDELAGSGNGH"
     misc_feature    111930..112490
                     /gene="cysW-1"
                     /locus_tag="BSVBI22_A0109"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(111978..111983,111990..111995,112008..112010,
                     112038..112049,112053..112082,112089..112094,
                     112098..112100,112194..112199,112206..112208,
                     112212..112214,112221..112226,112230..112232,
                     112242..112247,112254..112256,112305..112307,
                     112347..112352,112359..112361,112380..112391,
                     112398..112403,112440..112445,112473..112478,
                     112485..112490)
                     /gene="cysW-1"
                     /locus_tag="BSVBI22_A0109"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(112056..112100,112380..112397)
                     /gene="cysW-1"
                     /locus_tag="BSVBI22_A0109"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(112098..112100,112179..112181,112398..112400,
                     112434..112436,112443..112445,112473..112475)
                     /gene="cysW-1"
                     /locus_tag="BSVBI22_A0109"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(112257..112295,112311..112316,112326..112328)
                     /gene="cysW-1"
                     /locus_tag="BSVBI22_A0109"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            112696..113775
                     /locus_tag="BSVBI22_A0110"
                     /db_xref="GeneID:11728931"
     CDS             112696..113775
                     /locus_tag="BSVBI22_A0110"
                     /note="identified by similarity to SP:P14788; match to
                     protein family HMM PF00005; match to protein family HMM
                     TIGR00968"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter ATP-binding protein"
                     /protein_id="YP_005153818.1"
                     /db_xref="GI:376279812"
                     /db_xref="GeneID:11728931"
                     /translation="MEVRVAGVRKEFARFPALHNVSLTIQSGELIALLGPSGSGKTTL
                     LRLIAGLETPTEGMIFFGDEDASQKSVQERNVGFVFQHYALFRHMTVADNIGFGLKVR
                     PGGTRPSTAEIRRRALELLDLVQLSGLEKRYPAQLSGGQRQRVALARAMAIEPRVLLL
                     DEPFGALDAQVRKELRRWLREIHDKTGHTTVFVTHDQDEALELADRVVVMSQGRIEQV
                     GTPDEVYDKPNSPFVYGFIGESSTLPVRVENGEVWLADRNIGLGAENMPDGDAQLYFR
                     PHDVELLDGCGGCIAGTVIASRRSGGKRRVELEVGGARERIEIEIPAEHPAAEKSRIA
                     FRPRYWTLFRAGDSELPAPKAAATT"
     misc_feature    112696..113733
                     /locus_tag="BSVBI22_A0110"
                     /note="ABC-type sulfate/molybdate transport systems,
                     ATPase component [Inorganic ion transport and metabolism];
                     Region: CysA; COG1118"
                     /db_xref="CDD:224043"
     misc_feature    112696..113412
                     /locus_tag="BSVBI22_A0110"
                     /note="ATP-binding cassette domain of the sulfate
                     transporter; Region: ABC_CysA_sulfate_importer; cd03296"
                     /db_xref="CDD:213263"
     misc_feature    112798..112821
                     /locus_tag="BSVBI22_A0110"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213263"
     misc_feature    order(112807..112812,112816..112824,112936..112938,
                     113176..113181,113278..113280)
                     /locus_tag="BSVBI22_A0110"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213263"
     misc_feature    112927..112938
                     /locus_tag="BSVBI22_A0110"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213263"
     misc_feature    113104..113133
                     /locus_tag="BSVBI22_A0110"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213263"
     misc_feature    113164..113181
                     /locus_tag="BSVBI22_A0110"
                     /note="Walker B; other site"
                     /db_xref="CDD:213263"
     misc_feature    113188..113199
                     /locus_tag="BSVBI22_A0110"
                     /note="D-loop; other site"
                     /db_xref="CDD:213263"
     misc_feature    113266..113286
                     /locus_tag="BSVBI22_A0110"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213263"
     misc_feature    113545..113709
                     /locus_tag="BSVBI22_A0110"
                     /note="TOBE-like domain; Region: TOBE_3; pfam12857"
                     /db_xref="CDD:257353"
     gene            114566..122764
                     /locus_tag="BSVBI22_A0111"
                     /db_xref="GeneID:11727582"
     CDS             114566..122764
                     /locus_tag="BSVBI22_A0111"
                     /note="identified by similarity to GP:3551791; match to
                     protein family HMM TIGR01612"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic beta 1-2 glucan synthetase"
                     /protein_id="YP_005153819.1"
                     /db_xref="GI:376279813"
                     /db_xref="GeneID:11727582"
                     /translation="MPRIFALAWLYVAHTDSNFSLKMLTAMVKGFQTVEPLKIGELWA
                     LPSAVRYFLIENARRLAMRVDRAREMRNLANTAADRIVVAAEGAELDGILAQYASAAC
                     DSTFATHLLYRLRSSSTDTTAAASWLERILEQDGSNPEDAIIEEHARQSTGGVTMGNV
                     IRSLKSIDDVDWETWFETVNEVDAILRDHSDFELLDFRSRNAYRVTIEKLARYSDMSE
                     IDITWAALKLAEDGSRAEKAGHPEAEGKGAISYYLSGEGRRDLEKVCGYRAPFGVKAL
                     RLYRGLGLWGLFVPTAIFTVLTLLLVNYCMMRAGLSTDLRTLFTLLAIFPAMDASYSL
                     FNVLVPWFVQPTRLIGFEYKDGLPPEARTLVAVPTFITSRDSIDEQIRNLEVHYLTNP
                     RGEIYFALVSDWTDASQEIVPADMEIYEYARDEIAKLNEHYTGDDQPRFFLLNRRRLF
                     NEKQGCWMGWERKRGKLHELNLLLRGDQDTSFFPADERLPKDIKYVMTLDADTRLTPE
                     AVTHLAGKLNHPMNRPVIDEKTGKVVRGYGILQPRVTPSLTTGDEASFLQRVFSVNRG
                     IDPYVFAVSDTYQDLLGEGTFTGKGLYDIDAFEAALKGRVPENTLLSHDLLEGGYARS
                     ALVSDVEVVEDYPTGYNVDVSRHHRWARGDWQLLPWLFTTGRGVSAITRWKMVDNLRR
                     SLNPILWLIAAIVGWSVLPLGAAAVWQGFLILSMFVAPTFGIVTNLIPASMDYSLKGH
                     AQSVLTDIALGTADVALRTTFIAHSAFLMADAIARTIYRLFISRRNLLEWRTAAQART
                     SPDTLLFYFQLMWPAMAIAGLAIFFPLAAESHAALIAAPFVVIWFASPLIAWLVSRSA
                     KPQDTLEVLSSDKADLRRYARRTWRYFAEFANEENNHLPPDNFQEDPAPIVAQRTSPT
                     NIGVYLLSVIAARDFGWIGFDETLDRVEATLGSLDKMEKYQGHLYNWYETNTLNPMRP
                     LYVSAVDSGNLAGHLVTLSSALEEWAEAPSVYVQGDLDGIIDVNDILEETIARIPDDR
                     RVLRPLRRRLEERIANFRRAVTSIKDEPETASFRTINLSLFASDIVRLMDELDSEVET
                     VASAEAREWARILVDTCKAHTDDAIGEHDTDALRERLRDLATRARQLAFDMQFGFLER
                     KERRLLSIGFRVQENELDESCYDLLASEARLASLFAIAKGDVPVEHWFKLGRLLVPVG
                     WKGALLSWSGSMFEYLMPPLVMSEPLGSLLDQTNKLVVQRQIDYATSRGLPWGISEAA
                     FNARDAHLNYQYSNFGVPNLGLQRGLSRNAVIAPYASLLAAQYQPAAAVANLKRLAKL
                     GALGRYGFHDSVDFTPSRIREGETCAVVKNYYAHHHGMSIIAVNNVIFEGRMRERFHN
                     DPVIEAAELLLQEKAPREIPMIYAKTENPMRVDSGGFDDAPMRIIDKPFRAPRTMHMM
                     SNGQYALMVTANGSGYSRWHNWDITRFHADASEDMQGTFLFLRDMESGYWWSATGEPV
                     RNPDEETKTVFTEDKAEFYKTAGDIKTVMEVIVASEADGEGRRLDIINTSPRDRMIEV
                     TSYAELVLNDSDSDAAHPAFAKMFVETEIADSGSTIYAKRRKRAPSDPDIHAAHFVTD
                     LSGALREIEVETDRRAFIGRGRSLRNAAAFDPGAKFTGSQGCVLDPIVSVRTRVRVPA
                     HKKVSLVFWTFAGGSRDAVEHAVTMHRHPETFAREYSLSWTSSQVQLYHIGIKPAEAA
                     DYQKVAAYLLYPERTLRQPPETIASGLGKQSDLWPMSISGDYPIFALRIDNEADLDVL
                     RGVLRAQEYWRLKGLIVDVVAVNERAFSYAQDTQRAIDWIVEGFRARGGGQPHIFAVR
                     RDQMSEESYNTLLASARIVMHAQNGSLAEQLRRSEEITVDLAARSDARTATNGQASVQ
                     GLGAAGLAPVAIERGAEERRPVVKPPVDRPRPSGDDLRFWNGYGGFAEDGSYVVRING
                     RTSTPHPWINVIANPSFGFHVSAEGSAFTWAGNSRDYQLTPWANDPVTNRPGEAIYIL
                     DRETGRSFAPTANVLRDEAVTYEARHGHGYSAFSAQHGELALELTHIVDAEKPVRLSR
                     LTITNKGRSKRKLRVYGYVEWVLGNARARNVPFIVPSQDEELGALFAGNPYHPDKSGQ
                     VAFFAASEKPQSVTADRGEFIGTAGSVDRPEIVLAGKVLSGTVEAGRDPCAALALDIE
                     VGPGEAREIVFLLGNTADQKQAKALIADMRTASFEEKLVAARHQWESFFNRVQVKTPD
                     PAFDLMVNGWLPYQAVACRIWARAAFYQASGAFGFRDQLQDTLSLLLVDPSLAREQIL
                     NAASRQFREGDVQHWWLPATGAGVRTLISDDVVWLGYGASLYVETTGDRSILDEKLPF
                     LEGRKLEEGEHDAFYEPEISKETASLYEHCALALDLAVARTGKHGLPLILGGDWNDGM
                     NLVGVKGKGESVWLGWFLAYTLKAFIPLAEARKDQKRADLWKAHVESLTAALDRDGWD
                     GEWYRRGFYDNGRPLGSKNSDECQIDAIAQSWSVLSGVADPKRAEKAMASLEKYLLDE
                     DNALLRLFTPPFDVTPQEPGYIKGYPPGVRENGGQYTHGATWAILALARMGKAAEAWR
                     LFSLISPVSHGRNPDVYRVEPYVIAADIYSVAPRCGQGGWTWYTGSAGWFYRVATEGI
                     LGVTKRGDRLHFQPALPPEWEGYEAELRFGEALYRVKVVAGAKAGTIRLNGRKLAKPD
                     EGVALKPDGEHEIVVELPKQ"
     misc_feature    <116045..116755
                     /locus_tag="BSVBI22_A0111"
                     /note="Glycosyltransferases, probably involved in cell
                     wall biogenesis [Cell envelope biogenesis, outer
                     membrane]; Region: COG1215"
                     /db_xref="CDD:224136"
     misc_feature    117182..>117472
                     /locus_tag="BSVBI22_A0111"
                     /note="Protein of unknown function (DUF3131); Region:
                     DUF3131; pfam11329"
                     /db_xref="CDD:256417"
     misc_feature    118061..118705
                     /locus_tag="BSVBI22_A0111"
                     /note="Putative glucoamylase; Region: Glycoamylase;
                     pfam10091"
                     /db_xref="CDD:255746"
     misc_feature    118679..119683
                     /locus_tag="BSVBI22_A0111"
                     /note="Second GH94N domain of cyclic beta 1-2 glucan
                     synthetase and similar domains; Region:
                     GH94N_ChvB_NdvB_2_like; cd11753"
                     /db_xref="CDD:213069"
     misc_feature    119420..122758
                     /locus_tag="BSVBI22_A0111"
                     /note="Cellobiose phosphorylase [Carbohydrate transport
                     and metabolism]; Region: COG3459"
                     /db_xref="CDD:225990"
     misc_feature    120371..121225
                     /locus_tag="BSVBI22_A0111"
                     /note="First GH94N domain of cyclic beta 1-2 glucan
                     synthetase and similar domains; Region:
                     GH94N_ChvB_NdvB_1_like; cd11756"
                     /db_xref="CDD:213072"
     misc_feature    <121730..>122167
                     /locus_tag="BSVBI22_A0111"
                     /note="Protein of unknown function, DUF608; Region:
                     DUF608; pfam04685"
                     /db_xref="CDD:252742"
     gene            122854..124158
                     /gene="pncB"
                     /locus_tag="BSVBI22_A0112"
                     /db_xref="GeneID:11727583"
     CDS             122854..124158
                     /gene="pncB"
                     /locus_tag="BSVBI22_A0112"
                     /note="catalyzes the formation of nictonate and
                     5-phospho-alpha-D-ribose 1-diphosphate from nicotinate
                     D-ribonucleotide and diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="YP_005153820.1"
                     /db_xref="GI:376279814"
                     /db_xref="GeneID:11727583"
                     /translation="MAKTDLARRVYNHTWKLDPIIRSLLDTDFYKLLMLQMIWGLYPR
                     VDATFSLINRTSSVRLADEIDEGELRAQLDHARTLRFSKKEMIWLAGNTFYGRKQIFQ
                     PEFLAWLHDFQLPEYELRRKDGQYELHFHGPWTHTTMWEIPALAIINELRSRAAMKNL
                     GPFSLDVLYARAKAKMWSKVERLRQLPDLKISDFGTRRRHSFLWQRWCVEALKEGIGS
                     AFTGTSNVLLAMDTDLEALGTNAHELPMVLAALAKTDDELRSAPYRVLQDWNRYYGGN
                     LLIVLPDAFGTAAFLRNAPDWVADWTGFRPDSAPPIEGGERIIEWWKSKGKDPREKLL
                     IFSDALDVDTIEETYRHFEGRVRMGFGWGTNLTNDFAGCAPQSIDGLKAISLVCKVTD
                     ANGHPAVKLSDNPQKATGDPKEVARYLRFFGNEERVEQLVRV"
     misc_feature    122884..124152
                     /gene="pncB"
                     /locus_tag="BSVBI22_A0112"
                     /note="Nicotinic acid phosphoribosyltransferase [Coenzyme
                     metabolism]; Region: PncB; COG1488"
                     /db_xref="CDD:224405"
     misc_feature    122890..124143
                     /gene="pncB"
                     /locus_tag="BSVBI22_A0112"
                     /note="nicotinate phosphoribosyltransferase; Provisional;
                     Region: PRK05321"
                     /db_xref="CDD:235406"
     gene            complement(124200..125030)
                     /locus_tag="BSVBI22_A0113"
                     /db_xref="GeneID:11727584"
     CDS             complement(124200..125030)
                     /locus_tag="BSVBI22_A0113"
                     /note="identified by similarity to EGAD:38480; match to
                     protein family HMM PF02567; match to protein family HMM
                     TIGR00654"
                     /codon_start=1
                     /transl_table=11
                     /product="PhzF family phenazine biosynthesis protein"
                     /protein_id="YP_005153821.1"
                     /db_xref="GI:376279815"
                     /db_xref="GeneID:11727584"
                     /translation="MDVLRIAAFSQGDKGGNPAGVMIADRLPSPQDMQKIAKDVGFSE
                     TAFAAPDGESWRVRYFAPEMEVPFCGHATIALGAALAMREGDGRFALRLNHDEISVEG
                     RKEGELFAASLQSPRTRNRAATEAEIGQALALFNYEPDDLAHGISPALIHAGADHIVL
                     PLRSREKLASMHYDLSRGRVTMSRQGWTTILLIYSETPRRFHARNPFASGGVYEDPAT
                     GAATAAFAAYLRDIGWPHGGSIEVFQGEDMGSPSHLHAEIGTERGGSIRVSGTARLME
                     "
     misc_feature    complement(124209..125030)
                     /locus_tag="BSVBI22_A0113"
                     /note="Predicted epimerase, PhzC/PhzF homolog [General
                     function prediction only]; Region: COG0384"
                     /db_xref="CDD:223461"
     misc_feature    complement(124215..125024)
                     /locus_tag="BSVBI22_A0113"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     cl19724"
                     /db_xref="CDD:268077"
     gene            complement(125140..125928)
                     /locus_tag="BSVBI22_A0114"
                     /db_xref="GeneID:11727585"
     CDS             complement(125140..125928)
                     /locus_tag="BSVBI22_A0114"
                     /note="identified by similarity to GP:15075131"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153822.1"
                     /db_xref="GI:376279816"
                     /db_xref="GeneID:11727585"
                     /translation="MAQNIYDRDDFFTAYSQLPRSVHGLEGAPEWPVVRSLLPDLTGR
                     DIADLGCGFGWFCRFAREQGAASVTGYDLSQNMLERARRDTQDDAVCYIQADMERLEL
                     PEASFDLVYSSLAFHYIRDFPRILKTIHAALRPDGRFVFTIEHPIFMASLAPGWIEEG
                     NGQKRWPVDHYAVEGERQTDWLAEGVIKYHRRLSTTVNALIEAGFAINRLEEWYPSPE
                     QIAAWPALSEEMERPMLLLVSASVVDLNPKSVHGAAPGAFPAKM"
     misc_feature    complement(125494..125796)
                     /locus_tag="BSVBI22_A0114"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(125590..125592,125638..125646,
                     125710..125715,125764..125784))
                     /locus_tag="BSVBI22_A0114"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(125951..126877)
                     /gene="cscK"
                     /locus_tag="BSVBI22_A0115"
                     /db_xref="GeneID:11727586"
     CDS             complement(125951..126877)
                     /gene="cscK"
                     /locus_tag="BSVBI22_A0115"
                     /note="identified by similarity to EGAD:15614; match to
                     protein family HMM PF00294"
                     /codon_start=1
                     /transl_table=11
                     /product="fructokinase"
                     /protein_id="YP_005153823.1"
                     /db_xref="GI:376279817"
                     /db_xref="GeneID:11727586"
                     /translation="MILCCGEALIDMLPRETTGGETAFQPFAGGSVFNTAIALGRLGV
                     PTGFFSGISSDFFGDVLRDTLARSNVDYSFAAISNRPTTLAFVRLVDGQARYAFYDEN
                     TAGRMLSRNDMPYVDETISAMLFGCISLISEPCGSVYETLLAREAPNRVMFLDPNIRA
                     NLITVRETHLTRMKRMIALADIVKLSDEDLDWFGEKGSHDEIAAEWLKLGPKLVVITK
                     GAHGAVVYTNHATVPVPGVKVDVVDTVGAGDTVNAGILASLHSQGLLTKDALANLSED
                     QIHSAVALGVRAAAVTVSRAGANPPWAHEMRD"
     misc_feature    complement(125984..126877)
                     /gene="cscK"
                     /locus_tag="BSVBI22_A0115"
                     /note="Fructokinases (FRKs) mainly from bacteria and
                     plants are enzymes with high specificity for fructose, as
                     are all FRKs, but they catalyzes the conversion of
                     fructose to fructose-6-phosphate, which is an entry point
                     into glycolysis via conversion into...; Region: bac_FRK;
                     cd01167"
                     /db_xref="CDD:238572"
     misc_feature    complement(order(126131..126133,126140..126142,
                     126776..126778))
                     /gene="cscK"
                     /locus_tag="BSVBI22_A0115"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238572"
     misc_feature    complement(order(126125..126127,126134..126139,
                     126146..126148,126227..126229,126320..126322))
                     /gene="cscK"
                     /locus_tag="BSVBI22_A0115"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238572"
     gene            complement(126968..127774)
                     /locus_tag="BSVBI22_A0116"
                     /db_xref="GeneID:11727587"
     CDS             complement(126968..127774)
                     /locus_tag="BSVBI22_A0116"
                     /note="identified by match to protein family HMM PF00106"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /protein_id="YP_005153824.1"
                     /db_xref="GI:376279818"
                     /db_xref="GeneID:11727587"
                     /translation="MSPDSNTDNSRPGVSSSEIPRTDTERKTLVLTGASRGIGHATVK
                     RFSLAGWRVITCSRQDFSENCPWPAGPEDHIKVDLSDPEDIGKAIAEIRRRLEANGSK
                     LHALVNNAGISPKAEGGRRMNSIETPMAVWRDVFQVNFMAPIMLARGLFKELEAAQGS
                     VVNVTSIAGSRVHPFAGTAYATSKAALAALTREMASDFGPYGIRVNAIAPGEIDTAIL
                     SPGTDKLVEQLPMRRLGKTSEVAETIYFLCTEASSYVTGSEIHINGGQHV"
     misc_feature    complement(126977..127708)
                     /locus_tag="BSVBI22_A0116"
                     /note="Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases) [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: FabG; COG1028"
                     /db_xref="CDD:223959"
     misc_feature    complement(126986..127687)
                     /locus_tag="BSVBI22_A0116"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(127127..127132,127136..127147,
                     127223..127225,127235..127237,127277..127285,
                     127361..127363,127442..127450,127538..127546,
                     127598..127606,127661..127672,127676..127678))
                     /locus_tag="BSVBI22_A0116"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(127223..127225,127235..127237,
                     127277..127279,127358..127360))
                     /locus_tag="BSVBI22_A0116"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(127895..130186)
                     /locus_tag="BSVBI22_A0117"
                     /db_xref="GeneID:11727588"
     CDS             complement(127895..130186)
                     /locus_tag="BSVBI22_A0117"
                     /note="identified by match to protein family HMM PF00905;
                     match to protein family HMM PF00912; match to protein
                     family HMM TIGR02074"
                     /codon_start=1
                     /transl_table=11
                     /product="1A family penicillin-binding protein"
                     /protein_id="YP_005153825.1"
                     /db_xref="GI:376279819"
                     /db_xref="GeneID:11727588"
                     /translation="MASRDDRNRRIEPSFGGEEKREDEVFQVDEEDRMARSQQRRQKQ
                     SADRAPRSSRGGKRKQRGFFGFLRRSIYWFLVLGLWGGIAFAGLLVYFAAKMPPTTAW
                     AIPDRPPNVRIVDVNSNLIANRGTTGGEAVSLHEMSPYIPQAVIAIEDRRFNSHFGID
                     PIGLARAIVTNVVSGRAVQGGSTLTQQLAKNLFLSPDRTLERKVQEVMLALWLEHKYT
                     KDQILEMYLNRVYLGSGAFGVDAASRRYFNKSAKDVNLMEAATLAGLLKAPSRLSPAR
                     DPEAAAARARLVLGAMREEGMIDDRQVAIAESEPPTRAPSYWQGSENYVADKVVAELP
                     ELIGEAKDDIIVQTTIDLNLQRAGEEAIKDQIEQNGKKMNASQGALVSIDNTGAVRAM
                     VGGVDYAASQFDRVTDAHRQPASSFKPFVYLSALEQGRTPDSVRNDAPVRIGKWTPSN
                     DNGKYMGPVTLATALSHSLNSVAAQLVMEVGPQTVIDTAHRLGVQSKLEPNASLALGT
                     SEVTLLELTDAYVPFANGGYRAPVYFITKMTDSDGNVLYQKEDGVGPRVIDERNVGMM
                     NAMLRRTVEDGTAKRAAFGWPAAGKTGTSQNFRDAWFIGYTANLTTGVWFGNDDGKGM
                     KRVFGATLPVAAWKSFMKEAHKGVPIAELPGHYDIQNVLPGGSDGIDPNAPYDPGMMQ
                     QDNYGNQPMAGTGDDGYWPPAPDLPGRSGIQQGETGQPLASSARNNGDYRPMPAGNVG
                     EQPQAQPARKSTTLLDIIMGNSQ"
     misc_feature    complement(128027..130018)
                     /locus_tag="BSVBI22_A0117"
                     /note="Membrane carboxypeptidase (penicillin-binding
                     protein) [Cell envelope biogenesis, outer membrane];
                     Region: MrcB; COG0744"
                     /db_xref="CDD:223815"
     misc_feature    complement(129308..129838)
                     /locus_tag="BSVBI22_A0117"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:250219"
     misc_feature    complement(128261..129055)
                     /locus_tag="BSVBI22_A0117"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; pfam00905"
                     /db_xref="CDD:250215"
     gene            complement(130391..131083)
                     /locus_tag="BSVBI22_A0118"
                     /db_xref="GeneID:11727589"
     CDS             complement(130391..131083)
                     /locus_tag="BSVBI22_A0118"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_005153826.1"
                     /db_xref="GI:376279820"
                     /db_xref="GeneID:11727589"
                     /translation="MTFKNLLGASLVAVITSTSAYAADAIVAQEPAPIAIAPSFSWAG
                     AYFGGQVGYGWGRAKLENRTNGGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDY
                     NNLKKSRDFITSGNPVQTTGETQLRWSGAVRARAGYAIDRFMPYIAGGVAFGGIKNSL
                     RIGGEESSKSKTQTGWTVGAGIDYAATDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFK
                     TNDIRLGVAYKF"
     misc_feature    complement(130394..131077)
                     /locus_tag="BSVBI22_A0118"
                     /note="Opacity protein and related surface antigens [Cell
                     envelope biogenesis, outer membrane]; Region: COG3637"
                     /db_xref="CDD:226163"
     gene            complement(131351..132037)
                     /locus_tag="BSVBI22_A0119"
                     /db_xref="GeneID:11727590"
     CDS             complement(131351..132037)
                     /locus_tag="BSVBI22_A0119"
                     /note="identified by similarity to EGAD:151783"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_005153827.1"
                     /db_xref="GI:376279821"
                     /db_xref="GeneID:11727590"
                     /translation="MKLKALLFASTVVLVAATGANAADAVIEQEPAPVVVAPTFTWNG
                     AYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNSVVLGIDGDVTYN
                     DVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAVDRFLPYIAGGVAFGSLRNRGEF
                     EGTGFSQSKTLTGWTIGAGMDYAATDNVILRLEYRYTDYGNKDYGFDDAAVTNNFKTN
                     DIRFGVAYKF"
     misc_feature    complement(131354..131947)
                     /locus_tag="BSVBI22_A0119"
                     /note="Opacity protein and related surface antigens [Cell
                     envelope biogenesis, outer membrane]; Region: COG3637"
                     /db_xref="CDD:226163"
     gene            complement(132269..132886)
                     /locus_tag="BSVBI22_A0120"
                     /db_xref="GeneID:11727591"
     CDS             complement(132269..132886)
                     /locus_tag="BSVBI22_A0120"
                     /note="identified by match to protein family HMM PF01612"
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="YP_005153828.1"
                     /db_xref="GI:376279822"
                     /db_xref="GeneID:11727591"
                     /translation="MTIRFHRNDLPNLDNYQVDAVAIDTETLGLNPHRDRLCVVQISP
                     GDGTADVIQIEADQKKAPNLVKLLKDRSITKIFHFGRFDLAVLAHAFGTMPQPVFCTK
                     IASKLTRTYTDRHGLKEICSELLDVSISKQQQSSDWAAEVLSQAQLEYAASDVLYLHR
                     LKAVLEQRLERDGRTKQAEACFKFLPTRSELDLMGWAESDIFAHS"
     misc_feature    complement(<132272..132874)
                     /locus_tag="BSVBI22_A0120"
                     /note="Ribonuclease D [Translation, ribosomal structure
                     and biogenesis]; Region: Rnd; COG0349"
                     /db_xref="CDD:223426"
     misc_feature    complement(132326..132838)
                     /locus_tag="BSVBI22_A0120"
                     /note="DEDDy 3'-5' exonuclease domain of Ribonuclease D
                     and similar proteins; Region: RNaseD_exo; cd06142"
                     /db_xref="CDD:176654"
     misc_feature    complement(order(132425..132427,132437..132439,
                     132536..132541,132638..132646,132650..132655,
                     132806..132817))
                     /locus_tag="BSVBI22_A0120"
                     /note="putative active site [active]"
                     /db_xref="CDD:176654"
     misc_feature    complement(order(132425..132427,132437..132439,
                     132638..132640,132809..132811,132815..132817))
                     /locus_tag="BSVBI22_A0120"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176654"
     misc_feature    complement(order(132425..132427,132437..132439,
                     132536..132541,132641..132646,132650..132655,
                     132806..132814))
                     /locus_tag="BSVBI22_A0120"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176654"
     gene            complement(132925..134340)
                     /locus_tag="BSVBI22_A0121"
                     /db_xref="GeneID:11727592"
     CDS             complement(132925..134340)
                     /locus_tag="BSVBI22_A0121"
                     /note="identified by match to protein family HMM PF01546"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153829.1"
                     /db_xref="GI:376279823"
                     /db_xref="GeneID:11727592"
                     /translation="MSTLSLDKVLNHLDANLNKSLDRLFNLLRIKSISTDPAYKADCR
                     KAAEWLVEDLKSIGFDASVRDTPGHPMVVAHHEGATADAPHVLFYGHYDVQPVDPLSL
                     WENDPFDPAIKDVGDASNGGRKILTGRGTSDDKGQLMTFVEACRAYKAVNGSLPVKVT
                     LLFEGEEESGSPSLKPFLEANRQELKADVALVCDTAMWDAETPAISVGLRGLVGEEIV
                     IKAADRDLHSGFFGGAAANPIHILTKILADLHDETGRITIPDFYEGVEETPTQILKSW
                     ESLGRTAESFLGPIGLSIPAGEKGRSVLELTWARPTAEVNGIIGGYTGEGFKTVIAAE
                     ASAKVSFRLVHKQDPVKIREAFRAFVKERVPADCSVEFHPHGGSPAIQLPYDSPLVSK
                     AKNALSDEWPKPAVLIAMGGSIPIVGDFNTFLGMESLLVGFGLEDDRIHSPNEKYELN
                     SFHKGQRSWARILAAIAAKQG"
     misc_feature    complement(132934..134337)
                     /locus_tag="BSVBI22_A0121"
                     /note="hypothetical protein; Validated; Region: PRK09104"
                     /db_xref="CDD:236379"
     misc_feature    complement(132943..134280)
                     /locus_tag="BSVBI22_A0121"
                     /note="Uncharacterized M20 Dipeptidases; Region:
                     M20_dipept_like_3; cd05680"
                     /db_xref="CDD:193555"
     misc_feature    complement(order(133018..133020,133759..133761,
                     133837..133842,133942..133944,134068..134070))
                     /locus_tag="BSVBI22_A0121"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193555"
     misc_feature    complement(order(133012..133023,133105..133110,
                     133315..133317,133321..133323,133327..133329,
                     133348..133371,133384..133407,133420..133425,
                     133432..133434,133513..133515,133591..133593,
                     133600..133605,133612..133614,133618..133626,
                     133642..133662,133666..133683,133693..133695,
                     133699..133701,133711..133713))
                     /locus_tag="BSVBI22_A0121"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193555"
     gene            134493..134819
                     /locus_tag="BSVBI22_A0122"
                     /db_xref="GeneID:11727593"
     CDS             134493..134819
                     /locus_tag="BSVBI22_A0122"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153830.1"
                     /db_xref="GI:376279824"
                     /db_xref="GeneID:11727593"
                     /translation="MATNVFHAKGEGEKIGRCGEGITTAAMSLHSGSPERGMRLPLPS
                     GFRRGTGRKTGDRRSVDDRNLAFQLWLFKGIEDYKYVTNPLSGRDGFLSRGRSNLLTR
                     GRFPLL"
     gene            134901..137840
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /db_xref="GeneID:11727594"
     CDS             134901..137840
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="has 3'-5' exonuclease, 5'-3' exonuclease and
                     5'-3'polymerase activities, primarily functions to fill
                     gaps during DNA replication and repair"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="YP_005153831.1"
                     /db_xref="GI:376279825"
                     /db_xref="GeneID:11727594"
                     /translation="MKKGDHLFLVDGSGYIFRAYHALPPLTRKTDGLPVGAVSGFCNM
                     LWKLLKDARNTDVGVVPTHFAVIFDYSSKTFRKEIYPDYKANRTAPPEDLIPQFGLIR
                     QATRAFNLPCIEKEGFEADDLIATYARLAEKAGGDVTIISSDKDLMQLVTPSVSMYDS
                     MKDKQISIPEVIEKWGVPPEKMIDVQSLTGDSTDNVPGIPGIGPKTAAQLLEEFGDLD
                     TLLARASEIKQNKRRENILAFADQTKIARELVTLKTDVPLDIDLDGLVLEPQNGPKLI
                     GFLKAMEFTSLTRRVAEATDTDASSVEPCHVETDWGADAHGPDVDVPEKADAAAASQL
                     LSAPTAAEPDQGYTPKALAEGRAAQAIAQKIDTSAYVCIRDIATLEQWLAEAAETGIL
                     AFDTETTSLDPMQAELVGFSLALAPGKAAYVPLQHKSGAGDLLGGGMVENQIPLDMAL
                     AALKRVLEDASILKIAQNMKYDWLVMRRHGINAVSFDDTMLISYVLDAGTGSHGMDPL
                     SERWLGHTPIAYKDVAGSGKSAVTFDMVDIDRATAYAAEDADVTLRLWQVLKPRLAAE
                     GLMSVYERLERPLVDVLARMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYALAGEKF
                     TIGSPKQLGDILFGKMGLPGASKTKTGQWSTSAQVLEDLAAEGHPLPRKIVDWRQLTK
                     LKSTYTDALPGFINPQTKRVHTSYAMASTSTGRLSSSDPNLQNIPVRTAEGRKIRTAF
                     IAEPGNKLISADYSQIELRVLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPS
                     EVRRRAKAINFGIIYGISAFGLANQLSIPREEAGQYIRTYFERFPGIKDYMEATKAFA
                     REHGYVETIFGRRAHYPDIRASNPQVRAFNERAAINAPIQGAAADIIRRAMIRMEDAL
                     AKENLAARMLLQVHDELIFEVPENEVEKTIPVVRRVMENAAMPAVSLAVPLRVDARAA
                     HNWDEAH"
     misc_feature    134913..137837
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="DNA polymerase I; Provisional; Region: PRK05755"
                     /db_xref="CDD:235591"
     misc_feature    134919..135404
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="PIN domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: PIN_53EXO; cd09859"
                     /db_xref="CDD:189029"
     misc_feature    order(134931..134933,135105..135107,135255..135257,
                     135261..135266,135330..135332,135336..135338)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="active site"
                     /db_xref="CDD:189029"
     misc_feature    order(134931..134933,135261..135263,135330..135332)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    135123..135161
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="putative 5' ssDNA interaction site; other site"
                     /db_xref="CDD:189029"
     misc_feature    order(135255..135257,135264..135266)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="metal binding site 3; metal-binding site"
                     /db_xref="CDD:189029"
     misc_feature    order(135330..135332,135336..135338)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    135435..135656
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="H3TH domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: H3TH_53EXO; cd09898"
                     /db_xref="CDD:188618"
     misc_feature    order(135465..135488,135492..135521,135525..135536)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:188618"
     misc_feature    order(135471..135473,135480..135482)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:188618"
     misc_feature    136053..136655
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="DEDDy 3'-5' exonuclease domain of Escherichia coli
                     DNA polymerase I and similar bacterial family-A DNA
                     polymerases; Region: DNA_polA_I_Ecoli_like_exo; cd06139"
                     /db_xref="CDD:176651"
     misc_feature    order(136083..136094,136101..136103,136299..136304,
                     136308..136316,136410..136415,136458..136463,
                     136530..136532,136542..136544)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="active site"
                     /db_xref="CDD:176651"
     misc_feature    order(136083..136085,136089..136091,136314..136316,
                     136530..136532,136542..136544)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176651"
     misc_feature    order(136086..136094,136101..136103,136299..136304,
                     136308..136313,136410..136415,136458..136463,
                     136530..136532,136542..136544)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176651"
     misc_feature    136680..137828
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="Polymerase I functions primarily to fill DNA gaps
                     that arise during DNA repair, recombination and
                     replication; Region: DNA_pol_A_pol_I_C; cd08637"
                     /db_xref="CDD:176474"
     misc_feature    order(136932..136934,136944..136946,136953..136958,
                     137031..137039,137043..137045,137049..137060,
                     137154..137159,137241..137243,137301..137303,
                     137313..137315,137565..137567,137586..137588,
                     137679..137687)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="active site"
                     /db_xref="CDD:176474"
     misc_feature    order(136932..136934,136944..136946,136953..136958,
                     137031..137039,137043..137045,137049..137060,
                     137337..137339,137562..137567,137574..137576,
                     137586..137588,137679..137687)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176474"
     misc_feature    order(137154..137159,137163..137165,137241..137243,
                     137301..137303,137313..137315,137685..137687)
                     /gene="polA"
                     /locus_tag="BSVBI22_A0123"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176474"
     gene            137982..139862
                     /locus_tag="BSVBI22_A0124"
                     /db_xref="GeneID:11727595"
     CDS             137982..139862
                     /locus_tag="BSVBI22_A0124"
                     /note="identified by similarity to SP:P23304; match to
                     protein family HMM PF00270; match to protein family HMM
                     PF00271; match to protein family HMM PF03880"
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="YP_005153832.1"
                     /db_xref="GI:376279826"
                     /db_xref="GeneID:11727595"
                     /translation="MSLPDTIAPALSGALTARGYNTLTAVQNAVLAPETLASDLLVSA
                     QTGSGKTVAFGLAMANTILEDELRFGDAGAPLAMIIAPTRELALQVRRELEWLYADTG
                     ARIASCVGGMDIRTERRALERGSHIVVGTPRRLRDHITRNALDMSQLRAIVLDEADEM
                     LDMGFREDLEFILGEAPEDRRTLMFSATVPKPIAQLAKRFQNNALRITVQSETSQHAD
                     IDYVAMPVPPHERDHAIINTLLYYDSQNSIIFCSTREAVKHMASRLSNRGFAVVALSG
                     ELSQAERNNALQAMRDGRARVCVATDVAARGIDLPNLDLVIHADLPTNPDTLLHRSGR
                     TGRAGRKGTCVLVVPFSRRRSAERLLHMAKLDAQTVPAPSIAAVQAKTNERILNAEVF
                     NQPVEEEYQELLKALAERYTPEQIASAFLNREVASYPAAEEVSDAPVHPVGGKKPRSD
                     RFEKGDRYERGERRERGEPGERFDRNARFDGVWFSVSAGRKHRADPKWLLPLICKAGD
                     VSKRDVGSIKIFDNETRFEIAASKADEFRQSVAERGTGEKSLVIRTAVAGAGGDAAAR
                     ESRGSFKPRSDKFKEGGFRDGHKSDKPRDFSRGDDFKKDGFKKGGKKPEGGGYSKKRR
                     GE"
     misc_feature    138006..138605
                     /locus_tag="BSVBI22_A0124"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cl17251"
                     /db_xref="CDD:266587"
     misc_feature    138024..138608
                     /locus_tag="BSVBI22_A0124"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    138120..138134
                     /locus_tag="BSVBI22_A0124"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    138444..138455
                     /locus_tag="BSVBI22_A0124"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    138633..139022
                     /locus_tag="BSVBI22_A0124"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(138735..138746,138804..138809,138882..138890)
                     /locus_tag="BSVBI22_A0124"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(138906..138908,138969..138971,138981..138983,
                     138990..138992)
                     /locus_tag="BSVBI22_A0124"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    139428..139640
                     /locus_tag="BSVBI22_A0124"
                     /note="RNA recognition motif in the DbpA subfamily of
                     prokaryotic DEAD-box rRNA helicases; Region: RRM_DbpA;
                     cd12252"
                     /db_xref="CDD:240698"
     misc_feature    order(139449..139451,139464..139475,139479..139487,
                     139491..139496,139512..139514,139521..139532,
                     139620..139625,139632..139634)
                     /locus_tag="BSVBI22_A0124"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240698"
     gene            complement(139958..142390)
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /db_xref="GeneID:11727596"
     CDS             complement(139958..142390)
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="negatively supercoils closed circular
                     double-stranded DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_005153833.1"
                     /db_xref="GI:376279827"
                     /db_xref="GeneID:11727596"
                     /translation="MPEMNSEAPAEYGADSIRVLKGLDAVRKRPGMYIGDTDDGSGLH
                     HMVYEVVDNAIDEALAGHATLVTVTLNADGSCTVTDNGRGIPTDIHKEEGVSAAEVIM
                     TQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSIWLKLKIRRAGKIHEMSFTHGVADAP
                     LVVTGDAGSETGTEVSFLPSPDTFSMVEFDYETLERRLRELAFLNSGVRIKLADRRHA
                     DVKEQELHYDGGLVEFVKYIDQSKKSLLEEPIYIRSEKDGMTVEVAMWWNDSYHEKVL
                     CFTNNIPQRDGGTHLAGFRGALTRQITGYADSSGMTKKEKVQLTGDDCREGLTAVLSV
                     KVPDPKFSSQTKDKLVSSEVRPVVEGLVNEALSTWLEEHPAGGKIVVEKVIQAAAARE
                     AARKARDITRKSNLSVTSLPGKLADCQERDPAKSEIFIVEGDSAGGSAKSGRSRQNQA
                     ILPLRGKILNVERVRFDRMISSDQVGTLITALGTSIGKDETHGFNADKLRYHKIIIMT
                     DADVDGAHIRTLLLTFFFRQMPELIERGHIYIAQPPLYKVTRGKSSQYIKNEAAFEDF
                     LIETGLEETTLELVTGEMRAGPDLRSVVEDARMLRQLLHGLHTRYDRSVVEQAAIAGL
                     LNPDASRDNATAQHSADTVAKRLDMISEETERGWSGHVMEDGGYRFERMVRGVKDIAI
                     LDMALLGSADARQVDRVAGRMAEIFMEPPVLRRKDKVESLSGPVALLDAVFATGRKGL
                     TLQRYKGLGEMNAEQLWETTLDPNVRSLLQVKVNDATDADSLFSRLMGDEVEPRREFI
                     QDNALNVANLDV"
     misc_feature    complement(139961..142375)
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    complement(<141989..142264)
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(142010..142021,142136..142141,
                     142145..142147,142151..142153,142157..142159,
                     142223..142225,142232..142234,142244..142246))
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(142232..142234)
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(142013..142015,142019..142021,
                     142139..142141,142145..142147))
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(141233..141706)
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    complement(141551..141553)
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(141359..141361,141365..141370,
                     141377..141379))
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(141353..141355,141359..141361))
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(140762..141115)
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(140852..140854,140858..140860,
                     140864..140866,141083..141085,141092..141097))
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(140864..140866,141095..141097))
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    complement(139994..140188)
                     /gene="gyrB"
                     /locus_tag="BSVBI22_A0125"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(142450..142617)
                     /locus_tag="BSVBI22_A0126"
                     /db_xref="GeneID:11727597"
     CDS             complement(142450..142617)
                     /locus_tag="BSVBI22_A0126"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153834.1"
                     /db_xref="GI:376279828"
                     /db_xref="GeneID:11727597"
                     /translation="MRPADQIWTPIMAAPESQSGHHAQIGAKQPESPANLPLKFGKIA
                     VSTYIKAMFVA"
     gene            complement(142722..143477)
                     /locus_tag="BSVBI22_A0127"
                     /db_xref="GeneID:11727598"
     CDS             complement(142722..143477)
                     /locus_tag="BSVBI22_A0127"
                     /note="identified by similarity to OMNI:NTL02ML5595; match
                     to protein family HMM PF00756"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="YP_005153835.1"
                     /db_xref="GI:376279829"
                     /db_xref="GeneID:11727598"
                     /translation="MTFALFLPPQAKDGPVPVLWYLSGLTCTHQNVMDKGEYRQLASE
                     LGIAVICPDTSPRGDSIADEPDNWQFGKGAGFYVDAMQAPFAQNYRMYSYITQELSAL
                     VARQFPLDMERQAITGHSMGGHGALTIALKNPDRFKSVSAFAPIVQPSTAGWSRPALE
                     KYLGPDEQAWRAYDATLLIEDGHRFPEILVDQGTADGFLDDGLRPWLLEEACRKAGIA
                     LTLNMREGYDHSYFFISTFMGDHLRWHSERLRS"
     misc_feature    complement(142731..143477)
                     /locus_tag="BSVBI22_A0127"
                     /note="Predicted hydrolase of the alpha/beta superfamily
                     [General function prediction only]; Region: COG2819;
                     cl19187"
                     /db_xref="CDD:267540"
     misc_feature    complement(142749..143477)
                     /locus_tag="BSVBI22_A0127"
                     /note="Putative esterase; Region: Esterase; pfam00756"
                     /db_xref="CDD:250111"
     gene            complement(143566..144222)
                     /locus_tag="BSVBI22_A0128"
                     /db_xref="GeneID:11727599"
     CDS             complement(143566..144222)
                     /locus_tag="BSVBI22_A0128"
                     /note="identified by similarity to GP:14021760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153836.1"
                     /db_xref="GI:376279830"
                     /db_xref="GeneID:11727599"
                     /translation="MFLLRRHISFYIGAIGGVVAFTIAWALKSPLAPVIGANCFFVIY
                     LLLAVSVLPRLTPSFLKKHAASADEPVWIIFLVTFAAVLIGIASLFILINSASKVDTF
                     SLVVTLASVPLGWFTIHMMTAIHYAHVYWQPREPAGNDPKRASRYRGGFDFPGTPEPS
                     GWDFAYYAYVIGMTAQTSDTNVTTPAMRRTTLLHSIVSFFFNTVLVAAAVNVVVALGS
                     "
     misc_feature    complement(143614..144222)
                     /locus_tag="BSVBI22_A0128"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4291"
                     /db_xref="CDD:226741"
     gene            complement(144222..144689)
                     /locus_tag="BSVBI22_A0129"
                     /db_xref="GeneID:11727600"
     CDS             complement(144222..144689)
                     /locus_tag="BSVBI22_A0129"
                     /note="identified by match to protein family HMM PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_005153837.1"
                     /db_xref="GI:376279831"
                     /db_xref="GeneID:11727600"
                     /translation="MNASLLTSHWAEIDDLAPRALYAMLKLRVDVFVVEQTCPYPEID
                     GKDIGAFHLRILDGDTLAAALRVLPPEGEKSVKIGRVVVAPAYRGYKLGQRLMMEAIA
                     FAQARFPGSPLELGGQSHLQKFYASFGFVAISGEYLEDGIPHVDMRLEPSETD"
     misc_feature    complement(144243..144665)
                     /locus_tag="BSVBI22_A0129"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    complement(144369..144527)
                     /locus_tag="BSVBI22_A0129"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(144408..144413,144441..144449))
                     /locus_tag="BSVBI22_A0129"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(144689..145801)
                     /locus_tag="BSVBI22_A0130"
                     /note="glutathione-dependent formaldehyde dehydrogenase,
                     authentic point mutation; this gene contains a premature
                     stop which is not the result of sequencing
                     error;identified by similarity to EGAD:20238"
                     /pseudo
                     /db_xref="GeneID:11727601"
     gene            complement(145835..146119)
                     /locus_tag="BSVBI22_A0131"
                     /db_xref="GeneID:11727602"
     CDS             complement(145835..146119)
                     /locus_tag="BSVBI22_A0131"
                     /note="identified by similarity to EGAD:97446; match to
                     protein family HMM PF02583"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153838.1"
                     /db_xref="GI:376279832"
                     /db_xref="GeneID:11727602"
                     /translation="MPHSPEDKKRALTRLRRIKGQAEALERAVEAGTECAALLQQIAA
                     LRGAANGLMAEVLESHFRETFGQARETMAQKDDPDTQIDEIMRILRTYLK"
     misc_feature    complement(145841..146113)
                     /locus_tag="BSVBI22_A0131"
                     /note="Transcriptional regulators RcnR and FrmR, and
                     related domains; this domain family was previously known
                     as part of DUF156; Region: RcnR-FrmR-like_DUF156; cd10153"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(145928..145930,145940..145942,
                     146015..146017,146111..146113))
                     /locus_tag="BSVBI22_A0131"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(145850..145879,145883..145888,
                     145925..145927,145934..145942,145946..145954,
                     145958..145963,145970..145975,145982..145987,
                     145991..145996,146000..146008,146012..146020,
                     146024..146035,146042..146047,146051..146056,
                     146063..146065,146072..146077,146084..146089,
                     146096..146098))
                     /locus_tag="BSVBI22_A0131"
                     /note="putative homotetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(145850..145861,145868..145870,
                     145940..145942,145952..145954,145961..145963,
                     145970..145975,145982..145987,145991..145996,
                     146000..146008,146012..146020,146024..146035,
                     146042..146047,146051..146056,146063..146065,
                     146072..146077,146084..146089,146096..146098))
                     /locus_tag="BSVBI22_A0131"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(145862..145867,145871..145879,
                     145883..145888,145925..145930,145934..145939,
                     145946..145951,145958..145960))
                     /locus_tag="BSVBI22_A0131"
                     /note="putative homodimer-homodimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(145868..145870,145940..145942))
                     /locus_tag="BSVBI22_A0131"
                     /note="putative allosteric switch controlling residues;
                     other site"
                     /db_xref="CDD:197388"
     gene            146246..148700
                     /locus_tag="BSVBI22_A0132"
                     /note="ATP-dependent helicase, authentic frameshift; this
                     gene contains a frame shift which is not the result of
                     sequencing error;identified by similarity to SP:P37024"
                     /pseudo
                     /db_xref="GeneID:11727603"
     gene            148795..150087
                     /locus_tag="BSVBI22_A0133"
                     /db_xref="GeneID:11727604"
     CDS             148795..150087
                     /locus_tag="BSVBI22_A0133"
                     /note="identified by match to protein family HMM PF00512;
                     match to protein family HMM PF02518"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_005153839.1"
                     /db_xref="GI:376279833"
                     /db_xref="GeneID:11727604"
                     /translation="MHAEFENRASNLSRRPRLTTLVRVRWLAIAGQTAAVMFVALYLQ
                     FPFSVGICFALIACSAWLNLYLAFRFPANHRLNPTAASLVLAFDVLQLAGLLYLTGGL
                     QNPFIVLMIVPVIISATSLSARDTIVLALLVVACTSFLTIHYDPLPWYPGETLNLPLL
                     FVIGIWCAIISALGFTGVYAYRIAEEARQLGDALSAAELILQREQHLSALDGLAAAAA
                     HELGTPLATIALVVKEMQRAHTKDPGLEEDIALLHSQTQRCREILQRLTSLSSEGEEH
                     MSRLPLSSLIEEVIAPHRNFGIMIEVQKEEGPKPEPVTRRNPGLLYGLGNLVENAVDF
                     ARGEVTVTWGWTDGHVSVTIQDDGEGFRPEILDRIGEPYMTSRDNTRNGGGLGLGLFI
                     AKTLLERSGAQISFRNRSNPGQGAEVKVTWPRSAFSAS"
     misc_feature    149059..150081
                     /locus_tag="BSVBI22_A0133"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    149449..149604
                     /locus_tag="BSVBI22_A0133"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    149449..149451
                     /locus_tag="BSVBI22_A0133"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    order(149455..149457,149464..149466,149476..149478,
                     149485..149487,149536..149538,149548..149550,
                     149557..149559,149569..149571,149578..149580,
                     149590..149592)
                     /locus_tag="BSVBI22_A0133"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    149764..150057
                     /locus_tag="BSVBI22_A0133"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(149770..149772,149782..149784,149791..149793,
                     149854..149856,149860..149862,149866..149868,
                     149872..149877,149953..149964,150010..150012,
                     150022..150024,150037..150042,150046..150048)
                     /locus_tag="BSVBI22_A0133"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    149782..149784
                     /locus_tag="BSVBI22_A0133"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(149866..149868,149872..149874,149953..149955,
                     149959..149961)
                     /locus_tag="BSVBI22_A0133"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            150179..150490
                     /locus_tag="BSVBI22_A0134"
                     /db_xref="GeneID:11727605"
     CDS             150179..150490
                     /locus_tag="BSVBI22_A0134"
                     /note="identified by similarity to EGAD:46813"
                     /codon_start=1
                     /transl_table=11
                     /product="IS711, transposase orfA"
                     /protein_id="YP_005153840.1"
                     /db_xref="GI:376279834"
                     /db_xref="GeneID:11727605"
                     /translation="MSNGTGSKHIFRGELVRPAAVASITDYLSTPSCGWLPMQRTGAI
                     CLRPSANGQRFMPAFGDGRTPVYGKGFSMPWLIRRTLNMSSLIAPYRKSTQMRRAQKG
                     G"
     misc_feature    150401..>150481
                     /locus_tag="BSVBI22_A0134"
                     /note="heme biosynthesis-associated TPR protein; Region:
                     TPR_hemY_coli; TIGR00540"
                     /db_xref="CDD:233013"
     gene            150522..150914
                     /locus_tag="BSVBI22_A0135"
                     /db_xref="GeneID:11727606"
     CDS             150522..150914
                     /locus_tag="BSVBI22_A0135"
                     /note="identified by similarity to PIR:PN0685; match to
                     protein family HMM PF01609"
                     /codon_start=1
                     /transl_table=11
                     /product="IS711, transposase orfB"
                     /protein_id="YP_005153841.1"
                     /db_xref="GI:376279835"
                     /db_xref="GeneID:11727606"
                     /translation="MTTKLHAVVDAIGLPLRIKPTPGHYGDCPQASSLLSGLKGVGHV
                     IADAAYDADHLRAFIASDLKATAQIKVNPTRSSVPTIDWRLYKERHQIECFFNKLKRY
                     RRIALRCEKTLTAFMGFVHLACAMIWLR"
     misc_feature    150528..150911
                     /locus_tag="BSVBI22_A0135"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    150651..150911
                     /locus_tag="BSVBI22_A0135"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            150980..151318
                     /locus_tag="BSVBI22_A0136"
                     /db_xref="GeneID:11727607"
     CDS             150980..151318
                     /locus_tag="BSVBI22_A0136"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153842.1"
                     /db_xref="GI:376279836"
                     /db_xref="GeneID:11727607"
                     /translation="MTRIFSENRFTPFGMRSNIPAAQSGGSDSFCRAIRRFRAPFSLR
                     AELNRLKRPFYSCRAMTRETQSLHKNHNLSHDTAIASVVAALYVHHDQQISGILLATL
                     SSQMRDYWRI"
     misc_feature    <151130..151312
                     /locus_tag="BSVBI22_A0136"
                     /note="Uncharacterized conserved protein (DUF2267);
                     Region: DUF2267; cl02314"
                     /db_xref="CDD:261241"
     gene            151514..152077
                     /locus_tag="BSVBI22_A0137"
                     /db_xref="GeneID:11727608"
     CDS             151514..152077
                     /locus_tag="BSVBI22_A0137"
                     /note="identified by match to protein family HMM PF00072;
                     match to protein family HMM TIGR01199"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="YP_005153843.1"
                     /db_xref="GI:376279837"
                     /db_xref="GeneID:11727608"
                     /translation="MEDLKQEDTEAIGNDPTLLLVDDDKPFLQRLARAMESRGFQVTT
                     AESVEEGIAAVKTSAPAYAVVDMRLGDGNGLDIIEAIRSRRADTRAIVLTGYGNIATA
                     VNAVKLGAIDYLSKPADADEVFAALTRRPGEKVAPPENPMSADRVRWEHIQRVYEMCE
                     RNVSETARRLNMHRRTLQRILAKRAPR"
     misc_feature    151532..152074
                     /locus_tag="BSVBI22_A0137"
                     /note="Response regulator consisting of a CheY-like
                     receiver domain and a Fis-type HTH domain [Signal
                     transduction mechanisms / Transcription]; Region: COG4567"
                     /db_xref="CDD:226933"
     misc_feature    151568..151900
                     /locus_tag="BSVBI22_A0137"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(151577..151582,151709..151711,151733..151735,
                     151793..151795,151850..151852,151859..151864)
                     /locus_tag="BSVBI22_A0137"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    151709..151711
                     /locus_tag="BSVBI22_A0137"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(151718..151723,151727..151735)
                     /locus_tag="BSVBI22_A0137"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    151859..151867
                     /locus_tag="BSVBI22_A0137"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    151973..>152053
                     /locus_tag="BSVBI22_A0137"
                     /note="PucR C-terminal helix-turn-helix domain; Region:
                     HTH_30; pfam13556"
                     /db_xref="CDD:257873"
     gene            complement(152083..152577)
                     /locus_tag="BSVBI22_A0138"
                     /db_xref="GeneID:11727609"
     CDS             complement(152083..152577)
                     /locus_tag="BSVBI22_A0138"
                     /note="identified by similarity to GP:15154914"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153844.1"
                     /db_xref="GI:376279838"
                     /db_xref="GeneID:11727609"
                     /translation="MPIVIPNQTHPLSDGRQSENALLVRRGVQRLFLAMGLATLPELS
                     LASGRRADLIAVSRKGEIWIVEIKSSIEDWKADHKWPEYRAYCDRLFFATHPAVPREI
                     FPEECGFILSDGYGAEILREAPEHRLAGATRKALMLRFARAGAARLMAAELAGLDVPG
                     TEID"
     misc_feature    complement(152086..152577)
                     /locus_tag="BSVBI22_A0138"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5321"
                     /db_xref="CDD:227631"
     gene            152846..153466
                     /locus_tag="BSVBI22_A0139"
                     /db_xref="GeneID:11727610"
     CDS             152846..153466
                     /locus_tag="BSVBI22_A0139"
                     /note="identified by similarity to GP:9392598; match to
                     protein family HMM PF03734"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_005153845.1"
                     /db_xref="GI:376279839"
                     /db_xref="GeneID:11727610"
                     /translation="MDSRVLKLTAALFLGAALAGCSTAGGSFYTASYSSVSDAGYAIP
                     AIPSEKIPAQYRRQVVKYATDEKPGTIIVDTREKFLYLIMSEGKAVRYGIGVGRRGFE
                     WSGTARVAMKREWPTWTPPSAMIKRQPELAKYRNGMDPGLRNPLGARALYLYNKGGDT
                     GYRLHGTPEWWSIGKAMSSGCIRLMNQDIIDLYNRVEQGAKVVVKQ"
     misc_feature    152933..153463
                     /locus_tag="BSVBI22_A0139"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: ErfK; COG1376"
                     /db_xref="CDD:224294"
     misc_feature    153047..153457
                     /locus_tag="BSVBI22_A0139"
                     /note="L,D-transpeptidase catalytic domain; Region: YkuD;
                     pfam03734"
                     /db_xref="CDD:252135"
     gene            complement(153556..154128)
                     /locus_tag="BSVBI22_A0140"
                     /db_xref="GeneID:11727611"
     CDS             complement(153556..154128)
                     /locus_tag="BSVBI22_A0140"
                     /note="identified by match to protein family HMM PF01106"
                     /codon_start=1
                     /transl_table=11
                     /product="NifU-like protein"
                     /protein_id="YP_005153846.1"
                     /db_xref="GI:376279840"
                     /db_xref="GeneID:11727611"
                     /translation="MFIQTETTPNPATLKFLPGKVVMPEGTADFRDPASAENTSPLAA
                     KLFAVPGVTGVFFGYDFITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNANADAA
                     AAHGEEEFFDEADTEIVETIKELIETRVRPAVAQDGGDITFRGFENGTVFLHMKGACS
                     GCPSSTATLKHGIQNLLRHFVPEVQQVEQI"
     misc_feature    complement(153862..154122)
                     /locus_tag="BSVBI22_A0140"
                     /note="Scaffold protein Nfu/NifU N terminal; Region:
                     Nfu_N; pfam08712"
                     /db_xref="CDD:254992"
     misc_feature    complement(153559..153804)
                     /locus_tag="BSVBI22_A0140"
                     /note="Thioredoxin-like proteins and domains
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0694"
                     /db_xref="CDD:223766"
     gene            complement(154237..154725)
                     /locus_tag="BSVBI22_A0141"
                     /db_xref="GeneID:11727612"
     CDS             complement(154237..154725)
                     /locus_tag="BSVBI22_A0141"
                     /note="identified by similarity to GP:15155260; match to
                     protein family HMM PF00582"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153847.1"
                     /db_xref="GI:376279841"
                     /db_xref="GeneID:11727612"
                     /translation="MVSRRLSREAGHRRKFLAVIDETPECGRAVAYVARRARNTNGSL
                     VMLFVIDNSEFQQILGVGEIMRAEAEERARTALEKFAANVRAEQGIDPELIIREGRTA
                     EELLSLVEEDQDIAILVLAAGASKEGPGPLVQSLAGRAQFPIPVTVVPAGLSDDDIDA
                     LT"
     misc_feature    complement(154279..154683)
                     /locus_tag="BSVBI22_A0141"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    complement(order(154327..154338,154348..154353,
                     154357..154359,154366..154368,154579..154581,
                     154663..154671))
                     /locus_tag="BSVBI22_A0141"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            complement(154783..155850)
                     /gene="trpS"
                     /locus_tag="BSVBI22_A0142"
                     /db_xref="GeneID:11727613"
     CDS             complement(154783..155850)
                     /gene="trpS"
                     /locus_tag="BSVBI22_A0142"
                     /note="catalyzes a two-step reaction, first charging a
                     tryptophan molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="YP_005153848.1"
                     /db_xref="GI:376279842"
                     /db_xref="GeneID:11727613"
                     /translation="MSTFKPLVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEECIYCVV
                     DMHALTVSPDPVELMQSTREVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVAR
                     IGWMSRMTQFKDKAGKDRENASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTR
                     DIAQKFNNDYSDRIASLGVGVDMKVGDEQVSGFFPLTEPMISGPAMRIMSLRDGTKKM
                     SKSDPSDLSRINLIDDEDTITKKIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALS
                     STTKEDVLKEFGGRQFSDLKASLADLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQ
                     AGAIAEQTMRHVRDIVGWLQN"
     misc_feature    complement(154789..155838)
                     /gene="trpS"
                     /locus_tag="BSVBI22_A0142"
                     /note="tryptophanyl-tRNA synthetase; Reviewed; Region:
                     PRK00927"
                     /db_xref="CDD:234866"
     misc_feature    complement(154948..155829)
                     /gene="trpS"
                     /locus_tag="BSVBI22_A0142"
                     /note="catalytic core domain of tryptophanyl-tRNA
                     synthetase; Region: TrpRS_core; cd00806"
                     /db_xref="CDD:173903"
     misc_feature    complement(order(155191..155193,155197..155202,
                     155230..155232,155386..155388,155395..155400,
                     155404..155409,155413..155415,155440..155442,
                     155449..155451,155461..155463,155599..155601,
                     155710..155712,155725..155727,155776..155778,
                     155785..155790,155794..155796,155812..155826))
                     /gene="trpS"
                     /locus_tag="BSVBI22_A0142"
                     /note="active site"
                     /db_xref="CDD:173903"
     misc_feature    complement(155785..155796)
                     /gene="trpS"
                     /locus_tag="BSVBI22_A0142"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173903"
     misc_feature    complement(order(155452..155457,155464..155469,
                     155473..155475,155530..155535,155539..155550,
                     155554..155559,155566..155574,155578..155583,
                     155701..155706,155713..155715))
                     /gene="trpS"
                     /locus_tag="BSVBI22_A0142"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173903"
     misc_feature    complement(155188..155202)
                     /gene="trpS"
                     /locus_tag="BSVBI22_A0142"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173903"
     gene            complement(155947..157536)
                     /gene="mviN"
                     /locus_tag="BSVBI22_A0143"
                     /db_xref="GeneID:11727614"
     CDS             complement(155947..157536)
                     /gene="mviN"
                     /locus_tag="BSVBI22_A0143"
                     /note="identified by similarity to SP:P56882; match to
                     protein family HMM PF03023; match to protein family HMM
                     TIGR01695"
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor MviN"
                     /protein_id="YP_005153849.1"
                     /db_xref="GI:376279843"
                     /db_xref="GeneID:11727614"
                     /translation="MSLVKKFATVASGTLMSRIFGFTREMFMAAALGTGPVADAFNAA
                     FRFPNTFRRLFAEGAFNSAFVPLFAKEIEKNGMDGARRFSEEVFGVLFTVLLFLTIAM
                     ELSMPFIVRTVIAPGFTDDPVKFSNTVRLAIIMFPYLACMSLAAMMGGMLNSLHRYFA
                     AAIAPVFLNIILIGVLAVAWMQGYDALAVGYGLSWGVMAAGLVQLAIVWIAVRHAGIK
                     IGFRRPRLTPNVKRLLVLALPAAITGGITQINLLINTNIASGMQGAVSSLVYADRIYQ
                     LPLGVVGIAVATVLLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAVALLVMSEP
                     IVRLLFERGKFSPDSTLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAI
                     SVVVNVSLAITLFPHFGPTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLTRIPR
                     LLIAAGIMAFGIHYAIGHFTYELSSAAPLAARAGTVAVMVITAMIVYFALAFGLGGAN
                     TGMIRRNLKRGGGKNQPESEA"
     misc_feature    complement(155992..157536)
                     /gene="mviN"
                     /locus_tag="BSVBI22_A0143"
                     /note="Uncharacterized membrane protein, putative
                     virulence factor [General function prediction only];
                     Region: MviN; COG0728"
                     /db_xref="CDD:223800"
     misc_feature    complement(156232..157506)
                     /gene="mviN"
                     /locus_tag="BSVBI22_A0143"
                     /note="MurJ/MviN, a subfamily of the multidrug and toxic
                     compound extrusion (MATE)-like proteins; Region:
                     MATE_MurJ_like; cd13123"
                     /db_xref="CDD:240528"
     gene            complement(157550..160354)
                     /locus_tag="BSVBI22_A0144"
                     /db_xref="GeneID:11727615"
     CDS             complement(157550..160354)
                     /locus_tag="BSVBI22_A0144"
                     /note="catalyzes the uridylylation or deuridylylation of
                     the PII nitrogen regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PII uridylyl-transferase"
                     /protein_id="YP_005153850.1"
                     /db_xref="GI:376279844"
                     /db_xref="GeneID:11727615"
                     /translation="MSAHDLKLEEIVNAETLRRKLNELADTADESYTSLPMRKVVLQT
                     LKDALASGRANAEDMLMKDGGGTLCAKRLCYLMDTLIDILFEFATTRAYPTRNPSKAE
                     NMALVAVGGYGRGGLAQGSDIDLLFLLPYKQTPWGEQVVEYTLYMLWDMGLKVGHSTR
                     NIDECIRLAREDMTIRTALLDARFLTGDKDLFRTLEIRFEEEIVKGTEPEFIQAKLAE
                     RDARHRKAGETRYLVEPNVKEGKGGQRDLHTLFWITKYFYRVKTKEELVKLGVLSRAE
                     LKLFNKAEDFLWAVRCHMHFATLKAEERLSFDIQPEIAQRLGYTAHPGQNYVERFMKH
                     YFLVAKDVGDLTRIICAALEEQQAKHVPGFNRIFLTFSRRKRKLSDDGAFISENHRIN
                     IARPDIFRQDPVNMIRLFHLADRHGLEFHPEAMQSLTRSLKLINADLRENPEANRLFL
                     EILTSPRNPELILRRMNESGVLGKFIPDFGKIVAMMQFNMYHHYTVDEHLLRCIAVLS
                     EIEHGELKTEHPLSNHLITTIKRDRNLLYVTLLLHDIAKGRPEDHSIAGARIARRLCP
                     RFGLTPSETETVEWLVREHLTMSMVAQSRDLNDRKTIIDFADTVQTMERLKLLLILTV
                     CDIKAVGPGIWNGWKGQLLRTLFYETELVLTGGFSELSRAARDKQAREALAERLSDWP
                     KEERDAYLALPYTNYFLTVSLDDQVRHAHFIRDADQQGRALVTMAKPHAFEAVTEITV
                     LAPDHPRLLSVITGACAAAGGNIVDAQIFTTSNGRALDTILISREFDTDDDERRRAER
                     VGKVIEDVLSGKAHLPDMLAKRTKPKKAARAFKVEPRVEINNTLSNKFTVIEVEGLDR
                     PGLLSELTGLISDLSLDIASAHITTFGEKVIDSFYVTDLVGHKISNATRQGNIKRKLL
                     ALLGAENGARTNGRSPQAAA"
     misc_feature    complement(157553..160354)
                     /locus_tag="BSVBI22_A0144"
                     /note="PII uridylyl-transferase; Provisional; Region:
                     PRK05092"
                     /db_xref="CDD:235342"
     misc_feature    complement(159752..160219)
                     /locus_tag="BSVBI22_A0144"
                     /note="Nucleotidyltransferase (NT) domain of Escherichia
                     coli adenylyltransferase (GlnE), Escherichia coli uridylyl
                     transferase (GlnD), and similar proteins; Region:
                     NT_GlnE_GlnD_like; cd05401"
                     /db_xref="CDD:143391"
     misc_feature    complement(order(159905..159907,159983..159985,
                     159989..159991))
                     /locus_tag="BSVBI22_A0144"
                     /note="metal binding triad; metal-binding site"
                     /db_xref="CDD:143391"
     misc_feature    complement(159305..159724)
                     /locus_tag="BSVBI22_A0144"
                     /note="GlnD PII-uridylyltransferase; Region:
                     GlnD_UR_UTase; pfam08335"
                     /db_xref="CDD:254738"
     misc_feature    complement(158417..158875)
                     /locus_tag="BSVBI22_A0144"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(158477..158479,158723..158728,
                     158858..158860))
                     /locus_tag="BSVBI22_A0144"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(158723..158725)
                     /locus_tag="BSVBI22_A0144"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(157934..158152)
                     /locus_tag="BSVBI22_A0144"
                     /note="ACT domain family, ACT_UUR-like_1, includes the
                     first of two C-terminal ACT domains of the bacterial
                     signal-transducing uridylyltransferase /uridylyl-removing
                     (UUR) enzyme, GlnD and related domains; Region:
                     ACT_UUR-like_1; cd04900"
                     /db_xref="CDD:153172"
     misc_feature    complement(157604..157816)
                     /locus_tag="BSVBI22_A0144"
                     /note="C-terminal ACT domains of the bacterial
                     signal-transducing uridylyltransferase /uridylyl-removing
                     (UUR) enzyme, GlnD and related domains; Region:
                     ACT_ACR-UUR-like_2; cd04899"
                     /db_xref="CDD:153171"
     gene            160420..160515
                     /locus_tag="BSVBI22_A0145"
                     /db_xref="GeneID:11727616"
     CDS             160420..160515
                     /locus_tag="BSVBI22_A0145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153851.1"
                     /db_xref="GI:376279845"
                     /db_xref="GeneID:11727616"
                     /translation="MDMVNIEKQRPGETPGPTLSCYFLIFQFVAL"
     gene            complement(160497..162646)
                     /locus_tag="BSVBI22_A0146"
                     /note="NADP-dependent malic enzyme, authentic frameshift;
                     this gene contains a frame shift which is not the result
                     of sequencing error;identified by similarity to SP:O30808"
                     /pseudo
                     /db_xref="GeneID:11727617"
     gene            162926..165658
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /db_xref="GeneID:11727618"
     CDS             162926..165658
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="This protein performs the mismatch recognition step
                     during the DNA repair process"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="YP_005153852.1"
                     /db_xref="GI:376279846"
                     /db_xref="GeneID:11727618"
                     /translation="MEAKVEEKEPEPVENAGPDAPVRLTPMMEQYIEIKAANVDSLLF
                     YRMGDFYELFFDDAVAASAALGITLTKRGKHLGEDIPMCGVPVHAADDYLQKLIAKGY
                     RVAVCEQVEDPAEAKKRGSKSVVKRDVIRLVTPGTLTEEKLLDPAQANFLMAMGRTRG
                     DGALALAWIDISTGTFRVAETTPDRLFADIMRVDPRELVVADSAFHDEELRPVFDLIG
                     KAVTPQPATLFDSAAAQTRIQHYFNVATLDGFGQFSRPELSAISGAIAYIEKTQISER
                     PPLMRPEREHEGGTLFIDPATRASLELARTMSGNRDGSLLKAIDRTVTGGGARLLAER
                     LTAPLTSPKEIALRLDSVSWCLSEQTLCEALRLELKGVPDMPRALSRLAVGRGGPRDL
                     GALACGFEAAGGIASLLDGALLPDELAAAREAIEKMPAGFAAHLDRALADELPLLKRD
                     GGFVREGYNSELDEMRALRDQSRRVIAGLQADYIEETGIKSLKIKHNNVLGYFIEVTA
                     NNSGAMTDTDEAKSRFIHRQTMANAMRFTTTELAELESKIANAADRALSIELAIFEEL
                     TAEAVAHADSIRAAASALSVFDVSTALAVLAEERGYCRPHVDDSLSFNIVAGRHPVVE
                     QALRRQAANPFVANDCDLSPQRDGGDGAIWLLTGPNMGGKSTFLRQNALIAILAQMGS
                     FVPAGSAHIGVVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQAGEHSLVILDEIG
                     RGTATFDGLSIAWAAVEYLHEKNRCRALFATHFHEMTALSEKLERLSNVTMRVKEWDN
                     DVIFLHEVAKGAADRSYGVQVARLAGLPEAVVNRARDVLHQLEAGETSGKADRLIDDL
                     PLFSVMLQQEKPKPQIQAKDSELANAVAAISPDELTPREALDLIYKLKELAGKA"
     misc_feature    162995..165652
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="DNA mismatch repair protein MutS; Provisional;
                     Region: PRK05399"
                     /db_xref="CDD:235444"
     misc_feature    162998..163348
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="MutS domain I; Region: MutS_I; pfam01624"
                     /db_xref="CDD:250754"
     misc_feature    163373..163762
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="MutS domain II; Region: MutS_II; pfam05188"
                     /db_xref="CDD:253070"
     misc_feature    163808..164707
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="MutS domain III; Region: MutS_III; pfam05192"
                     /db_xref="CDD:253074"
     misc_feature    164768..165436
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="ATP-binding cassette domain of MutS1 homolog;
                     Region: ABC_MutS1; cd03284"
                     /db_xref="CDD:213251"
     misc_feature    164897..164920
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213251"
     misc_feature    order(164906..164911,164915..164923,165029..165031,
                     165134..165139,165239..165241)
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213251"
     misc_feature    165020..165031
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213251"
     misc_feature    165044..165085
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213251"
     misc_feature    165122..165139
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="Walker B; other site"
                     /db_xref="CDD:213251"
     misc_feature    165146..165157
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="D-loop; other site"
                     /db_xref="CDD:213251"
     misc_feature    165227..165247
                     /gene="mutS"
                     /locus_tag="BSVBI22_A0147"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213251"
     gene            complement(165964..166809)
                     /locus_tag="BSVBI22_A0148"
                     /db_xref="GeneID:11727619"
     CDS             complement(165964..166809)
                     /locus_tag="BSVBI22_A0148"
                     /note="identified by similarity to GP:15073322"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153853.1"
                     /db_xref="GI:376279847"
                     /db_xref="GeneID:11727619"
                     /translation="MSGLEAQQALFASNGDAIILGRIGSLEVRLANSRAAIEAAQELR
                     FRVFFEEMGARKETIEAVEQRDADRFDTICDHLLVYDTALPVPEHQQIVGTYRLMRNE
                     QAEKALGFYSADEYDVQRLKLSRPNLRLLELGRSCVKPEYRSKRTVELLWQGAWAYCR
                     RHSIDVMFGCASFHGAVPAAHALGLSFLHHNCRATDDWDVRALPHRYQAMDLMPKEAI
                     NNKVALFSMPPLVKGYLRLGAMIGDGAVIDEAFGTTDVFIILPIERISSRYISYYGAE
                     ANRFV"
     misc_feature    complement(165970..166752)
                     /locus_tag="BSVBI22_A0148"
                     /note="Putative hemolysin [General function prediction
                     only]; Region: COG3176"
                     /db_xref="CDD:225717"
     gene            complement(167132..167614)
                     /gene="lspA"
                     /locus_tag="BSVBI22_A0149"
                     /db_xref="GeneID:11727620"
     CDS             complement(167132..167614)
                     /gene="lspA"
                     /locus_tag="BSVBI22_A0149"
                     /note="identified by similarity to EGAD:21383; match to
                     protein family HMM PF01252; match to protein family HMM
                     TIGR00077"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="YP_005153854.1"
                     /db_xref="GI:376279848"
                     /db_xref="GeneID:11727620"
                     /translation="MKRHAVWSSLFVVILAVLIDQGIKYLVESRMFYGQQIDLLPFLA
                     LFRTHNEGIAFSMLAWLHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGA
                     IGNLIDRVMHGYVVDYVLFHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRERISH
                     "
     misc_feature    complement(167144..167614)
                     /gene="lspA"
                     /locus_tag="BSVBI22_A0149"
                     /note="lipoprotein signal peptidase; Provisional; Region:
                     PRK14795"
                     /db_xref="CDD:173256"
     gene            complement(167616..168509)
                     /locus_tag="BSVBI22_A0150"
                     /db_xref="GeneID:11727621"
     CDS             complement(167616..168509)
                     /locus_tag="BSVBI22_A0150"
                     /note="identified by match to protein family HMM PF00588"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="YP_005153855.1"
                     /db_xref="GI:376279849"
                     /db_xref="GeneID:11727621"
                     /translation="MSRNDEFSRSGGSRPEHRSEHPKVGQVKEVTSLANPIVKDLRSL
                     ALKKFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVAARTFAKGGL
                     VLEVTEKVISAITRRDNPQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRDPGNLGTV
                     IRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKGFSGLV
                     VGTHLKGAVDYRTIPYANKPVILIMGNEQQGLPDSLAGACDKLARIPQAGRADSLNLA
                     IATGVMLYEIRREALTLDERG"
     misc_feature    complement(167646..168422)
                     /locus_tag="BSVBI22_A0150"
                     /note="rRNA methylases [Translation, ribosomal structure
                     and biogenesis]; Region: SpoU; COG0566"
                     /db_xref="CDD:223640"
     misc_feature    complement(168123..168341)
                     /locus_tag="BSVBI22_A0150"
                     /note="RNA 2'-O ribose methyltransferase substrate
                     binding; Region: SpoU_sub_bind; pfam08032"
                     /db_xref="CDD:254595"
     misc_feature    complement(167658..168083)
                     /locus_tag="BSVBI22_A0150"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            complement(168506..169651)
                     /locus_tag="BSVBI22_A0151"
                     /db_xref="GeneID:11727622"
     CDS             complement(168506..169651)
                     /locus_tag="BSVBI22_A0151"
                     /note="identified by similarity to OMNI:NTL02ML2473"
                     /codon_start=1
                     /transl_table=11
                     /product="SAM dependent methyltransferase"
                     /protein_id="YP_005153856.1"
                     /db_xref="GI:376279850"
                     /db_xref="GeneID:11727622"
                     /translation="MKTPKGKGKKPSGGKQERGFERRKQDAPRTENKFESRTEGKGAF
                     KKPRPQFAKAAPKPAEEKAPGPLREIRPYTGPRPAERLPLILETEPSPDYALLDSGNG
                     LKLEQYGPYRIVRPEGQAIWLPALPQREWDQADAIFTGNTDEEGMGRWAFPKTPLDET
                     WPMQHDGISFHGRFTSFRHVGVFPEQAAHWSFMDGLIRDAVKTGRTVKVLNLFGYTGV
                     ASLVAARAGAEVTHVDASKKAILWARENQEMAGLSDKPIRWICEDAMKFVQREERRGS
                     FYDIILLDPPAYGRGPSGEVWQLFEHLPAMVDTCRAILSAKPLAVILTAYSIRASFFA
                     IHELMRDRFTGLGSTVESGELILRERSADQSGGRALSTSMFSRWVAK"
     misc_feature    complement(168515..169534)
                     /locus_tag="BSVBI22_A0151"
                     /note="Predicted SAM-dependent methyltransferases [General
                     function prediction only]; Region: COG1092"
                     /db_xref="CDD:224017"
     misc_feature    complement(168674..169030)
                     /locus_tag="BSVBI22_A0151"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(168800..168802,168860..168868,
                     168947..168952,168998..169018))
                     /locus_tag="BSVBI22_A0151"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(169764..170087)
                     /locus_tag="BSVBI22_A0152"
                     /db_xref="GeneID:11727623"
     CDS             complement(169764..170087)
                     /locus_tag="BSVBI22_A0152"
                     /note="identified by similarity to GP:15073316"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153857.1"
                     /db_xref="GI:376279851"
                     /db_xref="GeneID:11727623"
                     /translation="MLAKRIVTIVILVPLAVILIALSVANRASAILTIDPFNPGNPAL
                     SYSAPLFIWLFGALLFGVVIGSAVTWLTQGKYRRKARNSSREAARLLERAESAEKRNI
                     PLANS"
     misc_feature    complement(169800..>169955)
                     /locus_tag="BSVBI22_A0152"
                     /note="Protein of unknown function (DUF1049); Region:
                     DUF1049; pfam06305"
                     /db_xref="CDD:253667"
     gene            complement(170097..170381)
                     /gene="ihfB"
                     /locus_tag="BSVBI22_A0153"
                     /db_xref="GeneID:11727624"
     CDS             complement(170097..170381)
                     /gene="ihfB"
                     /locus_tag="BSVBI22_A0153"
                     /note="This protein is one of the two subunits of
                     integration host factor, a specific DNA-binding protein
                     that functions in genetic recombination as well as in
                     transcriptional and translational control"
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor subunit beta"
                     /protein_id="YP_005153858.1"
                     /db_xref="GI:376279852"
                     /db_xref="GeneID:11727624"
                     /translation="MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVE
                     LRGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV"
     misc_feature    complement(170115..170381)
                     /gene="ihfB"
                     /locus_tag="BSVBI22_A0153"
                     /note="Beta subunit of integration host factor (IHFB);
                     Region: IHF_B; cd13836"
                     /db_xref="CDD:259858"
     misc_feature    complement(order(170124..170126,170136..170138,
                     170142..170144,170148..170150,170154..170159,
                     170238..170240,170244..170261,170271..170300,
                     170304..170312,170319..170321,170331..170333,
                     170343..170345,170352..170357,170364..170366,
                     170373..170375))
                     /gene="ihfB"
                     /locus_tag="BSVBI22_A0153"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259858"
     misc_feature    complement(order(170130..170135,170139..170141,
                     170145..170147,170211..170216,170220..170222,
                     170238..170240,170244..170252,170370..170375))
                     /gene="ihfB"
                     /locus_tag="BSVBI22_A0153"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259858"
     gene            complement(170428..171423)
                     /gene="sppA"
                     /locus_tag="BSVBI22_A0154"
                     /db_xref="GeneID:11727625"
     CDS             complement(170428..171423)
                     /gene="sppA"
                     /locus_tag="BSVBI22_A0154"
                     /note="identified by match to protein family HMM PF01343;
                     match to protein family HMM TIGR00706"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide peptidase SppA"
                     /protein_id="YP_005153859.1"
                     /db_xref="GI:376279853"
                     /db_xref="GeneID:11727625"
                     /translation="MDERMAHDAEAMIERRRLRRKLTSWRLAFLVLLAALIAGFAFYS
                     LRSAKFNQPHIAKVRIEGTIFENEELLKRLDKIAGDDAVKGVILLLDSPGGTTVGGEA
                     IYDAVRKIATKKPVVTQVGTLAASAGYMIASASDHIVARQTSIVGSIGVLFQYPDLSK
                     LLDTLGVKVETIKSSPLKAEPNYFSPASEEAKNMIRSMIMDSYDWFVGIVQERRAFTH
                     EQALALANGAVFTGRQALDKKLIDGLGGEAEAVAWLQTKGLSDKLPRLEWKPVGSETG
                     FSLRDLIIHAGARLLGLPQEADGAIKEIARDRIFLDGLLSVWHVDGIAGANPANQ"
     misc_feature    complement(170473..171414)
                     /gene="sppA"
                     /locus_tag="BSVBI22_A0154"
                     /note="Periplasmic serine proteases (ClpP class)
                     [Posttranslational modification, protein turnover,
                     chaperones / Intracellular trafficking and secretion];
                     Region: SppA; COG0616"
                     /db_xref="CDD:223689"
     misc_feature    complement(170659..171264)
                     /gene="sppA"
                     /locus_tag="BSVBI22_A0154"
                     /note="Signal peptide peptidase A (SppA), a serine
                     protease, has catalytic Ser-Lys dyad; Region:
                     S49_Sppa_N_C; cd07023"
                     /db_xref="CDD:132934"
     misc_feature    complement(order(170722..170724,170731..170733,
                     170737..170745,170815..170817,170962..170973,
                     170995..170997,171001..171003,171046..171048,
                     171157..171159,171241..171243))
                     /gene="sppA"
                     /locus_tag="BSVBI22_A0154"
                     /note="tandem repeat interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132934"
     misc_feature    complement(order(170809..170811,170821..170823,
                     170908..170922,170926..170928,171121..171123,
                     171199..171201,171220..171222))
                     /gene="sppA"
                     /locus_tag="BSVBI22_A0154"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132934"
     misc_feature    complement(171046..171048)
                     /gene="sppA"
                     /locus_tag="BSVBI22_A0154"
                     /note="active site residues [active]"
                     /db_xref="CDD:132934"
     gene            171942..172595
                     /locus_tag="BSVBI22_A0155"
                     /db_xref="GeneID:11727626"
     CDS             171942..172595
                     /locus_tag="BSVBI22_A0155"
                     /note="identified by similarity to GP:15155241"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153860.1"
                     /db_xref="GI:376279854"
                     /db_xref="GeneID:11727626"
                     /translation="MRFGASEKADSLFHAAQRHSVRVRVLKTALPVAAIALAAVFSWY
                     TFLATPASPVKVEVNTGGETGKLVMKSPHLNGYTKDNRPYSMTAAKATQDVKNSGAIT
                     LEGISARLPVGEKGHATVEAASGVYDNANGRLQLDKDFTVTTDNGLRAQLHSADVNLK
                     SGQIATDKPVDIRNGTTHILADSMQVKDNGKVLIFENNVHMTVDGNTLSANKTPEGG"
     misc_feature    171942..172565
                     /locus_tag="BSVBI22_A0155"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5375"
                     /db_xref="CDD:227667"
     gene            172918..173532
                     /locus_tag="BSVBI22_A0156"
                     /db_xref="GeneID:11727627"
     CDS             172918..173532
                     /locus_tag="BSVBI22_A0156"
                     /note="identified by similarity to GP:15155240; match to
                     protein family HMM PF03968"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153861.1"
                     /db_xref="GI:376279855"
                     /db_xref="GeneID:11727627"
                     /translation="MVRTLRIGFSVLALAAFAAPGASWAQQAGDGSVPGLKLSNSKDP
                     VKIDADKLEMRDKEGVAVFTGNVAVSQGDALLKAGQMTVYYSKAKKGAEAPEPANAGV
                     GGIGSSSIDHIDIAGKVYLKSGTQVATGDTGRYDAKNQIMVLQGQKVVLTDGDNIVTG
                     CKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQQQGGAAPKRN"
     misc_feature    172996..173523
                     /locus_tag="BSVBI22_A0156"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1934"
                     /db_xref="CDD:224845"
     misc_feature    173053..173430
                     /locus_tag="BSVBI22_A0156"
                     /note="OstA-like protein; Region: OstA; pfam03968"
                     /db_xref="CDD:252284"
     gene            173544..174377
                     /locus_tag="BSVBI22_A0157"
                     /db_xref="GeneID:11727628"
     CDS             173544..174377
                     /locus_tag="BSVBI22_A0157"
                     /note="identified by similarity to GP:17983823; match to
                     protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_005153862.1"
                     /db_xref="GI:376279856"
                     /db_xref="GeneID:11727628"
                     /translation="MGLFWNKKAGEVQSPSHDVAASGVDAISGQPNMASRLKGTLVAR
                     GLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTCFYMVTGLVPADSGSIEIDGF
                     DVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRARRASELDALLEE
                     FHIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFAGVDPIAVSDIQQLVRH
                     LTSRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVANPDVRRLYLGDQFT
                     L"
     misc_feature    173655..174374
                     /locus_tag="BSVBI22_A0157"
                     /note="ABC-type (unclassified) transport system, ATPase
                     component [General function prediction only]; Region:
                     YhbG; COG1137"
                     /db_xref="CDD:224060"
     misc_feature    173664..174359
                     /locus_tag="BSVBI22_A0157"
                     /note="ATP-binding cassette component of YhbG transport
                     system; Region: ABC_YhbG; cd03218"
                     /db_xref="CDD:213185"
     misc_feature    173760..173783
                     /locus_tag="BSVBI22_A0157"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213185"
     misc_feature    order(173769..173774,173778..173786,173907..173909,
                     174135..174140,174234..174236)
                     /locus_tag="BSVBI22_A0157"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213185"
     misc_feature    173898..173909
                     /locus_tag="BSVBI22_A0157"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213185"
     misc_feature    174063..174092
                     /locus_tag="BSVBI22_A0157"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213185"
     misc_feature    174123..174140
                     /locus_tag="BSVBI22_A0157"
                     /note="Walker B; other site"
                     /db_xref="CDD:213185"
     misc_feature    174147..174158
                     /locus_tag="BSVBI22_A0157"
                     /note="D-loop; other site"
                     /db_xref="CDD:213185"
     misc_feature    174222..174242
                     /locus_tag="BSVBI22_A0157"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213185"
     gene            174673..176175
                     /gene="rpoN"
                     /locus_tag="BSVBI22_A0158"
                     /db_xref="GeneID:11727629"
     CDS             174673..176175
                     /gene="rpoN"
                     /locus_tag="BSVBI22_A0158"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; sigma 54 factor is
                     responsible for the expression of enzymes involved in
                     nitrogen assimilation and metabolism; the rhizobia often
                     have 2 copies of this sigma factor; in Rhizobium etli
                     RpoN1 shown to be involved in the assimilation of several
                     nitrogen and carbon sources during free-living aerobic
                     growth and RpoN2 is involved in symbiotic nitrogen
                     fixation; in Bradyrhizobium both RpoN1 and N2 are
                     functional in free-living and symbiotic conditions, rpoN1
                     gene was regulated in response to oxygen"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-54"
                     /protein_id="YP_005153863.1"
                     /db_xref="GI:376279857"
                     /db_xref="GeneID:11727629"
                     /translation="MALSPKLDIRQSQSLVMTPQLMQSIKLLQMTHIELDQFLDMEIE
                     KNPLLDRIEADSDDLAGGEPASGADDPTESADNDDWFQTEGAGAAENLSATFDNSLEN
                     IFPDDLGSSQEQWKLSAGEGAFSGNGYDIDQVTAGRLSLSDYVAEQIVLGFSKAADRF
                     IATALADALDESGYLRIDIVGLAHNLGIETAEIGRILGVLQGFDPPGLFARDLRECLA
                     IQLRLKDRFDPAMEALIANLDLLARRDFATLQKICGVDQADLIDMLAEIRALDPKPGA
                     RFEVSVADTIVPDVLVFSARDGGWAIELNPATMPRLIVNNEYYAEVSGSVKTEEKAFL
                     TDCMQTAGWLVRSLDQRARTILKVAQEIVRQQDGFLRHGVAHLKPLNLRMVADAVGMH
                     ESTISRVTANKFMATPRGVFELRYFFTASLASSEGGEAHSSESVRHRIRQVIEAEKPD
                     EVLSDDAIVDALKKDGVDIARRTVAKYREAMNIASSVQRRREKKARFSTP"
     misc_feature    174679..176148
                     /gene="rpoN"
                     /locus_tag="BSVBI22_A0158"
                     /note="RNA polymerase factor sigma-54; Reviewed; Region:
                     PRK05932"
                     /db_xref="CDD:235648"
     misc_feature    174685..174831
                     /gene="rpoN"
                     /locus_tag="BSVBI22_A0158"
                     /note="Sigma-54 factor, Activator interacting domain
                     (AID); Region: Sigma54_AID; pfam00309"
                     /db_xref="CDD:249760"
     misc_feature    175045..175629
                     /gene="rpoN"
                     /locus_tag="BSVBI22_A0158"
                     /note="Sigma-54 factor, core binding domain; Region:
                     Sigma54_CBD; pfam04963"
                     /db_xref="CDD:252909"
     misc_feature    175663..176145
                     /gene="rpoN"
                     /locus_tag="BSVBI22_A0158"
                     /note="Sigma-54, DNA binding domain; Region: Sigma54_DBD;
                     pfam04552"
                     /db_xref="CDD:252667"
     gene            complement(176324..176689)
                     /locus_tag="BSVBI22_A0159"
                     /db_xref="GeneID:11727630"
     CDS             complement(176324..176689)
                     /locus_tag="BSVBI22_A0159"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153864.1"
                     /db_xref="GI:376279858"
                     /db_xref="GeneID:11727630"
                     /translation="MPRTRLFLSFKQTDIVHFIPKCRMHYHVAPKDCPEILDFQPRPA
                     TRAGLLLTETIFVNCSSCQLASLGRPCFHRSRLTFSDRTAAQVQNFRAFSLYFQRSEK
                     AAIERLTDIPIWSIPNFPA"
     gene            176925..177518
                     /gene="yfiA"
                     /locus_tag="BSVBI22_A0160"
                     /db_xref="GeneID:11727631"
     CDS             176925..177518
                     /gene="yfiA"
                     /locus_tag="BSVBI22_A0160"
                     /note="identified by match to protein family HMM PF02482;
                     match to protein family HMM TIGR00741"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal subunit interface protein"
                     /protein_id="YP_005153865.1"
                     /db_xref="GI:376279859"
                     /db_xref="GeneID:11727631"
                     /translation="MTLRVSGKHMDVGEAFTSRIVDRVNDAVGKYFDHGFSGQVTVAK
                     SGSRFSADCTLHLDSGATLQSAGEAQDPQLAFDMAADKIETRLRRYKRRLKSRAPAQQ
                     NAIYDDVAYRVMAPLPEEEEDLPADYAPTIVAESSVALRTMSVASAVVELDLTEHPVL
                     VFRNAGNDEVNIVYRRADGNIGWVDPSTVTRQAAPRA"
     misc_feature    176931..177182
                     /gene="yfiA"
                     /locus_tag="BSVBI22_A0160"
                     /note="RaiA ('ribosome-associated inhibitor A', also known
                     as Protein Y (PY), YfiA, and SpotY,  is a stress-response
                     protein that binds the ribosomal subunit interface and
                     arrests translation by interfering with aminoacyl-tRNA
                     binding to the ribosomal...; Region: RaiA; cd00552"
                     /db_xref="CDD:238308"
     misc_feature    order(176934..176936,176940..176942,176946..176948,
                     177003..177005,177012..177014,177030..177035,
                     177045..177047,177057..177059,177084..177086,
                     177093..177095,177099..177107,177114..177116,
                     177120..177122,177129..177131,177135..177137,
                     177144..177146)
                     /gene="yfiA"
                     /locus_tag="BSVBI22_A0160"
                     /note="30S subunit binding site; other site"
                     /db_xref="CDD:238308"
     gene            177621..178085
                     /gene="ptsN"
                     /locus_tag="BSVBI22_A0161"
                     /db_xref="GeneID:11727632"
     CDS             177621..178085
                     /gene="ptsN"
                     /locus_tag="BSVBI22_A0161"
                     /note="identified by match to protein family HMM PF00359;
                     match to protein family HMM TIGR01419"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system nitrogen regulatory protein IIA"
                     /protein_id="YP_005153866.1"
                     /db_xref="GI:376279860"
                     /db_xref="GeneID:11727632"
                     /translation="MDLSDLIQPGAIIPALKASSKKQLLQILSEKAAVLTGLPEREVF
                     ETVLQRERLGSTGVGNGVAIPHGKLASINKIAGIFARLETPVDFEALDDQPVDLVFLL
                     LAPENAGADHLKALSRIARLLRDPDMVAKLRGTHDAQALYSFLTAHPTSNAA"
     misc_feature    177639..178055
                     /gene="ptsN"
                     /locus_tag="BSVBI22_A0161"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    order(177768..177770,177816..177818)
                     /gene="ptsN"
                     /locus_tag="BSVBI22_A0161"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    177816..177818
                     /gene="ptsN"
                     /locus_tag="BSVBI22_A0161"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            complement(178166..178411)
                     /locus_tag="BSVBI22_A0162"
                     /db_xref="GeneID:11727633"
     CDS             complement(178166..178411)
                     /locus_tag="BSVBI22_A0162"
                     /note="identified by similarity to GP:15073342"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153867.1"
                     /db_xref="GI:376279861"
                     /db_xref="GeneID:11727633"
                     /translation="MNKHVFTDNEFAHLGEGEIAYVRKIRSDDLARSFPSLPPIAPGL
                     ELWALFGASGEPIVLSDVRATALQGAHDHELRTVTLH"
     misc_feature    complement(178169..178411)
                     /locus_tag="BSVBI22_A0162"
                     /note="Uncharacterized small protein [Function unknown];
                     Region: COG5568"
                     /db_xref="CDD:227855"
     gene            complement(178517..178999)
                     /locus_tag="BSVBI22_A0163"
                     /db_xref="GeneID:11727634"
     CDS             complement(178517..178999)
                     /locus_tag="BSVBI22_A0163"
                     /note="identified by similarity to OMNI:CC3592; match to
                     protein family HMM PF00011"
                     /codon_start=1
                     /transl_table=11
                     /product="HSP20 family protein"
                     /protein_id="YP_005153868.1"
                     /db_xref="GI:376279862"
                     /db_xref="GeneID:11727634"
                     /translation="MRRYAERVLLKTVAWIRTDEMTRMTPFSSPLLLGFDTMEKTLER
                     IAKSGDGYPPYNIERLRGDTGSERLRITLAVAGFASEDLEVMTEDNQLVIRGRQTDDT
                     EREYLHRGIAARQFQRVFVLADGMRVLACELRNGLLAIDLDRPEPERLIKRIDIAVKD
                     "
     misc_feature    complement(178532..178945)
                     /locus_tag="BSVBI22_A0163"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    complement(178568..178843)
                     /locus_tag="BSVBI22_A0163"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    complement(order(178589..178594,178646..178648,
                     178769..178774,178778..178780,178784..178786,
                     178823..178837))
                     /locus_tag="BSVBI22_A0163"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            complement(179030..179242)
                     /locus_tag="BSVBI22_A0164"
                     /db_xref="GeneID:11727635"
     CDS             complement(179030..179242)
                     /locus_tag="BSVBI22_A0164"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153869.1"
                     /db_xref="GI:376279863"
                     /db_xref="GeneID:11727635"
                     /translation="MALPLPKPGVEAAPFPQNLPGYSIGPKIDIGFQKARCFEKLKHV
                     SQKAGNAREVSNHGFTIAMREFGLHP"
     gene            complement(179211..179708)
                     /locus_tag="BSVBI22_A0165"
                     /db_xref="GeneID:11727636"
     CDS             complement(179211..179708)
                     /locus_tag="BSVBI22_A0165"
                     /note="identified by similarity to GP:15158767"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153870.1"
                     /db_xref="GI:376279864"
                     /db_xref="GeneID:11727636"
                     /translation="MHHPDGAEPERFETPIFEALLTPYRSLGRTGFYNLMSALTGCWM
                     FVGILFWSIGAWPIFGFFGLDVLLIYLAFRWNYRAARAREEISVSRAALQVRKYAASG
                     KMTTHHFNPFWARFKVARKPDIGITAMRIESRENSIVIGSFLNPDERESFATAFGAAL
                     AEARR"
     misc_feature    complement(179214..179705)
                     /locus_tag="BSVBI22_A0165"
                     /note="Integral membrane protein [Function unknown];
                     Region: COG5488"
                     /db_xref="CDD:227775"
     gene            179813..180559
                     /gene="nth"
                     /locus_tag="BSVBI22_A0166"
                     /db_xref="GeneID:11727637"
     CDS             179813..180559
                     /gene="nth"
                     /locus_tag="BSVBI22_A0166"
                     /note="identified by similarity to EGAD:18451; match to
                     protein family HMM PF00633; match to protein family HMM
                     PF00730; match to protein family HMM TIGR01083"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="YP_005153871.1"
                     /db_xref="GI:376279865"
                     /db_xref="GeneID:11727637"
                     /translation="MQETKIKSAVNGSTSPVRRPRRVAGTLYTADEIHEIFRRFSIQR
                     PEPKGELEHVNAFTLLVAVVLSAQATDAGVNKATRALFAVADTPQKMLALGEEKVGEY
                     IRTIGLWRNKAKNIILLSEALIRDYGGEVPGDRDELVKLPGVGRKTANVVLNMAFGQP
                     TMAVDTHILRIGNRIGLAPGKTPEAVEAILVRVIPREYMLHAHHWLILHGRYVCKARK
                     PECEKCVIADLCKYPAKTCDIPAALVPLAP"
     misc_feature    179906..180526
                     /gene="nth"
                     /locus_tag="BSVBI22_A0166"
                     /note="Predicted EndoIII-related endonuclease [DNA
                     replication, recombination, and repair]; Region: Nth;
                     COG0177"
                     /db_xref="CDD:223255"
     misc_feature    179981..180442
                     /gene="nth"
                     /locus_tag="BSVBI22_A0166"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    order(180014..180022,180029..180031,180146..180148)
                     /gene="nth"
                     /locus_tag="BSVBI22_A0166"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    180233..180256
                     /gene="nth"
                     /locus_tag="BSVBI22_A0166"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    order(180263..180265,180419..180421,180431..180433)
                     /gene="nth"
                     /locus_tag="BSVBI22_A0166"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    180305..180307
                     /gene="nth"
                     /locus_tag="BSVBI22_A0166"
                     /note="active site"
                     /db_xref="CDD:238013"
     misc_feature    180449..180508
                     /gene="nth"
                     /locus_tag="BSVBI22_A0166"
                     /note="iron-sulpphur binding domain in DNA-(apurinic or
                     apyrimidinic site) lyase (subfamily of ENDO3); Region:
                     FES; smart00525"
                     /db_xref="CDD:197771"
     gene            complement(180600..181313)
                     /locus_tag="BSVBI22_A0167"
                     /db_xref="GeneID:11727638"
     CDS             complement(180600..181313)
                     /locus_tag="BSVBI22_A0167"
                     /note="putative role in sulfur assimilation"
                     /codon_start=1
                     /transl_table=11
                     /product="CysZ-like protein"
                     /protein_id="YP_005153872.1"
                     /db_xref="GI:376279866"
                     /db_xref="GeneID:11727638"
                     /translation="MIIDAAWKALNRLLTPQFRTVFWKTLGVTLLLLVGLWVAIRQVF
                     FSFAWPWMEQLLPGMPQWAGWLGIVAAIVAGLGLALVLALMIALVTALIAGFFLDDVA
                     EIVEREDYPADPPGTPLPLGRSVIASLKFLGVVILGNGVALILLFVPGINLIAFFVIN
                     AYLLSREFFEFAAMRYRSEAEAKALRSQYGVTVFLAGLVIAGFMAIPIVNLLTPLFAA
                     TMMVHLHKAISKRAIKTYS"
     misc_feature    complement(180621..181310)
                     /locus_tag="BSVBI22_A0167"
                     /note="CysZ-like protein; Reviewed; Region: PRK12768"
                     /db_xref="CDD:237196"
     gene            complement(181310..181570)
                     /locus_tag="BSVBI22_A0168"
                     /db_xref="GeneID:11727639"
     CDS             complement(181310..181570)
                     /locus_tag="BSVBI22_A0168"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153873.1"
                     /db_xref="GI:376279867"
                     /db_xref="GeneID:11727639"
                     /translation="MPLKLPFVSGFTADAAETPAGAAAMREPVYPFTVLLASLITSRL
                     VGSAACARLRPYLFPLQISQFRHLRRNERRSEPYAIPQKGGK"
     gene            181573..182565
                     /locus_tag="BSVBI22_A0169"
                     /db_xref="GeneID:11727640"
     CDS             181573..182565
                     /locus_tag="BSVBI22_A0169"
                     /note="identified by match to protein family HMM PF00294"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="YP_005153874.1"
                     /db_xref="GI:376279868"
                     /db_xref="GeneID:11727640"
                     /translation="MATFDVLCIGNAIVDILARTDDVFLETNGIIKGAMNLIDAERAE
                     LLYSRMGPATEMSGGSAGNTAAGIASLGGRSAYFGKVATDHLGRVFAHDIRAQGVAFD
                     TRPLEKGSPTARSMIFVTPDGERSMNTYLGACVELGPEDVETSKVADARVTYFEGYLW
                     DPPRAKEAIVMASKIAHESGRQMAMTLSDPFCVDRYRDEFLQLMRSRTVDIVFANEDE
                     AKALYKTKSLETAIAAMRMDCRLSVITRSEKGAVVVTPDQTLTVPAIEIDDLVDTTGA
                     GDLYAAGFLYGYTKDRSLEDCARLGSLAAGLIIQQMGPRPQISLEAAASQAGLI"
     misc_feature    181573..182511
                     /locus_tag="BSVBI22_A0169"
                     /note="adenosine kinase; Provisional; Region: PTZ00247"
                     /db_xref="CDD:240328"
     misc_feature    181579..182523
                     /locus_tag="BSVBI22_A0169"
                     /note="Adenosine kinase (AK) catalyzes the phosphorylation
                     of ribofuranosyl-containing nucleoside analogues at the
                     5'-hydroxyl using ATP or GTP as the phosphate donor.The
                     physiological function of AK is associated with the
                     regulation of extracellular...; Region: adenosine_kinase;
                     cd01168"
                     /db_xref="CDD:238573"
     misc_feature    order(181603..181605,181609..181611,181615..181617,
                     181675..181677,181744..181752,181759..181761,
                     181915..181917,181951..181953,181957..181959,
                     181963..181965,182044..182046,182143..182145,
                     182392..182397,182404..182406)
                     /locus_tag="BSVBI22_A0169"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238573"
     misc_feature    order(182305..182307,182311..182316,182323..182325,
                     182356..182358,182362..182364,182380..182382,
                     182389..182391,182398..182403,182410..182412,
                     182485..182487,182497..182499)
                     /locus_tag="BSVBI22_A0169"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238573"
     gene            complement(182584..183240)
                     /locus_tag="BSVBI22_A0170"
                     /db_xref="GeneID:11727641"
     CDS             complement(182584..183240)
                     /locus_tag="BSVBI22_A0170"
                     /note="identified by similarity to GP:15155036; match to
                     protein family HMM PF03458"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153875.1"
                     /db_xref="GI:376279869"
                     /db_xref="GeneID:11727641"
                     /translation="MTIIQFLNYAGVFVFAATGALAASRRQLDIIGFIFLANITAIGG
                     GTMRDLVLASPVFWVVQPLYLFVGTLAAIAVYFTAHKVESRYRTLLWLDAIGMAAYTV
                     MGAAKGLALGFGPSVAIVTGIFTATFGGILRDMVVGEPSVLMRREIYVTAAVAGACLY
                     VVLEYLGINPVISAGAAAFAAFFVRGGALYFGWTLPVYKSKPGRTEEELQRDQIIRPE
                     "
     misc_feature    complement(182626..183240)
                     /locus_tag="BSVBI22_A0170"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2860"
                     /db_xref="CDD:225415"
     misc_feature    complement(182992..183231)
                     /locus_tag="BSVBI22_A0170"
                     /note="UPF0126 domain; Region: UPF0126; pfam03458"
                     /db_xref="CDD:251969"
     misc_feature    complement(182737..182976)
                     /locus_tag="BSVBI22_A0170"
                     /note="UPF0126 domain; Region: UPF0126; pfam03458"
                     /db_xref="CDD:251969"
     gene            complement(183373..184065)
                     /gene="grpE"
                     /locus_tag="BSVBI22_A0171"
                     /db_xref="GeneID:11727642"
     CDS             complement(183373..184065)
                     /gene="grpE"
                     /locus_tag="BSVBI22_A0171"
                     /note="identified by match to protein family HMM PF01025"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein GrpE"
                     /protein_id="YP_005153876.1"
                     /db_xref="GI:376279870"
                     /db_xref="GeneID:11727642"
                     /translation="MADEKNKPENPDLDQRDINNPRDREALKQAADDFLKARRAEARA
                     EAAADEAEGEVDETANRIAVLEADNTELKDQMLRVAAEMENLRKRTQRDVQDARAYAI
                     TNFARDMLSVSDNLRRALDAIPADALEADSNLKSLSEGVEMTERAMLLALERHGVKKL
                     EPEGQKFDPNFHQAMFEVPNPDLPNNTVVQVVQAGYAIGDRVLRPAMVGVSKGGPKVS
                     AENGASTSEDNA"
     misc_feature    complement(183436..183861)
                     /gene="grpE"
                     /locus_tag="BSVBI22_A0171"
                     /note="GrpE is the adenine nucleotide exchange factor of
                     DnaK (Hsp70)-type ATPases. The GrpE dimer binds to the
                     ATPase domain of Hsp70 catalyzing the dissociation of ADP,
                     which enables rebinding of ATP, one step in the Hsp70
                     reaction cycle in protein folding; Region: GrpE; cd00446"
                     /db_xref="CDD:238252"
     misc_feature    complement(order(183601..183603,183634..183636,
                     183643..183645,183709..183711,183721..183723,
                     183742..183744,183751..183753,183763..183765,
                     183805..183810,183817..183819,183829..183831,
                     183838..183843,183850..183855))
                     /gene="grpE"
                     /locus_tag="BSVBI22_A0171"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238252"
     misc_feature    complement(order(183451..183453,183463..183465,
                     183490..183492,183538..183552,183559..183561,
                     183802..183804))
                     /gene="grpE"
                     /locus_tag="BSVBI22_A0171"
                     /note="hsp70 (ATPase domain) interactions [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238252"
     gene            complement(184171..185295)
                     /gene="hrcA"
                     /locus_tag="BSVBI22_A0172"
                     /db_xref="GeneID:11727643"
     CDS             complement(184171..185295)
                     /gene="hrcA"
                     /locus_tag="BSVBI22_A0172"
                     /note="Negative regulator of class I heat shock genes
                     (grpE-dnaK-dnaJ and groELS operons). Prevents heat-shock
                     induction of these operons"
                     /codon_start=1
                     /transl_table=11
                     /product="heat-inducible transcription repressor"
                     /protein_id="YP_005153877.1"
                     /db_xref="GI:376279871"
                     /db_xref="GeneID:11727643"
                     /translation="MPQPYIYYIQFRGFAEQAMMRPPEHQLLSSLDQRSRDIFRLIVE
                     TYLNDGDPVGSRNLSRLLPHTLSPATIRNVMSDLEHLGLIYAPHISAGRLPTQIGLRF
                     FVDAFLEVGDLPPEERSSIEAQVRAAGTSNSVESVLTEASQVLSGLSRGAGLVLTNKT
                     DVALKHIEFVRLEPMRALAVLVMQNGDVENRVIDLPAGISTSQLIEASNFLNAHIHGH
                     TLSEAKSELRKLSEETRRELDQLSQELVAKGLAVWSGAGADQPARLIVRGRANLLENV
                     HAQEDIERLRHLFDDLETKDGMVQLLDLAEAGSGVRIFIGSENKLFSLSGSSLVVAPY
                     RDSEQRVIGALGVIGPTRLNYARIVPMVDYTAQIVSRLLR"
     misc_feature    complement(184174..185214)
                     /gene="hrcA"
                     /locus_tag="BSVBI22_A0172"
                     /note="heat-inducible transcription repressor;
                     Provisional; Region: hrcA; PRK00082"
                     /db_xref="CDD:234621"
     misc_feature    complement(185008..185208)
                     /gene="hrcA"
                     /locus_tag="BSVBI22_A0172"
                     /note="Winged helix-turn-helix transcription repressor,
                     HrcA DNA-binding; Region: HrcA_DNA-bdg; pfam03444"
                     /db_xref="CDD:146200"
     misc_feature    complement(184219..184896)
                     /gene="hrcA"
                     /locus_tag="BSVBI22_A0172"
                     /note="HrcA protein C terminal domain; Region: HrcA;
                     pfam01628"
                     /db_xref="CDD:250757"
     gene            185463..186179
                     /gene="rph"
                     /locus_tag="BSVBI22_A0173"
                     /db_xref="GeneID:11727644"
     CDS             185463..186179
                     /gene="rph"
                     /locus_tag="BSVBI22_A0173"
                     /note="RNase PH; tRNA nucleotidyltransferase; forms
                     hexamers in Bacillus subtilis; phosphoroltic 3'-5'
                     exoribonuclease; involved in maturation of tRNA precursors
                     and removes terminal nucleotides near CCA acceptor arms of
                     mature tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="YP_005153878.1"
                     /db_xref="GI:376279872"
                     /db_xref="GeneID:11727644"
                     /translation="MRPSKRAADEMRAISFERGVSKHAEGSCLVKFGDTHVLCTASLE
                     EKVPGWMRNTGKGWVTAEYGMLPRSTGERMRREAAAGKQGGRTQEIQRFIGRSLRAVV
                     DMQALGEMQITVDCDVIQADGGTRTAAITGGWVALHECLRWMEARQMVRVEKVLKDHV
                     AAISCGIYEGVPVLDLDYAEDSVAETDSNFVMTGKGGIVEIQGTAEGVPFSEEEFGAL
                     MKLARSGIDRLVSLQKMAVA"
     misc_feature    185463..186176
                     /gene="rph"
                     /locus_tag="BSVBI22_A0173"
                     /note="ribonuclease PH; Reviewed; Region: rph; PRK00173"
                     /db_xref="CDD:178914"
     misc_feature    185490..186173
                     /gene="rph"
                     /locus_tag="BSVBI22_A0173"
                     /note="Ribonuclease PH; Region: RNase_PH_bact; cd11362"
                     /db_xref="CDD:206767"
     misc_feature    order(185520..185534,185562..185564,185568..185570,
                     185574..185576,185580..185582,185586..185588,
                     185646..185648,185652..185654,185658..185675,
                     185679..185681,185688..185693,185715..185720,
                     185724..185729,185736..185738,185748..185750,
                     185757..185759,185799..185801,185805..185807,
                     185811..185813,185817..185825,186051..186065,
                     186069..186071,186075..186092,186096..186098,
                     186105..186110,186117..186122,186129..186131)
                     /gene="rph"
                     /locus_tag="BSVBI22_A0173"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206767"
     misc_feature    order(185655..185657,185718..185720,185823..185840,
                     186003..186005,186021..186023)
                     /gene="rph"
                     /locus_tag="BSVBI22_A0173"
                     /note="active site"
                     /db_xref="CDD:206767"
     gene            186353..186757
                     /locus_tag="BSVBI22_A0174"
                     /db_xref="GeneID:11727645"
     CDS             186353..186757
                     /locus_tag="BSVBI22_A0174"
                     /note="identified by match to protein family HMM PF00903"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase family protein"
                     /protein_id="YP_005153879.1"
                     /db_xref="GI:376279873"
                     /db_xref="GeneID:11727645"
                     /translation="MRAAHILETALYVRDVAEAIGFYRDVMGLEPVGKVSERNAFFRC
                     GDGILLLFRAQETLKPPLPGYLPVPPHGTSGPGHVCFAASRAEIEGWRKHLEKHGIAI
                     EADFDWPNGAHSIYFRDPSGNSLEIAEPKLWN"
     misc_feature    186368..186742
                     /locus_tag="BSVBI22_A0174"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_13; cd08354"
                     /db_xref="CDD:176702"
     misc_feature    order(186374..186376,186584..186586,186728..186730)
                     /locus_tag="BSVBI22_A0174"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176702"
     gene            186760..187422
                     /locus_tag="BSVBI22_A0175"
                     /db_xref="GeneID:11727646"
     CDS             186760..187422
                     /locus_tag="BSVBI22_A0175"
                     /note="HAM1-like protein; Rec-dependent growth; RgdB;
                     yggV; it is suspected that this protein functions to
                     remove misincorporated bases such as xanthine or
                     hypoxanthine"
                     /codon_start=1
                     /transl_table=11
                     /product="putative deoxyribonucleotide triphosphate
                     pyrophosphatase"
                     /protein_id="YP_005153880.1"
                     /db_xref="GI:376279874"
                     /db_xref="GeneID:11727646"
                     /translation="MRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEP
                     DETGTTFEENAYIKALAAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRD
                     FDMAMQKVENLLQEKGATTPDKRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGN
                     IGFGYDPVFLPDGYGKTFGEMTAEEKHGWKPGDASALSHRARAFKLFAEKALNVVSAP
                     AE"
     misc_feature    186784..187386
                     /locus_tag="BSVBI22_A0175"
                     /note="NTPase/HAM1.  This family consists of the HAM1
                     protein and pyrophosphate-releasing xanthosine/ inosine
                     triphosphatase. HAM1 protects the cell against mutagenesis
                     by the base analog 6-N-hydroxylaminopurine (HAP) in E.
                     Coli and S. cerevisiae. A...; Region: HAM1; cd00515"
                     /db_xref="CDD:238285"
     misc_feature    order(186802..186804,186808..186813,186820..186822,
                     186982..186990,187027..187032,187144..187146,
                     187246..187248,187252..187257,187354..187359)
                     /locus_tag="BSVBI22_A0175"
                     /note="active site"
                     /db_xref="CDD:238285"
     misc_feature    order(186895..186903,187003..187008,187015..187017,
                     187024..187026,187033..187035)
                     /locus_tag="BSVBI22_A0175"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238285"
     gene            187476..188633
                     /locus_tag="BSVBI22_A0176"
                     /db_xref="GeneID:11727647"
     CDS             187476..188633
                     /locus_tag="BSVBI22_A0176"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_005153881.1"
                     /db_xref="GI:376279875"
                     /db_xref="GeneID:11727647"
                     /translation="MHADGETAFGIYVHWPFCLAKCPYCDFNSHVRHKPVDQARYGAA
                     FRREMETLRERTGPRTVTSIFLGGGTPSLMQPETVGALLDGIASYWSVAPDIEVTLEA
                     NPTSVEADRFRGYRAAGVNRVSLGIQALNDPDLRRLGRMHSVAEAKAAIRLAREIFPR
                     LSFDLIYARPDQTIEAWREELKEAIGLAADHLSLYQLTIEEGTQFYNLWKAGKLTTPE
                     PDLAAALYEETQRVTAEHGLPAYEISNHAVPGRESQHNLVYWRYGQYAGIGPGAHGRF
                     VENDVRTVTMTEKHPETWLDHVERRGHGIIEEEYLDGGQEGDEFLMMGLRLREGIDLA
                     RYARLSGHAIDDKRLAKLIAEGMIEPMGGSLIRATPDGALVLDALVADLAA"
     misc_feature    187488..188630
                     /locus_tag="BSVBI22_A0176"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK09057"
                     /db_xref="CDD:181629"
     misc_feature    187527..188105
                     /locus_tag="BSVBI22_A0176"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(187527..187529,187533..187535,187539..187541,
                     187545..187553,187674..187676,187680..187685,
                     187776..187784,187851..187853,187971..187973,
                     188061..188066)
                     /locus_tag="BSVBI22_A0176"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    188430..188597
                     /locus_tag="BSVBI22_A0176"
                     /note="HemN C-terminal domain; Region: HemN_C; pfam06969"
                     /db_xref="CDD:253997"
     gene            188699..189556
                     /locus_tag="BSVBI22_A0177"
                     /db_xref="GeneID:11727648"
     CDS             188699..189556
                     /locus_tag="BSVBI22_A0177"
                     /note="identified by similarity to OMNI:CC0144; match to
                     protein family HMM PF00590; match to protein family HMM
                     TIGR00096"
                     /codon_start=1
                     /transl_table=11
                     /product="tetrapyrrole methylase family protein"
                     /protein_id="YP_005153882.1"
                     /db_xref="GI:376279876"
                     /db_xref="GeneID:11727648"
                     /translation="MRARPLEPALYIVSTPIGNLGDMTLRGLETLASADILACEDTRV
                     TRVLLDRYGISRRPISYHEHNAAEAGPKLIAALAAGKSVALVSDAGTPLVSDPGFRLV
                     GDAREAGIRVVPVPGASAVLAALAASGLPTDAFMFCGFLPAKHGQKQSRLESLKGIDA
                     TLVFYESPNRAAATLSDMVEVFGTGRQGALCRELTKAYETIVTAPLGELAKTFDGEDR
                     IRGEVVLLVGPPTGEAVAQSEEDIDRLLLSLVAEMPPSKAAGEAARMTGGQKSVLYQR
                     LLQLKSDGR"
     misc_feature    188726..189385
                     /locus_tag="BSVBI22_A0177"
                     /note="Ribosomal RNA small subunit methyltransferase I,
                     also known as rRNA (cytidine-2'-O-)-methyltransferase
                     RsmI; Region: RsmI; cd11648"
                     /db_xref="CDD:212507"
     misc_feature    order(188747..188749,188963..188971,188978..188983,
                     189053..189058,189191..189193,189269..189271,
                     189275..189280,189362..189370)
                     /locus_tag="BSVBI22_A0177"
                     /note="putative SAM binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212507"
     misc_feature    order(188765..188776,188780..188782,188969..188986,
                     188993..188998,189002..189007,189038..189040,
                     189044..189055,189059..189064,189071..189076,
                     189101..189115)
                     /locus_tag="BSVBI22_A0177"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212507"
     gene            189553..189933
                     /locus_tag="BSVBI22_A0178"
                     /db_xref="GeneID:11727649"
     CDS             189553..189933
                     /locus_tag="BSVBI22_A0178"
                     /note="identified by similarity to GP:15073266; match to
                     protein family HMM PF02021"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153883.1"
                     /db_xref="GI:376279877"
                     /db_xref="GeneID:11727649"
                     /translation="MTDLREKKRIAFFRGHSAERLAAFALMLKGFRIVARRYRTRLGE
                     IDLIARRGDLVLIVEVKARASFEAAQFAVTPQAMRRIEAAADLWLQRQTDRARLSLRF
                     DMVAVLPRRWPKHVPAFFTAGHYG"
     misc_feature    189583..189918
                     /locus_tag="BSVBI22_A0178"
                     /note="Predicted endonuclease distantly related to
                     archaeal Holliday junction resolvase [DNA replication,
                     recombination, and repair]; Region: COG0792"
                     /db_xref="CDD:223863"
     gene            190153..191586
                     /gene="cysG"
                     /locus_tag="BSVBI22_A0179"
                     /db_xref="GeneID:11727650"
     CDS             190153..191586
                     /gene="cysG"
                     /locus_tag="BSVBI22_A0179"
                     /note="identified by similarity to SP:P11098; match to
                     protein family HMM PF00590; match to protein family HMM
                     TIGR01469; match to protein family HMM TIGR01470"
                     /codon_start=1
                     /transl_table=11
                     /product="siroheme synthase"
                     /protein_id="YP_005153884.1"
                     /db_xref="GI:376279878"
                     /db_xref="GeneID:11727650"
                     /translation="MPVSLSQTRLLADFPAFFRVSGEVVAVVGGGEEALNKARLVAQT
                     AARLRIIAEKAEPHLAAFIESHGVEHIASPFAPELLDGAKLVFVATGDEAGDRAAAAA
                     ARARKIPVNVVDRPALCDFLTPAIVNRAPVTIAIGSQGTAPVLAQMVRARIDAAFSPR
                     LGELAHFAESWRPLVERALPKGLARRGFWRTFFSGKVARAVESGDHEAAHRAAAELIG
                     QGQDASGHVWLVGAGPGAEDLLTLRAQRVLMEADVIVHDALVPEGVIAMGRRDAERLP
                     VGKRKGCHSKSQDEINRLLVKLGQEGKRVVRLKSGDPLVFGRAGEEMAALRAAGIGFE
                     VVPGITSAFAAAADMELPLTLRGVASSLVFTTGHDMTGDVLPGWAKLAVSGATIAVYM
                     GSTVAASVASRLIAAGLHEDTAVAVVENASRSNKRMFHGTLKDLPQLENRKELSGPVM
                     VVIGDAVAGAAIGRAQALSLKPVPVAA"
     misc_feature    190261..191526
                     /gene="cysG"
                     /locus_tag="BSVBI22_A0179"
                     /note="siroheme synthase; Provisional; Region: cysG;
                     PRK10637"
                     /db_xref="CDD:182606"
     misc_feature    <190261..190527
                     /gene="cysG"
                     /locus_tag="BSVBI22_A0179"
                     /note="Putative NAD(P)-binding; Region: NAD_binding_7;
                     pfam13241"
                     /db_xref="CDD:257598"
     misc_feature    190627..>190767
                     /gene="cysG"
                     /locus_tag="BSVBI22_A0179"
                     /note="Sirohaem synthase dimerization region; Region:
                     CysG_dimeriser; pfam10414"
                     /db_xref="CDD:204480"
     misc_feature    190828..191526
                     /gene="cysG"
                     /locus_tag="BSVBI22_A0179"
                     /note="Uroporphyrin-III C-methyltransferase
                     (S-Adenosyl-L-methionine:uroporphyrinogen III
                     methyltransferase, SUMT); Region: SUMT; cd11642"
                     /db_xref="CDD:212501"
     misc_feature    order(190852..190854,190921..190929,191080..191088,
                     191095..191106,191170..191175,191185..191187,
                     191248..191250,191254..191256,191320..191334,
                     191404..191406,191410..191415,191419..191421,
                     191491..191502)
                     /gene="cysG"
                     /locus_tag="BSVBI22_A0179"
                     /note="active site"
                     /db_xref="CDD:212501"
     misc_feature    order(190852..190854,191080..191088,191095..191100,
                     191170..191175,191323..191325,191404..191406,
                     191410..191415,191494..191502)
                     /gene="cysG"
                     /locus_tag="BSVBI22_A0179"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212501"
     misc_feature    order(190864..190881,190885..190887,191086..191088,
                     191092..191100,191110..191115,191119..191121,
                     191131..191136,191155..191157,191161..191163,
                     191167..191169,191179..191184,191206..191208,
                     191212..191220,191230..191244)
                     /gene="cysG"
                     /locus_tag="BSVBI22_A0179"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212501"
     gene            191604..191906
                     /locus_tag="BSVBI22_A0180"
                     /db_xref="GeneID:11727651"
     CDS             191604..191906
                     /locus_tag="BSVBI22_A0180"
                     /note="identified by similarity to GP:15156533"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153885.1"
                     /db_xref="GI:376279879"
                     /db_xref="GeneID:11727651"
                     /translation="MIVKVLTANRLIDGQAVWLGADGSWQETIDGALVARHAEAVNAL
                     EEAGRLAARANLVVDVNVIDVEERGADLYPIRLRERIRLSGPTIVTMGHAFPAPAS"
     misc_feature    191613..191882
                     /locus_tag="BSVBI22_A0180"
                     /note="Protein of unknown function (DUF2849); Region:
                     DUF2849; pfam11011"
                     /db_xref="CDD:256247"
     gene            191927..193597
                     /gene="cysI"
                     /locus_tag="BSVBI22_A0181"
                     /db_xref="GeneID:11727652"
     CDS             191927..193597
                     /gene="cysI"
                     /locus_tag="BSVBI22_A0181"
                     /note="identified by similarity to OMNI:CC1119; match to
                     protein family HMM PF01077; match to protein family HMM
                     PF03460"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase (NADPH) hemoprotein
                     beta-component"
                     /protein_id="YP_005153886.1"
                     /db_xref="GI:376279880"
                     /db_xref="GeneID:11727652"
                     /translation="MYRYDEFDRDFVAARVAQFKDQVARRLSGELTEDQFKPLRLMNG
                     LYLQLHAYMLRVAIPYGTLSSRQLRKLGSIARTYDRGFGHFTTRQNIQYNWPALKDVP
                     QILAELAEVEMHSIQTSGNCIRNVTADHFAGAAADEVTDPRPLAEILRQWSSLHPEFS
                     YLPRKFKIAIVGSEHDRAAIQVHDIGLQLKKNEAGELGLAVYVGGGQGRTPMVAKKIR
                     DFLPIEDMLTYVTAIVRVYNLHGRRDNKFKARIKILVHETGIEQLTREIDAEWEEIRH
                     GELKLPQRDIDVIESYFRMPDLPQRPEGWEILAVAQKADAEFASWVARNVTAHKHPDY
                     AVVTISLKPVGGIPGDASAEQMELVADVAQTCSFDEIRVSHEQNLVLPHVAKADLPAV
                     YDRLQSGGLVTPNAGLITDIIACPGLDYCALANARSIPVAQRISERFADLDRQLEIGD
                     LKIKISGCINACGHHHVGHIGILGVEKKGEELYQITLGGSADENSAIGEITGRGFSSE
                     EVVDAIETIVDTYLGLRESAEETFLAAYRRVGMEPFKRALYGEIRSAA"
     misc_feature    191927..193561
                     /gene="cysI"
                     /locus_tag="BSVBI22_A0181"
                     /note="Sulfite reductase, beta subunit (hemoprotein)
                     [Inorganic ion transport and metabolism]; Region: CysI;
                     COG0155"
                     /db_xref="CDD:223233"
     misc_feature    192080..192247
                     /gene="cysI"
                     /locus_tag="BSVBI22_A0181"
                     /note="Nitrite/Sulfite reductase ferredoxin-like half
                     domain; Region: NIR_SIR_ferr; pfam03460"
                     /db_xref="CDD:251971"
     misc_feature    192281..192745
                     /gene="cysI"
                     /locus_tag="BSVBI22_A0181"
                     /note="Nitrite and sulphite reductase 4Fe-4S domain;
                     Region: NIR_SIR; pfam01077"
                     /db_xref="CDD:250346"
     misc_feature    <192971..193111
                     /gene="cysI"
                     /locus_tag="BSVBI22_A0181"
                     /note="Nitrite/Sulfite reductase ferredoxin-like half
                     domain; Region: NIR_SIR_ferr; pfam03460"
                     /db_xref="CDD:251971"
     misc_feature    193151..193570
                     /gene="cysI"
                     /locus_tag="BSVBI22_A0181"
                     /note="Nitrite and sulphite reductase 4Fe-4S domain;
                     Region: NIR_SIR; pfam01077"
                     /db_xref="CDD:250346"
     gene            193587..194345
                     /gene="cysH"
                     /locus_tag="BSVBI22_A0182"
                     /db_xref="GeneID:11727653"
     CDS             193587..194345
                     /gene="cysH"
                     /locus_tag="BSVBI22_A0182"
                     /note="catalyzes the reduction of 3'-phosphoadenylyl
                     sulfate into sulfite"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="YP_005153887.1"
                     /db_xref="GI:376279881"
                     /db_xref="GeneID:11727653"
                     /translation="MLPDADIADADERAAAQARLLEASHGASAPHEIIALVTHELFEG
                     RVAVVSSFGAESAVLLHMISQIDRATPVLFLDTGKHFRATLDYRHQLVGRLGLADVRD
                     ILPVADSLAKEDPFGALSMTDKDRCCFIRKVEPMARAVAPYRAWMTGRKQFQASTRNG
                     LPVFESVGPRIRINPLARWRAEDLRAYAEKYSLPPHPLTAQGYRSIGCMPCTRPVSEG
                     EDQRAGRWAGSEKTECGIHLSGLADSLKGIPKAV"
     misc_feature    193611..194339
                     /gene="cysH"
                     /locus_tag="BSVBI22_A0182"
                     /note="3'-phosphoadenosine 5'-phosphosulfate
                     sulfotransferase (PAPS reductase)/FAD synthetase and
                     related enzymes [Amino acid transport and metabolism /
                     Coenzyme metabolism]; Region: CysH; COG0175"
                     /db_xref="CDD:223253"
     misc_feature    193719..194207
                     /gene="cysH"
                     /locus_tag="BSVBI22_A0182"
                     /note="This domain is found in phosphoadenosine
                     phosphosulphate (PAPS) reductase enzymes or PAPS
                     sulphotransferase. PAPS reductase is part of the adenine
                     nucleotide alpha hydrolases superfamily also including N
                     type ATP PPases and ATP sulphurylases. A highly...;
                     Region: PAPS_reductase; cd01713"
                     /db_xref="CDD:238846"
     misc_feature    order(193980..193982,194058..194060,194088..194090,
                     194100..194102)
                     /gene="cysH"
                     /locus_tag="BSVBI22_A0182"
                     /note="Active Sites [active]"
                     /db_xref="CDD:238846"
     gene            194398..194922
                     /locus_tag="BSVBI22_A0183"
                     /db_xref="GeneID:11727654"
     CDS             194398..194922
                     /locus_tag="BSVBI22_A0183"
                     /note="identified by similarity to GP:15156535"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153888.1"
                     /db_xref="GI:376279882"
                     /db_xref="GeneID:11727654"
                     /translation="MSSTNETKLWSRDGFREDDYIFADDLEAAGDAPAIVLPLAVWLE
                     LGEEHRRSSNRRIGVSVSPGEKIDPLLGHLDSIALIALQFPVFNDGRSYSKAEILRRE
                     GFAGELRAVGDVLIDQAVLMLRAGFDTLQVANEVALRRLGENRLVDTPGYYQPGRGSL
                     PQEGAFAWRRVKAG"
     misc_feature    194407..194916
                     /locus_tag="BSVBI22_A0183"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3749"
                     /db_xref="CDD:226272"
     gene            194990..195283
                     /locus_tag="BSVBI22_A0184"
                     /db_xref="GeneID:11727655"
     CDS             194990..195283
                     /locus_tag="BSVBI22_A0184"
                     /note="identified by similarity to GP:14021352"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153889.1"
                     /db_xref="GI:376279883"
                     /db_xref="GeneID:11727655"
                     /translation="MIRHIVFFSVKEGQDIETVRKGLEQLATIPYSDVFEVLANSKVD
                     PMCERIDLVVYAEFKDEEALYAFKNHPTYDATTQLVRPMRELRFSADVVTDKN"
     misc_feature    194993..195268
                     /locus_tag="BSVBI22_A0184"
                     /note="Stress responsive A/B Barrel Domain; Region: Dabb;
                     pfam07876"
                     /db_xref="CDD:254481"
     gene            complement(195284..195862)
                     /gene="ogt"
                     /locus_tag="BSVBI22_A0185"
                     /db_xref="GeneID:11727656"
     CDS             complement(195284..195862)
                     /gene="ogt"
                     /locus_tag="BSVBI22_A0185"
                     /note="identified by similarity to OMNI:CC0659; match to
                     protein family HMM PF01035; match to protein family HMM
                     TIGR00589"
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="YP_005153890.1"
                     /db_xref="GI:376279884"
                     /db_xref="GeneID:11727656"
                     /translation="MESFGITVFETPIGPRGIAWRGSKIVGVEIGEADEKETRHRLRE
                     RFAGGEYAEPPAFIRQTIEKVRALLDGASPDFSDTPLALDSVPDLNRRVYEIILELKP
                     GETTTYGAIARRLGDVSLSQAVGYALGKNPFPIIVPCHRVLGSNGKVGGFSAAGGTAT
                     KLRLLNIERARTTSEPDLFGGLPLQERPQTGW"
     misc_feature    complement(195353..195847)
                     /gene="ogt"
                     /locus_tag="BSVBI22_A0185"
                     /note="Methylated DNA-protein cysteine methyltransferase
                     [DNA replication, recombination, and repair]; Region: Ada;
                     COG0350"
                     /db_xref="CDD:223427"
     misc_feature    complement(195356..195592)
                     /gene="ogt"
                     /locus_tag="BSVBI22_A0185"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    complement(order(195359..195361,195437..195439,
                     195443..195448,195539..195541))
                     /gene="ogt"
                     /locus_tag="BSVBI22_A0185"
                     /note="active site"
                     /db_xref="CDD:119438"
     misc_feature    complement(order(195410..195412,195431..195433,
                     195446..195448,195470..195472,195476..195481,
                     195488..195490,195494..195499,195503..195505,
                     195512..195514,195536..195541))
                     /gene="ogt"
                     /locus_tag="BSVBI22_A0185"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     gene            196120..196365
                     /locus_tag="BSVBI22_A0186"
                     /db_xref="GeneID:11727657"
     CDS             196120..196365
                     /locus_tag="BSVBI22_A0186"
                     /note="identified by similarity to GP:14025509"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153891.1"
                     /db_xref="GI:376279885"
                     /db_xref="GeneID:11727657"
                     /translation="MDDYERYATGLMIVFGALIIGGLMAANLYHGDKPGFLFALGAAV
                     VGWFSAFAVLFDKPRVYGVMIAIAIGLVAASIGAYVT"
     gene            complement(196418..196807)
                     /locus_tag="BSVBI22_A0187"
                     /db_xref="GeneID:11727658"
     CDS             complement(196418..196807)
                     /locus_tag="BSVBI22_A0187"
                     /note="identified by similarity to GP:15073804"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153892.1"
                     /db_xref="GI:376279886"
                     /db_xref="GeneID:11727658"
                     /translation="MKRFGYSLFAACLSIGMGLSAMSANAAQPLLPLASAAASQDADA
                     VQRVQYYDYRGDRRYWRHQRYWRHHHPRYRPYYRYYRHWGPPPRAYRGGNPHVRWCYN
                     RYRSYRAYDNTYQPNYGPRCQCYSPYL"
     misc_feature    complement(196433..196522)
                     /locus_tag="BSVBI22_A0187"
                     /note="BA14K-like protein; Region: BA14K; pfam07886"
                     /db_xref="CDD:203793"
     gene            197121..200906
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /db_xref="GeneID:11727659"
     CDS             197121..200906
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /note="one of two methionine synthases in Escherichia
                     coli; MetH catalyzes a methyl transfer reaction from
                     methyltetrahydrofolate to homocysteine to create
                     methionine; requires zinc for activity"
                     /codon_start=1
                     /transl_table=11
                     /product="B12-dependent methionine synthase"
                     /protein_id="YP_005153893.1"
                     /db_xref="GI:376279887"
                     /db_xref="GeneID:11727659"
                     /translation="MASSLDDLFGATAAKPDGSEVLAALTQAARERILILDGAMGTQI
                     QGLGFHEEHFRGDRFATCDCQLQGNNDLLTLTQPKAIEEIHYAYAMAGADILETNTFS
                     STSIAQADYGMEAMVYDLNRDGARLARRAALRAEQKDGRRRFVAGALGPTNRTASLSP
                     DVNNPGFRAVTFDDLRIAYSEQIRGLIDGGSDIILIETIFDTLNAKAAVFATEEVFAE
                     KGVRLPVMISGTITDLSGRTLSGQTPTAFWYSLRHARPFTIGLNCALGANAMRAHLNE
                     LSGIADTFICAYPNAGLPNEFGQYDETPEAMAAQIEGFARDGLVNVVGGCCGSTPDHI
                     RAIAQAVAKYEPRKPAKVPPLMRLSGLEPFTLTKDIPFVNIGERTNVTGSARFRKLVK
                     AGDFAAALDVARDQVANGAQIIDINMDEGLIDSEKAMVEFLNLIAAEPDIARVPIMLD
                     SSKWEVIEAGLKCVQGKAVVNSISLKEGEEAFLHHARLVRAYGAAVVIMAFDETGQAD
                     TQARKIEICTRAYKILTEQVGFPPEDIIFDPNIFAVATGIEEHNNYGVDFIEATREIV
                     RTLPHVHISGGVSNLSFSFRGNEPVREAMHAVFLYHAIQAGMDMGIVNAGQLAVYDTI
                     DAELREACEDVVLNRPTKTGESATERLLEIAERFRDSGSREARTQDLSWREWPVEKRL
                     EHALVNGITEYIEADTEEARLAAERPLHVIEGPLMAGMNVVGDLFGSGKMFLPQVVKS
                     ARVMKQAVAVLLPFMEEEKRLNGGEGRQSAGKVLMATVKGDVHDIGKNIVGVVLACNN
                     YEIIDLGVMVPSQKILQVARDEKVDIIGLSGLITPSLDEMAHVAAEMEREGFDIPLLI
                     GGATTSRVHTAVKIHSRYERGQAVYVVDASRAVGVVSNLLSPEGKQAYIDGLRNEYAK
                     VAAAHARNEAEKQRLPIARARANPHQLDWENYEPVKPAFTGTKVFETYDLAEIARYID
                     WTPFFQTWELRGRYPAILEDEKQGEAARQLWADAQAMLRKIIDEKWFTPRAVVGFWPA
                     NAVGDDIRLFTDESRKEELATLFTLRQQLTKRDGRPNVAMADFVAPVESGKQDYVGGF
                     VVTAGIGEIAITERFERANDDYSAILVKALADRFAEAFAELMHERVRKEFWAYAPDEA
                     FTPEELISEPYKGIRPAPGYPAQPDHTEKTTLFRLLDATANTGVELTESYAMWPGSSV
                     SGLYIGHPESYYFGVAKVERDQVEDYARRKDMDVEAVERWLTPILNYVPGASKDEAA"
     misc_feature    197163..200870
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /note="B12-dependent methionine synthase; Provisional;
                     Region: metH; PRK09490"
                     /db_xref="CDD:236539"
     misc_feature    197172..198149
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /note="Methionine synthase I (cobalamin-dependent),
                     methyltransferase domain [Amino acid transport and
                     metabolism]; Region: MetH; COG0646"
                     /db_xref="CDD:223719"
     misc_feature    198234..199004
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /note="MeTr subgroup of pterin binding enzymes. This
                     family includes cobalamin-dependent methyltransferases
                     such as methyltetrahydrofolate, corrinoid iron-sulfur
                     protein methyltransferase (MeTr) and methionine synthase
                     (MetH).  Cobalamin-dependent...; Region: MeTr; cd00740"
                     /db_xref="CDD:238381"
     misc_feature    order(198258..198260,198468..198470,198531..198533,
                     198537..198539,198615..198617,198732..198734,
                     198849..198851,198861..198863,198954..198956,
                     198960..198962)
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238381"
     misc_feature    199152..199808
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /note="B12 binding domain of methionine synthase. This
                     domain binds methylcobalamin, which it uses as an
                     intermediate methyl carrier from methyltetrahydrofolate
                     (CH3H4folate) to homocysteine (Hcy); Region:
                     methionine_synthase_B12_BD; cd02069"
                     /db_xref="CDD:239020"
     misc_feature    order(199257..199259,199269..199271,199320..199322,
                     199329..199331,199458..199478,199485..199487,
                     199596..199604,199608..199616,199695..199697,
                     199764..199766,199773..199775,199782..199784)
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239020"
     misc_feature    199467..199469
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /note="cobalt ligand [ion binding]; other site"
                     /db_xref="CDD:239020"
     misc_feature    200004..200822
                     /gene="metH"
                     /locus_tag="BSVBI22_A0188"
                     /note="Vitamin B12 dependent methionine synthase,
                     activation domain; Region: Met_synt_B12; pfam02965"
                     /db_xref="CDD:251646"
     gene            complement(200870..201037)
                     /locus_tag="BSVBI22_A0189"
                     /db_xref="GeneID:11727660"
     CDS             complement(200870..201037)
                     /locus_tag="BSVBI22_A0189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153894.1"
                     /db_xref="GI:376279888"
                     /db_xref="GeneID:11727660"
                     /translation="MKIEYLFGRKIKPEDSTAKLEANSPRGGLLHEGCFAVSSRTIGC
                     QAASSFDAPGT"
     misc_feature    complement(<200882..>200962)
                     /locus_tag="BSVBI22_A0189"
                     /note="Dehydratase family; Region: ILVD_EDD; cl00340"
                     /db_xref="CDD:260368"
     gene            201227..201934
                     /locus_tag="BSVBI22_A0190"
                     /db_xref="GeneID:11727661"
     CDS             201227..201934
                     /locus_tag="BSVBI22_A0190"
                     /note="identified by match to protein family HMM PF00196;
                     match to protein family HMM PF03472"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_005153895.1"
                     /db_xref="GI:376279889"
                     /db_xref="GeneID:11727661"
                     /translation="MKWETFYDAMQSADSADQLFEIVKNYAHDLGFEYVSYVMSIPSL
                     NGSLKWVRFGAFPDGWEQRYLAQNYAEIDPLLRRGVNSIDPLIWSQNFFASAPQIWAD
                     AVKYGLKVGISQPCWAAQGVFGLLSFVRSGPALTPGEISMLRRQLQMVTNLLHLSMYE
                     RVDVPAISCIGDVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLV
                     AVNKVQAVAKARTFGLL"
     misc_feature    201257..201931
                     /locus_tag="BSVBI22_A0190"
                     /note="DNA-binding transcriptional activator SdiA;
                     Provisional; Region: PRK10188"
                     /db_xref="CDD:182292"
     misc_feature    201269..201700
                     /locus_tag="BSVBI22_A0190"
                     /note="Autoinducer binding domain; Region: Autoind_bind;
                     pfam03472"
                     /db_xref="CDD:251983"
     misc_feature    201749..201916
                     /locus_tag="BSVBI22_A0190"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(201752..201760,201797..201805,201827..201832,
                     201836..201841,201845..201859,201890..201892)
                     /locus_tag="BSVBI22_A0190"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(201785..201787,201791..201793,201797..201799,
                     201890..201898,201905..201907,201914..201916)
                     /locus_tag="BSVBI22_A0190"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            202049..203419
                     /locus_tag="BSVBI22_A0191"
                     /db_xref="GeneID:11727662"
     CDS             202049..203419
                     /locus_tag="BSVBI22_A0191"
                     /note="identified by match to protein family HMM PF00202"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="YP_005153896.1"
                     /db_xref="GI:376279890"
                     /db_xref="GeneID:11727662"
                     /translation="MTAQPNSLEARDIRYHLHSYTDAVRLEAEGPLVIERGDGIYVED
                     IAGKRYIEAMSGLWSVGVGFSEQRLAEAAARQMKKLPFYHTFSYRSHGPVIDLAEKLV
                     AMAPVPMNKAYFTNSGSEANDTVVKLIWYRSNALGEPERKKIISRKRGYHGVTIASAS
                     LTGLPNNHRSFDLPIDRILHTGCPHHYHDALPGESEEQFATRLANELEQLILAEGPHT
                     IAAFIGEPVMGAGGVVVPPKTYWEKVQAVLGRYNILLVADEVICGFGRTGNLFGCQTF
                     DIKPDILVMSKQLSSSYLPISAFLINERVYAPIAEESHKIGTLGTGFTASGHPVAAAV
                     ALENLAIIEERDLVANARERGARMQKRLRELQDHPLVGEVRGVGLIAGVELVIDKEAK
                     TGLEQPGALGARANAALQERGVISRAMGDTLAFCPPLIINDQQVDTMVSALEAALNDV
                     QASLGK"
     misc_feature    202058..203413
                     /locus_tag="BSVBI22_A0191"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    202070..203389
                     /locus_tag="BSVBI22_A0191"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(202397..202405,202499..202504,202508..202510,
                     202721..202723,202820..202822,202826..202831,
                     202907..202909)
                     /locus_tag="BSVBI22_A0191"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(202400..202405,202499..202504,202721..202723,
                     202820..202822,202829..202831,202907..202909)
                     /locus_tag="BSVBI22_A0191"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    202907..202909
                     /locus_tag="BSVBI22_A0191"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(203459..203644)
                     /locus_tag="BSVBI22_A0192"
                     /db_xref="GeneID:11727663"
     CDS             complement(203459..203644)
                     /locus_tag="BSVBI22_A0192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153897.1"
                     /db_xref="GI:376279891"
                     /db_xref="GeneID:11727663"
                     /translation="MKAEKGKNAIAYCRRHREKLARFSVGPETNLLRKQKSDFLPSHG
                     KSYKKLCYLPGLGTGRS"
     gene            203823..204725
                     /gene="cysD"
                     /locus_tag="BSVBI22_A0193"
                     /db_xref="GeneID:11727664"
     CDS             203823..204725
                     /gene="cysD"
                     /locus_tag="BSVBI22_A0193"
                     /note="with CysN catalyzes the formation of
                     adenylylsulfate from sulfate and ATP"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit 2"
                     /protein_id="YP_005153898.1"
                     /db_xref="GI:376279892"
                     /db_xref="GeneID:11727664"
                     /translation="MKNLTHLQRLEAEAIHVFREVAATFSNPVMLYSVGKDSSVMLHL
                     AMKAFYPAPPPFPFLHVDTTWKFREMIEFRDAQAREKGFELLVHVNEQGVRDGIGPFT
                     HGSNVHTHIMKTVGLRQALDKYRFDAAFGGARRDEEKSRAKERIFSFRNAQHGWDPKN
                     QRPEMWKIYNTRVSKGESIRVFPLSNWTELDIWQYILQENIPIVPLYFAARRPVVERD
                     GMLIMVDDDRMKLRPGEQVENRLVRFRTLGCYPLTGAIPSSAANLSDIVEEMLIARTS
                     ERQGRAIDRDEAGSMEKKKREGYF"
     misc_feature    203835..204722
                     /gene="cysD"
                     /locus_tag="BSVBI22_A0193"
                     /note="3'-phosphoadenosine 5'-phosphosulfate
                     sulfotransferase (PAPS reductase)/FAD synthetase and
                     related enzymes [Amino acid transport and metabolism /
                     Coenzyme metabolism]; Region: CysH; COG0175"
                     /db_xref="CDD:223253"
     misc_feature    203901..204467
                     /gene="cysD"
                     /locus_tag="BSVBI22_A0193"
                     /note="This domain is found in phosphoadenosine
                     phosphosulphate (PAPS) reductase enzymes or PAPS
                     sulphotransferase. PAPS reductase is part of the adenine
                     nucleotide alpha hydrolases superfamily also including N
                     type ATP PPases and ATP sulphurylases. A highly...;
                     Region: PAPS_reductase; cd01713"
                     /db_xref="CDD:238846"
     misc_feature    order(204159..204161,204243..204245,204348..204350,
                     204360..204362)
                     /gene="cysD"
                     /locus_tag="BSVBI22_A0193"
                     /note="Active Sites [active]"
                     /db_xref="CDD:238846"
     gene            204725..206659
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /db_xref="GeneID:11727665"
     CDS             204725..206659
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="in Rhizobium meliloti this protein is involved in
                     the synthesis of nodulation factors that are active on the
                     roots of alfalfa; catalyzes formation of activated sulfate
                     intermediate; converts ATP and sulfate to diphosphate and
                     adenylylsulfate and then ATP and adenylyl sulfate to ADP
                     and 3'-phosphoadenylyl sulfate; the activated intermediate
                     is transferred to the nodulation factors by NodH; may
                     interact with NodP and NodQ; similar to the CysD and CysN
                     proteins from EScherichia coli involved in cysteine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional sulfate adenylyltransferase subunit
                     1/adenylylsulfate kinase"
                     /protein_id="YP_005153899.1"
                     /db_xref="GI:376279893"
                     /db_xref="GeneID:11727665"
                     /translation="MNVVMKPSQKNTAVADFLADQEHKSLLRFLTCGSVDDGKSTLIG
                     RLLYDTKLIFEDQLASLKNDSRKFGTTDDDFDFALLVDGLEAEREQGITIDVAYRFFS
                     TPRRKFIVADTPGHAQYTRNMATGASTADLAVVLVDARQGVLTQTRRHSFIAAALGIR
                     HIVLAVNKIDLVDFSQDRFDGIVADYLSFAQDLGFTSIQPIPLSARFGDNVTASSPRI
                     GWYEGPHLLEHLETVRIDTEAAAKPFRFPVQYVNRPNLDFRGFSGTVASGSIHVGDPV
                     VVAKSGKQSRVKRIATYDGDLQRASERQAVTLVLEDEIEVSRGNMLAGVELRPEVADR
                     FAADIVWFGEDPLLPGRSYLLRTETDQTPVTVNAIRHRTDVNTFIQEETARLDLNEIG
                     RCHLQTVDPIAFDPYGENRATGAFVLIDRLTNATVGAGMIDAALRQATNVHLQAFDLN
                     KQARAAQKFQKPAVLWFTGLSASGKSTIANRLEQRLHALGKHTYLLDGDNVRHGLNSD
                     LGFSDADRVENIRRVGEVARLMADAGLITLVSFISPFREERDQVRARLPEGEFIEIFI
                     DTPIEECMARDPKGLYAQALRGEIKAFTGIDSPYEPPVAPELRLNTAGRTVDELIAEV
                     ENYLAERGVIGSYGSDSWSI"
     misc_feature    204731..206626
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="bifunctional sulfate adenylyltransferase subunit
                     1/adenylylsulfate kinase protein; Provisional; Region:
                     PRK05506"
                     /db_xref="CDD:180120"
     misc_feature    204806..205432
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="CysN, together with protein CysD, forms the ATP
                     sulfurylase (ATPS) complex; Region: CysN_ATPS; cd04166"
                     /db_xref="CDD:206729"
     misc_feature    order(204806..204808,205007..205012,205016..205018,
                     205022..205024,205043..205045,205049..205051,
                     205097..205099,205106..205108)
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="CysD dimerization site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206729"
     misc_feature    204821..204844
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="G1 box; other site"
                     /db_xref="CDD:206729"
     misc_feature    order(204824..204826,204830..204832,204842..204847,
                     204854..204856,204863..204868,205013..205018,
                     205070..205075,205142..205147,205265..205267,
                     205277..205279)
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206729"
     misc_feature    order(204830..204832,204836..204847,204977..204979,
                     205223..205228,205232..205237,205334..205342)
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206729"
     misc_feature    204983..205015
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206729"
     misc_feature    205001..205003
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="G2 box; other site"
                     /db_xref="CDD:206729"
     misc_feature    205058..205069
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="G3 box; other site"
                     /db_xref="CDD:206729"
     misc_feature    205064..205120
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206729"
     misc_feature    205223..205234
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="G4 box; other site"
                     /db_xref="CDD:206729"
     misc_feature    205334..205342
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="G5 box; other site"
                     /db_xref="CDD:206729"
     misc_feature    205454..205693
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="CysN_NodQ_II: This subfamily represents the domain
                     II of the large subunit of ATP sulfurylase (ATPS): CysN or
                     the N-terminal portion of NodQ, found mainly in
                     proteobacteria and homologous to the domain II of EF-Tu.
                     Escherichia coli ATPS consists of CysN...; Region:
                     CysN_NodQ_II; cd03695"
                     /db_xref="CDD:239666"
     misc_feature    205712..206020
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="TCysN_NoDQ_II: This subfamily represents the domain
                     II of the large subunit of ATP sulfurylase (ATPS): CysN or
                     the N-terminal portion of NodQ, found mainly in
                     proteobacteria and homologous to the domain II of EF-Tu.
                     Escherichia coli ATPS consists of CysN...; Region:
                     CysN_NoDQ_III; cd04095"
                     /db_xref="CDD:239762"
     misc_feature    206114..206560
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="Adenosine 5'-phosphosulfate kinase (APSK) catalyzes
                     the phosphorylation of adenosine 5'-phosphosulfate to form
                     3'-phosphoadenosine 5'-phosphosulfate (PAPS). The
                     end-product PAPS is a biologically 'activated' sulfate
                     form...; Region: APSK; cd02027"
                     /db_xref="CDD:238985"
     misc_feature    order(206135..206140,206144..206155,206228..206230,
                     206255..206257,206270..206272,206279..206281,
                     206348..206356,206450..206452,206501..206506)
                     /gene="cysNC"
                     /locus_tag="BSVBI22_A0194"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238985"
     gene            206707..207507
                     /gene="cysQ"
                     /locus_tag="BSVBI22_A0195"
                     /db_xref="GeneID:11727666"
     CDS             206707..207507
                     /gene="cysQ"
                     /locus_tag="BSVBI22_A0195"
                     /note="identified by similarity to SP:P22255; match to
                     protein family HMM PF00459; match to protein family HMM
                     TIGR01331"
                     /codon_start=1
                     /transl_table=11
                     /product="3'(2'),5'-bisphosphate nucleotidase"
                     /protein_id="YP_005153900.1"
                     /db_xref="GI:376279894"
                     /db_xref="GeneID:11727666"
                     /translation="MRAVLRDAALEAGRSIMKHYVNGCAVQSKKDASPVTEADHAAEA
                     IILAALSSACPDVPVVAEEEVAAGRLPDHLGRKFLLVDPLDGTREFLLRNGDFTVNIG
                     LVEEGAPVLGIVYAPARNLLFIGSDAGAWAMETTPDHGAGQDQRIFARVSPAEKVAVC
                     SRSHLTPETERFLAENRIASSVSVGSSLKFCILAKGEADIYPRFGPTMEWDTAAGDAV
                     LRAAGGMTATLDGRPMIYGQRLRAGAAGFANPDFVAYGAGEAPVFTTA"
     misc_feature    206707..207468
                     /gene="cysQ"
                     /locus_tag="BSVBI22_A0195"
                     /note="CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate
                     (PAPS) 3'-phosphatase, is a bacterial member of the
                     inositol monophosphatase family. It has been proposed that
                     CysQ helps control intracellular levels of PAPS, which is
                     an intermediate in...; Region: CysQ; cd01638"
                     /db_xref="CDD:238816"
     misc_feature    order(206821..206823,206890..206895,206950..206967,
                     206971..206973,207187..207189,207196..207198,
                     207271..207273,207307..207309,207334..207339)
                     /gene="cysQ"
                     /locus_tag="BSVBI22_A0195"
                     /note="active site"
                     /db_xref="CDD:238816"
     gene            207640..207713
                     /locus_tag="BSVBI22_At02"
                     /db_xref="GeneID:11727667"
     tRNA            207640..207713
                     /locus_tag="BSVBI22_At02"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:11727667"
     gene            complement(207769..208530)
                     /locus_tag="BSVBI22_A0196"
                     /db_xref="GeneID:11727668"
     CDS             complement(207769..208530)
                     /locus_tag="BSVBI22_A0196"
                     /note="identified by match to protein family HMM PF00027"
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/FNR family transcriptional regulator"
                     /protein_id="YP_005153901.1"
                     /db_xref="GI:376279895"
                     /db_xref="GeneID:11727668"
                     /translation="MQSGRQNTTSSTDALIGLLEAAPILAKLEAREIDALATLDIIEN
                     NFAADAIIIEQGARVRSIHLVRSGWGCIYRDLSSGQRQIIDFPMRCDFVGLRTSNGYS
                     YNTIAAITPMSIFEIPLNSLENAIKHAPRLSFILIELLSRQRSFLIEHLTNVGCRNAF
                     VRTAHLLLELSDRVKSCGMGEPDSFYCPLTQYQLADALGLTPIHLNRMLRELREEGLV
                     LFRSNRVEILNREQLAALAEYYGEFMRMAVFARHE"
     misc_feature    complement(207838..208479)
                     /locus_tag="BSVBI22_A0196"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(208120..208461)
                     /locus_tag="BSVBI22_A0196"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(208219..208227,208246..208251))
                     /locus_tag="BSVBI22_A0196"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(208135..208143,208153..208161))
                     /locus_tag="BSVBI22_A0196"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(207823..208047)
                     /locus_tag="BSVBI22_A0196"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     misc_feature    complement(208042..208047)
                     /locus_tag="BSVBI22_A0196"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(207928..207930,207955..207963,
                     207967..207969))
                     /locus_tag="BSVBI22_A0196"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(207910..207930)
                     /locus_tag="BSVBI22_A0196"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(207910..207912,207922..207927))
                     /locus_tag="BSVBI22_A0196"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(207922..207927)
                     /locus_tag="BSVBI22_A0196"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            208736..209508
                     /locus_tag="BSVBI22_A0197"
                     /note="transcriptional regulator, LuxR family, authentic
                     frameshift; this gene contains a frame shift which is not
                     the result of sequencing error;identified by similarity to
                     GP:15140544"
                     /pseudo
                     /db_xref="GeneID:11727669"
     gene            209483..209614
                     /locus_tag="BSVBI22_A0198"
                     /db_xref="GeneID:11727670"
     CDS             209483..209614
                     /locus_tag="BSVBI22_A0198"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153902.1"
                     /db_xref="GI:376279896"
                     /db_xref="GeneID:11727670"
                     /translation="METCRTKIEEIFQYIAKNIYRYSYDLFSGKYCVEAFQMLPRLK"
     gene            209836..210627
                     /gene="glpR"
                     /locus_tag="BSVBI22_A0199"
                     /db_xref="GeneID:11727671"
     CDS             209836..210627
                     /gene="glpR"
                     /locus_tag="BSVBI22_A0199"
                     /note="identified by similarity to SP:P09392; match to
                     protein family HMM PF00455"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transcriptional regulator"
                     /protein_id="YP_005153903.1"
                     /db_xref="GI:376279897"
                     /db_xref="GeneID:11727671"
                     /translation="MQLTPRHHAIVELARRKGQVLVDDLAVAFDVTPQTVRKDLNDLC
                     RARLLRRIHGGALYPSGVENMEYEARRRIAAHEKESIGRATAAIIPDGASLFINIGTT
                     TEAVSHALVDHNHLMVITNNINVANTLRVYPSIEVVIAGGVVRASDGGIVGEAAVDFI
                     RQFKVDFAIIGTSAIDEDGALLDFDFREVKVAQAIIANARHVILVTDSTKLERTAPVR
                     IGHLSQVNTFITDRCTSLQLQDLCREHGVELIETLAGKEPEQKDD"
     misc_feature    209836..210585
                     /gene="glpR"
                     /locus_tag="BSVBI22_A0199"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    209851..210015
                     /gene="glpR"
                     /locus_tag="BSVBI22_A0199"
                     /note="DeoR-like helix-turn-helix domain; Region:
                     HTH_DeoR; cl17531"
                     /db_xref="CDD:248085"
     misc_feature    210049..210534
                     /gene="glpR"
                     /locus_tag="BSVBI22_A0199"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            210709..212220
                     /gene="glpD"
                     /locus_tag="BSVBI22_A0200"
                     /db_xref="GeneID:11727672"
     CDS             210709..212220
                     /gene="glpD"
                     /locus_tag="BSVBI22_A0200"
                     /note="in Escherichia coli this homodimeric enzyme is
                     expressed under aerobic conditions; anaerobic expression
                     is repressed by the arcAB system; converts
                     sn-glycerol-3-phosphate and ubiquinone-8 to dihydroxy
                     acetone phosphate and ubiquinol-8; associates with the
                     cytoplasmic membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="YP_005153904.1"
                     /db_xref="GI:376279898"
                     /db_xref="GeneID:11727672"
                     /translation="MVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGT
                     SSRATKLIHGGLRYLEHYEFRLVCEALMEREVLWANAPHIIHPMRFVLPYHKGGLRPA
                     WLLRLGLFLYDHLGGRKKLPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVA
                     LTARDAADRGAKIATRTSVVAASRDGQGWTITLEDTGTGRRENVHARLLVNAAGPWAD
                     KVLQGVEGDRQLHNIRLVQGSHIVVRRKFSDPCAYFFQNNDGRIIFAIPYEDDFTLIG
                     TTDQDYKGDPAKVAITDSETDYLCQAASEYFREPVRREDIVWTYSGVRPLYDDGASKA
                     QEATRDYVLKEDAPDGLAPLINVFGGKLTTARKLAEHMLQKIEHRLGRKGAPWTHVAP
                     LPGGDFEDVAFETELKKLEAAYPFLDARHARRLFRLYGTRAYKLLGQASSLGDLGRHF
                     GSDLYEAEVRYLVENEWARSAEDILWRRTKLGLRLTAAEVAAVQGFVEPAIAA"
     misc_feature    210772..212217
                     /gene="glpD"
                     /locus_tag="BSVBI22_A0200"
                     /note="glycerol-3-phosphate dehydrogenase; Reviewed;
                     Region: glpD; PRK12266"
                     /db_xref="CDD:237027"
     misc_feature    210772..212202
                     /gene="glpD"
                     /locus_tag="BSVBI22_A0200"
                     /note="Glycerol-3-phosphate dehydrogenase [Energy
                     production and conversion]; Region: GlpA; COG0578"
                     /db_xref="CDD:223651"
     gene            212439..213408
                     /locus_tag="BSVBI22_A0201"
                     /note="transcriptional regulator, Fis family, authentic
                     frameshift; this gene contains a frame shift which is not
                     the result of sequencing error;identified by similarity to
                     OMNI:NTL02ML5216; match to protein family HMM PF02954;
                     match to protein family HMM TIGR01199"
                     /pseudo
                     /db_xref="GeneID:11727673"
     gene            213557..215074
                     /locus_tag="BSVBI22_A0202"
                     /db_xref="GeneID:11727674"
     CDS             213557..215074
                     /locus_tag="BSVBI22_A0202"
                     /note="identified by match to protein family HMM PF00171"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase family protein"
                     /protein_id="YP_005153905.1"
                     /db_xref="GI:376279899"
                     /db_xref="GeneID:11727674"
                     /translation="MNKVEFSRTVKPAFAKRYGNFIGGKWVEPRSGRYFENTSPVNGQ
                     VLCEVARSDAADVEAALDAAHAARELWGRTSVAERALILNRIADRIEENLPALAAAET
                     WDNGKPIRETTNADLPLAVDHFRYFAGVIRAQEGGISEIDHDTVAYHFHEPLGVVGQI
                     IPWNFPLLMATWKLAPALAAGNCVVLKPAEQTPASILVLMELIADILPPGVVNIVNGF
                     GLEAGKPLASSPRIAKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAA
                     EDDDFLDKAIEGFVMFALNQGEVCTCPSRALIQESIYDRFMKKALKRVEAIVQGDPLD
                     PATMIGAQASSEQLEKILSYLDIGRQEGAEVLAGGERNMLPGDLAGGYYVKPTVFKGH
                     NKMRIFQEEIFGPVVSVATFKDDAEALSIANDTLYGLGAGIWTRDGTRAYRFGRAIKA
                     GRVWTNCYHAYPAHAAFGGYKQSGIGRENYLKMLDHYQNTKNMLVSYSPKKLGFF"
     misc_feature    213608..215047
                     /locus_tag="BSVBI22_A0202"
                     /note="Ralstonia eutrophus NAD+-dependent acetaldehyde
                     dehydrogenase II-like; Region: ALDH_ACDHII-AcoD; cd07116"
                     /db_xref="CDD:143434"
     misc_feature    order(214034..214048,214070..214072,214115..214117,
                     214121..214126,214265..214276,214283..214285,
                     214292..214297,214337..214345,214454..214456,
                     214757..214759,214763..214765,214841..214843,
                     214955..214957)
                     /locus_tag="BSVBI22_A0202"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143434"
     misc_feature    order(214046..214048,214337..214339,214445..214447,
                     214454..214456)
                     /locus_tag="BSVBI22_A0202"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143434"
     gene            215555..216589
                     /locus_tag="BSVBI22_A0203"
                     /db_xref="GeneID:11727675"
     CDS             215555..216589
                     /locus_tag="BSVBI22_A0203"
                     /note="identified by similarity to SP:P42327; match to
                     protein family HMM PF00107"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-containing alcohol dehydrogenase"
                     /protein_id="YP_005153906.1"
                     /db_xref="GI:376279900"
                     /db_xref="GeneID:11727675"
                     /translation="MAKTMKAAVVRAFGKPLTIDEVPIPQPGPGQIQVAIQASGVCHT
                     DLHAAEGDWPVKPNPPFIPGHEGVGFVSAVGSGVKHVKEGDRVGIPWLYTACGHCRHC
                     LGGWETLCEEQLNTGYSVNGGFAEYVVADPNFVGHLPKNIDFNEIAPVLCAGVTVYKG
                     LKVTDTKPGDWVVISGIGGLGHMAVQYARAMGLNVAAVDIDDRKLDLARRLGATVTVN
                     AKTVADPAAYIRKETDGGAQGVLVTAVSPKAFEQALGMVARGGTVSLNGLPPGDFPLS
                     IFNMVLNGVTVRGSIVGTRLDLQESLDFAADGKVKATIQTGKLEDINAIFDDMRQGNI
                     EGRIVMDLTQ"
     misc_feature    215561..216583
                     /locus_tag="BSVBI22_A0203"
                     /note="Zn-dependent alcohol dehydrogenases [General
                     function prediction only]; Region: AdhP; COG1064"
                     /db_xref="CDD:223992"
     misc_feature    215567..216580
                     /locus_tag="BSVBI22_A0203"
                     /note="Cinnamyl alcohol dehydrogenases (CAD); Region:
                     CAD3; cd08297"
                     /db_xref="CDD:176257"
     misc_feature    order(215678..215686,215693..215695,216008..216010,
                     216020..216022,216080..216082,216086..216091,
                     216092..216094,216146..216151,216164..216166,
                     216281..216292,216299..216301,216350..216358,
                     216422..216430,216563..216565)
                     /locus_tag="BSVBI22_A0203"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:176257"
     misc_feature    order(215678..215680,215684..215686,215711..215713,
                     215747..215749,215825..215827,216008..216010,
                     216356..216358,216428..216430)
                     /locus_tag="BSVBI22_A0203"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176257"
     misc_feature    order(215678..215680,215747..215749,216008..216010)
                     /locus_tag="BSVBI22_A0203"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176257"
     misc_feature    order(215711..215713,215846..215848,215852..215857,
                     215879..215887,216053..216061,216122..216130,
                     216134..216136,216170..216172,216179..216184,
                     216302..216304,216326..216328,216332..216334,
                     216347..216349,216353..216358,216383..216388,
                     216401..216427,216437..216442,216452..216454,
                     216464..216466,216473..216475)
                     /locus_tag="BSVBI22_A0203"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176257"
     misc_feature    order(215840..215842,215849..215851,215858..215860,
                     215882..215884)
                     /locus_tag="BSVBI22_A0203"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176257"
     gene            216680..217012
                     /locus_tag="BSVBI22_A0204"
                     /db_xref="GeneID:11727676"
     CDS             216680..217012
                     /locus_tag="BSVBI22_A0204"
                     /note="identified by similarity to OMNI:NTL02ML5214; match
                     to protein family HMM PF05610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153907.1"
                     /db_xref="GI:376279901"
                     /db_xref="GeneID:11727676"
                     /translation="MGQVSATPAALDLIRALQAEYGPIMFHQSGGCCDGSSPMCYPQG
                     EFIVGDTDVKLGEIGGAPVYISGPQYAAWKHTELIIDVVPGRGGMFSLDNGREVRFLT
                     RSRVCSVP"
     misc_feature    216680..217009
                     /locus_tag="BSVBI22_A0204"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3564"
                     /db_xref="CDD:226094"
     gene            217074..218095
                     /locus_tag="BSVBI22_A0205"
                     /note="transcriptional regulator, LacI family, authentic
                     frameshift; this gene contains a frame shift which is not
                     the result of sequencing error;identified by similarity to
                     OMNI:CC2053"
                     /pseudo
                     /db_xref="GeneID:11727677"
     gene            complement(218187..219792)
                     /locus_tag="BSVBI22_A0206"
                     /note="ABC transporter, HlyB/MsbA family, degenerate; this
                     region contains one or more premature stops and/or
                     frameshifts which are not the result of sequencing
                     error;identified by similarity to OMNI:NTL02ML0644"
                     /pseudo
                     /db_xref="GeneID:11727678"
     gene            219541..220110
                     /locus_tag="BSVBI22_A0207"
                     /db_xref="GeneID:11727679"
     CDS             219541..220110
                     /locus_tag="BSVBI22_A0207"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153908.1"
                     /db_xref="GI:376279902"
                     /db_xref="GeneID:11727679"
                     /translation="MMSVSFSRSSAHMPRVTLRTVEPAKAFACQPPGIERGENVGGCR
                     QQHADNHRRQPQGLTSPVAERVAENAAERRPPEIDAKTGHINIPARTAHGCRSFIWKK
                     NYSAPEGRDERGFWKWPKGGPMRDERRTFQLAGRDARPMSGNTLSDVERASDSGQAPD
                     LPKRTLGIIGNGYCTRISYLLPVLQMVAQ"
     gene            complement(220152..220250)
                     /locus_tag="BSVBI22_A0208"
                     /db_xref="GeneID:11727680"
     CDS             complement(220152..220250)
                     /locus_tag="BSVBI22_A0208"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153909.1"
                     /db_xref="GI:376279903"
                     /db_xref="GeneID:11727680"
                     /translation="MQGCTVPATENIEKNDLLEKIAGANLPHFSRD"
     gene            220245..220400
                     /locus_tag="BSVBI22_A0209"
                     /db_xref="GeneID:11727681"
     CDS             220245..220400
                     /locus_tag="BSVBI22_A0209"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153910.1"
                     /db_xref="GI:376279904"
                     /db_xref="GeneID:11727681"
                     /translation="MHFGPSWAIENRYIRNGPAVMKPAGVPAVGGEIRLGRNVQDGAE
                     FWIQKDH"
     gene            220413..221846
                     /locus_tag="BSVBI22_A0210"
                     /db_xref="GeneID:11727682"
     CDS             220413..221846
                     /locus_tag="BSVBI22_A0210"
                     /note="identified by similarity to EGAD:17385; match to
                     protein family HMM PF00171"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase family protein"
                     /protein_id="YP_005153911.1"
                     /db_xref="GI:376279905"
                     /db_xref="GeneID:11727682"
                     /translation="MTFHQNLIAGEWVGGDDIANINPSDTNDVVGTYARATAEDTKAA
                     IAAAKAAFPAWSRSGILERHAILRKTADEILARKEELGRLLSREEGKTLVEGIGETIR
                     ASQIFDFFAGECLRLAGEVLPSARPGIGVEVTREPVGVVGIITPWNFPIAIPAWKIAP
                     ALCYGNTIVFKPAELVPGCSWAIADILHRAGLPKGVLNLVMGKGSVVGQTILDSADVN
                     AVTFTGSTGTGKRVAAASIEHNRRFQLEMGGKNPVVVLDDADLNVAVESVVNSAFFST
                     GQRCTASSRIIVTEGIHDKFVAAAIEKLKTVVVDNALKPGTHIGPVVDETQLQQDMDY
                     IELGRKEGAKLAFGGERLNRETPGFYLQPALFTEATNQMRISREEIFGPVASVIRVKD
                     YEEALATANDTSFGLSSGICTTSLKYATHFKRNSEAGMVMVNLPTAGVDFHVPFGGRK
                     GSSFGPREQGRYAAEFYTTVKTAYTLA"
     misc_feature    220422..221837
                     /locus_tag="BSVBI22_A0210"
                     /note="Bacillus subtilis NADP+-dependent
                     alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like;
                     Region: ALDH_KGSADH-YcbD; cd07097"
                     /db_xref="CDD:143415"
     misc_feature    order(220842..220856,220878..220880,220923..220925,
                     220929..220934,221076..221087,221094..221096,
                     221103..221108,221148..221156,221250..221252,
                     221547..221549,221553..221555,221631..221633,
                     221748..221750)
                     /locus_tag="BSVBI22_A0210"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143415"
     misc_feature    order(220854..220856,221148..221150,221241..221243,
                     221250..221252)
                     /locus_tag="BSVBI22_A0210"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143415"
     gene            complement(221891..222667)
                     /locus_tag="BSVBI22_A0211"
                     /db_xref="GeneID:11727683"
     CDS             complement(221891..222667)
                     /locus_tag="BSVBI22_A0211"
                     /note="identified by match to protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005153912.1"
                     /db_xref="GI:376279906"
                     /db_xref="GeneID:11727683"
                     /translation="MNDAVPNRSRLKRAADGFLSVAAALAIWQAVVSIGQMPRFILPG
                     PLDVVHALVANARLIAENAAATIGEVLGGLVLGSAVGIAAAIGLMMSPLAQRLVMPVM
                     VFSQAIPIFALAPILTLWLGYGPASKIAVAVLMIFFPVVSTFFDGMRRTETGLIDAAE
                     ILGAGRMAILFRIRIPSAFPALASGLSLAAVYAPIGAVVGEWVGASRGLGYLMLFANG
                     RAKVDLMFACLFVLAAFTMLLHGLVSYFARKLAAWPKKAA"
     misc_feature    complement(221909..222661)
                     /locus_tag="BSVBI22_A0211"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(221951..222472)
                     /locus_tag="BSVBI22_A0211"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(221954..221959,221966..221971,
                     221975..221980,221987..221992,222020..222025,
                     222062..222067,222074..222085,222104..222106,
                     222113..222118,222158..222160,222209..222211,
                     222218..222223,222233..222235,222239..222244,
                     222251..222253,222257..222259,222263..222268,
                     222314..222316,222320..222325,222332..222361,
                     222365..222376,222413..222415,222428..222433,
                     222440..222445))
                     /locus_tag="BSVBI22_A0211"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(222068..222085,222314..222358))
                     /locus_tag="BSVBI22_A0211"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(221990..221992,222020..222022,
                     222029..222031,222065..222067,222281..222283,
                     222314..222316))
                     /locus_tag="BSVBI22_A0211"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(222137..222139,222149..222154,
                     222170..222208))
                     /locus_tag="BSVBI22_A0211"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(222664..223362)
                     /locus_tag="BSVBI22_A0212"
                     /db_xref="GeneID:11727684"
     CDS             complement(222664..223362)
                     /locus_tag="BSVBI22_A0212"
                     /note="identified by similarity to EGAD:24145; match to
                     protein family HMM PF03070"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator TenA"
                     /protein_id="YP_005153913.1"
                     /db_xref="GI:376279907"
                     /db_xref="GeneID:11727684"
                     /translation="MNLPQPHYSSELFTRLRTATLADWKPYIEHDFVRGLGDGTLPKA
                     AFLHYLRQDYVYLHHYARAFALGVVKANTLQETRLCVDIMHSLTHMELPLHVRICARE
                     GISEDALYATREEPENLAYTRYVLDCGQAGDFLDLLTALVPCAHGYGEIGLNLAATAR
                     AGTPYQEWIDTYAGSEYQDMCRTVGRLFDQAARDRIGDDFEKSPRWPKLCQIFATASR
                     LEADFWSMGLKAGS"
     misc_feature    complement(222670..223335)
                     /locus_tag="BSVBI22_A0212"
                     /note="Putative transcription activator [Transcription];
                     Region: TenA; COG0819"
                     /db_xref="CDD:223889"
     gene            complement(223359..224327)
                     /locus_tag="BSVBI22_A0213"
                     /db_xref="GeneID:11727685"
     CDS             complement(223359..224327)
                     /locus_tag="BSVBI22_A0213"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter periplasmic substrate-binding
                     protein"
                     /protein_id="YP_005153914.1"
                     /db_xref="GI:376279908"
                     /db_xref="GeneID:11727685"
                     /translation="MKKMAFAALFGAVLSFASSAEANDKLKLILDWYVNPDHGPIIIA
                     NKLGYFRQAGLDVDIVAPADASVPTKMVAAGQADLAVSYQQQVHLQVHEGLPVIRVGT
                     LIDSPLNCLMTRDDGSVNAIADLKGKKIGYSVAGVEETLLGTILGQHGVKLSDVELIN
                     VNFSLAPALMSKQVDAVIGAYRNVELNQMAVEGVAGKCFFVEEEGVPVYDELVYVANS
                     DKLDAAERQKISRFLAATEKAAQYIVNHPEKSYEIFSSYSTELKDELNQRAWKDTVAR
                     FSRAPASLDHGRWSRCESYLKEHGLVPSILPVEKLAIDVNAEGSKT"
     misc_feature    complement(223395..224327)
                     /locus_tag="BSVBI22_A0213"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    complement(223578..224225)
                     /locus_tag="BSVBI22_A0213"
                     /note="NMT1/THI5 like; Region: NMT1; pfam09084"
                     /db_xref="CDD:255172"
     gene            complement(224351..224962)
                     /gene="thiE"
                     /locus_tag="BSVBI22_A0214"
                     /db_xref="GeneID:11727686"
     CDS             complement(224351..224962)
                     /gene="thiE"
                     /locus_tag="BSVBI22_A0214"
                     /note="Condenses 4-methyl-5-(beta-hydroxyethyl)-thiazole
                     monophosphate and 4-amino-5-hydroxymethyl pyrimidine
                     pyrophosphate to form thiamine monophosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="YP_005153915.1"
                     /db_xref="GI:376279909"
                     /db_xref="GeneID:11727686"
                     /translation="MTALDPFYPIFDSADWLERMVPLGIRLVQLRVKDKADAQLRAEI
                     RAARDICAAHDCQLIVNDYWKLALDEGCDFIHLGQEDLDGADLDAIRAGGLKLGVSSH
                     DEAELDRALSVRPDYIALGPIYPTILKKMKWHEQGLPRLGEWKARIGNIPLVGIGGLS
                     VERAPGVFAAGADIVSVVTDITLHADPAARVREWIAVTRPFVA"
     misc_feature    complement(224375..224950)
                     /gene="thiE"
                     /locus_tag="BSVBI22_A0214"
                     /note="Thiamine monophosphate synthase (TMP
                     synthase)/TenI. TMP synthase catalyzes an important step
                     in the thiamine biosynthesis pathway, the substitution of
                     the pyrophosphate of 2-methyl-4-amino-5-
                     hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-;
                     Region: TMP_TenI; cd00564"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(224426..224431,224489..224491,
                     224576..224581,224585..224587,224663..224665,
                     224720..224722,224777..224782,224864..224866,
                     224870..224872,224876..224878))
                     /gene="thiE"
                     /locus_tag="BSVBI22_A0214"
                     /note="active site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(224426..224437,224489..224491,
                     224501..224503,224579..224581,224585..224587,
                     224606..224608,224612..224614,224663..224665,
                     224735..224737,224870..224872,224876..224878))
                     /gene="thiE"
                     /locus_tag="BSVBI22_A0214"
                     /note="thiamine phosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(224576..224578,224663..224665,
                     224720..224722,224729..224731,224777..224782,
                     224864..224866,224870..224872))
                     /gene="thiE"
                     /locus_tag="BSVBI22_A0214"
                     /note="pyrophosphate binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238317"
     gene            complement(224959..225729)
                     /gene="thiG"
                     /locus_tag="BSVBI22_A0215"
                     /db_xref="GeneID:11727687"
     CDS             complement(224959..225729)
                     /gene="thiG"
                     /locus_tag="BSVBI22_A0215"
                     /note="functions in thiamine (vitamin B1) biosynthesis; in
                     Bacillus subtilis this enzyme catalyzes the formation of
                     thiazole from dehydroxyglycine and
                     1-deoxy-D-xylulose-5-phosphate and ThiS-thiocarboxylate"
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="YP_005153916.1"
                     /db_xref="GI:376279910"
                     /db_xref="GeneID:11727687"
                     /translation="MLEFYGKRFESRLLLGTAQYPSPSILADAVRASLSRIVTVSLRR
                     ESGEARAGQDFWALIKALGVAVLPNTAGCHTPREAITTAHMAREVFGTNWIKLEVIGD
                     TDTLQPDPFGLVEAARILCDESFEVFPYMNDDLIVAERLIEAGCKVLMPWGAPIGSGR
                     GLNNPYALKTMRAHFPDIPLVVDAGIGVPSHAAAAMELGFDAVLINTAVAKAGDPAAM
                     ARAFALAVEAGRLAYEADPIEARDMASPSTPLLGKAFL"
     misc_feature    complement(224980..225726)
                     /gene="thiG"
                     /locus_tag="BSVBI22_A0215"
                     /note="Thiazole synthase (ThiG) is the tetrameric enzyme
                     that is involved in the formation of the thiazole moiety
                     of thiamin pyrophosphate, an essential ubiquitous cofactor
                     that plays an important role in carbohydrate and amino
                     acid metabolism. ThiG catalyzes...; Region: ThiG; cd04728"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(225559..225561,225568..225570,
                     225607..225609))
                     /gene="thiG"
                     /locus_tag="BSVBI22_A0215"
                     /note="ThiS interaction site; other site"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(225181..225183,225436..225438,
                     225442..225444))
                     /gene="thiG"
                     /locus_tag="BSVBI22_A0215"
                     /note="putative active site [active]"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(224983..224985,224989..224997,
                     225001..225003,225007..225012,225016..225030,
                     225034..225039,225046..225048,225067..225069,
                     225076..225081,225088..225096,225109..225111,
                     225136..225141,225148..225150,225160..225168,
                     225211..225213,225223..225225,225241..225243,
                     225250..225258,225310..225315,225322..225330,
                     225334..225336,225403..225411,225418..225420,
                     225427..225429))
                     /gene="thiG"
                     /locus_tag="BSVBI22_A0215"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240079"
     gene            complement(225731..225928)
                     /locus_tag="BSVBI22_A0216"
                     /db_xref="GeneID:11727688"
     CDS             complement(225731..225928)
                     /locus_tag="BSVBI22_A0216"
                     /note="identified by similarity to SP:O32583; match to
                     protein family HMM PF02597; match to protein family HMM
                     TIGR01683"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiS"
                     /protein_id="YP_005153917.1"
                     /db_xref="GI:376279911"
                     /db_xref="GeneID:11727688"
                     /translation="MTIVLNGEAHETASVTLAALLNEIEFDEAVVATALNGEFIPANA
                     REDTHISEGDRIEVLAPMQGG"
     misc_feature    complement(225734..225925)
                     /locus_tag="BSVBI22_A0216"
                     /note="ThiaminS ubiquitin-like sulfur carrier protein;
                     Region: ThiS; cd00565"
                     /db_xref="CDD:176353"
     misc_feature    complement(order(225752..225760,225812..225814))
                     /locus_tag="BSVBI22_A0216"
                     /note="thiS-thiF/thiG interaction site; other site"
                     /db_xref="CDD:176353"
     gene            complement(225925..226929)
                     /locus_tag="BSVBI22_A0217"
                     /db_xref="GeneID:11727689"
     CDS             complement(225925..226929)
                     /locus_tag="BSVBI22_A0217"
                     /note="identified by match to protein family HMM PF01266"
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid oxidase family protein"
                     /protein_id="YP_005153918.1"
                     /db_xref="GI:376279912"
                     /db_xref="GeneID:11727689"
                     /translation="MRVTIIGAGVAGLATAAEFTDQGHAVTVIAKSAEIGSDSCSWFA
                     GGMLAPWCEGESAEEPVVRLGQDAIGWWERHVSTVRRKGTLVLSHTRDMSELRRFARR
                     TEEHETIDQNYLDTLEPDLAGRFRQGLFFADEGHLDPRRTLIELAERLRQQGVVFHLG
                     VDAKDISVDADITVDARGLAARDSLQDLRGVKGEMLIVRSRDINLSRPVRLLHPRIPL
                     YIVPRGDGIHMIGATMIESDDRRGISVRSTLELLSAAYALHPAFGEAEILEVGVDARP
                     AFADNLPRVRRRGDTVYVNGLYRHGFLLSPAVARMAVAVATNAQAEAETMTDFVEDYA
                     "
     misc_feature    complement(226012..226929)
                     /locus_tag="BSVBI22_A0217"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     misc_feature    complement(<226843..226929)
                     /locus_tag="BSVBI22_A0217"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; cl19126"
                     /db_xref="CDD:267479"
     misc_feature    complement(226012..226878)
                     /locus_tag="BSVBI22_A0217"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(226929..227804)
                     /gene="thiD"
                     /locus_tag="BSVBI22_A0218"
                     /db_xref="GeneID:11727690"
     CDS             complement(226929..227804)
                     /gene="thiD"
                     /locus_tag="BSVBI22_A0218"
                     /note="identified by match to protein family HMM
                     TIGR00097"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine kinase"
                     /protein_id="YP_005153919.1"
                     /db_xref="GI:376279913"
                     /db_xref="GeneID:11727690"
                     /translation="MDQKQSFSPTNPTDNHAASVPICVTIAGSDSSGGAGIQADLKAF
                     SALGVYGASVIAAITVQNTRTVSAVHDVPPQIVAGQIDAVFSDLDVAAVKIGMVSVPE
                     TIEAIAHGLAHFSGPIVLDPVTVAKSGDRLLSETAISSLRKKLLPLATLLTPNRPEAA
                     CLLDTGTAGSDAEAEEQGRALLDLGAKAVLMKGGHAEGAICTDLLIRRDRPTLRIEAP
                     RILTNNTHGTGCTLSSAIAAGLSRNLSLETALAQAHAYLQGAIRAADSLKVGQGHGPV
                     HHFHALWKQAEREAI"
     misc_feature    complement(227013..227741)
                     /gene="thiD"
                     /locus_tag="BSVBI22_A0218"
                     /note="4-amino-5-hydroxymethyl-2-methyl-pyrimidine
                     phosphate kinase (HMPP-kinase) catalyzes two consecutive
                     phosphorylation steps in the thiamine phosphate
                     biosynthesis pathway, leading to the synthesis of vitamin
                     B1. The first step is the phosphorylation of...; Region:
                     HMPP_kinase; cd01169"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(227553..227558,227568..227570,
                     227577..227579,227586..227591,227595..227597,
                     227601..227606,227619..227633,227640..227642,
                     227646..227663,227670..227672,227679..227684,
                     227691..227693,227703..227705,227709..227714,
                     227718..227720,227739..227741))
                     /gene="thiD"
                     /locus_tag="BSVBI22_A0218"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(227115..227117,227514..227516,
                     227622..227624,227685..227687,227721..227723))
                     /gene="thiD"
                     /locus_tag="BSVBI22_A0218"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(227118..227120,227124..227126,
                     227229..227231,227331..227333,227442..227444))
                     /gene="thiD"
                     /locus_tag="BSVBI22_A0218"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238574"
     gene            228233..230344
                     /locus_tag="BSVBI22_A0219"
                     /db_xref="GeneID:11727691"
     CDS             228233..230344
                     /locus_tag="BSVBI22_A0219"
                     /note="identified by match to protein family HMM PF00563;
                     match to protein family HMM PF00785; match to protein
                     family HMM PF00989; match to protein family HMM PF00990;
                     match to protein family HMM TIGR00229; match to protein
                     family HMM TIGR00254"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory box protein"
                     /protein_id="YP_005153920.1"
                     /db_xref="GI:376279914"
                     /db_xref="GeneID:11727691"
                     /translation="MRKRKGAPAEGTMACTSEQDFRILFTTHPTPMWVYDPETLRFIV
                     MNDAAYELYGYTADEIPGMTVLDIRPQSERDRMLSAIRDRSDLERPERWQHLRANGEI
                     IDVLTYGRQVVFDGREAILAIVQDRTELAEANRQASHAQTLLDSLVTNLPVGVFVKDM
                     HDDGRYVLYNQAASTASGQPIDEAIGSIDFDIFPEREAAVFAQHDRMVMRRREVLSVE
                     RKVERKDGTSRTMRIIKSSIPPVEGNEPRYLIGFVEDITERREIEKRMVHIAMHDSLT
                     GLPNRAYFPHHVGSLLKKGSDCDPFALFYLDIDHFKNVNDSISHQAGDQLLQEVALRL
                     RQITTADQFIARLGGDEFAIVYRSGTLAQIAMFADRVLSAFQDPFVLGGNAEFVTCSM
                     GIAQAPLHGDNPDVLMRNADLALYASKSGGRRTFRFYQDSLRLAAEKRHVMTSDLRQA
                     LAAGQFQLHYQPIFNLEGGHISGFEALIRWNHPEHGMIPPLEFISVAEETGLIGPIGD
                     WVLQEACREAARWPEDIKVSVNLSPVQFDQSTLLQSVTDALGAAHLAPERLELEITET
                     VFLSNSKHNIELLFDLRRLGVRIAMDDFGTGYSSLSYLRAFPFDKIKIDRSFVSGIEV
                     DTRDLAIIQAVATLGAGFNIVTTAEGVETAQQLERLKNERFGEVQGYFTGRPMRAGDV
                     HAFIRNSGGLGMARPHNTLAI"
     misc_feature    228317..228610
                     /locus_tag="BSVBI22_A0219"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    228344..229021
                     /locus_tag="BSVBI22_A0219"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    order(228365..228367,228377..228379,228395..228397,
                     228434..228445,228515..228517,228530..228532)
                     /locus_tag="BSVBI22_A0219"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(228425..228427,228437..228439,228461..228463,
                     228470..228475,228551..228553,228557..228559)
                     /locus_tag="BSVBI22_A0219"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    228683..229000
                     /locus_tag="BSVBI22_A0219"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(228737..228739,228749..228751,228767..228769,
                     228806..228811,228812..228814,228893..228895,
                     228908..228910)
                     /locus_tag="BSVBI22_A0219"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(228797..228799,228809..228811,228830..228832,
                     228839..228844,228929..228931,228944..228946)
                     /locus_tag="BSVBI22_A0219"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    229043..229513
                     /locus_tag="BSVBI22_A0219"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(229151..229153,229280..229282)
                     /locus_tag="BSVBI22_A0219"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(229166..229168,229175..229180,229190..229192,
                     229202..229204,229268..229270,229274..229285)
                     /locus_tag="BSVBI22_A0219"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(229256..229258,229340..229342)
                     /locus_tag="BSVBI22_A0219"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    229565..230275
                     /locus_tag="BSVBI22_A0219"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            230443..232923
                     /locus_tag="BSVBI22_A0220"
                     /db_xref="GeneID:11727692"
     CDS             230443..232923
                     /locus_tag="BSVBI22_A0220"
                     /note="identified by match to protein family HMM PF00122;
                     match to protein family HMM PF00403; match to protein
                     family HMM PF00702; match to protein family HMM TIGR00003;
                     match to protein family HMM TIGR01494; match to protein
                     family HMM TIGR01511; match to protein family HMM
                     TIGR01525"
                     /codon_start=1
                     /transl_table=11
                     /product="copper-translocating P-type ATPase"
                     /protein_id="YP_005153921.1"
                     /db_xref="GI:376279915"
                     /db_xref="GeneID:11727692"
                     /translation="MNKTVKPEAVSFPVPVEGMSCASCVSSVEKAVSRVPGVDKVSVN
                     LATERADVTFKGTPDLPAVIEAIRKAGYDVPAGSVDLAIEGMSCASCVSKVEKALSGV
                     PGVTRASVNLATERAHVELAGQVALSELIKAVEKAGYEAHALDEARSDARAEAQSEKR
                     DAEAAELKKSVILAAILTLPVFILEMGSHLIPAVHMFVMDRIGMQNSWYLQFVLTTLV
                     LFGPGLRFFKKGVPTLLRGTPDMNSLVVVGTFAAWGFSVVATFLPGALPEGTVNVYFE
                     AAAMIVTLILIGRYLEARAKGRTSAAISRLVGLQAKSARVVRDGQAIDVPLEDVRAGD
                     IVQVRPGEKVPVDGEVIEGASYVDESMITGEPVPVAKEKGAAVVGGTINKTGAFTFRA
                     TKVGHDMVISQIIRMVQDAQADKLPIQAMVDKVTGWFVPAVMAAAAITFVLWLAIGGT
                     AMMGYALVNAIAVVIIACPCAMGLATPTSIMVGTGRAAEFGVLFRRGDALQTLRDASV
                     IAVDKTGTLTEGKPALAHFDTVEGFDKDELLALVAAVEARSEHPIADAIVAAAQEKGL
                     KLAEVSAFEAVPGFGLKASVGGREVAIGADRYTAKLGADVAVFAEDAKRFGDEGQSPL
                     YAAVDGRLAAILTVADPMKETTPAAIAALHAQGLKVAMITGDNRRTAQAIARKLGIDE
                     VVAEVLPDGKVAALKRLSAGGKRIAFVGDGINDAPALAAADVGLAIGTGTDIAIESAD
                     VVLMSGDLRGVVNAIAISKATIRNIGENLFWAFAYNVALIPVAGGILYPFTGTLLSPV
                     LAAGAMALSSIFVLSNALRLRRLRLAVQ"
     misc_feature    230482..230664
                     /locus_tag="BSVBI22_A0220"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(230497..230505,230512..230514)
                     /locus_tag="BSVBI22_A0220"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    230674..232887
                     /locus_tag="BSVBI22_A0220"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: ZntA; COG2217"
                     /db_xref="CDD:225127"
     misc_feature    230680..230868
                     /locus_tag="BSVBI22_A0220"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(230698..230706,230713..230715)
                     /locus_tag="BSVBI22_A0220"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    231280..231948
                     /locus_tag="BSVBI22_A0220"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    <232378..232626
                     /locus_tag="BSVBI22_A0220"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    232432..232434
                     /locus_tag="BSVBI22_A0220"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(232903..233352)
                     /locus_tag="BSVBI22_A0221"
                     /db_xref="GeneID:11727693"
     CDS             complement(232903..233352)
                     /locus_tag="BSVBI22_A0221"
                     /note="identified by match to protein family HMM PF00376"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_005153922.1"
                     /db_xref="GI:376279916"
                     /db_xref="GeneID:11727693"
                     /translation="MNIGQAAAASGISAKMIRHYETIGLIEAADRTSSGYRIYTQKDV
                     ETLRFIRRSRDLGFQVEQIKELLALWRDRNRASADVKKVALGHIEELEAKMRQLQEMA
                     DTLRYLARNCHGDNRPDCPIIHQLAEPGPEARKPPQPRKGELLHGKT"
     misc_feature    complement(232972..233352)
                     /locus_tag="BSVBI22_A0221"
                     /note="Cu(I)-responsive transcriptional regulator; Region:
                     CueR; TIGR02044"
                     /db_xref="CDD:131099"
     misc_feature    complement(232972..233352)
                     /locus_tag="BSVBI22_A0221"
                     /note="Helix-Turn-Helix DNA binding domain of CueR-like
                     transcription regulators; Region: HTH_CueR; cd01108"
                     /db_xref="CDD:133383"
     misc_feature    complement(order(233242..233250,233299..233301,
                     233341..233349))
                     /locus_tag="BSVBI22_A0221"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133383"
     misc_feature    complement(order(232975..232980,232987..232989,
                     232993..232995,232999..233013,233026..233028,
                     233047..233052,233059..233061,233071..233073,
                     233089..233091,233101..233103,233110..233112,
                     233119..233124,233143..233145,233155..233157,
                     233182..233187,233197..233199,233206..233208))
                     /locus_tag="BSVBI22_A0221"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133383"
     misc_feature    complement(order(232993..232995,233017..233019,
                     233122..233124))
                     /locus_tag="BSVBI22_A0221"
                     /note="copper binding site [ion binding]; other site"
                     /db_xref="CDD:133383"
     gene            complement(233458..234204)
                     /locus_tag="BSVBI22_A0222"
                     /db_xref="GeneID:11727694"
     CDS             complement(233458..234204)
                     /locus_tag="BSVBI22_A0222"
                     /note="identified by match to protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005153923.1"
                     /db_xref="GI:376279917"
                     /db_xref="GeneID:11727694"
                     /translation="MKLFLSLFPRMVLVAVLLLFLLHPHLFEPVFRPFVDAGTPVIYD
                     RANLMTLTLQHLGLVALATFCSTLIAVTMAIFVTRRQGAEFLPLSRSLVNIGQTFPPV
                     AVLALAVPVFGFGDKPTLIALFLYGLLPIFENTLTGLTSLPPPIVEAARGMGMTGMQR
                     LFKVEMPLAMPVILAGIRLSAVIGLATATIGSTVAAKTLGEVIIAGLISNNLAFVLEG
                     GLVVAALAILIFDAFQAAEHYLMKRTGRTA"
     misc_feature    complement(233506..234048)
                     /locus_tag="BSVBI22_A0222"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(233506..233511,233518..233523,
                     233530..233535,233539..233544,233551..233556,
                     233584..233589,233626..233631,233638..233649,
                     233668..233670,233677..233682,233722..233724,
                     233773..233775,233782..233787,233797..233799,
                     233803..233808,233815..233817,233821..233823,
                     233827..233832,233878..233880,233884..233889,
                     233896..233925,233929..233937,233941..233943,
                     233971..233973,233986..233991,233998..234003))
                     /locus_tag="BSVBI22_A0222"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(233632..233649,233878..233922))
                     /locus_tag="BSVBI22_A0222"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(233554..233556,233584..233586,
                     233593..233595,233629..233631,233845..233847,
                     233878..233880))
                     /locus_tag="BSVBI22_A0222"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(233701..233703,233713..233718,
                     233734..233772))
                     /locus_tag="BSVBI22_A0222"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(234201..235139)
                     /locus_tag="BSVBI22_A0223"
                     /db_xref="GeneID:11727695"
     CDS             complement(234201..235139)
                     /locus_tag="BSVBI22_A0223"
                     /note="identified by match to protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_005153924.1"
                     /db_xref="GI:376279918"
                     /db_xref="GeneID:11727695"
                     /translation="MIEFDRITKNYNGRAAVDEVSFTIEPHSIAAIVGTSGSGKTTLL
                     RMVNRLEEPTSGEIRIDGQSILDEPGHELRRRIGYVIQQHGLFPHRTVGENIATVPAL
                     LGWPKQRIEARVDELLELFQLEPGAYRDRYPHELSGGQQQRVGVARALAAGPNILLMD
                     EPFGALDPVIRAKAQEDLKAIQRRFGTTILLVTHDMEEAISLGDRIAVMDEGKLLQFG
                     PPAEILARPATEFVERLVGTGERPFRLLSLTDLKTVLQPGDASGEPLPVTASQRDALA
                     ELLWSGRRALPVLDEDGRSLGRVTLEKLLHQAERPA"
     misc_feature    complement(234216..235139)
                     /locus_tag="BSVBI22_A0223"
                     /note="ABC-type proline/glycine betaine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: OpuBA; COG1125"
                     /db_xref="CDD:224050"
     misc_feature    complement(234420..235136)
                     /locus_tag="BSVBI22_A0223"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(235017..235040)
                     /locus_tag="BSVBI22_A0223"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(234558..234560,234657..234662,
                     234894..234896,235014..235022,235026..235031))
                     /locus_tag="BSVBI22_A0223"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(234894..234905)
                     /locus_tag="BSVBI22_A0223"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(234705..234734)
                     /locus_tag="BSVBI22_A0223"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(234657..234674)
                     /locus_tag="BSVBI22_A0223"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(234639..234650)
                     /locus_tag="BSVBI22_A0223"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(234552..234572)
                     /locus_tag="BSVBI22_A0223"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(234240..>234407)
                     /locus_tag="BSVBI22_A0223"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair; cl15354"
                     /db_xref="CDD:265675"
     gene            complement(235136..236296)
                     /locus_tag="BSVBI22_A0224"
                     /db_xref="GeneID:11727696"
     CDS             complement(235136..236296)
                     /locus_tag="BSVBI22_A0224"
                     /note="identified by similarity to SP:P33361; match to
                     protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005153925.1"
                     /db_xref="GI:376279919"
                     /db_xref="GeneID:11727696"
                     /translation="MGHIAGRIDKLGLVISVLGVGGLLLPFATFRANRIVQGEPRFLF
                     DALPGAIAGLFVLIIGASLLVALLSQHRLLRLGASLISLAVLLVTIGLAATHLAPEGN
                     NYARISPASGFWLLLFALALYAADGLVRLKVRPLPRIALLVVATGLLALLLSSGLWDD
                     ISFMKEYHSRAASFWIEARRHIALALGSLLAAAIAGIPLGLICHRLPRLRASVLNSLN
                     IVQTIPSMALFGILIAPLSWFAAQFPWAASLGIRGIGAAPAFVALFLYSLLPIVANTV
                     AGLAQVPEPVTDAARGMGMTRLQRLFRTEFPLAFPVILTGIRIVMVQNIGLTTIAALI
                     GGGGFGIFVFQGIGQTAMDLVLLGALPTVLLAFAAAVILDAAIEIADRGKPA"
     misc_feature    complement(235178..235711)
                     /locus_tag="BSVBI22_A0224"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(235178..235180,235187..235192,
                     235196..235201,235208..235213,235241..235246,
                     235298..235303,235310..235321,235340..235342,
                     235349..235354,235394..235396,235445..235447,
                     235454..235459,235469..235471,235475..235480,
                     235487..235489,235493..235495,235499..235504,
                     235598..235600,235604..235609,235616..235645,
                     235646..235657,235685..235687,235700..235705))
                     /locus_tag="BSVBI22_A0224"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(235304..235321,235598..235642))
                     /locus_tag="BSVBI22_A0224"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(235211..235213,235241..235243,
                     235250..235252,235301..235303,235517..235519,
                     235598..235600))
                     /locus_tag="BSVBI22_A0224"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(235373..235375,235385..235390,
                     235406..235444))
                     /locus_tag="BSVBI22_A0224"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(236369..237283)
                     /locus_tag="BSVBI22_A0225"
                     /db_xref="GeneID:11727697"
     CDS             complement(236369..237283)
                     /locus_tag="BSVBI22_A0225"
                     /note="identified by similarity to GP:17983752; match to
                     protein family HMM PF04069"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter periplasmic substrate-binding
                     protein"
                     /protein_id="YP_005153926.1"
                     /db_xref="GI:376279920"
                     /db_xref="GeneID:11727697"
                     /translation="MLKGSAFALALFVGAIQFSSLAEAQVAVSSKIDTEGGVLGNIIL
                     TVLNANGIKTTDRIQLGATPVVRKAITAGEIDIYPEYTGNAAFFFNKADDPLWKDPAK
                     AYETAKKLDYDANKIVWLTPSPANNTWGIAVRKDVANENKLASLSDFGKYIAGGGKVV
                     LAASSEFVNSAAALPAFQTAYGFTLKPDQLITLSGGDTAATIAAAANQTNGANAAMVY
                     GTDGGIAPSGLVVLEDDKHVQPVYQPAPIIREEVLKKDPKIEELLKPVFEKLDLTTLQ
                     DLNGRVQLGGEPAKAVAEDFLKKNGFLK"
     misc_feature    complement(236384..237283)
                     /locus_tag="BSVBI22_A0225"
                     /note="Periplasmic glycine betaine/choline-binding
                     (lipo)protein of an ABC-type transport system
                     (osmoprotectant binding protein) [Cell envelope
                     biogenesis, outer membrane]; Region: OpuBC; COG1732"
                     /db_xref="CDD:224646"
     gene            complement(237469..238134)
                     /locus_tag="BSVBI22_A0226"
                     /db_xref="GeneID:11727698"
     CDS             complement(237469..238134)
                     /locus_tag="BSVBI22_A0226"
                     /note="identified by similarity to OMNI:NTL02ML0782"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153927.1"
                     /db_xref="GI:376279921"
                     /db_xref="GeneID:11727698"
                     /translation="MRAETMKKFIIASLVGISAALPLPTHAETNKAPENSTIINGMDF
                     GPLAKLVGTWKKVEPGGTDVAPGKEGPNVGKGGTAVEPYYEVLTFEPAADATNASDQY
                     LVAMYYKHEVFRVRDNGKFHDQRGYLIYDKKNNTVYNTFCIPRAVCVVAEGPAGETMS
                     LETKENGIAESSYMAKNDKTMKFSFEIDLSGDQLQYTQVTSLQVYGQPFEHVDTSTLE
                     KVK"
     misc_feature    complement(237472..238119)
                     /locus_tag="BSVBI22_A0226"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5514"
                     /db_xref="CDD:227801"
     misc_feature    complement(order(237496..237501,237529..237531,
                     237535..237537,237541..237543,237586..237588,
                     237592..237594,237706..237708,237769..237774,
                     237799..237801,237886..237888,237892..237894,
                     237931..237936))
                     /locus_tag="BSVBI22_A0226"
                     /note="heme-binding site [chemical binding]; other site"
                     /db_xref="CDD:143652"
     gene            complement(238424..239689)
                     /locus_tag="BSVBI22_A0227"
                     /db_xref="GeneID:11727699"
     CDS             complement(238424..239689)
                     /locus_tag="BSVBI22_A0227"
                     /note="identified by similarity to EGAD:22862; match to
                     protein family HMM PF00208; match to protein family HMM
                     PF02812"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="YP_005153928.1"
                     /db_xref="GI:376279922"
                     /db_xref="GeneID:11727699"
                     /translation="MTTENLLESALVRLDEAASHINIDADVIEKLKFARETMKVRLMI
                     RMDDGSRKSFIAWRCRYDDTRGPTKGGIRYHPDSTVEEVETLAFWMTFKCAVMNLPYG
                     GGKGAIQVDPRQLSKAELERLSRAYIQAFSGIIGPDRDIPAPDVYTNSMIMGWMADEY
                     SQIVGQSSPAVITGKPIALGGSLGRNDATARGGFYLVRHLSHDLGLASVLRVAIQGFG
                     NAGQFMAKLMAGDGHKIVAVSDSAGAVYCADGLDVDLLLAAKADGKSVISTAGHKGHE
                     AISADELVAADCDVLVPSAMENMIHASNAASIRAKLIVELANGPVTGDADKILAEKGV
                     MVLPDILANAGGVTVSYFEWVQNRQGYYWTLEEIHERLKTIMEREGRAIWNHARERGV
                     TLRTAAYVHALERLAQAIEAHGTQNDFAA"
     misc_feature    complement(238448..239680)
                     /locus_tag="BSVBI22_A0227"
                     /note="Glutamate dehydrogenase/leucine dehydrogenase
                     [Amino acid transport and metabolism]; Region: GdhA;
                     COG0334"
                     /db_xref="CDD:223411"
     misc_feature    complement(239198..239581)
                     /locus_tag="BSVBI22_A0227"
                     /note="Glu/Leu/Phe/Val dehydrogenase, dimerization domain;
                     Region: ELFV_dehydrog_N; pfam02812"
                     /db_xref="CDD:251546"
     misc_feature    complement(238466..239152)
                     /locus_tag="BSVBI22_A0227"
                     /note="NAD(P) binding domain of glutamate dehydrogenase,
                     subgroup 1; Region: NAD_bind_1_Glu_DH; cd01076"
                     /db_xref="CDD:133445"
     misc_feature    complement(order(238736..238744,238802..238807,
                     238967..238972,239030..239038))
                     /locus_tag="BSVBI22_A0227"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133445"
     gene            239880..240047
                     /locus_tag="BSVBI22_A0228"
                     /db_xref="GeneID:11727700"
     CDS             239880..240047
                     /locus_tag="BSVBI22_A0228"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153929.1"
                     /db_xref="GI:376279923"
                     /db_xref="GeneID:11727700"
                     /translation="MVRMSYLWRLVTQACCRLLAGAHKISSKASRVPQWCAGQVKMVV
                     VHVPLFFSFSR"
     gene            240016..241269
                     /gene="soxB"
                     /locus_tag="BSVBI22_A0229"
                     /db_xref="GeneID:11727701"
     CDS             240016..241269
                     /gene="soxB"
                     /locus_tag="BSVBI22_A0229"
                     /note="identified by similarity to SP:P40875; match to
                     protein family HMM PF01266; match to protein family HMM
                     TIGR01373"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase, beta subunit"
                     /protein_id="YP_005153930.1"
                     /db_xref="GI:376279924"
                     /db_xref="GeneID:11727701"
                     /translation="MSRFSLASVVKNALSGNRNWEPQWPDAQPRAEYDVIIVGAGGHG
                     LGAAYYLAKEHGITNVAVIEKGWLGGGNTGRNTTIIRSNYLYDESAHLYEHAMKLWEG
                     LSQDLNYNVMFSQRGVMMLAHTVHDVQSFKRHIHANRLNGIDNEWLTKEQAKEYCPPL
                     DISPNARYPVIGATLQRRGGVARHDAVAWGYARGASQRGVDIIQNCPVLAIRRDASGR
                     VSGVETARGFIKAKKVAVSAAGNTSVVMDTASVRMPLESFPLQALVSEPVKPIFPCVV
                     MSNTVHAYISQSDKGELVIGSGTDQYVSYSQRGGLPLIEHTLAAICEVFPIFTRMRML
                     RKWGGIVDVTPDRSPIIGKTPVPGLYVNCGWGTGGFKATPGSAHVFAHTIARDEPHWI
                     NAPFTLERFTTGRLIDEAAAAAVAH"
     misc_feature    240022..241242
                     /gene="soxB"
                     /locus_tag="BSVBI22_A0229"
                     /note="sarcosine oxidase, beta subunit family,
                     heterotetrameric form; Region: soxB; TIGR01373"
                     /db_xref="CDD:233383"
     misc_feature    240160..241167
                     /gene="soxB"
                     /locus_tag="BSVBI22_A0229"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            241288..241593
                     /gene="soxD"
                     /locus_tag="BSVBI22_A0230"
                     /db_xref="GeneID:11727702"
     CDS             241288..241593
                     /gene="soxD"
                     /locus_tag="BSVBI22_A0230"
                     /note="identified by similarity to EGAD:43131; match to
                     protein family HMM PF04267; match to protein family HMM
                     TIGR01374"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit delta"
                     /protein_id="YP_005153931.1"
                     /db_xref="GI:376279925"
                     /db_xref="GeneID:11727702"
                     /translation="MLLIRCPYCEMERPELEFAYAGEAHIARPADPSTLSDEEWRDFL
                     FTRSNPRGTHYERWRHIHGCGRFFNAVRDTVSDKFVVTYKAGKPRPVLEQTPAAETK"
     misc_feature    241288..241581
                     /gene="soxD"
                     /locus_tag="BSVBI22_A0230"
                     /note="Sarcosine oxidase delta subunit [Amino acid
                     transport and metabolism]; Region: SoxD; COG4311"
                     /db_xref="CDD:226761"
     gene            241593..244592
                     /gene="soxA"
                     /locus_tag="BSVBI22_A0231"
                     /db_xref="GeneID:11727703"
     CDS             241593..244592
                     /gene="soxA"
                     /locus_tag="BSVBI22_A0231"
                     /note="identified by similarity to EGAD:43132; match to
                     protein family HMM PF01571; match to protein family HMM
                     TIGR01372"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase, alpha subunit"
                     /protein_id="YP_005153932.1"
                     /db_xref="GI:376279926"
                     /db_xref="GeneID:11727703"
                     /translation="MTDMRIQNKGRVNKAKSVRFTFNGKTYSGFEGDTLASALLANGE
                     HLTGRSFKYHRPRGILSAGSEEPNALMGVSRGAGRFEPNTRATALELYDGLKAESQNH
                     WPSLKHDVGAINDAFSMFFSAGFYYKTFMWPKSFWNKVYEPFIRGAAGLGKSPSEPDP
                     DTYASRYAYCDVLVVGAGPAGLAAALEAAKSGAKVMLCDEQAELGGSLLSEPEPVING
                     RASWDWLDETLAALAAMPNVTLLPRTTAIGYYHQNMLGLCQRLTDHLPNPPANAPRER
                     MWRVRAKQVVLAQGAIERPLVFAGNDRPGVMLAGAGRTYLNRYGVKVGHKAVIVTSHD
                     SAWLAAFDLAVAGVKVPAIIDVREHVAGSLVNRAKMLGIETLTGWTVTDTGGRHRVSS
                     VRANPVQGGVAGAPRTIECDVVLMCGGWTPSVHLFSHTKGQLVWDEERQIYLPGARTE
                     ESRCAGAGNGHFDLEAALREGAQSGAGVASDAGYKASAREYAVAGDFICNGISCRELP
                     TDRDPGKAKAFIDFQNDVTAKDIRLAVREGFRSIEHVKRYTTNGMATDQGKTSNINGL
                     AVASDALKRPAPQVGLTTFRPPYTPTTFGAFCGYNRGKLFEVTRKTPIDAWAEQHGAA
                     FEPVSLWRRAWYFPKPGEDMHQAVARECRATRQSLGMFDASTLGKIEVVGPDAAEFMN
                     RMYTNPWTKLGVGRCRYGLLLGEDGFIRDDGVVGRLTQDRFHVTTTTGGAARVLNMME
                     DYLQTEWPQLKVALTSTTEQWAVVAINGPNARKLIEPMVEGLDISDEAFPHMSVAECT
                     FLGVPARLFRMSFTGELGFEINVPSRYGLALWKALYEAGQQYDITPYGTETMHILRAE
                     KGYIIVGQDTDGTVTPDDASLGWAIGKQKPDFVGKRSLSRPDMLKKDRKHLVGLLTKD
                     PKLVLEEGAQIVADPKQAVPMTMLGHVTSSYWSETLGRSIAMALVSGGKDRMGETIYM
                     PMPDGSVHEAIISGTVFYDPEGKKLNA"
     misc_feature    241620..244589
                     /gene="soxA"
                     /locus_tag="BSVBI22_A0231"
                     /note="sarcosine oxidase, alpha subunit family,
                     heterotetrameric form; Region: soxA; TIGR01372"
                     /db_xref="CDD:233382"
     misc_feature    241635..241898
                     /gene="soxA"
                     /locus_tag="BSVBI22_A0231"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_4; pfam13510"
                     /db_xref="CDD:257830"
     misc_feature    243573..244232
                     /gene="soxA"
                     /locus_tag="BSVBI22_A0231"
                     /note="Aminomethyltransferase folate-binding domain;
                     Region: GCV_T; pfam01571"
                     /db_xref="CDD:250713"
     misc_feature    244251..244547
                     /gene="soxA"
                     /locus_tag="BSVBI22_A0231"
                     /note="Glycine cleavage T-protein C-terminal barrel
                     domain; Region: GCV_T_C; pfam08669"
                     /db_xref="CDD:254962"
     gene            244603..245157
                     /gene="soxG"
                     /locus_tag="BSVBI22_A0232"
                     /db_xref="GeneID:11727704"
     CDS             244603..245157
                     /gene="soxG"
                     /locus_tag="BSVBI22_A0232"
                     /note="identified by similarity to EGAD:43133; match to
                     protein family HMM PF04268"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase, gamma subunit"
                     /protein_id="YP_005153933.1"
                     /db_xref="GI:376279927"
                     /db_xref="GeneID:11727704"
                     /translation="MLVETNPYSHRRVSIPGRLDVLPAKDGARFILRIAPAKLALAEK
                     TLGAKIPAKIGGLAKTGETAVACIGPDEWYIWAGEGEADAIRQAFARLYESEPHSLVE
                     VSHRETGIDISGPEAEWLLNAASPLNLAEMLAPGAARTVFDHAQVILLKWDADHYRIE
                     VWNSFADHVWTLLETASREVELSI"
     misc_feature    244603..245148
                     /gene="soxG"
                     /locus_tag="BSVBI22_A0232"
                     /note="Sarcosine oxidase gamma subunit [Amino acid
                     transport and metabolism]; Region: COG4583"
                     /db_xref="CDD:226949"
     gene            complement(245210..246058)
                     /locus_tag="BSVBI22_A0233"
                     /db_xref="GeneID:11727705"
     CDS             complement(245210..246058)
                     /locus_tag="BSVBI22_A0233"
                     /note="identified by similarity to OMNI:NTL02ML5639"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153934.1"
                     /db_xref="GI:376279928"
                     /db_xref="GeneID:11727705"
                     /translation="MLIDTHLHLIDKNALSYPWLESAPALNRDFLFDSYRLQAERAGI
                     GGALHIEVDVAPHAMQAETDHIRQIARRSGGFIKGAIASCRPEEPGFAAYLERQLSDP
                     FVKGLRRVLHVVPDEVSEGALFRENIKRLEGTGLTFDLCVQPHQIGKAIALADLAPDL
                     CFIVDHCSAPDIKAGALDGWREGMAEISRRPNVIAKISGLVVYCDAESWTVETLRPYA
                     EQVIQSFGWDRVIWGSDWPVCTLASSPDAGLSTWVAATHALLEGCSTTEKSRLFCENA
                     RRIWNL"
     misc_feature    complement(245213..246058)
                     /locus_tag="BSVBI22_A0233"
                     /note="Predicted metal-dependent hydrolase of the
                     TIM-barrel fold [General function prediction only];
                     Region: COG3618"
                     /db_xref="CDD:226145"
     misc_feature    complement(order(245354..245356,245561..245563,
                     246035..246037,246041..246043))
                     /locus_tag="BSVBI22_A0233"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            complement(246116..246910)
                     /locus_tag="BSVBI22_A0234"
                     /db_xref="GeneID:11727706"
     CDS             complement(246116..246910)
                     /locus_tag="BSVBI22_A0234"
                     /note="identified by match to protein family HMM PF01614"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_005153935.1"
                     /db_xref="GI:376279929"
                     /db_xref="GeneID:11727706"
                     /translation="MREPTLETDDRYRAPALDKGLDILELLASVDGGLTQAEIAKHLD
                     RSPNEFYRMLDRLVKRGYVTKLDGDRYSLTLKLFGLAQLHAPVRRLASFATPFMRELA
                     DRSKQANQLAVFDRGSVVVIAQQEAPDYWGISIRVGSHISLFDTGSGHVLLAFRSPEE
                     REMMIAAHVKSRDEVNLDQDFYDRLDQIRERGYEMMASAQMAGAYNLSAPILGPDGTC
                     IAALTCPYITLVNPSSAPDITQTISLLQKTVRDLSKLVGADVGVTG"
     misc_feature    complement(246137..246868)
                     /locus_tag="BSVBI22_A0234"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(<246716..246850)
                     /locus_tag="BSVBI22_A0234"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(246716..246718,246734..246739,
                     246743..246748,246755..246760,246764..246775,
                     246800..246808))
                     /locus_tag="BSVBI22_A0234"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(246797..246799,246806..246808))
                     /locus_tag="BSVBI22_A0234"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(<246236..246508)
                     /locus_tag="BSVBI22_A0234"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            247068..248387
                     /locus_tag="BSVBI22_A0235"
                     /db_xref="GeneID:11727707"
     CDS             247068..248387
                     /locus_tag="BSVBI22_A0235"
                     /note="identified by match to protein family HMM PF01547"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter periplasmic sugar-binding
                     protein"
                     /protein_id="YP_005153936.1"
                     /db_xref="GI:376279930"
                     /db_xref="GeneID:11727707"
                     /translation="MQDFKSHVLAGAALLAMGIAPAYAADLPGKFEGVTVNAKLIGGQ
                     QYETLYARIADWEKATGAKVNILSKKNHFELDKEIKSDMASGSINWCVGSNHSSFAPQ
                     YGDLYTDLKPLLPKEEIDAFVPSVIKASMLNGKLVMLPRAQFDVSALYYQKSLYQDEA
                     RKKAFKEKYGYDLAPPKTWKEVSDQAIFFADPPNFYGTQFAGKEEAINGRFYEMLVAE
                     GGEYLDKNGKPAFNSDAGVRALDWFVNLYKAKAVPAGTTNYLWDDLGAGFASGTVALD
                     LDWPGWATYFNDPKSSKVAGNVGIVVQPKGSSGKRTGWSGHHGFSVTEACPTKEAAAS
                     LVWFLTNEDSQKVEAANGTLPTRTKVWEWDIEQAASDPYKKEVLTVFQEAAKNAFPVP
                     STPSWIEISNAVYPELQAAILGDKTSKEALDSAAQKATQILEDAGDL"
     misc_feature    247089..248369
                     /locus_tag="BSVBI22_A0235"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    247218..248153
                     /locus_tag="BSVBI22_A0235"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_8; pfam13416"
                     /db_xref="CDD:257741"
     gene            248448..249371
                     /locus_tag="BSVBI22_A0236"
                     /db_xref="GeneID:11727708"
     CDS             248448..249371
                     /locus_tag="BSVBI22_A0236"
                     /note="identified by match to protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="YP_005153937.1"
                     /db_xref="GI:376279931"
                     /db_xref="GeneID:11727708"
                     /translation="MRRTQYLGWIMFKRLSPPVLLLLPAFIILAAVVLFPLALSLYSS
                     FTPFRLTRPETLFRFIGLRNYERILSDWVFWAAFLRTVVFLTIALNLEMLLGLGLALL
                     VNKATWGKRTLRTLIMFPMMFSPVLVGFQFKFMFNDNIGLVNNALQSLGLTDRAIPWL
                     IDGNLALVAILTAEVWSSTAVFAILILAGLLAMPQDPVEAARVDGCTPWQTFRYVIWP
                     YLMPFAYIAMTIRSLDVARAYDIVKIMTDGGPARRTELIWTLVGRTAYSDAQMGLANA
                     MAYVAILLSILFTVIFFRKLAAARTQIGAEW"
     misc_feature    248478..249353
                     /locus_tag="BSVBI22_A0236"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    248760..249305
                     /locus_tag="BSVBI22_A0236"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(248784..248795,248799..248828,248835..248840,
                     248844..248846,248970..248975,248982..248984,
                     248988..248990,248997..249002,249006..249008,
                     249018..249023,249030..249032,249081..249083,
                     249123..249128,249135..249137,249156..249167,
                     249174..249179,249222..249227,249255..249260,
                     249267..249272,249276..249281,249288..249293,
                     249300..249305)
                     /locus_tag="BSVBI22_A0236"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(248802..248846,249156..249173)
                     /locus_tag="BSVBI22_A0236"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(248844..248846,248955..248957,249174..249176,
                     249216..249218,249225..249227,249255..249257)
                     /locus_tag="BSVBI22_A0236"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(249033..249071,249087..249092,249102..249104)
                     /locus_tag="BSVBI22_A0236"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            249374..250249
                     /locus_tag="BSVBI22_A0237"
                     /db_xref="GeneID:11727709"
     CDS             249374..250249
                     /locus_tag="BSVBI22_A0237"
                     /note="identified by match to protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="YP_005153938.1"
                     /db_xref="GI:376279932"
                     /db_xref="GeneID:11727709"
                     /translation="MAQSLSNAQHRMRRRIARVFYLVGLFLAMLVICLPGFWIVLSSL
                     RPPVEIMAKPPVWIPQDISLDAYRTMFSGAGAGGVPVWDYFRNSIIVSVTSTVVSLII
                     GMSGGYAFARFRFRGKSATFLGFMLTRSVPGIALSLPLFMVYSRIGIIDTHFGLILTY
                     VALNIPFTIWLIDGFFRQVPKDLAEAAQIDGCTRWQAFWQVEFPLAGPGIASAGIFAF
                     LTCWNEYALASQLTRSVNSKTLPVGLLDYTAEFTIDWRGMCALAVVMIVPALALTFVI
                     QKHLVSGLTFGAVKG"
     misc_feature    249404..250243
                     /locus_tag="BSVBI22_A0237"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    249626..250183
                     /locus_tag="BSVBI22_A0237"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(249674..249679,249686..249691,249704..249706,
                     249734..249745,249749..249778,249785..249790,
                     249794..249796,249866..249868,249872..249874,
                     249881..249886,249890..249892,249902..249907,
                     249914..249916,249965..249967,250007..250012,
                     250019..250021,250040..250051,250058..250063,
                     250100..250105,250133..250138,250145..250150,
                     250154..250159,250166..250171,250178..250183)
                     /locus_tag="BSVBI22_A0237"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(249752..249796,250040..250057)
                     /locus_tag="BSVBI22_A0237"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(249794..249796,249854..249856,250058..250060,
                     250094..250096,250103..250105,250133..250135)
                     /locus_tag="BSVBI22_A0237"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(249917..249955,249971..249976,249986..249988)
                     /locus_tag="BSVBI22_A0237"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            250257..251348
                     /locus_tag="BSVBI22_A0238"
                     /db_xref="GeneID:11727710"
     CDS             250257..251348
                     /locus_tag="BSVBI22_A0238"
                     /note="identified by similarity to SP:Q00752; match to
                     protein family HMM PF00005; match to protein family HMM
                     PF03459"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="YP_005153939.1"
                     /db_xref="GI:376279933"
                     /db_xref="GeneID:11727710"
                     /translation="MAQLSIKNLVKRYGSIEVVHGINLEIADKEFVALVGPSGCGKST
                     TLRMIAGLESISGGTLEIGGKVVNDLPPRDRNISMVFQSYALYPHMSVRENMGFSLKI
                     AKQPQAEIDRRVNEAAAVLGLEALMDRRPAQLSGGQRQRVAMGRAIVRNPEVFLFDEP
                     LSNLDAKLRTQMRTEIKKLHAKVQSTVVYVTHDQVEAMTLADRIVIMRDGHIEQAGTP
                     DEVFKRPATQFVAGFIGSPPMNMAEATVKGDELLFANGDRLPLPARFKARVGEGAKVT
                     FGLRPDDIFPKGHGLSTGDGVHEKELRVVITEPLGNETLVFAEFAGREWVARMLNPRP
                     VQPGESIAMQFDLAQAHLFDAATGKSLAV"
     misc_feature    250257..251333
                     /locus_tag="BSVBI22_A0238"
                     /note="glycerol-3-phosphate transporter ATP-binding
                     subunit; Provisional; Region: ugpC; PRK11650"
                     /db_xref="CDD:236947"
     misc_feature    250266..250904
                     /locus_tag="BSVBI22_A0238"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    250362..250385
                     /locus_tag="BSVBI22_A0238"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(250371..250376,250380..250388,250500..250502,
                     250728..250733,250830..250832)
                     /locus_tag="BSVBI22_A0238"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    250491..250502
                     /locus_tag="BSVBI22_A0238"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    250656..250685
                     /locus_tag="BSVBI22_A0238"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    250716..250733
                     /locus_tag="BSVBI22_A0238"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    250740..250751
                     /locus_tag="BSVBI22_A0238"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    250818..250838
                     /locus_tag="BSVBI22_A0238"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    251088..251315
                     /locus_tag="BSVBI22_A0238"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            251351..252469
                     /locus_tag="BSVBI22_A0239"
                     /db_xref="GeneID:11727711"
     CDS             251351..252469
                     /locus_tag="BSVBI22_A0239"
                     /note="identified by match to protein family HMM PF01188;
                     match to protein family HMM PF02746"
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase/muconate lactonizing protein"
                     /protein_id="YP_005153940.1"
                     /db_xref="GI:376279934"
                     /db_xref="GeneID:11727711"
                     /translation="MARIERFELRMVDLPPKAKRTDAIQSFVSQETPIVTITDSDGAV
                     GTGYSYTIGTGGSSVMRLLADHLAPLVIGEDADCIEAIWRRLEFATHATTIGAITALA
                     LAAIDTALWDLRAKKQNLPLWKLAGGARDHCPLYTTEGGWLHIEKEALVEDALQAKAK
                     GFTGSKIKIGKPHGAQDYARLSAVRAAVGAAFEIMTDCNQGFTVDEAIRRAERLKELD
                     LAWIEEPLPADDLDGHMRLARSTATPVAVGESIYSIRHFREYMHKGACSIVQVDVARI
                     GGITPWLKVAHMAEAFDIPVCPHFLMELHVSLVCAVPNGRYVEYIPQLDDLTDKGMEI
                     RDSHAVAPSQPGIGIAWDWDAVRSRSIGEFTREIVRAP"
     misc_feature    251351..252433
                     /locus_tag="BSVBI22_A0239"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    251357..252397
                     /locus_tag="BSVBI22_A0239"
                     /note="Mandelate racemase (MR)-like subfamily of the
                     enolase superfamily. Enzymes of this subgroup share three
                     conserved carboxylate ligands for the essential divalent
                     metal ion (usually Mg2+), two aspartates and a glutamate,
                     and conserved catalytic residues; Region: MR_like;
                     cd03316"
                     /db_xref="CDD:239432"
     misc_feature    order(251846..251848,251852..251854,251939..251941,
                     252017..252019,252095..252097,252164..252166,
                     252245..252247,252305..252307)
                     /locus_tag="BSVBI22_A0239"
                     /note="active site pocket [active]"
                     /db_xref="CDD:239432"
     gene            252466..252810
                     /locus_tag="BSVBI22_A0240"
                     /db_xref="GeneID:11727712"
     CDS             252466..252810
                     /locus_tag="BSVBI22_A0240"
                     /note="identified by similarity to GP:15140572; match to
                     protein family HMM PF05336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153941.1"
                     /db_xref="GI:376279935"
                     /db_xref="GeneID:11727712"
                     /translation="MSKHQGQRMGMVIGLNPEKVAKYKALHAQVWPEILALISECNIT
                     NYSIFLKELENLLFGYWEYVGSDFAADMRKMAESPKNQEWWSVCMPCQKPLETRKEGE
                     WWAMMEEVFHHD"
     misc_feature    252484..252807
                     /locus_tag="BSVBI22_A0240"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3254"
                     /db_xref="CDD:225793"
     gene            252803..253882
                     /locus_tag="BSVBI22_A0241"
                     /db_xref="GeneID:11727713"
     CDS             252803..253882
                     /locus_tag="BSVBI22_A0241"
                     /note="identified by match to protein family HMM PF01408"
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="YP_005153942.1"
                     /db_xref="GI:376279936"
                     /db_xref="GeneID:11727713"
                     /translation="MTDAFDPKALRQWWARPSRPKPIVIFGAGSIVGDAHLPAYEKGG
                     FPVTGIFDPDLEKARKLAEKWGVTAFASMQEALAVEGAVFDLAIPPSAHVSVLSQLPE
                     GAAALIQKPMGSDLAGATEILKVCRARKLKAAVNFQLRFAPMMLALYDAVDKGWLGEV
                     VDFDAWLALATPWGLWPFLKGLPRIEIAMHSIHYLDFVRGLLGNPQGVHAKSIGHPNH
                     DVAQTRTAAILDYGERVRCALSINHDHDFGRKFQACEFRICGTQGAAYVKLGVNLDYP
                     RGEPDELWIRPKGGDDWVCVPLEGAWFPDAFLNRMAHLQRFACREDDELVGSVEDAWH
                     TMALVEAAYRSSAAPATPLAARPEV"
     misc_feature    252854..253855
                     /locus_tag="BSVBI22_A0241"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    252869..253213
                     /locus_tag="BSVBI22_A0241"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     gene            253885..253983
                     /locus_tag="BSVBI22_A0242"
                     /db_xref="GeneID:11727714"
     CDS             253885..253983
                     /locus_tag="BSVBI22_A0242"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153943.1"
                     /db_xref="GI:376279937"
                     /db_xref="GeneID:11727714"
                     /translation="MAEQTLYFENYELGCAQAIYACDHTLLVERRA"
     gene            253987..254721
                     /locus_tag="BSVBI22_A0243"
                     /db_xref="GeneID:11727715"
     CDS             253987..254721
                     /locus_tag="BSVBI22_A0243"
                     /note="identified by match to protein family HMM PF00106"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /protein_id="YP_005153944.1"
                     /db_xref="GI:376279938"
                     /db_xref="GeneID:11727715"
                     /translation="MTIRLDGKTALVTAAGQGIGQASALAFAEAGAKVYATDINADAL
                     AKLEGIAGIVTRRLDVLDDAAVKALVAEIGQIDILFNCAGFVHNGTILEMKDEELDFA
                     VNLNVRSMIRTIRAVLPGMLERKDGAIINMASVASSVKGVSNRFVYGLTKAAVIGLTK
                     AVAADYVGKGIRCNAICPGTVESPSLQDRLRAQGDYEAARAAFIARQPIGRIGQPEEI
                     ADLAVYLAGATYTTGQAYNIDGGWSI"
     misc_feature    253993..254715
                     /locus_tag="BSVBI22_A0243"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    254002..254718
                     /locus_tag="BSVBI22_A0243"
                     /note="human DHRS6-like, classical (c) SDRs; Region:
                     DHRS6_like_SDR_c; cd05368"
                     /db_xref="CDD:187626"
     misc_feature    order(254026..254028,254032..254043,254098..254106,
                     254158..254166,254230..254238,254299..254301,
                     254380..254385,254428..254430,254440..254442,
                     254518..254529,254533..254541,254551..254553)
                     /locus_tag="BSVBI22_A0243"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187626"
     misc_feature    order(254173..254175,254254..254262,254266..254274,
                     254281..254286,254293..254295,254305..254310,
                     254317..254319,254326..254331,254338..254343,
                     254350..254352,254395..254397,254401..254409,
                     254413..254418,254422..254424,254431..254436,
                     254443..254448,254452..254460,254464..254469,
                     254473..254487,254524..254526,254608..254613,
                     254617..254625,254635..254637,254647..254649,
                     254656..254658,254674..254682,254686..254688,
                     254695..254709,254716..254718)
                     /locus_tag="BSVBI22_A0243"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187626"
     misc_feature    order(254173..254175,254254..254262,254266..254274,
                     254281..254286,254293..254295,254305..254310,
                     254317..254319,254326..254331,254338..254343,
                     254350..254352,254395..254397,254401..254403,
                     254407..254409,254413..254418,254422..254424,
                     254431..254436,254443..254448,254452..254460,
                     254464..254469,254476..254484)
                     /locus_tag="BSVBI22_A0243"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187626"
     misc_feature    order(254302..254304,254386..254388,254428..254430,
                     254440..254442)
                     /locus_tag="BSVBI22_A0243"
                     /note="active site"
                     /db_xref="CDD:187626"
     gene            254762..255607
                     /locus_tag="BSVBI22_A0244"
                     /db_xref="GeneID:11727716"
     CDS             254762..255607
                     /locus_tag="BSVBI22_A0244"
                     /note="identified by similarity to GP:15140576; match to
                     protein family HMM PF01557"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="YP_005153945.1"
                     /db_xref="GI:376279939"
                     /db_xref="GeneID:11727716"
                     /translation="MKFLRYGAAGQEKPGLLDADGTIRDLSAHVSDLSGAALDPDALA
                     KLGALDVNSLPKVEGNPRIGPCVAGTGKFICIGLNYSDHAAETGAAVPSEPIIFMKAT
                     SAIVGPNDDLVIPRGSQKTDWEVELGIIIGKTAKYVSEEDALDYVAGYCTIHDVSERA
                     FQIERQGQWTKGKSCDTFGPTGPWLVTKDEIADPENLAMWLKVNGETMQNGSSRTMIY
                     GVRHLVSYLSQFMSLQPGDIISTGTPPGVGMGMKPPRYLKAGDVVELGIEGLGSQKQN
                     VRADS"
     misc_feature    254789..255598
                     /locus_tag="BSVBI22_A0244"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    254975..255595
                     /locus_tag="BSVBI22_A0244"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            255621..256898
                     /locus_tag="BSVBI22_A0245"
                     /db_xref="GeneID:11727717"
     CDS             255621..256898
                     /locus_tag="BSVBI22_A0245"
                     /note="identified by match to protein family HMM PF01188"
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase/muconate lactonizing protein"
                     /protein_id="YP_005153946.1"
                     /db_xref="GI:376279940"
                     /db_xref="GeneID:11727717"
                     /translation="MTKITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILDTDDE
                     ALKGHGLTFTIGRGNDICCHAILAMRHLVVGASLDEIRAAPGKFWHHLTGDSQLRWIG
                     PEKGAMHLATGAVVNAIWDLLAKQAGKPVWRLVSELSPEEIADIVDYRYLTDVLTRDE
                     AIEILRKAESGKAERIATLEAEGYACYTTSAGWLGYDDAKLRRLCQEAIDEGFNHVKM
                     KVGHDLEDDIRRLTIAREVIGPDRYLMIDANQVWEVDQAIEWVRRLAFANPFFIEEPT
                     SPDDVAGHRKIRAAIGPVKVATGEMCQNRIMFKQFIAEGAIDVVQIDSCRMGGLNEVL
                     AVLLMAAKYDLPVWPHAGGVGLCEYVQHLSMIDYVAVSGTKEGRVIEYVDHLHEHFLD
                     PCIIRNAAYMPPSLPGFSIEMKPQSIAQYAFKG"
     misc_feature    255624..256895
                     /locus_tag="BSVBI22_A0245"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    255624..256862
                     /locus_tag="BSVBI22_A0245"
                     /note="Human rTS beta is encoded by the rTS gene which,
                     through alternative RNA splicing, also encodes rTS alpha
                     whose mRNA is complementary to thymidylate synthase mRNA.
                     rTS beta expression is associated with the production of
                     small molecules that appear to...; Region:
                     rTSbeta_L-fuconate_dehydratase; cd03324"
                     /db_xref="CDD:239440"
     misc_feature    order(256179..256181,256269..256271,256275..256277,
                     256359..256361,256431..256433,256437..256439,
                     256518..256520,256587..256589,256668..256670,
                     256761..256763)
                     /locus_tag="BSVBI22_A0245"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:239440"
     misc_feature    order(256359..256361,256437..256439,256518..256520)
                     /locus_tag="BSVBI22_A0245"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239440"
     gene            complement(257297..257848)
                     /locus_tag="BSVBI22_A0246"
                     /db_xref="GeneID:11727718"
     CDS             complement(257297..257848)
                     /locus_tag="BSVBI22_A0246"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153947.1"
                     /db_xref="GI:376279941"
                     /db_xref="GeneID:11727718"
                     /translation="MNAGTAVSRWTEEKAQTKVLLGEIVMLWGDVMASVYRLPSALGL
                     ANPEAIQLGLAHLNGDGTRFTYLSKLLRHNPKLADVDEQRIADTIAVLARLNKMNKQR
                     DSFVHGLPVLTMKRDQDTRETIRDGCYLIQTRELDEKDRYLKVPEAAETFLTELQEVY
                     DQLLQVTVPMLFEDWQQLWDDES"
     gene            258066..258467
                     /locus_tag="BSVBI22_A0247"
                     /db_xref="GeneID:11727719"
     CDS             258066..258467
                     /locus_tag="BSVBI22_A0247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153948.1"
                     /db_xref="GI:376279942"
                     /db_xref="GeneID:11727719"
                     /translation="MTHLHDFARQTSPCSTDCIRRLIIIRCMNCGRRKQCGGQNYMSH
                     GTPKSLGITGRAQGTGQGADMAEAGFSRIGCGEGCTKLWRPHHRPNFGRCRKVWLTAP
                     DKFLATVIAGISGIMKENEIVVGVAHWATPL"
     gene            complement(258864..258936)
                     /locus_tag="BSVBI22_At03"
                     /db_xref="GeneID:11727720"
     tRNA            complement(258864..258936)
                     /locus_tag="BSVBI22_At03"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:11727720"
     gene            complement(259121..259294)
                     /locus_tag="BSVBI22_A0248"
                     /db_xref="GeneID:11727721"
     CDS             complement(259121..259294)
                     /locus_tag="BSVBI22_A0248"
                     /note="identified by similarity to OMNI:NTL02ML5069; match
                     to protein family HMM PF03884"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding protein"
                     /protein_id="YP_005153949.1"
                     /db_xref="GI:376279943"
                     /db_xref="GeneID:11727721"
                     /translation="MTPLRPTRPCPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVI
                     AGKPLGEEDENDS"
     misc_feature    complement(259130..259294)
                     /locus_tag="BSVBI22_A0248"
                     /note="zinc-binding protein; Provisional; Region:
                     PRK01343"
                     /db_xref="CDD:234943"
     gene            complement(259346..259972)
                     /gene="maf"
                     /locus_tag="BSVBI22_A0249"
                     /db_xref="GeneID:11727722"
     CDS             complement(259346..259972)
                     /gene="maf"
                     /locus_tag="BSVBI22_A0249"
                     /note="Maf; overexpression in Bacillus subtilis inhibits
                     septation in the dividing cell"
                     /codon_start=1
                     /transl_table=11
                     /product="Maf-like protein"
                     /protein_id="YP_005153950.1"
                     /db_xref="GI:376279944"
                     /db_xref="GeneID:11727722"
                     /translation="MNVQHKLVLASGSPRRIELLGQAGIEPDRIHPADIDETPQRAEH
                     PRSLARRLSRDKARKAHEQLQGEAGFSGALVLAADTVVAVGRRILPKAEIEDEARECL
                     RLLSGRTHKVFTGVCLVLPNGNLRQTLVETRLRFERLSRLQINAYLSSGEWRGKAGGY
                     AIQGLAGSFVVKLVGSYTNVVGLPLQETVGLLADGGYPVYANWGTGKV"
     misc_feature    complement(259397..259954)
                     /gene="maf"
                     /locus_tag="BSVBI22_A0249"
                     /note="Nucleotide binding protein Maf. Maf has been
                     implicated in inhibition of septum formation in
                     eukaryotes, bacteria and archaea, but homologs in
                     B.subtilis and S.cerevisiae are nonessential for cell
                     division. Maf has been predicted to be a nucleotide-
                     or...; Region: Maf; cd00555"
                     /db_xref="CDD:238310"
     misc_feature    complement(order(259700..259702,259736..259738,
                     259805..259807,259862..259864,259925..259927,
                     259940..259942))
                     /gene="maf"
                     /locus_tag="BSVBI22_A0249"
                     /note="active site"
                     /db_xref="CDD:238310"
     misc_feature    complement(order(259586..259603,259823..259825))
                     /gene="maf"
                     /locus_tag="BSVBI22_A0249"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238310"
     gene            complement(260006..260224)
                     /gene="infA"
                     /locus_tag="BSVBI22_A0250"
                     /db_xref="GeneID:11727723"
     CDS             complement(260006..260224)
                     /gene="infA"
                     /locus_tag="BSVBI22_A0250"
                     /note="stimulates the activities of the other two
                     initiation factors, IF-2 and IF-3"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="YP_005153951.1"
                     /db_xref="GI:376279945"
                     /db_xref="GeneID:11727723"
                     /translation="MAKEEVLEFPGVVTELLPNAMFRVKLENEHEIIAHTAGRMRKNR
                     IRVLAGDKVLVEMTPYDLTKGRITYRLK"
     misc_feature    complement(260015..260206)
                     /gene="infA"
                     /locus_tag="BSVBI22_A0250"
                     /note="S1_IF1: Translation Initiation Factor IF1, S1-like
                     RNA-binding domain. IF1 contains an S1-like RNA-binding
                     domain, which is found in a wide variety of RNA-associated
                     proteins. Translation initiation includes a number of
                     interrelated steps preceding the...; Region: S1_IF1;
                     cd04451"
                     /db_xref="CDD:239898"
     misc_feature    complement(order(260027..260029,260033..260035,
                     260084..260095,260108..260113,260120..260122,
                     260156..260158,260174..260182))
                     /gene="infA"
                     /locus_tag="BSVBI22_A0250"
                     /note="rRNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239898"
     misc_feature    complement(order(260015..260017,260108..260110,
                     260120..260122))
                     /gene="infA"
                     /locus_tag="BSVBI22_A0250"
                     /note="predicted 30S ribosome binding site; other site"
                     /db_xref="CDD:239898"
     gene            complement(260336..260809)
                     /locus_tag="BSVBI22_A0251"
                     /db_xref="GeneID:11727724"
     CDS             complement(260336..260809)
                     /locus_tag="BSVBI22_A0251"
                     /note="identified by match to protein family HMM PF01451"
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase"
                     /protein_id="YP_005153952.1"
                     /db_xref="GI:376279946"
                     /db_xref="GeneID:11727724"
                     /translation="MVAVTRTDAEGGKEAATRLPTSILFVCGKNAIRSPMAELLARTL
                     LPANIYIASAGVKRGERDPFVDAVLSEEGLSLDNRQPRGIEELADGYFDLIVTLTPLA
                     HHTVLERMRGFSVDVEYWPTPDPTLVTGSREQIMAAYRDVRDRLKRRITLRFGFG"
     misc_feature    complement(260348..260749)
                     /locus_tag="BSVBI22_A0251"
                     /note="Low molecular weight phosphatase family; Region:
                     LMWPc; cd00115"
                     /db_xref="CDD:238063"
     misc_feature    complement(order(260708..260716,260720..260725,
                     260729..260731))
                     /locus_tag="BSVBI22_A0251"
                     /note="active site"
                     /db_xref="CDD:238063"
     gene            complement(260816..261298)
                     /locus_tag="BSVBI22_A0252"
                     /db_xref="GeneID:11727725"
     CDS             complement(260816..261298)
                     /locus_tag="BSVBI22_A0252"
                     /note="identified by similarity to OMNI:NTL02ML5073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153953.1"
                     /db_xref="GI:376279947"
                     /db_xref="GeneID:11727725"
                     /translation="MTADVPNARLVDVELDESIGRSTPDVEHERAVAIFDLIEENSFH
                     PVGDQKGGPYRLKLSLMESRLIFSITRENGDAVATHILSLTPLRRVVRDYFMICESYY
                     QAIRSATPSKIEAIDMGRRGLHNEGSQTLQARLKGKIEVDFDTARRLFTLVCVLHWRG
                     "
     misc_feature    complement(260819..261295)
                     /locus_tag="BSVBI22_A0252"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5328"
                     /db_xref="CDD:227636"
     gene            complement(261305..262597)
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /db_xref="GeneID:11727726"
     CDS             complement(261305..262597)
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /note="catalyzes the oxidation of L-histidinol to
                     L-histidinaldehyde and then to L-histidine in histidine
                     biosynthesis; functions as a dimer"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="YP_005153954.1"
                     /db_xref="GI:376279948"
                     /db_xref="GeneID:11727726"
                     /translation="MVTTLRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRRE
                     GDSALLDYSRRFDRIDLEKTGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQ
                     LPKDDRYTDALGVELGSRWTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMV
                     VPAPDGNLNPLVLVAARLAGVSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVA
                     AAKRIVFGTVGIDMIAGPSEVLIVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEA
                     FAHAVEEAVERQLHTLARTETASASWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVA
                     DAEAFVPRIRNAGSIFIGGYTPEVIGDYVGGCNHVLPTARSARFSSGLSVLDYMKRTS
                     LLKLGSEQLRALGPAAIEIARAEGLDAHAQSVAIRLNL"
     misc_feature    complement(261308..262594)
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /note="Histidinol dehydrogenase [Amino acid transport and
                     metabolism]; Region: HisD; COG0141"
                     /db_xref="CDD:223219"
     misc_feature    complement(261338..262510)
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /note="Histidinol dehydrogenase, HisD, E.C 1.1.1.23.
                     Histidinol dehydrogenase catalyzes the last two steps in
                     the L-histidine biosynthesis pathway, which is conserved
                     in bacteria, archaea, fungi, and plants. These last two
                     steps are (i) the NAD-dependent...; Region: Histidinol_dh;
                     cd06572"
                     /db_xref="CDD:119329"
     misc_feature    complement(order(261812..261814,261947..261952,
                     261956..261964,262025..262027,262031..262036,
                     262112..262114,262175..262177,262199..262204,
                     262208..262210,262430..262432))
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    complement(order(261338..261358,261362..261367,
                     261410..261433,261440..261445,261449..261463,
                     261467..261472,261500..261502,261506..261508,
                     261512..261526,261530..261535,261539..261541,
                     261545..261571,261575..261580,261587..261589,
                     261602..261604,261812..261817,261821..261829,
                     261833..261838,261845..261850,261920..261922,
                     261932..261934,261977..261979,262178..262192,
                     262226..262228,262232..262234,262241..262255,
                     262265..262267,262271..262273,262292..262297,
                     262304..262309,262316..262321,262328..262330,
                     262334..262339,262346..262351))
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    complement(order(261338..261340,261347..261349,
                     261353..261355,261494..261496,261512..261517,
                     261527..261529,261614..261619,261812..261814,
                     261887..261889,262178..262180,262184..262186))
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /note="product binding site; other site"
                     /db_xref="CDD:119329"
     misc_feature    complement(order(261338..261340,261347..261349,
                     261353..261355,261494..261496,261512..261517,
                     261527..261529,261614..261619,261812..261814,
                     261821..261823,261887..261889,262178..262180))
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    complement(order(261338..261340,261515..261517,
                     261812..261814,261821..261823))
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    complement(261614..261619)
                     /gene="hisD"
                     /locus_tag="BSVBI22_A0253"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:119329"
     gene            complement(262672..263112)
                     /locus_tag="BSVBI22_A0254"
                     /db_xref="GeneID:11727727"
     CDS             complement(262672..263112)
                     /locus_tag="BSVBI22_A0254"
                     /note="identified by similarity to GP:15073540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153955.1"
                     /db_xref="GI:376279949"
                     /db_xref="GeneID:11727727"
                     /translation="MEMLKLVALDEEDLQVLSAHLQDAVLKVSDLQYLAREKRFLLTA
                     NRFVWEEARPKFLRKPSYQRRRTALHFNRVSMAKATGINRQNQDDVLSLLTIRFIPGQ
                     TPAGTIELTFSANAAIRLDVECIEAQLTDLGAAWETESLPRHNV"
     misc_feature    complement(262681..263103)
                     /locus_tag="BSVBI22_A0254"
                     /note="Protein of unknown function (DUF2948); Region:
                     DUF2948; pfam11164"
                     /db_xref="CDD:256329"
     gene            complement(263383..264672)
                     /gene="murA"
                     /locus_tag="BSVBI22_A0255"
                     /db_xref="GeneID:11727728"
     CDS             complement(263383..264672)
                     /gene="murA"
                     /locus_tag="BSVBI22_A0255"
                     /note="adds enolpyruvyl to UDP-N-acetylglucosamine as a
                     component of cell wall formation; gram-positive bacteria
                     have 2 copies of MurA which are active"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="YP_005153956.1"
                     /db_xref="GI:376279950"
                     /db_xref="GeneID:11727728"
                     /translation="MDRIKIVGGNKLNGVIPISGAKNAALPLMIASLLTDDTLTLENV
                     PHLADVEQLIRILSNHGVDYSVNGRREHQNGPYSRTIHFTARNIVDTTAPYELVSRMR
                     ASFWVIGPLLARMGEANVSLPGGCAIGTRPVDLLLDALLALGAEIDIENGYAKAKARN
                     GLVGARYKFPKVSVGATHVMLMAATLAKGETIIENAAREPEVANLADCLNAMGAKISG
                     AGSSTIHVQGVTNLSGARVRIIPDRIEAGTYAMAVAMTGGDVLLEGAQESQLSCVLET
                     LRQAGAEINETNSGLRVVRNGHGIQPVDITTDPFPGFPTDLQAQFMGLMTRAKGTSHI
                     TETIFENRFMHVQELARLGAKISLSGQTATVEGVERLKGAQVMATDLRASVSLVIAGL
                     AAEGETIVNRVYHLDRGFERLEEKLSRCGADVKRISG"
     misc_feature    complement(263422..264651)
                     /gene="murA"
                     /locus_tag="BSVBI22_A0255"
                     /note="EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase); Region: EPSP_synthase;
                     pfam00275"
                     /db_xref="CDD:249736"
     misc_feature    complement(263413..264639)
                     /gene="murA"
                     /locus_tag="BSVBI22_A0255"
                     /note="UDP-N-acetylglucosamine enolpyruvyl transferase
                     catalyzes enolpyruvyl transfer as part of the first step
                     in the biosynthesis of peptidoglycan, a component of the
                     bacterial cell wall. The reaction is phosphoenolpyruvate +
                     UDP-N-acetyl-D-glucosamine =...; Region: UdpNAET; cd01555"
                     /db_xref="CDD:238796"
     misc_feature    complement(order(263947..263958,264610..264621))
                     /gene="murA"
                     /locus_tag="BSVBI22_A0255"
                     /note="hinge; other site"
                     /db_xref="CDD:238796"
     misc_feature    complement(order(263725..263727,264148..264153,
                     264160..264162,264265..264282,264355..264357,
                     264367..264369,264604..264606))
                     /gene="murA"
                     /locus_tag="BSVBI22_A0255"
                     /note="active site"
                     /db_xref="CDD:238796"
     gene            complement(264895..265074)
                     /locus_tag="BSVBI22_A0256"
                     /db_xref="GeneID:11727729"
     CDS             complement(264895..265074)
                     /locus_tag="BSVBI22_A0256"
                     /note="identified by similarity to OMNI:NTL02ML5077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153957.1"
                     /db_xref="GI:376279951"
                     /db_xref="GeneID:11727729"
                     /translation="MTEKTTPREKLTEADYRKKRLAEQLRANLMRRKAQSRSRRAGEA
                     DERNDGITAGHGKEE"
     gene            265223..265294
                     /locus_tag="BSVBI22_At04"
                     /db_xref="GeneID:11727730"
     tRNA            265223..265294
                     /locus_tag="BSVBI22_At04"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:11727730"
     gene            265389..267143
                     /locus_tag="BSVBI22_A0257"
                     /db_xref="GeneID:11727731"
     CDS             265389..267143
                     /locus_tag="BSVBI22_A0257"
                     /note="identified by match to protein family HMM PF00589;
                     match to protein family HMM PF02899"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family site specific
                     recombinase"
                     /protein_id="YP_005153958.1"
                     /db_xref="GI:376279952"
                     /db_xref="GeneID:11727731"
                     /translation="MPAPYKHPKTGVYYLRQRVPADLKDKARGKIVALPISGTLKSFT
                     VGDSVKASLETKDPADAKARYREADASLSKFWEAVRNGPLSLTQKEIAERAGLVYKFF
                     ADTFEDDAEAPELWERAQRINAVVLKKAKLGKRPTYPLTVAQRDILEPRFGGFVDKLL
                     IDTGEQVDQESRDKLLVAVAEALQQSTGTILKRADGDYSPDTAIRQRYPEYAPIEKPQ
                     AVPRQTEERSGAKLDLYNLLDHKFKDKGKAKTHRDYRSEIDKFVKFIGHSDAERITKD
                     NVREWRDALIAQGLSLKTVNDKRLTAIKAVLAHGVAEFSLSQNVADGIRDKRQEAAPV
                     GSKGYSPEQAKAILQATFNGTDKELDPHYQRAVFWVPWICAYTGLRVSEVTQLQGKNV
                     RNVDGHAIFVITPQDGSTKSGKAWTTGIHPHLIEMGILDMFKAVGDGPAFYRAYPVGT
                     DLQKIAGKHRAKESASRVGDWVTATLGETAPGGRPNHAWRHTFTTLSRRVKMDKEARD
                     YMLGSRSRTDAREGYGDWTPDVICGEIDKLPRFDVKETDYRPTLRVMKPKPISEPYVR
                     PKKTRGGKLVLTPRVPKG"
     misc_feature    266034..267023
                     /locus_tag="BSVBI22_A0257"
                     /note="Integrase [DNA replication, recombination, and
                     repair]; Region: XerC; COG0582"
                     /db_xref="CDD:223655"
     misc_feature    266088..>266576
                     /locus_tag="BSVBI22_A0257"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    266403..266963
                     /locus_tag="BSVBI22_A0257"
                     /note="INT_SG2, DNA breaking-rejoining enzymes,
                     integrase/recombinases subgroup 2, C-terminal catalytic
                     domain. The CD contains mainly predicted
                     integrase/recombinases and phage-related integrases. Some
                     have N-terminal domains, which show little sequence...;
                     Region: INT_SG2_C; cd01184"
                     /db_xref="CDD:238589"
     misc_feature    order(266526..266528,266619..266621,266847..266849,
                     266856..266858,266925..266927,266955..266957)
                     /locus_tag="BSVBI22_A0257"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238589"
     gene            complement(267133..267246)
                     /locus_tag="BSVBI22_A0258"
                     /db_xref="GeneID:11727732"
     CDS             complement(267133..267246)
                     /locus_tag="BSVBI22_A0258"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153959.1"
                     /db_xref="GI:376279953"
                     /db_xref="GeneID:11727732"
                     /translation="MVHEVFAVPAWKISVSASLRVIASALLVIAAVAFVNL"
     gene            267238..267660
                     /locus_tag="BSVBI22_A0259"
                     /db_xref="GeneID:11727733"
     CDS             267238..267660
                     /locus_tag="BSVBI22_A0259"
                     /note="identified by match to protein family HMM PF02498"
                     /codon_start=1
                     /transl_table=11
                     /product="BRO family protein"
                     /protein_id="YP_005153960.1"
                     /db_xref="GI:376279954"
                     /db_xref="GeneID:11727733"
                     /translation="MDHRVRVVLLNGDPWFVAADVVSLLGLATYADGSPNVTHATRVL
                     NTTEKLLLRRTTPHLMSGSVEKLFAFRQPSLLSVSESGLYKLIMRSRKPEAKKFQNWV
                     TQVVLPAIRKDGMYVRGEEKVSAGEMDLEELTLITLTD"
     misc_feature    267238..>267657
                     /locus_tag="BSVBI22_A0259"
                     /note="Prophage antirepressor [Transcription]; Region:
                     COG3617"
                     /db_xref="CDD:226144"
     misc_feature    267250..267561
                     /locus_tag="BSVBI22_A0259"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     smart01040"
                     /db_xref="CDD:214989"
     gene            267673..267867
                     /locus_tag="BSVBI22_A0260"
                     /db_xref="GeneID:11727734"
     CDS             267673..267867
                     /locus_tag="BSVBI22_A0260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153961.1"
                     /db_xref="GI:376279955"
                     /db_xref="GeneID:11727734"
                     /translation="MGQDGERTSWFVAVDLYDILFGLRTGISTRWFLKREETKTLRKA
                     ESAQYALSSRSQISSRPRPG"
     gene            268459..269076
                     /locus_tag="BSVBI22_A0261"
                     /db_xref="GeneID:11727735"
     CDS             268459..269076
                     /locus_tag="BSVBI22_A0261"
                     /note="identified by match to protein family HMM PF00239"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase family site-specific recombinase"
                     /protein_id="YP_005153962.1"
                     /db_xref="GI:376279956"
                     /db_xref="GeneID:11727735"
                     /translation="MNNATVANVAATYRGQLVGYARTSTTDQKAGLAAQERDLQAAGC
                     DRIFSEQTSAKDSKRPELQRALDHLREGDTFIVTKLDRLARSVADLVDLTGQLSSKGV
                     SLRILAMNLDTATPTGKLMLNLLGSIAEFERELMLERQREGIAAAKAGGKYKGRAPTA
                     QRQADEIIRLKDEGKTVAEIMAATKAGRSSVFSILKEAGRTERQR"
     misc_feature    268507..268887
                     /locus_tag="BSVBI22_A0261"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    268510..269064
                     /locus_tag="BSVBI22_A0261"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    order(268522..268524,268528..268530,268699..268704,
                     268711..268713)
                     /locus_tag="BSVBI22_A0261"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    268528..268530
                     /locus_tag="BSVBI22_A0261"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    order(268696..268698,268828..268833,268837..268842,
                     268852..268854)
                     /locus_tag="BSVBI22_A0261"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(268714..268716,268729..268734,268816..268818,
                     268825..268830,268837..268842,268849..268851,
                     268858..268860)
                     /locus_tag="BSVBI22_A0261"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(268783..268791,268816..268821,268828..268833,
                     268840..268842,268852..268854,268861..268863,
                     268873..268875)
                     /locus_tag="BSVBI22_A0261"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(268783..268785,268831..268833,268840..268842,
                     268852..268854,268861..268863,268873..268875)
                     /locus_tag="BSVBI22_A0261"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(268855..268857,268873..268878)
                     /locus_tag="BSVBI22_A0261"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     gene            269634..270998
                     /locus_tag="BSVBI22_A0262"
                     /db_xref="GeneID:11727736"
     CDS             269634..270998
                     /locus_tag="BSVBI22_A0262"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153963.1"
                     /db_xref="GI:376279957"
                     /db_xref="GeneID:11727736"
                     /translation="MVDYADDVDGVILEDDEQGNDSEPQEEDAETRRYSDMAFNPWRF
                     AATVKAEALVREAVQAVEAAETRQKKRRATDQKVFEDTVEAIICDLMHHRICGHEHGI
                     RVSRSNRSLGKSRYRNPIYSKVFPSILDKLEYAGWIEQTVGDRGKVVKGAQTVIYPGL
                     RLVSRMDAVDISLADMGIADQSDPIILQRPKKDRRLFGAREEYEDNERTRQFRSEMDQ
                     INGWLGKADLEVLDASDIAVDDTGAAIIRLHDPAKRKLRRYFTDSDHTFTSGGRLFGG
                     FWQNMTKAERRDLLLIEGESCVALDYSGMGLRIAYGHAGIDPGEGDLYLVPGLEDFRS
                     GVKIVTSAMLAASTRLRRMPEGTRVKFPRLLKFSTVRDAIEGRHPSIRHLFYSGHGHA
                     VQFTESQIMVDVLLRLMKMEIVALPVHDAVLIAESKADQTKAVMLEAFRDHVGFPGSV
                     TFEN"
     gene            271586..271765
                     /locus_tag="BSVBI22_A0263"
                     /db_xref="GeneID:11727737"
     CDS             271586..271765
                     /locus_tag="BSVBI22_A0263"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153964.1"
                     /db_xref="GI:376279958"
                     /db_xref="GeneID:11727737"
                     /translation="MVLLNGDPWFVAVDLYSILFKRRTGVASRRFLKPEETKTFRRSE
                     SAQYALSNLFEAKAS"
     misc_feature    271598..>271705
                     /locus_tag="BSVBI22_A0263"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     cl10591"
                     /db_xref="CDD:264009"
     gene            complement(272239..272523)
                     /locus_tag="BSVBI22_A0264"
                     /db_xref="GeneID:11727738"
     CDS             complement(272239..272523)
                     /locus_tag="BSVBI22_A0264"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153965.1"
                     /db_xref="GI:376279959"
                     /db_xref="GeneID:11727738"
                     /translation="MRLWLHLRRLWQTLTFVATCGTMGHTFSRTTVQMLTVGPVTTIP
                     HTATSTHTRGAQAHTRLRMEAEATGEAAATAVIHTVATAMAALVFNVFRA"
     gene            complement(272637..272897)
                     /locus_tag="BSVBI22_A0265"
                     /db_xref="GeneID:11727739"
     CDS             complement(272637..272897)
                     /locus_tag="BSVBI22_A0265"
                     /note="identified by similarity to OMNI:NTL02ML3521"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153966.1"
                     /db_xref="GI:376279960"
                     /db_xref="GeneID:11727739"
                     /translation="MSEIHQVTGSQIAAARALIRMSQADLAAAAGVSVPTLGRMETSE
                     GPASGLRNNVLAVKRALEAAGVVFMAEGELIAGGAGGRLKSA"
     misc_feature    complement(<272754..272873)
                     /locus_tag="BSVBI22_A0265"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(<272766..272873)
                     /locus_tag="BSVBI22_A0265"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(order(272772..272774,272847..272849,
                     272859..272861))
                     /locus_tag="BSVBI22_A0265"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(272775..272777,272850..272852))
                     /locus_tag="BSVBI22_A0265"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(272769..272774,272784..272786,
                     272793..272795,272826..272831))
                     /locus_tag="BSVBI22_A0265"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            272981..273370
                     /locus_tag="BSVBI22_A0266"
                     /db_xref="GeneID:11727740"
     CDS             272981..273370
                     /locus_tag="BSVBI22_A0266"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153967.1"
                     /db_xref="GI:376279961"
                     /db_xref="GeneID:11727740"
                     /translation="MNAHTNISGSAAFDPNAWHHSQMTIREAIDLSQSGGHPYSSPNV
                     PKGFNTVVGFFFDCYDWYPAAYDDEEGNAMKDRELIQYEEWCAKYARKLGLEVKEVEA
                     PAALKVHGIMTLKAYPEALLEIRCLEL"
     misc_feature    <273161..>273271
                     /locus_tag="BSVBI22_A0266"
                     /note="Pyridoxine 5'-phosphate (PNP) synthase domain;
                     pyridoxal 5'-phosphate is the active form of vitamin B6
                     that acts as an essential, ubiquitous coenzyme in amino
                     acid metabolism. In bacteria, formation of pyridoxine
                     5'-phosphate is a step in...; Region: PNPsynthase;
                     cl00541"
                     /db_xref="CDD:260488"
     misc_feature    273167..273172
                     /locus_tag="BSVBI22_A0266"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:237977"
     gene            complement(273823..273927)
                     /locus_tag="BSVBI22_A0267"
                     /db_xref="GeneID:11727741"
     CDS             complement(273823..273927)
                     /locus_tag="BSVBI22_A0267"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153968.1"
                     /db_xref="GI:376279962"
                     /db_xref="GeneID:11727741"
                     /translation="MFSKIRGMDLGKHDVQIEAGVSLKHPPEPYCALI"
     gene            273962..274804
                     /gene="ureD-1"
                     /locus_tag="BSVBI22_A0268"
                     /db_xref="GeneID:11727742"
     CDS             273962..274804
                     /gene="ureD-1"
                     /locus_tag="BSVBI22_A0268"
                     /note="identified by similarity to SP:P42888; match to
                     protein family HMM PF01774"
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreD"
                     /protein_id="YP_005153969.1"
                     /db_xref="GI:376279963"
                     /db_xref="GeneID:11727742"
                     /translation="MLIINDNNLSGLSLQRVNGTGELSVQFKDGRSRISRLYQEGAAK
                     IRMPQAVTGPLEAILINTSGGLTGGDRLKWDVALDDGASAVITTQACERIYRSGGGEA
                     RIATRLKAAKGTRLAWLPQETILFNRSILSRRLDVELEEGAQMLVVEATVFGRLAMGE
                     RVVAARFADRWRVRLGGRVIHAEEFRLGPDVGAELQAPAVAGGACAMATVLMVCEQAG
                     RHLETARAIIGEEGGCSLWRVGKASKLVVRLYAPDSYALRRRLCPLVALLNGKAGLPK
                     VWTI"
     misc_feature    274004..274795
                     /gene="ureD-1"
                     /locus_tag="BSVBI22_A0268"
                     /note="Urease accessory protein UreH [Posttranslational
                     modification, protein turnover, chaperones]; Region: UreH;
                     COG0829"
                     /db_xref="CDD:223899"
     gene            274957..275259
                     /gene="ureA"
                     /locus_tag="BSVBI22_A0269"
                     /db_xref="GeneID:11727743"
     CDS             274957..275259
                     /gene="ureA"
                     /locus_tag="BSVBI22_A0269"
                     /note="UreA, with UreB and UreC catalyzes the hydrolysis
                     of urea into ammonia and carbon dioxide; nickel
                     metalloenzyme; accessory proteins UreD, UreE, UreF, and
                     UreG are necessary for assembly of the metallocenter"
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit gamma"
                     /protein_id="YP_005153970.1"
                     /db_xref="GI:376279964"
                     /db_xref="GeneID:11727743"
                     /translation="MNLTPREKDKLLIAMAAMVARRRLERGVKLNHPEAIALVSDFVV
                     EGARDGRTVAELMEAGAYVITREQVMDGVAEMIRDIQVEATFPDGTKLVTVHEPIR"
     misc_feature    274966..275253
                     /gene="ureA"
                     /locus_tag="BSVBI22_A0269"
                     /note="Urease gamma-subunit; Urease is a nickel-dependent
                     metalloenzyme that catalyzes the hydrolysis of urea to
                     form ammonia and carbon dioxide. Nickel-dependent ureases
                     are found in bacteria, archaea, fungi and plants. Their
                     primary role is to allow the use...; Region: Urease_gamma;
                     cd00390"
                     /db_xref="CDD:238229"
     misc_feature    order(274981..274986,275011..275013,275023..275025,
                     275047..275055,275074..275076,275167..275169,
                     275182..275184,275197..275199,275203..275205)
                     /gene="ureA"
                     /locus_tag="BSVBI22_A0269"
                     /note="alpha-gamma subunit interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238229"
     misc_feature    275167..275169
                     /gene="ureA"
                     /locus_tag="BSVBI22_A0269"
                     /note="beta-gamma subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238229"
     gene            275426..275731
                     /gene="ureB"
                     /locus_tag="BSVBI22_A0270"
                     /db_xref="GeneID:11727744"
     CDS             275426..275731
                     /gene="ureB"
                     /locus_tag="BSVBI22_A0270"
                     /note="ureases catalyze the hydrolysis of urea into
                     ammonia and carbon dioxide; in Helicobacter pylori and
                     Yersinia enterocolitica the ammonia released plays a key
                     role in bacterial survival by neutralizing acids when
                     colonizing the gastric mucosa; the holoenzyme is composed
                     of 3 UreC (alpha) and 3 UreAB (gamma/beta); in Brucella
                     suis the urease encoded by this operon (one of two
                     urease-encoding operons found in its genome) is involved
                     with urease activity, optimum growth, resistance to low-pH
                     killing in-vitro and persistence in-vivo, while the other
                     operon does not seem to be active"
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit beta"
                     /protein_id="YP_005153971.1"
                     /db_xref="GI:376279965"
                     /db_xref="GeneID:11727744"
                     /translation="MIPGEIITLEGDIELNQGQPTVTMRVANTGDRPIQVGSHFHFYE
                     VNAALSFDREKARGQRLDIAAGTAVRFEPGQERDVTLVPIRGHREIYGFRQMIMGKL"
     misc_feature    275426..275728
                     /gene="ureB"
                     /locus_tag="BSVBI22_A0270"
                     /note="Urease beta-subunit; Urease is a nickel-dependent
                     metalloenzyme that catalyzes the hydrolysis of urea to
                     form ammonia and carbon dioxide. Nickel-dependent ureases
                     are found in bacteria, archaea, fungi and plants. Their
                     primary role is to allow the use of...; Region:
                     Urease_beta; cd00407"
                     /db_xref="CDD:238238"
     misc_feature    275426..275428
                     /gene="ureB"
                     /locus_tag="BSVBI22_A0270"
                     /note="gamma-beta subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238238"
     misc_feature    order(275429..275452,275456..275473,275540..275542,
                     275603..275605,275609..275611,275615..275623,
                     275678..275692,275696..275704)
                     /gene="ureB"
                     /locus_tag="BSVBI22_A0270"
                     /note="alpha-beta subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238238"
     gene            275750..277462
                     /gene="ureC"
                     /locus_tag="BSVBI22_A0271"
                     /db_xref="GeneID:11727745"
     CDS             275750..277462
                     /gene="ureC"
                     /locus_tag="BSVBI22_A0271"
                     /note="ureases catalyze the hydrolysis of urea into
                     ammonia and carbon dioxide; in Helicobacter pylori the
                     ammonia released plays a key role in bacterial survival by
                     neutralizing acids when colonizing the gastric mucosa; the
                     holoenzyme is composed of 3 ureC (alpha) and 3 ureAB
                     (gamma/beta) subunits"
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit alpha"
                     /protein_id="YP_005153972.1"
                     /db_xref="GI:376279966"
                     /db_xref="GeneID:11727745"
                     /translation="MPARISRATYAQMFGPTVGDKVRLADTDLIIEVERDLTTYGEEV
                     KFGGGKVIRDGMGQSQLSRAEGAMDTVITNALILDHSGIYKADIGLLDGRIALIGKAG
                     NPDTQPGISIIIGPGTEIIAGEGKIVTAGGIDTHVHFISPQQVDEALNAGITCMVGGG
                     TGPAHGTLATTCTPGPWHIARLIQSFDGLPMNIGVFGKGNASLPGALEEMVRAGACGL
                     KLHEDWGCTPAAIDNCLSVADHFDVQVAIHTDTLNEGGFVEDTLNAFKGRTIHSFHTE
                     GAGGGHAPDIIRVCQYPNVLPASTNPTRPYTVNTIAEHLDMLMVCHHLSPAIPEDIAF
                     AESRIRKETIAAEDILHDMGAFSIISSDSQAMGRVGEMIIRCWQTADKMKKQRGSLPD
                     DRPGNDNYRARRYIAKYTINPAIAHGMAHEIGSVEVGKRADLVLWNPAFFGVKPDMVL
                     LGGWIATAPMGDANGSIPTPQPMHTRPMFGSFGKARTNTSITFVSQAAMDEGLREKIG
                     VDKQLVAVVNTRGGIGKHSMILNNAMPQMEVDPETYEVRADGELLTCEPVDVVPMAQR
                     YFLF"
     misc_feature    275753..277459
                     /gene="ureC"
                     /locus_tag="BSVBI22_A0271"
                     /note="urease subunit alpha; Reviewed; Region: ureC;
                     PRK13207"
                     /db_xref="CDD:237305"
     misc_feature    275759..277456
                     /gene="ureC"
                     /locus_tag="BSVBI22_A0271"
                     /note="Urease alpha-subunit; Urease is a nickel-dependent
                     metalloenzyme that catalyzes the hydrolysis of urea to
                     form ammonia and carbon dioxide. Nickel-dependent ureases
                     are found in bacteria, fungi and plants. Their primary
                     role is to allow the use of...; Region: Urease_alpha;
                     cd00375"
                     /db_xref="CDD:238221"
     misc_feature    order(275759..275764,275768..275770,275789..275791,
                     275807..275812,275816..275818,275822..275824,
                     275867..275878,275882..275884,275900..275902,
                     275909..275917,276059..276073,276122..276124,
                     277067..277069,277133..277150,277154..277162,
                     277175..277177,277442..277456)
                     /gene="ureC"
                     /locus_tag="BSVBI22_A0271"
                     /note="subunit interactions [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238221"
     misc_feature    order(276155..276157,276161..276163,276254..276256,
                     276404..276406,276410..276412,276491..276493,
                     276569..276571,276584..276586,276713..276715,
                     276833..276835,276842..276847)
                     /gene="ureC"
                     /locus_tag="BSVBI22_A0271"
                     /note="active site"
                     /db_xref="CDD:238221"
     misc_feature    276698..276748
                     /gene="ureC"
                     /locus_tag="BSVBI22_A0271"
                     /note="flap region; other site"
                     /db_xref="CDD:238221"
     gene            277478..277966
                     /gene="ureE"
                     /locus_tag="BSVBI22_A0272"
                     /db_xref="GeneID:11727746"
     CDS             277478..277966
                     /gene="ureE"
                     /locus_tag="BSVBI22_A0272"
                     /note="involved in the assembly of the urease
                     metallocenter; possible nickel donor"
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreE"
                     /protein_id="YP_005153973.1"
                     /db_xref="GI:376279967"
                     /db_xref="GeneID:11727746"
                     /translation="MFRAIAIIRAHEVIDAVPASHIVLERDERHLRRKAITLENGEKI
                     LADFAEPVVLEHGDRLVLDDGREIEIRAASEELYEIRGRDPRHIAELAWHIGNRHLAA
                     QIETDRIFILRDHVIRVMLEGLGATVTDVVAIFSPLRGAYSGGHQHHHGHDHDHHHPD
                     HE"
     misc_feature    277478..277906
                     /gene="ureE"
                     /locus_tag="BSVBI22_A0272"
                     /note="Urease accessory protein UreE [Posttranslational
                     modification, protein turnover, chaperones]; Region: UreE;
                     COG2371"
                     /db_xref="CDD:225246"
     misc_feature    277538..277870
                     /gene="ureE"
                     /locus_tag="BSVBI22_A0272"
                     /note="UreE urease accessory protein. UreE is a
                     metallochaperone assisting the insertion of a Ni2+ ion in
                     the active site of urease, an important step in the in
                     vivo assembly of urease, an enzyme that hydrolyses urea
                     into ammonia and carbamic acid. The...; Region: UreE;
                     cd00571"
                     /db_xref="CDD:238320"
     misc_feature    order(277751..277759,277763..277768,277772..277777,
                     277793..277795)
                     /gene="ureE"
                     /locus_tag="BSVBI22_A0272"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238320"
     misc_feature    order(277772..277774,277817..277819)
                     /gene="ureE"
                     /locus_tag="BSVBI22_A0272"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238320"
     gene            277938..278624
                     /locus_tag="BSVBI22_A0273"
                     /db_xref="GeneID:11727747"
     CDS             277938..278624
                     /locus_tag="BSVBI22_A0273"
                     /note="identified by similarity to SP:Q07402; match to
                     protein family HMM PF01730"
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreF"
                     /protein_id="YP_005153974.1"
                     /db_xref="GI:376279968"
                     /db_xref="GeneID:11727747"
                     /translation="MIIITPITNDPTTALLRLMAWLSPVFPVGSFSYSHGLERAVHDG
                     LVVDAAGLQDWLQWLVRRGSGWNDAVLCAESWRCAMKGEDLHEIAELAEALAGSRERH
                     METMLQGGAFLAAARSWPCEIFDRLPPDCAYPVAVGAVAGGHGVPLAQALAAFLQAFC
                     INLLQASIRLSVTGQSGVTAIMAALEPVLGETAARAALSSMEDLGSATFIADIMAMKH
                     ETQHSRLFRS"
     misc_feature    277962..278621
                     /locus_tag="BSVBI22_A0273"
                     /note="Urease accessory protein UreF [Posttranslational
                     modification, protein turnover, chaperones]; Region: UreF;
                     COG0830"
                     /db_xref="CDD:223900"
     gene            278621..279247
                     /gene="ureG-1"
                     /locus_tag="BSVBI22_A0274"
                     /db_xref="GeneID:11727748"
     CDS             278621..279247
                     /gene="ureG-1"
                     /locus_tag="BSVBI22_A0274"
                     /note="identified by similarity to EGAD:19477; match to
                     protein family HMM PF01495; match to protein family HMM
                     TIGR00101"
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreG"
                     /protein_id="YP_005153975.1"
                     /db_xref="GI:376279969"
                     /db_xref="GeneID:11727748"
                     /translation="MTQKNGPLRVGIGGPVGSGKTTLTEKLCKAMRDKYSVAVITNDI
                     YTQEDALILARRQALSEDRIIGVETGGCPHTAIREDASINLQAVVEMTRRFPDLDVVF
                     IESGGDNLAATFSPDLADLTLYVISVCQGEEIPRKGGPGITRSDFLVINKSDLAPYVH
                     VDLEVMEADAMRMRAKRPFGFTDLHRGKGVQEIIDFIVENGGLEPRSN"
     misc_feature    278639..279232
                     /gene="ureG-1"
                     /locus_tag="BSVBI22_A0274"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            complement(279371..279444)
                     /locus_tag="BSVBI22_At05"
                     /db_xref="GeneID:11727749"
     tRNA            complement(279371..279444)
                     /locus_tag="BSVBI22_At05"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:11727749"
     gene            complement(279604..281229)
                     /locus_tag="BSVBI22_A0275"
                     /db_xref="GeneID:11727750"
     CDS             complement(279604..281229)
                     /locus_tag="BSVBI22_A0275"
                     /note="identified by match to protein family HMM PF00512;
                     match to protein family HMM PF00672; match to protein
                     family HMM PF02518"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_005153976.1"
                     /db_xref="GI:376279970"
                     /db_xref="GeneID:11727750"
                     /translation="MHAKAGPHRARGPACGRLTDLEPDMAVADKTIDTSGTSPQAASP
                     AAADDRTSSTQFTRLRWRNRLSNKLLLLTALAVLIAEVLIFVPSIANMRVRWMNSRLD
                     TVGAVSEVLASSDSMEVPRDIQDKVLLATGTKAIALREAGASRLLALTEMPRKIDKVI
                     DLDNISEAGAIWDTFDTLFNGGNRTLRIYGTVSPSTSPGRIIEIVTSDAPLRHAMLVY
                     ARNVALISLIISVIAASLVYLIIHEMLLRPVRIMHRNMIDFATTPDNPALILVPENRK
                     DEFGVAQRQIAHIQSDLQRTLKEQKHLADLGLAVSKINHDMRNILASAQLMSDRLADT
                     NDPMVQRFAPKLIRTLSRAISYSESVIAYGRSQEEPPKPRRVLLHAIITDVQDTLNLS
                     AESGIEFQNLVPENFELDVDSEQLFRVLSNLCRNSVQAMERDQSSDAATIKRLTISAG
                     RIGTTAIIGVEDTGPGLPQKARDNLFTAFKGSTRSDGTGLGLAIAQELIRAHGGTIEL
                     REDRPIGAHFEIRLPDLPMQRDTRNNQQAEESA"
     misc_feature    complement(279640..280626)
                     /locus_tag="BSVBI22_A0275"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(279664..279984)
                     /locus_tag="BSVBI22_A0275"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(279676..279678,279682..279687,
                     279700..279702,279706..279708,279754..279765,
                     279829..279834,279838..279840,279844..279846,
                     279850..279852,279943..279945,279952..279954,
                     279964..279966))
                     /locus_tag="BSVBI22_A0275"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(279952..279954)
                     /locus_tag="BSVBI22_A0275"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(279757..279759,279763..279765,
                     279832..279834,279838..279840))
                     /locus_tag="BSVBI22_A0275"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(281246..281551)
                     /locus_tag="BSVBI22_A0276"
                     /db_xref="GeneID:11727751"
     CDS             complement(281246..281551)
                     /locus_tag="BSVBI22_A0276"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153977.1"
                     /db_xref="GI:376279971"
                     /db_xref="GeneID:11727751"
                     /translation="MSRHRAICFQDFIQPSGQGRLVIPDSPRPKPVSLQRRRQFSSPR
                     GKTHAGPQTAWIFSRATLHREIYEVELNFGNASIRLGRARFLTPSAKGVGIMLRQHI"
     gene            281514..282665
                     /locus_tag="BSVBI22_A0277"
                     /db_xref="GeneID:11727752"
     CDS             281514..282665
                     /locus_tag="BSVBI22_A0277"
                     /note="identified by similarity to GP:15075163; match to
                     protein family HMM TIGR01730"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_005153978.1"
                     /db_xref="GI:376279972"
                     /db_xref="GeneID:11727752"
                     /translation="MKSWKQIALCLLIILAATGGWYVYKNNNGAAQLALSSGDAPGNV
                     SQAQPKKQPKNHAAPLVVVAAAGEETINNRLTAIGSARALSTVSVTPYSSGYMTKLHV
                     RAGDTVKEGDLIAELDAETEQIAVAKAETALKDAQTTRQRIARLRATNTATEVQAVGA
                     ELAVANAQLALQDAQLALSRRMVRAPITGIVGILPVNAGNYVTAQTSIARIDDRSTVL
                     IDIWVPERFAPQIKVGQPLTAESTAFPGEIYKGRINAVDNMLDEASRTLHVRAEVPNA
                     EDRLRAGMSFSVTILFPGDNYPSVDPLAIQWGADGSYVWRIENGIAKKIPVRIVQRSS
                     DNILIDGPVKRGDMIVTQGVQTVRDDAPVRVKGEQGVSALAPAAMHDEG"
     misc_feature    281712..282608
                     /locus_tag="BSVBI22_A0277"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    281769..281915
                     /locus_tag="BSVBI22_A0277"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    282060..282362
                     /locus_tag="BSVBI22_A0277"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            282680..285811
                     /locus_tag="BSVBI22_A0278"
                     /db_xref="GeneID:11727753"
     CDS             282680..285811
                     /locus_tag="BSVBI22_A0278"
                     /note="identified by match to protein family HMM PF00873"
                     /codon_start=1
                     /transl_table=11
                     /product="AcrB/AcrD/AcrF multidrug efflux protein"
                     /protein_id="YP_005153979.1"
                     /db_xref="GI:376279973"
                     /db_xref="GeneID:11727753"
                     /translation="MSNKNPSSGGSTALFIRRPVFAFVINILIVVAGLAAFTGVDIRE
                     LPDVDRPVITISTDFSGASAETIDRQVTQVLENAVARVSGVKSISSTSSFERSRVTVE
                     FNDGVDLNVAAADMRDAISRVANNLPEEADPSRIIKADSNADPVMRLAVTSDTMAVDD
                     MTVLVEDQIEDVLSAVPGVADVQINGDRDKIFRIDIDQARLASYGLTIADISNALSSM
                     GLDAPAGSLRSSDQSIVVRATANLEKPEDFENVYIKGRTQIRDVATVTLGPDIESSAV
                     RSNSKTAIGLGIVRQAQSNTLDISQGVRAAVANLQKTLPEGVSIAVTSDDANFINGAI
                     HEVEIALIASVIIVVAIIFMFLWDARATLIPALSMPVALIGTIAAIYLVGFSVNILTL
                     LALVLATGLVVDDAIVVLENVVRRRNQGMGPRAAAVLGTQEVFFAVIATTLTLAAVFV
                     PISFLPGQAGGLFREFGFVLAIAVLLSSVVALTLCPMLASRFLKEASATVESEGHGPL
                     FLRRIGGGLANFYRKTLHACLSAPFIVVLVAVLFAGASYVGYGLIRQELTPSEDRAVA
                     LLRINGPQGISVEFLQSQLDKIEEAIQPLRDSGEITTTYAIAGSGGSSNNGFVVLTLA
                     PWKERQRSQQEIMADITNRIKGITAVRVFTTQPNSLGIRGAGNGLQFAIVGGEYAKLQ
                     PAAQAVVAALEKDPRFVQPRLSVEPTQAQISVEINRERASDLGIDITGLANAVQAVLD
                     GRKIGSVYVGDRSFDVKLVSTTNPINDPTDLENIFMKTADGRYVPMSSIASVVEKAVP
                     PQLNRELRQRSVAITTNLRDDFALGNAFAAAQEIAAPLLPPGSHIIPLAEASTLSETS
                     SGMAIVFGFAIVIILLVLAAQFESFISALIVMATVPLGLGCAVFAMILTGTSLNVYSQ
                     IGLVLLVGIMAKNGILIVEFADQLRDKGLNVREAIEEAANIRLRPVCMTMICAVLGGV
                     PLVLASGAGAEARVALGWVIVGGLGLATIATLYVTPVAYLLLGRFTKPKVEEEERLER
                     ELVRAEALEEKLK"
     misc_feature    282713..285730
                     /locus_tag="BSVBI22_A0278"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     misc_feature    <283688..284125
                     /locus_tag="BSVBI22_A0278"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    <285242..285742
                     /locus_tag="BSVBI22_A0278"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(285934..287403)
                     /gene="dhT"
                     /locus_tag="BSVBI22_A0279"
                     /db_xref="GeneID:11727754"
     CDS             complement(285934..287403)
                     /gene="dhT"
                     /locus_tag="BSVBI22_A0279"
                     /note="catalyzes the hydrolytic cleavage of hydantoin with
                     aromatic side chains at the 5'position"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylhydantoinase"
                     /protein_id="YP_005153980.1"
                     /db_xref="GI:376279974"
                     /db_xref="GeneID:11727754"
                     /translation="MAKTGASKVIKGGTVITADRTFRADILIEDGKIAAIGDSLEGDE
                     VIDASGCYVMPGGIDPHTHLQMPFMGTYSSDDFDTGTAAALAGGTTMVVDFVLPDSEG
                     NLLDALQEWFQKAGKARTDYSFHMAITGWNERTFNEMAEVVKRGINTFKHFMAYKGAL
                     MVNDDEMFASFQRCAELGAMPLVHAENGDIVAQLQAKLMAEGNDGPEAHAYSRPPEVE
                     GEATNRAIMIADQAGVPLYVVHVSCEQSHEAIRRARQKGMRVFGEPLIQHLTLDESEY
                     HNRDWDYAARRVMSPPFRDKLNQDSLWAGLAAGSLQCVATDHCAFTTEQKRYGIGNFT
                     KIPNGTGGLEERMPVLWTRGVRTGRLTPNEFVAVTSTNIAKILNIYPQKGAVVPGADA
                     DLVIWDPETTKKISAKTQHSSIDYNVFEGFELKGLPIMTLSRGRIAFDKGQVTAKPGD
                     GRFIEREPNGAVNRALSQWKEIVAPRKVERSAEHMPIGV"
     misc_feature    complement(286015..287385)
                     /gene="dhT"
                     /locus_tag="BSVBI22_A0279"
                     /note="phenylhydantoinase; Validated; Region: PRK08323"
                     /db_xref="CDD:236240"
     misc_feature    complement(286051..287382)
                     /gene="dhT"
                     /locus_tag="BSVBI22_A0279"
                     /note="D-hydantoinases (D-HYD) also called
                     dihydropyrimidases (DHPase) and related proteins; DHPases
                     are a family of enzymes that catalyze the reversible
                     hydrolytic ring opening of the amide bond in five- or
                     six-membered cyclic diamides, like dihydropyrimidine...;
                     Region: D-HYD; cd01314"
                     /db_xref="CDD:238639"
     misc_feature    complement(order(286249..286251,286264..286266,
                     286279..286281,286630..286635,286639..286644,
                     286723..286725,286732..286734,286744..286746,
                     286756..286758,286825..286827,286834..286836,
                     286843..286845,286906..286908,287296..287301,
                     287338..287340,287344..287349))
                     /gene="dhT"
                     /locus_tag="BSVBI22_A0279"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238639"
     misc_feature    complement(order(286453..286455,286684..286686,
                     286852..286854,286951..286953,287215..287217,
                     287221..287223))
                     /gene="dhT"
                     /locus_tag="BSVBI22_A0279"
                     /note="active site"
                     /db_xref="CDD:238639"
     gene            complement(287455..288702)
                     /locus_tag="BSVBI22_A0280"
                     /db_xref="GeneID:11727755"
     CDS             complement(287455..288702)
                     /locus_tag="BSVBI22_A0280"
                     /note="allantoate amidohydrolase and N-carbamoyl-L-amino
                     acid amidohydrolase are very similar; the allantoate
                     amidohydrolase from Escherichia coli forms a dimer and
                     binds zinc ions for catalytic activity and catalyzes the
                     conversion of allantoate to (S)-ureidoglycolate and
                     ammonia; carbamoyl amidohydrolase from Bacillus sp.
                     converts N-carbamoyl amino acids to amino acids, ammonia,
                     and carbon dioxide"
                     /codon_start=1
                     /transl_table=11
                     /product="allantoate amidohydrolase"
                     /protein_id="YP_005153981.1"
                     /db_xref="GI:376279975"
                     /db_xref="GeneID:11727755"
                     /translation="MVLTSNLRVNGDRLWDSLMEMAKIGPGLRGGNNRQTLTDEDGEG
                     RRLFQNWCEKAGLSMGVDTMGNMFFTRPGEDSDADPVYMGSHLDTQPTGGKFDGVLGV
                     LGGLEVMRTLNDMNIRTKRPIVVVNWTNEEGTRFAPAMLASGVFAGVLDQNWAYERTD
                     AKGKTFGEELVRIGWKGDEPVGSRKIHAMFELHIEQGPILEAERKDIGVVTHGQGLWW
                     LQVTLTGKEAHTGSTPMRMRKNASLGLGKLLQLVNEIAMAHQPDAVGGVGHIDVSPNS
                     RNVLPGQIVFTVDFRSPNQATLDGMKARFEKEAPKIAEELGIGIEIEVAGNFDPVTFD
                     TGCVEAIRNAAERLGYSHRNIVSGAGHDACWVNRVAPTAMVMCPCVDGLSHNEDEDIS
                     KEWASAGTDVLLHAVLETAEIVS"
     misc_feature    complement(287461..288693)
                     /locus_tag="BSVBI22_A0280"
                     /note="allantoate amidohydrolase; Reviewed; Region:
                     PRK12893"
                     /db_xref="CDD:237250"
     misc_feature    complement(287479..288663)
                     /locus_tag="BSVBI22_A0280"
                     /note="M20 Peptidase beta-alanine synthase, an
                     amidohydrolase; Region: M20_bAS; cd03884"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(287548..287550,287623..287628,
                     287830..287832,288049..288051,288055..288057,
                     288115..288117,288124..288126,288286..288288,
                     288307..288312,288409..288414,288445..288447))
                     /locus_tag="BSVBI22_A0280"
                     /note="active site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(287548..287550,288124..288126,
                     288307..288312,288412..288414,288445..288447))
                     /locus_tag="BSVBI22_A0280"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(287629..287631,287830..287832,
                     287836..287838,287860..287871,287875..287880,
                     287890..287913,287932..287937,287941..287946,
                     287950..287958,287962..287970,287974..287979,
                     287989..287991,287998..288000,288004..288018,
                     288049..288051,288094..288099,288106..288117))
                     /locus_tag="BSVBI22_A0280"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:193505"
     gene            288921..289604
                     /locus_tag="BSVBI22_A0281"
                     /db_xref="GeneID:11727756"
     CDS             288921..289604
                     /locus_tag="BSVBI22_A0281"
                     /note="identified by match to protein family HMM PF00440"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005153982.1"
                     /db_xref="GI:376279976"
                     /db_xref="GeneID:11727756"
                     /translation="MAIAPSDFRNGSTAKEKAEGGTRIQSINRRLILDAALDVFSAYG
                     FRGSTIDQIAEKAGMSKPNLLYYFPRKQNIYVTVLEDTLATWLEPFEDIDPDGDPLEE
                     LRRYIARKLEISASKPEASRLFANEILHGAPAIAGFLKGRLKELVDEKAAVIHRWIAQ
                     KRIAPVDPYHLIFTIWAVTQHYSDFAVQVSAIMGPRAEAANFYDEAARAVSAIILDGI
                     RLRDDAPKS"
     misc_feature    288987..289583
                     /locus_tag="BSVBI22_A0281"
                     /note="pyrimidine utilization regulatory protein R;
                     Region: RutR; TIGR03613"
                     /db_xref="CDD:200300"
     misc_feature    289014..289154
                     /locus_tag="BSVBI22_A0281"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    289155..289583
                     /locus_tag="BSVBI22_A0281"
                     /note="YcdC-like protein, C-terminal region; Region:
                     TetR_C_3; pfam08362"
                     /db_xref="CDD:203918"
     gene            289601..289990
                     /locus_tag="BSVBI22_A0282"
                     /db_xref="GeneID:11727757"
     CDS             289601..289990
                     /locus_tag="BSVBI22_A0282"
                     /note="identified by match to protein family HMM PF00293"
                     /codon_start=1
                     /transl_table=11
                     /product="MutT/nudix family protein"
                     /protein_id="YP_005153983.1"
                     /db_xref="GI:376279977"
                     /db_xref="GeneID:11727757"
                     /translation="MKTIRISAAIIRDEAGRFLLVRKRGSEIFFQPGGKIDDGEDPET
                     CLLREIEEELGIRIGRSQLRYAAKMAAPAANETDATVEAELYHLTLEEGQVPVASSEI
                     EELRWNPPGDTTRPVALLSQAIQARFA"
     misc_feature    289613..289963
                     /locus_tag="BSVBI22_A0282"
                     /note="Members of the Nudix hydrolase superfamily catalyze
                     the hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+, for their
                     activity and contain a highly...; Region:
                     Nudix_Hydrolase_31; cd04690"
                     /db_xref="CDD:240046"
     misc_feature    289700..289768
                     /locus_tag="BSVBI22_A0282"
                     /note="nudix motif; other site"
                     /db_xref="CDD:240046"
     gene            complement(290035..291345)
                     /locus_tag="BSVBI22_A0283"
                     /db_xref="GeneID:11727758"
     CDS             complement(290035..291345)
                     /locus_tag="BSVBI22_A0283"
                     /note="catalyzes the first step in pyrimidine degradation:
                     the NADPH-dependent reduction of uracil and thymine to the
                     corresponding 5,6-dihydropyrimidines"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropyrimidine dehydrogenase"
                     /protein_id="YP_005153984.1"
                     /db_xref="GI:376279978"
                     /db_xref="GeneID:11727758"
                     /translation="MADLSTNFLGIKSPNPFWLASAPPTDKAYNVERAFKAGWGGVVW
                     KTLGAEGPPVVNVNDPRYGAIHGADRRLLGLNNIELITDRPLEINLREMKEVKMRWPD
                     RALIASIMVPCEEEAWKAILPLVEETGADGIELNFGCPHGMSERGMGAAVGQVPEYVG
                     MVVKWCKQYSRMPVITKLTPNITDIRKPARAAFANGTDAVSLINTINSIVSVDLDTMS
                     PVPSIDGRGSHGGYCGPAVKPIALNMVAEIARDAETAGLPISGIGGITTWRDAAEFIA
                     LGCGTVQVCTAAMTYGFKVVQEMIDGLSDWMDSKGYQTLDDFQGCAVSHVTDWQYLNL
                     NYVTKARINQDLCIQCGRCHIACEDTSHQAITAMVNGARHFEVIDEECVGCNLCVNVC
                     PVENCITMEQISGVDPRTKAPIMPAYANWTTHPNNPAAMKEAAE"
     misc_feature    complement(290056..291345)
                     /locus_tag="BSVBI22_A0283"
                     /note="dihydropyrimidine dehydrogenase subunit B;
                     Validated; Region: PRK08318"
                     /db_xref="CDD:236237"
     misc_feature    complement(290437..291339)
                     /locus_tag="BSVBI22_A0283"
                     /note="Dihydropyrimidine dehydrogenase (DHPD) FMN-binding
                     domain.  DHPD catalyzes the first step in pyrimidine
                     degradation: the NADPH-dependent reduction of uracil and
                     thymine to the corresponding 5,6-dihydropyrimidines. DHPD
                     contains two FAD, two FMN, and...; Region: DHPD_FMN;
                     cd02940"
                     /db_xref="CDD:239244"
     misc_feature    complement(order(290464..290472,290476..290481,
                     290518..290520,290527..290529,290605..290610,
                     290617..290619,290629..290631,290641..290643,
                     290659..290664,290722..290727,290797..290802,
                     291061..291063,291073..291075,291082..291084,
                     291091..291099,291106..291108,291112..291114,
                     291154..291168,291172..291174,291178..291186,
                     291247..291252,291256..291264,291274..291279))
                     /locus_tag="BSVBI22_A0283"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239244"
     misc_feature    complement(order(290731..290739,290815..290817,
                     290929..290934,290938..290940,291109..291111,
                     291115..291117,291160..291162,291208..291213))
                     /locus_tag="BSVBI22_A0283"
                     /note="active site"
                     /db_xref="CDD:239244"
     misc_feature    complement(order(290731..290736,290815..290817,
                     290938..290940,291109..291111,291115..291117,
                     291160..291162,291211..291213))
                     /locus_tag="BSVBI22_A0283"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239244"
     misc_feature    complement(order(290731..290736,290932..290934,
                     290938..290940,291109..291111,291115..291117))
                     /locus_tag="BSVBI22_A0283"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239244"
     misc_feature    complement(290149..290340)
                     /locus_tag="BSVBI22_A0283"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     gene            complement(291349..292854)
                     /locus_tag="BSVBI22_A0284"
                     /db_xref="GeneID:11727759"
     CDS             complement(291349..292854)
                     /locus_tag="BSVBI22_A0284"
                     /note="function undetermined; similar to glutamate
                     synthase beta subunit and related oxidoreductases which
                     transfer electrons from NADPH to an acceptor protein or
                     protein domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="YP_005153985.1"
                     /db_xref="GI:376279979"
                     /db_xref="GeneID:11727759"
                     /translation="MRSMKHTGSAGSSSIDAGSPDIRGARLPAGDYAHVFDDLHPPLS
                     PHEAIVESDRCYFCYDAPCMNACPTGIDIPLFIRQINAGNPAGAARTILAENILGGMC
                     ARVCPTETLCEEVCVREVAEGKPVKIGHLQRYATDMLMATGNHPFTRAAETGRHIAVV
                     GAGPAGISAAHRLAMHGHQVTIFEARPKGGGLNEYGIAAYKTVNNFAQRELDFVLQIG
                     GIHIEYNQTLGQDITVEALKAGYDAVFLAMGLPGVNDLGLAGEDAPNVLDAVDYIANL
                     RQARNLSTLPVGRDIVVIGGGMTAIDVAIQTKKLGANNVTIVYRRGQESMNASAYEQE
                     LAQIHGVVIRHWLQPHALERSEDGIVHAITFEYTANRDGKLVGTGEYLTLEADQVFKA
                     IGQTFDPEPLRGSGIALAKGRISVDAEGRTSVEGIWAGGDCVAGGKDLTVASVEDGKV
                     AALSIHAALTSRPEAVEGFAEAVLSGAAHYAPAAPSRHATVQPGSEQGLGD"
     misc_feature    complement(291460..292797)
                     /locus_tag="BSVBI22_A0284"
                     /note="dihydropyrimidine dehydrogenase subunit A;
                     Provisional; Region: PRK11749"
                     /db_xref="CDD:236967"
     misc_feature    complement(292426..292761)
                     /locus_tag="BSVBI22_A0284"
                     /note="Dihydroprymidine dehydrogenase domain II, 4Fe-4S
                     cluster; Region: Fer4_20; pfam14691"
                     /db_xref="CDD:258829"
     misc_feature    complement(<292282..292380)
                     /locus_tag="BSVBI22_A0284"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    complement(291775..291984)
                     /locus_tag="BSVBI22_A0284"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            complement(293033..293485)
                     /locus_tag="BSVBI22_A0285"
                     /db_xref="GeneID:11727760"
     CDS             complement(293033..293485)
                     /locus_tag="BSVBI22_A0285"
                     /note="identified by similarity to GP:15073317"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153986.1"
                     /db_xref="GI:376279980"
                     /db_xref="GeneID:11727760"
                     /translation="MDLTGEERIAAPRQAVWDALNDIETLKACIPGCDGIERISETEI
                     RAALKVSFGILKVRFHGMLELSNMRPPESYTISGHGEGSIAGFAHGVTDVRLHEDGSA
                     TVLSYVIRGDAGGKVAQLGSRLLGSVARKIADRFFTNIAEAAAKQDVL"
     misc_feature    complement(293051..293485)
                     /locus_tag="BSVBI22_A0285"
                     /note="Carbon monoxide dehydrogenase subunit G (CoxG);
                     Region: CoxG; cd05018"
                     /db_xref="CDD:176853"
     misc_feature    complement(order(293066..293068,293075..293083,
                     293087..293095,293099..293113,293153..293155,
                     293159..293161,293165..293167,293171..293173,
                     293198..293200,293204..293206,293210..293218,
                     293252..293254,293258..293260,293264..293266,
                     293282..293284,293291..293299,293309..293311,
                     293321..293323,293336..293338,293342..293344,
                     293348..293350,293354..293356,293360..293362,
                     293378..293380,293396..293398,293408..293410,
                     293423..293428,293432..293440,293465..293467,
                     293471..293473,293477..293479))
                     /locus_tag="BSVBI22_A0285"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176853"
     gene            293636..295285
                     /gene="pgi"
                     /locus_tag="BSVBI22_A0286"
                     /db_xref="GeneID:11727761"
     CDS             293636..295285
                     /gene="pgi"
                     /locus_tag="BSVBI22_A0286"
                     /note="functions in sugar metabolism in glycolysis and the
                     Embden-Meyerhof pathways (EMP) and in gluconeogenesis;
                     catalyzes reversible isomerization of glucose-6-phosphate
                     to fructose-6-phosphate; member of PGI family"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="YP_005153987.1"
                     /db_xref="GI:376279981"
                     /db_xref="GeneID:11727761"
                     /translation="MARDATKLEATVAKLKKHWAESAPRDMRAAFSADPGRFGRYSLC
                     LDDLLFDWSKCRVNDETMALLKELAVAADVEGRRAAMFAGEHINNTEDRAVLHVALRD
                     TSSKEVLVDGHNVLPDVKHVLDRMAAFADGIRSGALKGATGRKITDIVNIGIGGSDLG
                     PVMATLALAPYHDGPRAHFVSNIDGAHIADTLSPLDPASTLIIVASKTFTTIETMTNA
                     QTARKWVADTLGEAAVGAHFAAVSTALDKVAAFGIPEDRVFGFWDWVGGRYSVWSAIG
                     LPVMIAVGPDNFRKFLAGAHAMDVHFRDAPLEKNLPVMLGLIGYWHRAICGYGSRAII
                     PYDQRLSRLPAYLQQLDMESNGKSVTLDGKPVSGPTGPVVWGEPGTNGQHAFFQLLHQ
                     GTDTIPLEFIVAAKGHEPTLDHQHEMLMANCLAQSEALMKGRTLDEARAQLQAKNLPA
                     SQVERIAPHRVFSGNRPSLTLIHDMLDPYALGRLIALYEHRVFVEAQIFGINAFDQWG
                     VELGKELATELLPVVSGKEGASGRDASTQGLVAHLHARRKA"
     misc_feature    293645..295279
                     /gene="pgi"
                     /locus_tag="BSVBI22_A0286"
                     /note="glucose-6-phosphate isomerase; Reviewed; Region:
                     pgi; PRK00179"
                     /db_xref="CDD:234679"
     misc_feature    293999..294481
                     /gene="pgi"
                     /locus_tag="BSVBI22_A0286"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the first SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_1; cd05015"
                     /db_xref="CDD:240146"
     misc_feature    order(294095..294097,294101..294106,294251..294259,
                     294266..294268,294434..294436)
                     /gene="pgi"
                     /locus_tag="BSVBI22_A0286"
                     /note="active site"
                     /db_xref="CDD:240146"
     misc_feature    order(294176..294187,294272..294274,294284..294286,
                     294293..294295)
                     /gene="pgi"
                     /locus_tag="BSVBI22_A0286"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240146"
     misc_feature    294623..295192
                     /gene="pgi"
                     /locus_tag="BSVBI22_A0286"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the second SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_2; cd05016"
                     /db_xref="CDD:240147"
     misc_feature    order(294644..294646,294680..294682,294692..294694,
                     294701..294706,294764..294766,294770..294778,
                     294785..294790,294797..294802,294809..294811,
                     294878..294880,294884..294886,294908..294910,
                     294917..294919)
                     /gene="pgi"
                     /locus_tag="BSVBI22_A0286"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240147"
     misc_feature    order(294680..294682,294692..294694)
                     /gene="pgi"
                     /locus_tag="BSVBI22_A0286"
                     /note="active site"
                     /db_xref="CDD:240147"
     gene            295521..296582
                     /locus_tag="BSVBI22_A0287"
                     /db_xref="GeneID:11727762"
     CDS             295521..296582
                     /locus_tag="BSVBI22_A0287"
                     /note="identified by similarity to GP:15073237"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153988.1"
                     /db_xref="GI:376279982"
                     /db_xref="GeneID:11727762"
                     /translation="MKTEIIKFAGDVPGNAIELRVLRFEGKDAKAPGAYLQSSLHGAE
                     LPGQAALHFLIPMLKQAAEEGRILGNITLVPQANPIGSNQWQAHQHLGRFETFSLINF
                     NRAFPLLPDFDTSDLPGPDAPVALAQRLKATLLKLALANDIVLDLHCDDEGENYVYIA
                     EEFVEDMKDLAIALNSTAILAWNTTLDAAFDEACAHPVLQLPADKRNMKRRAVTTVEF
                     RGMSDVYADMGRGDAEGLYRFLVHRGVVRDENVKLDGEYKGLVTPLSHVEMIRAPEGG
                     MVLFHVAPGDVVEAGAKLATVVTRPGEPEGDIAITAPQAGRILTRRSLRYVRRGDDLL
                     KLLADKPSAVKKRAGALEA"
     misc_feature    295521..296552
                     /locus_tag="BSVBI22_A0287"
                     /note="Predicted deacylase [General function prediction
                     only]; Region: COG3608"
                     /db_xref="CDD:226135"
     misc_feature    295530..296528
                     /locus_tag="BSVBI22_A0287"
                     /note="Peptidase M14 Succinylglutamate desuccinylase
                     (ASTE)/aspartoacylase (ASPA)-like subfamily; subgroup
                     includes Pseudomonas aeruginosa AotO; Region:
                     M14_PaAOTO_like; cd06250"
                     /db_xref="CDD:199870"
     misc_feature    order(295641..295643,295650..295652,295797..295799,
                     295827..295832,295962..295964,295983..295985,
                     296139..296141,296169..296171)
                     /locus_tag="BSVBI22_A0287"
                     /note="active site"
                     /db_xref="CDD:199870"
     misc_feature    order(295641..295643,295650..295652,295962..295964)
                     /locus_tag="BSVBI22_A0287"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:199870"
     gene            296579..297328
                     /locus_tag="BSVBI22_A0288"
                     /db_xref="GeneID:11727763"
     CDS             296579..297328
                     /locus_tag="BSVBI22_A0288"
                     /note="identified by match to protein family HMM PF00702;
                     match to protein family HMM TIGR01549"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD superfamily hydrolase"
                     /protein_id="YP_005153989.1"
                     /db_xref="GI:376279983"
                     /db_xref="GeneID:11727763"
                     /translation="MMAAHLADRVKSIRAVLFDKDGTLIDFDRTWFSISWQLAQWSAQ
                     GDEVLARALLDAGGYDWLAERFRANSVIAAGTVEDIVSLWHPGLAGPQLRSLIEKYDA
                     YCIAEGARSAIAIEAVHETLAVLRGAGYRLGIATNDSEAGARVTAKALGIDHLFDVMI
                     GYDTAARPKPFPDPLLYFAEKLGLSPHEIAMVGDNLHDLETAHAAGAGLAVGVLSGNS
                     PREALEPHADLVLESVAGLPAILQPFVLPSA"
     misc_feature    296579..>297136
                     /locus_tag="BSVBI22_A0288"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    296606..297310
                     /locus_tag="BSVBI22_A0288"
                     /note="Predicted phosphatases [General function prediction
                     only]; Region: Gph; COG0546"
                     /db_xref="CDD:223620"
     misc_feature    296876..297217
                     /locus_tag="BSVBI22_A0288"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    296984..296986
                     /locus_tag="BSVBI22_A0288"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(297301..298173)
                     /locus_tag="BSVBI22_A0289"
                     /db_xref="GeneID:11727764"
     CDS             complement(297301..298173)
                     /locus_tag="BSVBI22_A0289"
                     /note="identified by similarity to OMNI:NTL03PA01240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153990.1"
                     /db_xref="GI:376279984"
                     /db_xref="GeneID:11727764"
                     /translation="MSETVEFQAEDGISLSGQLFQGTGGKPLVLVSSATAVPQGFYAA
                     FARHLVDHGARAVLTYDYRGVSASRLTGKSRKPIRFKDWAMLDFPAALRQLQSVEPGH
                     ETVSIGQSFGGQALGISGQSAAFTRYGMVAAMSGALRLLNDRWAWPRMNLVGVPVSYF
                     TKNMPKWVGGEPIPGTVFRDWARWCRMENYFFDDPHLNARELVAAVRTPIFAIGLDDD
                     PWGTRAAVQHFLDYHVNAPIGQRWYSRKMAGNQPIGHLGYFRSRFAETLWPEMTGWLL
                     DGKMPDQAEGSTKG"
     misc_feature    complement(297346..298149)
                     /locus_tag="BSVBI22_A0289"
                     /note="Predicted alpha/beta hydrolase [General function
                     prediction only]; Region: COG4757"
                     /db_xref="CDD:227099"
     misc_feature    complement(<297982..>298104)
                     /locus_tag="BSVBI22_A0289"
                     /note="Trimeric dUTP diphosphatases; Region:
                     trimeric_dUTPase; cl00493"
                     /db_xref="CDD:241902"
     gene            complement(298199..299863)
                     /gene="fadD"
                     /locus_tag="BSVBI22_A0290"
                     /db_xref="GeneID:11727765"
     CDS             complement(298199..299863)
                     /gene="fadD"
                     /locus_tag="BSVBI22_A0290"
                     /note="activates fatty acids by binding to coenzyme A"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="YP_005153991.1"
                     /db_xref="GI:376279985"
                     /db_xref="GeneID:11727765"
                     /translation="MEKIWLKSYPAGVPHDINLSAATSISDMISASCRQFANSPAFTC
                     MGKDISYKELDDHSRALAAWLQSRGLVKGDRVAIMMPNILQYPITFTAVLRAGFVVVN
                     VNPLYTPRELEHQLNDAGAKALVVLENFATTVEKALPSINVPNILVASMGDMLGFKGH
                     IVNLVVRRVKKMVPAWNIPGHVRFKDALAQGRAKSFNPVPVQGCDIAFLQYTGGTTGI
                     SKGAMLTHSNILANVEQMNLWMDVAFRNKGKPKALNFVCALPLYHIFALTVNAMIGMK
                     LGARNILIPNPRDIPSFVKELKKYPVHIFPGLNTLFNGLMNNPDFQTLDFKPLILTLG
                     GGMAVQRPVAERWQHMTGCHITEGYGLSETSPVACANALDATEFTGTIGLPMPSTDVV
                     IRDDDGSDLPLGKVGEICVRGPQVMKGYWNRPEETARAIMADGFFRTGDMGFMDERGY
                     TKIVDRKKDMILVSGFNVYPNEIEEVAAEHPGVLESAAVGIPNEHSGEVVKLYVVRRD
                     PELTEDEVKAFCAERLTNYKRPREVEFRESLPKSNVGKILRRELRD"
     misc_feature    complement(298202..299863)
                     /gene="fadD"
                     /locus_tag="BSVBI22_A0290"
                     /note="Long-chain-fatty-acid--CoA ligase; Validated;
                     Region: PRK07059"
                     /db_xref="CDD:235923"
     misc_feature    complement(298205..299791)
                     /gene="fadD"
                     /locus_tag="BSVBI22_A0290"
                     /note="Prokaryotic long-chain fatty acid CoA synthetases
                     similar to Escherichia coli FadD; Region:
                     FC-FACS_FadD_like; cd05936"
                     /db_xref="CDD:213302"
     misc_feature    complement(order(299204..299209,299213..299230,
                     299237..299239))
                     /gene="fadD"
                     /locus_tag="BSVBI22_A0290"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    complement(order(298226..298228,298463..298465,
                     298496..298498,298505..298507,298541..298543,
                     298778..298795,298856..298861,299228..299230))
                     /gene="fadD"
                     /locus_tag="BSVBI22_A0290"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    complement(order(298283..298285,298463..298474,
                     298496..298498,298505..298507,298541..298543,
                     298778..298795,298856..298861,298922..298924,
                     298931..298936,298940..298942,299084..299089,
                     299228..299230))
                     /gene="fadD"
                     /locus_tag="BSVBI22_A0290"
                     /note="putative active site [active]"
                     /db_xref="CDD:213302"
     misc_feature    complement(order(298283..298285,298301..298303,
                     298466..298474,298859..298861,298922..298924,
                     298931..298936,299087..299089))
                     /gene="fadD"
                     /locus_tag="BSVBI22_A0290"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     gene            complement(300295..300924)
                     /locus_tag="BSVBI22_A0291"
                     /db_xref="GeneID:11727766"
     CDS             complement(300295..300924)
                     /locus_tag="BSVBI22_A0291"
                     /note="identified by match to protein family HMM PF00440"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005153992.1"
                     /db_xref="GI:376279986"
                     /db_xref="GeneID:11727766"
                     /translation="MRRTKAEAAETREAILLAAEQVFLERGVNQSTLTEIACYAGVTR
                     GAIYFHFEDKLDIFQSIIGRARFPQEEIMLQAARFDHPNPLHILEQSIVAALELFATD
                     ERQQVVFTIINQRCEYVGEMAPVIDRLKEMRSDVLALFIGLLKVAERRGELASEWSAE
                     TAAQILLAMVGGFLNEWLHGEKGFDLIIHGSRVISTVIQSLRAPANIPQ"
     misc_feature    complement(300307..300921)
                     /locus_tag="BSVBI22_A0291"
                     /note="DNA-binding transcriptional repressor AcrR;
                     Provisional; Region: PRK10668"
                     /db_xref="CDD:182632"
     misc_feature    complement(300742..300882)
                     /locus_tag="BSVBI22_A0291"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    complement(300322..300678)
                     /locus_tag="BSVBI22_A0291"
                     /note="MAATS-type transcriptional repressor, C-terminal
                     region; Region: TetR_C_2; pfam08361"
                     /db_xref="CDD:116942"
     gene            301097..302290
                     /locus_tag="BSVBI22_A0292"
                     /db_xref="GeneID:11727767"
     CDS             301097..302290
                     /locus_tag="BSVBI22_A0292"
                     /note="identified by match to protein family HMM PF00529;
                     match to protein family HMM TIGR01730"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="YP_005153993.1"
                     /db_xref="GI:376279987"
                     /db_xref="GeneID:11727767"
                     /translation="MTLNRTIRCFAAGAAFIVFAAQPALAQAPGGATPPPPQVFVVDI
                     KPHDVPVTYEYAARINAYRNVQVRARVGGILLHRNFVEGTQVKAGEVLFEIDPAPYQA
                     ELEKAQAQVAQAEAQYQQSIRDAERAEQLVQQKVQSAAVRDSAFATRDLNKAAVAAAK
                     AQLRTAELNLSYTKVTAPISGITSQEQVNEGSLIGTDASSSLLTSVTQLDPVYVNFSF
                     TDTEAAEIAKLRAERGATGEDADRLKIKILFGDGKAYDHEGTIDFTSSSLDTETGTLG
                     VRAVVENPNHRLIPGQFVRAEILDIQVKDAITVPKAALMQSAQGQFVYVVNKDNVVEV
                     RPVTGARELKNDWLISQGLNSGDRVITEGVIKAVPGRPVQPVVQGVDDKAQAEAGKEQ
                     AADKK"
     misc_feature    301211..302224
                     /locus_tag="BSVBI22_A0292"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    301283..301411
                     /locus_tag="BSVBI22_A0292"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    301616..301969
                     /locus_tag="BSVBI22_A0292"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            302287..305442
                     /locus_tag="BSVBI22_A0293"
                     /db_xref="GeneID:11727768"
     CDS             302287..305442
                     /locus_tag="BSVBI22_A0293"
                     /note="identified by match to protein family HMM PF00873;
                     match to protein family HMM TIGR00915"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrophobe/amphiphile efflux-1 family protein"
                     /protein_id="YP_005153994.1"
                     /db_xref="GI:376279988"
                     /db_xref="GeneID:11727768"
                     /translation="MNRFFVDRPVFAAVISIVLVLAGLICIRILPVAQYPELTPPQVV
                     VSATYPGASAETVAQTVAAPLEQQINGVENMLYMQSSSLGSGTMQLTVTFALGTDPDQ
                     ATINVNNRVQRATSSLPQEVQRLGVTVDKRFTTILGMVAMFATTDRYDRTYVGNYALL
                     NVVDDLKRLPGVGDVQLLGNIDYSMRVWLRPDKLAQYNLTPSDVSAAIQEQNAQFAAG
                     RFGDQPDPHAGPFTYTATTQGRLPDAAAFENIILRSSSQNAATLRLKDVARVELGTES
                     YLVDSNLNGTPAVPIAIYLQPGANALNTMELIQNRMNELKASFPAGIDYAIPFDTTKF
                     IKVSIEEVVHTFIEAIILVVLVVFIFLQNWRATLIPVIAVPISIIGTFAGMYVLGFSI
                     NLLTLFGLVLAIGIVVDDAIVVLENVERIMTTEKLSPRKAAIKAMGEVTGPVIAIVLV
                     LCAVFIPVAFMGGLVGEMYKQFAVTIAISVTLSGLVALTLTPALCALILKPGHHEPIL
                     PFRIFNRAFERVTSGYTRGVRFFLKRATIGLIIFAGLLGSTYYLFERVPGSLLPDEDQ
                     GFLFGVAVLPPAASLERTTVVLDQVSENIRKNPAVDNVFAVSGFDLLSGGLKTSAGTM
                     FIMLKDWKERTTPDADARNLPRTIMGMNAGIKDGMVLAFNPPPIMGLSTTGGFELYVQ
                     DRTGGGVESLTQATKLITEAAAKRPELQGVRTTFDPNVPQYDIQLDREKAKAMGVPIN
                     SVFTAMQATFGSLYVNDFTLYGRNYQVNLQSEAEFRRDPGDLKHVFVRADSGSMIPLD
                     ALVTVKRIVGPDQLERFNAFNAAKVTGNPAPGYTSGDAIKAMQEVAAQVLPQGYQIAW
                     TGSAYQEVSTSGTGSQAMIFGLIMVFLILAAQYERWSLPLAVITAVPFAIFGALLATD
                     LRGLTNDVYFQIGLVTLIGLAAKNAILIVEFAVLERESGKSAIEAAASAARLRFRPIV
                     MTSLAFILGVVPLAVSTGAGSASRHSIGTGVIGGMLAATFIATFFIPMFYSLIARKPP
                     KKHEDETADTPETPGGTGGGI"
     misc_feature    302287..305400
                     /locus_tag="BSVBI22_A0293"
                     /note="The (Largely Gram-negative Bacterial)
                     Hydrophobe/Amphiphile Efflux-1 (HAE1) Family; Region:
                     2A0602; TIGR00915"
                     /db_xref="CDD:233182"
     misc_feature    <303331..303780
                     /locus_tag="BSVBI22_A0293"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    <304891..305358
                     /locus_tag="BSVBI22_A0293"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(305553..305720)
                     /locus_tag="BSVBI22_A0294"
                     /db_xref="GeneID:11727769"
     CDS             complement(305553..305720)
                     /locus_tag="BSVBI22_A0294"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153995.1"
                     /db_xref="GI:376279989"
                     /db_xref="GeneID:11727769"
                     /translation="MFDGIPAQWHKAPEQARRSPNEAAYVFLGIMLAVLSVPAVFLGW
                     AIFLSVGLMLQ"
     gene            complement(305941..306081)
                     /locus_tag="BSVBI22_A0295"
                     /db_xref="GeneID:11727770"
     CDS             complement(305941..306081)
                     /locus_tag="BSVBI22_A0295"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153996.1"
                     /db_xref="GI:376279990"
                     /db_xref="GeneID:11727770"
                     /translation="MTHFSEIPAETEPSEPLYLFVFSHVLTPKLAPTFGDMLRTRNFR
                     KF"
     gene            complement(306150..306992)
                     /locus_tag="BSVBI22_A0296"
                     /db_xref="GeneID:11727771"
     CDS             complement(306150..306992)
                     /locus_tag="BSVBI22_A0296"
                     /note="identified by match to protein family HMM PF00497"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005153997.1"
                     /db_xref="GI:376279991"
                     /db_xref="GeneID:11727771"
                     /translation="MKSCLLSLTISMCLFAPAAHAAGEEPAAPHFFNQKERLPLPSLQ
                     GLNRLRFITTVDFPPFNRLNERGQLSGYNIDLAKALCQQLKIEDICQIEAVPWAELEE
                     RVLDGQADAIVAGWEPTDRNREKFTFTRSYMRLPARFATSNAKSFTEPAAKATQDKPV
                     GVIAGTAHEALLKNYFPQAKPVPYPNRDAMLTALKDGKIDTVFDDGMSLSAWLDSAEG
                     SACCTFTDGPYLAPQYLGSGLSIAVTRQNSALASAFNNALQALQQEGKLTELYLRYFP
                     ASFY"
     misc_feature    complement(306168..306848)
                     /locus_tag="BSVBI22_A0296"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(306168..306848)
                     /locus_tag="BSVBI22_A0296"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(306378..306380,306492..306494,
                     306627..306629,306702..306704,306822..306824))
                     /locus_tag="BSVBI22_A0296"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(306399..306401,306417..306419,
                     306429..306431))
                     /locus_tag="BSVBI22_A0296"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(306279..306296)
                     /locus_tag="BSVBI22_A0296"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            307258..309150
                     /locus_tag="BSVBI22_A0297"
                     /db_xref="GeneID:11727772"
     CDS             307258..309150
                     /locus_tag="BSVBI22_A0297"
                     /note="identified by match to protein family HMM PF00535"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_005153998.1"
                     /db_xref="GI:376279992"
                     /db_xref="GeneID:11727772"
                     /translation="MKVGSNLVDLEICSAISARLKRCGMPQDRIENAFSAAHLHGTGF
                     FEEAVHQPGVTERMVYEAIADYLQLPYTEEILPSRIFVSGDENICFAHIRQVMVIGRD
                     GISYLYIAPGERRIARLREHLKAAPQLRERIRICTPSVLKSILRQRHQRDLVMRAHAM
                     TPQLFSAARVLDTPQAFVIAMAVYAFLGCIVNWPMKTMLALHVAMSLFFFGCVLIRLF
                     AAASGKRLQFTEIAPFKPRDLPVYSILVPLYREKDVVAQLIAALNRLNWPRSKLDIKL
                     VCEKDDYETIAAIRCNTMPSNFKLVLVPPGGSRTKPKALNYALQFARGEIVAVFDAED
                     RPHPDQLLEAWQAFRRGGSKLACVQAPLIIGNFRRNLLTRMFAFEYAVLFRGLLPWLA
                     RRGLVIPLGGTSNHFRRSCLEQVGGWDAYNVTEDADLGMRLARFGYRIDVISRGTIED
                     APEEHGVWHRQRTRWIKGWMQTWLVHGRQPMSTWRELGWWRFVVSQIYTLGIIGSALL
                     HPLMLLMLAGLCLRMAFGPLTPQGLWLLALDVINILMAYMSFHMLGAKTMEPTELGGY
                     AYFLAIPIYWVLISLSAWRAVWQLVRQPHLWEKTPHQPNLFYIPLEDASSEFDARNAA
                     PRPIMD"
     misc_feature    307834..309045
                     /locus_tag="BSVBI22_A0297"
                     /note="Glycosyltransferases, probably involved in cell
                     wall biogenesis [Cell envelope biogenesis, outer
                     membrane]; Region: COG1215"
                     /db_xref="CDD:224136"
     misc_feature    307975..308697
                     /locus_tag="BSVBI22_A0297"
                     /note="CESA_like_2 is a member of the cellulose synthase
                     superfamily; Region: CESA_like_2; cd06427"
                     /db_xref="CDD:133049"
     misc_feature    308248..308256
                     /locus_tag="BSVBI22_A0297"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133049"
     gene            complement(309078..310037)
                     /locus_tag="BSVBI22_A0298"
                     /db_xref="GeneID:11727773"
     CDS             complement(309078..310037)
                     /locus_tag="BSVBI22_A0298"
                     /note="identified by similarity to GP:15155336; match to
                     protein family HMM PF03976"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005153999.1"
                     /db_xref="GI:376279993"
                     /db_xref="GeneID:11727773"
                     /translation="MGDSSKTANKKKAKKNGTKSAEKPIKIEIANKKRKFDINDPKLP
                     GWIDDCALQSGGYPYSSKMKSDEYEATLERLQIELVKLQYWLQNTGERVISVFEGRDA
                     AGKGGTIFTIRQFMNPRTARNVALPKPTETERGQWYFQRYVSHFPTAGEFVTFDRSWY
                     NRAGVERVMGFCTPQQLETFLTETPDFERMIVTDGIHLFKFWLDIGQEMQLKRFHERR
                     HSPLKNWKFSPMDIAGISRWDDYSTALHTMLERTDTGYAPWTIIRANDKRRARLAAIR
                     RILLTLPYEGRDIDAIGAEDQSIIGRGAAFLASNSEEASSSGM"
     misc_feature    complement(309174..309959)
                     /locus_tag="BSVBI22_A0298"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2326"
                     /db_xref="CDD:225207"
     gene            310170..311486
                     /locus_tag="BSVBI22_A0299"
                     /db_xref="GeneID:11727774"
     CDS             310170..311486
                     /locus_tag="BSVBI22_A0299"
                     /note="identified by match to protein family HMM PF00512;
                     match to protein family HMM PF02518"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_005154000.1"
                     /db_xref="GI:376279994"
                     /db_xref="GeneID:11727774"
                     /translation="MSEDSGRAGPEARTETSLFEPLLRIKGVLFVSMVLAICVMALDL
                     SFWFRAILLALVVLGAVWAAAGIGNGEDEKVPLREVASREMAAVSGERLADLLTDPMI
                     VFDHTATVRFANVAALEAFQSLQNGTALYLRFRAPEMLALIQGVIADGEPRNIEYFER
                     VPIDRWYKAMVKALRDAEGKPELFVLIFRDQSETRRIDRMRSDFIANASHELRTPLAS
                     LRGFIETLQGPARNDAAARDRFLDIMQKQAERMSRLIDDLLSLSRLEMRAHLAVNESV
                     DVAATLAHVADTLTPLAAGLGVTIERHLPEHPVHVMGARDELIQVFQNLVENACKYGQ
                     EGKRVIIRLSEEDTGNATEVVASIQDFGPGIAAEHLPRLTERFYRIDVETSRAHKGTG
                     LGLAIVKHILARHRGRLVVRSQLGEGSTFMVRLPGQNARSAEAATI"
     misc_feature    310458..311444
                     /locus_tag="BSVBI22_A0299"
                     /note="phosphate regulon sensor kinase PhoR; Region:
                     phoR_proteo; TIGR02966"
                     /db_xref="CDD:234074"
     misc_feature    310761..310958
                     /locus_tag="BSVBI22_A0299"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(310779..310781,310791..310793,310803..310805,
                     310812..310814,310824..310826,310833..310835,
                     310887..310889,310899..310901,310908..310910,
                     310920..310922,310929..310931,310941..310943)
                     /locus_tag="BSVBI22_A0299"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    310797..310799
                     /locus_tag="BSVBI22_A0299"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    311121..311444
                     /locus_tag="BSVBI22_A0299"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(311139..311141,311151..311153,311160..311162,
                     311241..311243,311247..311249,311253..311255,
                     311259..311264,311343..311354,311400..311402,
                     311406..311408,311421..311426,311430..311432)
                     /locus_tag="BSVBI22_A0299"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    311151..311153
                     /locus_tag="BSVBI22_A0299"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(311253..311255,311259..311261,311343..311345,
                     311349..311351)
                     /locus_tag="BSVBI22_A0299"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(311616..312158)
                     /locus_tag="BSVBI22_A0300"
                     /db_xref="GeneID:11727775"
     CDS             complement(311616..312158)
                     /locus_tag="BSVBI22_A0300"
                     /note="identified by similarity to GP:15073446"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154001.1"
                     /db_xref="GI:376279995"
                     /db_xref="GeneID:11727775"
                     /translation="MNWTDERVELLKKLWSEGLSASQIAAQLGGVSRNAVIGKVHRLK
                     LSGRGKTTTAAPRSKKVNTPAAAPRPAVQNNNSGTHTTTMRTATVTKTVGATALQMEY
                     ATEVVAETVIKPASDVVVPISRHLTLLQLSERTCKWPIGDPLNEDFHFCGNESGEASP
                     YCSYHSRLAFQPTAERRRAR"
     misc_feature    complement(311619..312158)
                     /locus_tag="BSVBI22_A0300"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5352"
                     /db_xref="CDD:227655"
     gene            complement(312330..312671)
                     /locus_tag="BSVBI22_A0301"
                     /db_xref="GeneID:11727776"
     CDS             complement(312330..312671)
                     /locus_tag="BSVBI22_A0301"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154002.1"
                     /db_xref="GI:376279996"
                     /db_xref="GeneID:11727776"
                     /translation="MQSGGNKKPPSGRHLSGAYIGLCKKNVNQSKQAYGASLRMGSCR
                     RPHHTTGTGNPGWSGYMKPGSSPLGGGRARSQARPLHGRLENARHDGRRIKEKPPLQP
                     KLGKTTKMESA"
     gene            312761..313972
                     /gene="argD"
                     /locus_tag="BSVBI22_A0302"
                     /db_xref="GeneID:11727777"
     CDS             312761..313972
                     /gene="argD"
                     /locus_tag="BSVBI22_A0302"
                     /note="DapATase; functions in arginine biosynthetic
                     pathway; catalyzes the formation of N-acetyl-L-glutamate
                     5-semialdehyde from 2-oxoglutarate and
                     N(2)-acetyl-L-ornithine"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine transaminase protein"
                     /protein_id="YP_005154003.1"
                     /db_xref="GI:376279997"
                     /db_xref="GeneID:11727777"
                     /translation="MTDATTVHPLYDTYNRAALRFERGEGIWLITEDGERYIDFAAGI
                     AVNSLGHSHPHLVETLKTQAEKLWHLSNVYEIPAQEKLGRRLVESTFADKVFFTNSGA
                     EALECAIKTARRYQYVSGHPERFRIITFEGAFHGRTLATIAAGGQAKYLEGFGPKVEG
                     FDQVPFGDEAALRAAITPETAGILLEPIQGEGGLRAFPEEFLRLVRQICDENGLLLLL
                     DEVQTGVGRTGKLFAHEWAGIRPDIMAIAKGIGGGFPIGACLATAEAAKGMTAGMHGT
                     TYGGNPLGMAVGNAVLDVVLADGFMENVQATALVMKQGLASLVDRYPNVVSEIRGRGL
                     LMGLKCVVPNTSLIQALRDEHILSVGAGDNVVRLLPPLITTPEEAREALKHIETAVER
                     LSIANPISKTV"
     misc_feature    312779..313930
                     /gene="argD"
                     /locus_tag="BSVBI22_A0302"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    312800..313939
                     /gene="argD"
                     /locus_tag="BSVBI22_A0302"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(313058..313066,313160..313165,313169..313171,
                     313316..313318,313415..313417,313421..313426,
                     313502..313504)
                     /gene="argD"
                     /locus_tag="BSVBI22_A0302"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(313061..313066,313160..313165,313316..313318,
                     313415..313417,313424..313426,313502..313504)
                     /gene="argD"
                     /locus_tag="BSVBI22_A0302"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    313502..313504
                     /gene="argD"
                     /locus_tag="BSVBI22_A0302"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            313977..314915
                     /gene="argF"
                     /locus_tag="BSVBI22_A0303"
                     /db_xref="GeneID:11727778"
     CDS             313977..314915
                     /gene="argF"
                     /locus_tag="BSVBI22_A0303"
                     /note="catalyzes the formation of L-citrulline from
                     carbamoyl phosphate and L-ornithine in arginine
                     biosynthesis and degradation"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="YP_005154004.1"
                     /db_xref="GI:376279998"
                     /db_xref="GeneID:11727778"
                     /translation="MANDNGIKHFIDLSTVPATELRAILEDAKARKARLKAGEVERPY
                     AGKVLAMIFEKPSTRTRVSFDVGMRQLGGETIMLTGSEMQLGRSEAIADTAKVLSRYV
                     DAIMIRTTAHERMLELAEYATVPVINALTDDTHPCQIMADVLTYEEHRGPIKGKTFAW
                     MGDGNNVLHSLVEAAARFDFNVNIATPKGSEPKSQYIDWARANGAGIMSTTDPEKAAS
                     GADCIVTDTWVSMGQEDHARGHNVFIPYQVNANLMAKADPKALFMHCLPAHRGEEVTD
                     EVIDGPQSVVFDEAENRLHAQKAILAWCLQDRGLGA"
     misc_feature    313995..314891
                     /gene="argF"
                     /locus_tag="BSVBI22_A0303"
                     /note="ornithine carbamoyltransferase; Provisional;
                     Region: PRK00779"
                     /db_xref="CDD:234835"
     misc_feature    313998..314423
                     /gene="argF"
                     /locus_tag="BSVBI22_A0303"
                     /note="Aspartate/ornithine carbamoyltransferase,
                     carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
                     /db_xref="CDD:251498"
     misc_feature    314436..314888
                     /gene="argF"
                     /locus_tag="BSVBI22_A0303"
                     /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
                     binding domain; Region: OTCace; pfam00185"
                     /db_xref="CDD:249663"
     gene            314917..315939
                     /gene="hslO"
                     /locus_tag="BSVBI22_A0304"
                     /db_xref="GeneID:11727779"
     CDS             314917..315939
                     /gene="hslO"
                     /locus_tag="BSVBI22_A0304"
                     /note="becomes active under oxidative stress; four
                     conserved cysteines bind a zinc atom when they are in the
                     reduced state and the enzyme is inactive; oxidative stress
                     results in oxidized cysteines, release of zinc, and
                     binding of Hsp33 to aggregation-prone proteins; forms
                     dimers and higher order oligomers"
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp33-like chaperonin"
                     /protein_id="YP_005154005.1"
                     /db_xref="GI:376279999"
                     /db_xref="GeneID:11727779"
                     /translation="MSDKTSNEHTEAENIQTGLGGFNFAGDDAVVHFQVEGLDVRGRA
                     VQLGPSINAILKRHEYPEEVARLLAEATVLTVLLGTSLKFDGKFIFQTQSDGPVDMLV
                     VDFRTPRSVRAYARYDEARLKEAIAANKTRPEELLGNGTLAFTVDQGIYTQRYQGIVA
                     LDGSTLEEIAVTYFRQSEQIPTDLKLSVAKLIERGADGKPVEQWRAGGLIIQFLPESE
                     LRARVPDLPGGDGDDSQLIHHPEDDAWDEARSLVGTIESSELTDPQVGSERLLYRLFH
                     ERGVRVFDSIAVIDECSCSREKIAGVLSGFTAEEIKDSVEDGKISVTCEFCSKLYQFD
                     PAEFTK"
     misc_feature    315004..315918
                     /gene="hslO"
                     /locus_tag="BSVBI22_A0304"
                     /note="Heat shock protein 33 (Hsp33):  Cytosolic protein
                     that acts as a molecular chaperone under oxidative
                     conditions.  In normal (reducing) cytosolic conditions,
                     four conserved Cys residues are coordinated by a Zn ion.
                     Under oxidative stress (such as heat...; Region: Hsp33;
                     cd00498"
                     /db_xref="CDD:238278"
     misc_feature    315022..315927
                     /gene="hslO"
                     /locus_tag="BSVBI22_A0304"
                     /note="Hsp33-like chaperonin; Reviewed; Region: hslO;
                     PRK00114"
                     /db_xref="CDD:234643"
     misc_feature    order(315037..315039,315433..315435,315445..315453,
                     315550..315552,315790..315792)
                     /gene="hslO"
                     /locus_tag="BSVBI22_A0304"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238278"
     misc_feature    order(315037..315039,315532..315534,315538..315540,
                     315550..315555,315592..315597)
                     /gene="hslO"
                     /locus_tag="BSVBI22_A0304"
                     /note="domain crossover interface; other site"
                     /db_xref="CDD:238278"
     misc_feature    order(315790..315792,315796..315798,315886..315888,
                     315895..315897)
                     /gene="hslO"
                     /locus_tag="BSVBI22_A0304"
                     /note="redox-dependent activation switch; other site"
                     /db_xref="CDD:238278"
     gene            complement(315980..316372)
                     /gene="apaG"
                     /locus_tag="BSVBI22_A0305"
                     /db_xref="GeneID:11727780"
     CDS             complement(315980..316372)
                     /gene="apaG"
                     /locus_tag="BSVBI22_A0305"
                     /note="protein associated with Co2+ and Mg2+ efflux"
                     /codon_start=1
                     /transl_table=11
                     /product="ApaG protein"
                     /protein_id="YP_005154006.1"
                     /db_xref="GI:376280000"
                     /db_xref="GeneID:11727780"
                     /translation="MYSAVTRGIEVTVEPFYLEVQSEPEENRYVWGYRVTIVNNSSET
                     VQLCSRYWQITDANGHVQEVRGSGVVGEQPVLDPGASYQYSSGCPLTTSSGVMVGRYQ
                     MKGEDGAQFEIEIPAFSLDVPEQRRTLN"
     misc_feature    complement(315983..316372)
                     /gene="apaG"
                     /locus_tag="BSVBI22_A0305"
                     /note="CO2+/MG2+ efflux protein ApaG; Reviewed; Region:
                     apaG; PRK05461"
                     /db_xref="CDD:180098"
     gene            complement(316741..317937)
                     /gene="metZ"
                     /locus_tag="BSVBI22_A0306"
                     /db_xref="GeneID:11727781"
     CDS             complement(316741..317937)
                     /gene="metZ"
                     /locus_tag="BSVBI22_A0306"
                     /note="catalyzes the conversion of O-succinylhomoserine
                     and sulfide to homocysteine; second step in methionine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylhomoserine sulfhydrylase"
                     /protein_id="YP_005154007.1"
                     /db_xref="GI:376280001"
                     /db_xref="GeneID:11727781"
                     /translation="MTTENARKFRPATELVHAGSLRSGFAEMSEALFLTQGFLYPTAE
                     AAEARFKGEDPGFIYSRYANPTTDMFEKRMCALEGAEDARATASGMAAVAAAILCQVQ
                     AGDHVISARAVFGSCRYIVETVLPRYGVEVSIIDGSDVANWKAAVRPNTKVMFLESPS
                     NPTLEIIDIAAVAQIANEAGAKLIVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGR
                     CLGGVVLSDREWIETTLQDYFRHTGPGLSPFNAWIMLKGLETLSVRVRQQTQSAAAIA
                     DFLAGKPGVKRVIYPGRADHPQADIIAKQMTGGSTLIALELEGGKEAAFKFENALQIF
                     SITNNLGDTKSLITHPATTTHKNLSNEAKAELGISDGLLRVSVGLEDTDDLLEDVEVA
                     LKVARG"
     misc_feature    complement(316756..317856)
                     /gene="metZ"
                     /locus_tag="BSVBI22_A0306"
                     /note="CGS_like: Cystathionine gamma-synthase is a PLP
                     dependent enzyme and catalyzes the committed step of
                     methionine biosynthesis. This pathway is unique to
                     microorganisms and plants, rendering the enzyme an
                     attractive target for the development of...; Region:
                     CGS_like; cd00614"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(316951..316953,317188..317193,
                     317197..317199,317227..317229,317278..317280,
                     317284..317286,317308..317310,317572..317574,
                     317581..317583,317596..317598,317665..317670,
                     317674..317679,317755..317757,317761..317763,
                     317818..317823,317827..317838))
                     /gene="metZ"
                     /locus_tag="BSVBI22_A0306"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(317278..317280,317305..317310,
                     317314..317316,317380..317382,317467..317469,
                     317596..317598,317668..317676))
                     /gene="metZ"
                     /locus_tag="BSVBI22_A0306"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(317305..317310,317314..317316,
                     317371..317373,317380..317382,317596..317598,
                     317668..317676))
                     /gene="metZ"
                     /locus_tag="BSVBI22_A0306"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99738"
     misc_feature    complement(317305..317307)
                     /gene="metZ"
                     /locus_tag="BSVBI22_A0306"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99738"
     gene            318364..319455
                     /locus_tag="BSVBI22_A0307"
                     /db_xref="GeneID:11727782"
     CDS             318364..319455
                     /locus_tag="BSVBI22_A0307"
                     /note="Catalyzes the deamination of dCTP to form dUTP"
                     /codon_start=1
                     /transl_table=11
                     /product="2'-deoxycytidine 5'-triphosphate deaminase"
                     /protein_id="YP_005154008.1"
                     /db_xref="GI:376280002"
                     /db_xref="GeneID:11727782"
                     /translation="MTQRDAGILADADIAALFESGLLASPRLLDADQIQPASLDLRLG
                     AKAYRVRASFMPGPGTPVIDKLERLKLHEIDLTAGAVLETGCVYIVPLLESLALSPEL
                     SASANPKSSTGRLDIFTRVIADGAQEFDKVPAGYKGPLYLEVSPRTFPIVVRTGSRLS
                     QIRFRKGRAQLDESELGVLHKAETLVASEMPNISGGGIALSVDLSGGEDRLIGYRGKH
                     HTGVVDVDKRAAHDVLDFWEPLYDRGAHELVLDPDEFYILVSREAVHVPPLYAAEMTP
                     FDPLVGEFRVHYAGFFDPGFGHSAAGGTGSRAVLEVRSHEVPFILEHGQIVGRLVYEH
                     MLGQPKALYGIDLGSNYQAQQLKLSKHFR"
     misc_feature    318364..319452
                     /locus_tag="BSVBI22_A0307"
                     /note="2'-deoxycytidine 5'-triphosphate deaminase;
                     Provisional; Region: PRK07559"
                     /db_xref="CDD:181028"
     misc_feature    318385..>318696
                     /locus_tag="BSVBI22_A0307"
                     /note="Trimeric dUTP diphosphatases; Region:
                     trimeric_dUTPase; cl00493"
                     /db_xref="CDD:241902"
     misc_feature    318583..318855
                     /locus_tag="BSVBI22_A0307"
                     /note="Trimeric dUTP diphosphatases; Region:
                     trimeric_dUTPase; cd07557"
                     /db_xref="CDD:143638"
     misc_feature    order(318604..318606,318619..318624,318628..318630,
                     318676..318678,318682..318699,318712..318717,
                     318724..318726,318754..318756,318763..318765,
                     318784..318786,318790..318792,318796..318798,
                     318802..318804,318811..318825,318832..318834,
                     318844..318846)
                     /locus_tag="BSVBI22_A0307"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    order(318688..318696,318754..318762,318769..318771,
                     318781..318786)
                     /locus_tag="BSVBI22_A0307"
                     /note="active site"
                     /db_xref="CDD:143638"
     misc_feature    318787..319452
                     /locus_tag="BSVBI22_A0307"
                     /note="Deoxycytidine deaminase [Nucleotide transport and
                     metabolism]; Region: Dcd; COG0717"
                     /db_xref="CDD:223789"
     misc_feature    order(319108..319110,319123..319128,319132..319134,
                     319180..319182,319186..319203,319213..319221,
                     319234..319236,319243..319245,319288..319290,
                     319294..319296,319300..319302,319306..319308,
                     319315..319329,319336..319338,319348..319350)
                     /locus_tag="BSVBI22_A0307"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    order(319192..319200,319234..319242,319249..319251,
                     319258..319260,319288..319290)
                     /locus_tag="BSVBI22_A0307"
                     /note="active site"
                     /db_xref="CDD:143638"
     gene            319546..320562
                     /locus_tag="BSVBI22_A0308"
                     /db_xref="GeneID:11727783"
     CDS             319546..320562
                     /locus_tag="BSVBI22_A0308"
                     /note="identified by match to protein family HMM PF00165;
                     match to protein family HMM PF01965"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005154009.1"
                     /db_xref="GI:376280003"
                     /db_xref="GeneID:11727783"
                     /translation="MSVVNETGRGLGGKAEATADVPPRRLSVGIVVLPGFTLSALSLF
                     LDPFRLAADDRDKSRQIRCAWKICTLSGDPVTSSSGMVIEPTVPLGEIDECDYVAVVG
                     GLLAQYRHSQQALIDLIKRADKRGKAVVGLCTAAFLLAEAGVLEDRNCCVSWFHRDDF
                     LELFDGYTADTTSLFHLSGRHYTCAGGLGAAALALSIIQNEISEELARKSASILLIPY
                     ELVRSEQPALSFNGVRSPMIRKAIRIFEETLEDPVPMIDVARRLGISVRQMERGFRLS
                     LGRTAFEVREELRVKKAKGLLAETSLSLLEVAVASGFTDTRSMNRSFSRQKQKAPRDY
                     RRQR"
     misc_feature    319591..320556
                     /locus_tag="BSVBI22_A0308"
                     /note="Transcriptional regulator containing an amidase
                     domain and an AraC-type DNA-binding HTH domain
                     [Transcription]; Region: COG4977"
                     /db_xref="CDD:227311"
     misc_feature    319627..320196
                     /locus_tag="BSVBI22_A0308"
                     /note="AraC transcriptional regulators having an
                     N-terminal Type 1 glutamine amidotransferase
                     (GATase1)-like domain; Region: GATase1_AraC_ArgR_like;
                     cd03136"
                     /db_xref="CDD:153230"
     misc_feature    319942..319944
                     /locus_tag="BSVBI22_A0308"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153230"
     gene            320649..320915
                     /locus_tag="BSVBI22_A0309"
                     /db_xref="GeneID:11727784"
     CDS             320649..320915
                     /locus_tag="BSVBI22_A0309"
                     /note="identified by similarity to GP:15155415"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154010.1"
                     /db_xref="GI:376280004"
                     /db_xref="GeneID:11727784"
                     /translation="MSDGVNRFLGDTPGRILVKLVLISLVVGVVMSAFHWTPYDILYG
                     IRDFFLHLWNMGFSAVARFADYLVLGAAVVIPAFILLRILSYRK"
     gene            321015..321434
                     /locus_tag="BSVBI22_A0310"
                     /db_xref="GeneID:11727785"
     CDS             321015..321434
                     /locus_tag="BSVBI22_A0310"
                     /note="identified by similarity to OMNI:NTL02ML6482; match
                     to protein family HMM PF00188"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154011.1"
                     /db_xref="GI:376280005"
                     /db_xref="GeneID:11727785"
                     /translation="MALSALPVDWAQAAGNNDPTAIFNAIRKANGLPLMATDSRLEQA
                     ALYQARRMASYGKIGHSVGWGNGFVSRLKQAGIRGPAAENVAVGQPDTQAVFDAWMKS
                     PGHRKNMLDPTFAHYGLAWATPESNPRRIYWAMMLGL"
     misc_feature    <321015..321431
                     /locus_tag="BSVBI22_A0310"
                     /note="Uncharacterized protein with SCP/PR1 domains
                     [Function unknown]; Region: COG2340"
                     /db_xref="CDD:225218"
     misc_feature    321084..321428
                     /locus_tag="BSVBI22_A0310"
                     /note="SCP_bacterial: SCP-like extracellular protein
                     domain, as found in bacteria and archaea. The wider family
                     of SCP containing proteins includes plant
                     pathogenesis-related protein 1 (PR-1), CRISPs, mammalian
                     cysteine-rich secretory proteins, and allergen 5...;
                     Region: SCP_bacterial; cd05379"
                     /db_xref="CDD:240179"
     gene            321609..322976
                     /locus_tag="BSVBI22_A0311"
                     /db_xref="GeneID:11727786"
     CDS             321609..322976
                     /locus_tag="BSVBI22_A0311"
                     /note="identified by similarity to EGAD:8949; match to
                     protein family HMM PF01554; match to protein family HMM
                     TIGR00797"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-damage-inducible protein F"
                     /protein_id="YP_005154012.1"
                     /db_xref="GI:376280006"
                     /db_xref="GeneID:11727786"
                     /translation="MDQVMQGGGQSIGNVTKPFDVTHRMVMLIAVPMTLAAITTPLLG
                     LVDMGVVGQMGQAELIGGLAIGALVFDFLLSLFNFLRSGTTGLVAQAMGAGDAVEEQA
                     IFWRAIIIAVAAGGLMILCLPLILGAASTFMHPTPATRAAMATYISIRMLSASVALIN
                     YSILGLVLGRGQGILGLGLQVLLNGINIALCIVLGLELGWGVTGVAWATVTGETVAAL
                     VGLFIVMRHFRKDATLRPDRKRIFQREGIMRMFAVNRDIMIRSLLLLTAFAFFTRAGS
                     DLGPVTLAANAVLLNFFLVAGFFLDGMAAAAEQIIGRSIGARYSPAFRRGAKLTFIWG
                     LVMAGLVAFFLLVFGDTIISLLSRAEDVHVEAMKYLPWAALTGLTGLLAFHMDGVYIG
                     ATWSRDMRNMMFLSLIFFLAVLYAAKPVMGNHGLWLAINLFLSVRGITLLAILPRRYR
                     MEFAH"
     misc_feature    321654..322961
                     /locus_tag="BSVBI22_A0311"
                     /note="Na+-driven multidrug efflux pump [Defense
                     mechanisms]; Region: NorM; COG0534"
                     /db_xref="CDD:223608"
     misc_feature    321672..322949
                     /locus_tag="BSVBI22_A0311"
                     /note="DinF and similar proteins, a subfamily of the
                     multidrug and toxic compound extrusion (MATE)-like
                     proteins; Region: MATE_DinF_like; cd13136"
                     /db_xref="CDD:240541"
     gene            complement(322978..324072)
                     /gene="pyrD"
                     /locus_tag="BSVBI22_A0312"
                     /db_xref="GeneID:11727787"
     CDS             complement(322978..324072)
                     /gene="pyrD"
                     /locus_tag="BSVBI22_A0312"
                     /note="catalyzes the conversion of dihydroorotate to
                     orotate in the pyrimidine biosynthesis pathway; uses a
                     flavin nucleotide as an essential cofactor; class 2
                     enzymes are monomeric and compared to the class 1 class 2
                     possess an extended N terminus, which plays a role in the
                     membrane association of the enzyme and provides the
                     binding site for the respiratory quinones that serve as
                     physiological electron acceptors"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase 2"
                     /protein_id="YP_005154013.1"
                     /db_xref="GI:376280007"
                     /db_xref="GeneID:11727787"
                     /translation="MSGLFETLGRRALFTFDAEQAHGLSITGLKTGIVTCRTPEDPAL
                     SVKVAGLKFPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRL
                     VDDKAVINRLGFNNEGHEAAFKRLSRRAGKSGIVGVNIGANKDAEDRIADYVAGIRRF
                     YQLARYFTVNISSPNTPGLRNLQAREALHELLSRVLEARDEEGNMCTLKRPVFLKIAP
                     DLTDEELDDIAAEADAQKLDGIIVSNTTLSRSGLKNPENSNETGGLSGAPLFERSTVV
                     LARMRERVGPDMPLIGVGGIDSAETALAKIKAGADLVQLYTGLIYRGPGLPGEILRGL
                     STAIKHEGVSSIAELRDRDTKEWAARKLIS"
     misc_feature    complement(323047..324063)
                     /gene="pyrD"
                     /locus_tag="BSVBI22_A0312"
                     /note="dihydroorotate dehydrogenase 2; Reviewed; Region:
                     PRK05286"
                     /db_xref="CDD:235388"
     misc_feature    complement(323071..324045)
                     /gene="pyrD"
                     /locus_tag="BSVBI22_A0312"
                     /note="Dihydroorotate dehydrogenase (DHOD) class 2. DHOD
                     catalyzes the oxidation of (S)-dihydroorotate to orotate.
                     This is the fourth step and the only redox reaction in the
                     de novo biosynthesis of UMP, the precursor of all
                     pyrimidine nucleotides. DHOD requires...; Region:
                     DHOD_2_like; cd04738"
                     /db_xref="CDD:240089"
     misc_feature    complement(order(323770..323772,324007..324009))
                     /gene="pyrD"
                     /locus_tag="BSVBI22_A0312"
                     /note="quinone interaction residues [chemical binding];
                     other site"
                     /db_xref="CDD:240089"
     misc_feature    complement(order(323122..323127,323188..323190,
                     323275..323277,323338..323346,323428..323430,
                     323548..323550,323554..323556,323563..323565,
                     323731..323739,323743..323745,323818..323820,
                     323878..323880,323890..323892))
                     /gene="pyrD"
                     /locus_tag="BSVBI22_A0312"
                     /note="active site"
                     /db_xref="CDD:240089"
     misc_feature    complement(order(323428..323430,323554..323556,
                     323878..323880))
                     /gene="pyrD"
                     /locus_tag="BSVBI22_A0312"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:240089"
     misc_feature    complement(order(323122..323127,323188..323190,
                     323275..323277,323341..323346,323428..323430,
                     323563..323565,323743..323745,323818..323820))
                     /gene="pyrD"
                     /locus_tag="BSVBI22_A0312"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:240089"
     misc_feature    complement(order(323338..323343,323557..323559,
                     323563..323565,323743..323745))
                     /gene="pyrD"
                     /locus_tag="BSVBI22_A0312"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240089"
     gene            complement(324069..324422)
                     /locus_tag="BSVBI22_A0313"
                     /db_xref="GeneID:11727788"
     CDS             complement(324069..324422)
                     /locus_tag="BSVBI22_A0313"
                     /note="identified by similarity to GP:15073480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154014.1"
                     /db_xref="GI:376280008"
                     /db_xref="GeneID:11727788"
                     /translation="MSNKIIYKIAPRELWARAEKAGSFAGAPVDIADGYIHFSTAAQV
                     RATAAKHFAGQSDLLLVHVDAQALGQALKYEVSRGGALFPHLYAPLPLTAVVKVEPLP
                     LGPDDLHIFPELEDK"
     misc_feature    complement(324078..324422)
                     /locus_tag="BSVBI22_A0313"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3502"
                     /db_xref="CDD:226033"
     gene            324676..325131
                     /locus_tag="BSVBI22_A0314"
                     /db_xref="GeneID:11727789"
     CDS             324676..325131
                     /locus_tag="BSVBI22_A0314"
                     /note="identified by similarity to OMNI:NTL02ML4408"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154015.1"
                     /db_xref="GI:376280009"
                     /db_xref="GeneID:11727789"
                     /translation="MLGRMAGSAHRLAIASLLGTALFSTGALAQENGRYRLEGTETGY
                     VRLDTQTGAISVCTQQKGQLVCKMAAEDRDAYENDIADLQARVKKLEAQVAAMGKVEG
                     SKASALPSEQEFEQSMSYMERFMRRFMDLAKSFESGEEKPAPPTIPGRT"
     gene            complement(325222..326172)
                     /gene="pip"
                     /locus_tag="BSVBI22_A0315"
                     /db_xref="GeneID:11727790"
     CDS             complement(325222..326172)
                     /gene="pip"
                     /locus_tag="BSVBI22_A0315"
                     /note="identified by similarity to EGAD:139406; match to
                     protein family HMM PF00561; match to protein family HMM
                     TIGR01249"
                     /codon_start=1
                     /transl_table=11
                     /product="proline iminopeptidase"
                     /protein_id="YP_005154016.1"
                     /db_xref="GI:376280010"
                     /db_xref="GeneID:11727790"
                     /translation="MTRNTLYPEIEPFKEEMLQVSSLHRIHVEQCGNPDGKPVIMIHG
                     GPGGGITPTMRRLHDPKRYRIILFDQRGCGRSTPHAELRENTTWDLVADMEHIRAHLG
                     IDKWQVFGGSWGSTLGLAYAETHPERVSELVLRGIFMVRRFEVDWMYSNGASIIFPDH
                     FEAYQEHIPEAERGDMIAAYYKRLTDRDPRVQLEAARRWARWEGSVISLLPDPARVDA
                     FGEDQYAIAFARIECHYFQNRGFLESDDQLLRNVERIRHIPGVIVHGRYDICTPFINA
                     WQLKKMWPEADLKIVEDSGHAVTEPGIMHELIEATKRFCE"
     misc_feature    complement(325231..326145)
                     /gene="pip"
                     /locus_tag="BSVBI22_A0315"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(325225..325986)
                     /gene="pip"
                     /locus_tag="BSVBI22_A0315"
                     /note="alpha/beta hydrolase fold; Region: Abhydrolase_1;
                     pfam00561"
                     /db_xref="CDD:249959"
     gene            326402..327043
                     /locus_tag="BSVBI22_A0316"
                     /db_xref="GeneID:11727791"
     CDS             326402..327043
                     /locus_tag="BSVBI22_A0316"
                     /note="identified by match to protein family HMM PF00072;
                     match to protein family HMM PF00196"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family DNA-binding response regulator"
                     /protein_id="YP_005154017.1"
                     /db_xref="GI:376280011"
                     /db_xref="GeneID:11727791"
                     /translation="MHFIIADDHPLFRGALRQVLSGQSENVEIIEAGDFDTVRKLVGE
                     KDDTDLLLLDLTMPGGTGLSGLVALKALQPALPIIIVSATDDPATIHHALELGASGFI
                     SKSASMETIGEAVGAVLAGDIWTPDDIDLDHPKDPEIESLIARLRTLTPQQTRVLTML
                     AEGLLNKQIAFELGVSEATVKAHVSAVLQKLGVDSRTQAVILLSRIGSDVLGV"
     misc_feature    326402..327022
                     /locus_tag="BSVBI22_A0316"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    326411..326758
                     /locus_tag="BSVBI22_A0316"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(326420..326425,326561..326563,326585..326587,
                     326645..326647,326702..326704,326711..326716)
                     /locus_tag="BSVBI22_A0316"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    326561..326563
                     /locus_tag="BSVBI22_A0316"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(326570..326575,326579..326587)
                     /locus_tag="BSVBI22_A0316"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    326711..326719
                     /locus_tag="BSVBI22_A0316"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    326846..327016
                     /locus_tag="BSVBI22_A0316"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(326849..326857,326894..326902,326924..326929,
                     326933..326938,326942..326956,326987..326989)
                     /locus_tag="BSVBI22_A0316"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(326882..326884,326888..326890,326894..326896,
                     326987..326995,327002..327004,327011..327016)
                     /locus_tag="BSVBI22_A0316"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(327080..330604)
                     /locus_tag="BSVBI22_A0317"
                     /db_xref="GeneID:11727792"
     CDS             complement(327080..330604)
                     /locus_tag="BSVBI22_A0317"
                     /note="identified by match to protein family HMM PF00072;
                     match to protein family HMM PF00512; match to protein
                     family HMM PF02518"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase/response regulator"
                     /protein_id="YP_005154018.1"
                     /db_xref="GI:376280012"
                     /db_xref="GeneID:11727792"
                     /translation="MPAMQGWGIIGFAFLYLLLLFAVASIGDRRTARWSSTPRPYIYA
                     LSLAVYCTSWTFFGSVGLSAQRGLEFLGIYIGPILVFTLGNRLLRHIVRLAKSEHITS
                     IADFLAARYGKSFGVASLATCIAAVGSIPYIALQLKAVSGGVGLVMDYYGAAVDPAVF
                     VFGDISLPVAAVLATFAILFGTRHTDATEHQNGLILAVALESVIKLCAFLTVGLACAF
                     FLFGAPSQLIRQISQSPEALEAFHYETSIGTWLVQTALSAAAVIMLPRQFHVTVVESR
                     SEKELRTASWLFPLYLILINIFVFPIALIGVMTLGNSVNGDLYVLALPLSAGAHWLAL
                     IAFLGGLSAATAMVIVACVALSIMISNHLVLPLIISSFAKRHLAEQRDLTKIILNTRR
                     ITIIVILALAFSYYRLTSNNIHLASIGFVSFAAVAQFAPALIGGLFWRNANGRGAMLG
                     LSAGFIVWCYTLLLPTVAPENAAILRDGFLGFTALRPEALFGTNALPLTNGVAWSIAA
                     NTLFYILGSLSRASTPLERIQASIFLPRTFIGAPTLKRFRTTVTVAELKATMARYLGA
                     ERVERAFLRFEGREQRRLDPGMTVDTPLIRYAEQLLGTAVGSSSARLVLSLLLQRNDA
                     SPRDARQLLDDASAALQQNRDLLQIALDQMDQGITVLDKDLRLTCWNRQFRKLFDLPD
                     EVMQVGIPISEIVEHLSQRGDIALNARNSAIRSLGTVRRPWRMTMKSTGKILEINSNP
                     MPDGGLVTTFTDITAAVEADLMRQKASEMLEQRVIDRTAELMHVNDELARAQAAAEEA
                     NLGKTRFLAAAGHDILQPLNAARLYSTALAEKLGRSETSEFARNIDSSLEAVEAILGM
                     VLDISRLDTGSLKPETSVFRLDKLLSQIATDFTPLAVKKGLKLRVVPSSIVVKTDRNM
                     LRRLIQNLVSNSIKYSRKGGILLGVRRRGNFVDLQVLDTGIGIAPQKLKLVFWEFTRL
                     NEGMREAEGLGLGLSIVDRIARVLSLPLSLASTPGKGTVFSLRIPVSGEAPPAEEVKN
                     RRGPQRASELDGLGVLCIDNDVNILCGMETLLSGWGCNVTTLRSGAELKNFCATGTAA
                     PAVIIADYHLIHENGLDMIGFARESFKTEIPAILLTADRSKEVRQRAEDENVTVLHKP
                     LRPAALRSMLSLFHHARQDGASTQGSTR"
     misc_feature    complement(329015..330487)
                     /locus_tag="BSVBI22_A0317"
                     /note="Na+/proline symporter [Amino acid transport and
                     metabolism / General function prediction only]; Region:
                     PutP; COG0591"
                     /db_xref="CDD:223664"
     misc_feature    complement(order(329558..329563,329576..329578,
                     330452..330454,330461..330463))
                     /locus_tag="BSVBI22_A0317"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212031"
     misc_feature    complement(<328514..328672)
                     /locus_tag="BSVBI22_A0317"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     misc_feature    complement(328325..328654)
                     /locus_tag="BSVBI22_A0317"
                     /note="PAS fold; Region: PAS_7; pfam12860"
                     /db_xref="CDD:257355"
     misc_feature    complement(327530..>328201)
                     /locus_tag="BSVBI22_A0317"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(328019..328201)
                     /locus_tag="BSVBI22_A0317"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(328034..328036,328046..328048,
                     328055..328057,328067..328069,328076..328078,
                     328088..328090,328136..328138,328145..328147,
                     328157..328159,328166..328168,328178..328180,
                     328190..328192))
                     /locus_tag="BSVBI22_A0317"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(328172..328174)
                     /locus_tag="BSVBI22_A0317"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(327557..327862)
                     /locus_tag="BSVBI22_A0317"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(327569..327571,327575..327580,
                     327593..327595,327599..327601,327647..327658,
                     327734..327739,327743..327745,327749..327751,
                     327755..327757,327821..327823,327830..327832,
                     327842..327844))
                     /locus_tag="BSVBI22_A0317"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(327830..327832)
                     /locus_tag="BSVBI22_A0317"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(327650..327652,327656..327658,
                     327737..327739,327743..327745))
                     /locus_tag="BSVBI22_A0317"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(327137..327469)
                     /locus_tag="BSVBI22_A0317"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(327167..327172,327179..327181,
                     327233..327235,327296..327298,327320..327322,
                     327455..327460))
                     /locus_tag="BSVBI22_A0317"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(327320..327322)
                     /locus_tag="BSVBI22_A0317"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(327296..327304,327308..327313))
                     /locus_tag="BSVBI22_A0317"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(327164..327172)
                     /locus_tag="BSVBI22_A0317"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(330889..331035)
                     /locus_tag="BSVBI22_A0318"
                     /db_xref="GeneID:11727793"
     CDS             complement(330889..331035)
                     /locus_tag="BSVBI22_A0318"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154019.1"
                     /db_xref="GI:376280013"
                     /db_xref="GeneID:11727793"
                     /translation="MALAVNDKMAGKLMGFAQPLRLLVFLQMRNRENPISALAAATGH
                     TSSV"
     gene            331117..331533
                     /gene="mscL"
                     /locus_tag="BSVBI22_A0319"
                     /db_xref="GeneID:11727794"
     CDS             331117..331533
                     /gene="mscL"
                     /locus_tag="BSVBI22_A0319"
                     /note="homopentamer; channel that opens in response to
                     pressure or hypoosmotic shock"
                     /codon_start=1
                     /transl_table=11
                     /product="large-conductance mechanosensitive channel"
                     /protein_id="YP_005154020.1"
                     /db_xref="GI:376280014"
                     /db_xref="GeneID:11727794"
                     /translation="MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIG
                     LITGGIDFSNMFIQLAGDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKL
                     MNRLKKREEAKPAPAAPSEEVLLTEIRDILAKQQKA"
     misc_feature    331117..331524
                     /gene="mscL"
                     /locus_tag="BSVBI22_A0319"
                     /note="large-conductance mechanosensitive channel;
                     Provisional; Region: mscL; PRK13952"
                     /db_xref="CDD:237569"
     gene            complement(331609..332886)
                     /gene="hemA"
                     /locus_tag="BSVBI22_A0320"
                     /db_xref="GeneID:11727795"
     CDS             complement(331609..332886)
                     /gene="hemA"
                     /locus_tag="BSVBI22_A0320"
                     /note="catalyzes the formation of 5-aminolevulinate from
                     succinyl-CoA and glycine"
                     /codon_start=1
                     /transl_table=11
                     /product="5-aminolevulinate synthase"
                     /protein_id="YP_005154021.1"
                     /db_xref="GI:376280015"
                     /db_xref="GeneID:11727795"
                     /translation="MDYRRFFEEAIDQLHAEKRYRVFADLERIVGRFPQAIWRNNGTA
                     REITVWCSNDYLGMGHHPDVIKAMCETAGSAGSGAGGTRNISGNNHPLVELESELADL
                     HGKEAGLVFTSGFVSNEASISTIARLLPNCLILSDELNHASMIEGVRHSGAEKKIFRH
                     NDVEHLEQLLKAADRSRAKLIVFESVYSMDGDIAPIEKIADLADKYNAMTYIDEVHAV
                     GMYGAHGGGITERDGLAHRIDIIEGTLAKAFGALGGYITGSRAIIDAVRSYAPGFIFT
                     TSLPPAVAAAATAAIRHLKSSQAERDGQQRQAQRAKDVLSAAGLPVMPSQTHIVPILV
                     GDPELCKKASDRLLEVHGIYIQPINYPTVPRGTERLRITPSPLHDDKLIDGLKDALLE
                     VWNELGIPFAEPSAPQAANSDRIIPLMVSKAGG"
     misc_feature    complement(331717..332805)
                     /gene="hemA"
                     /locus_tag="BSVBI22_A0320"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    complement(331705..332754)
                     /gene="hemA"
                     /locus_tag="BSVBI22_A0320"
                     /note="KBL_like; this family belongs to the pyridoxal
                     phosphate (PLP)-dependent aspartate aminotransferase
                     superfamily (fold I). The major groups in this CD
                     corresponds to serine palmitoyltransferase (SPT),
                     5-aminolevulinate synthase (ALAS); Region: KBL_like;
                     cd06454"
                     /db_xref="CDD:99747"
     misc_feature    complement(order(331774..331776,332146..332148,
                     332155..332157,332239..332244,332248..332250,
                     332320..332325,332335..332337,332464..332466,
                     332542..332550,332728..332730))
                     /gene="hemA"
                     /locus_tag="BSVBI22_A0320"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99747"
     misc_feature    complement(order(332146..332148,332155..332157,
                     332239..332244,332248..332250,332323..332325,
                     332335..332337,332464..332466,332542..332550))
                     /gene="hemA"
                     /locus_tag="BSVBI22_A0320"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99747"
     misc_feature    complement(332146..332148)
                     /gene="hemA"
                     /locus_tag="BSVBI22_A0320"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99747"
     gene            complement(333032..333733)
                     /locus_tag="BSVBI22_A0321"
                     /db_xref="GeneID:11727796"
     CDS             complement(333032..333733)
                     /locus_tag="BSVBI22_A0321"
                     /note="identified by match to protein family HMM PF01522"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase family protein"
                     /protein_id="YP_005154022.1"
                     /db_xref="GI:376280016"
                     /db_xref="GeneID:11727796"
                     /translation="MPVPILLYHQIAPLPAKNIPFRGLLVHPDRFRSQMRWLKRLGYQ
                     GLSLRDAMPYIKGEKTGKVAVITFDDGYLNVLENAGPVLAEYGFTATNYFVANQVGGS
                     NVWDQPIGVPKTPCMSVAQLREWADLGHEVGAHTLDHVALSKVPEDEARHQIAQSKTV
                     LEDMLGTQVTNFCYPYGDNTPIHREMVREAGYETATTTVRARARPTDDPFGIPRIYVR
                     RRDLWPKFVVRLRVR"
     misc_feature    complement(333047..333724)
                     /locus_tag="BSVBI22_A0321"
                     /note="Predicted xylanase/chitin deacetylase [Carbohydrate
                     transport and metabolism]; Region: CDA1; COG0726"
                     /db_xref="CDD:223798"
     misc_feature    complement(333074..333541)
                     /locus_tag="BSVBI22_A0321"
                     /note="Putative catalytic NodB homology domain of PgaB,
                     IcaB, and similar proteins which consist of a deformed
                     (beta/alpha)8 barrel fold with 5- or 6-strands; Region:
                     CE4_NodB_like_5s_6s; cd10918"
                     /db_xref="CDD:213023"
     misc_feature    complement(order(333203..333211,333317..333319,
                     333329..333331,333524..333529))
                     /locus_tag="BSVBI22_A0321"
                     /note="putative active site [active]"
                     /db_xref="CDD:213023"
     misc_feature    complement(order(333317..333319,333329..333331,
                     333524..333526))
                     /locus_tag="BSVBI22_A0321"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:213023"
     gene            complement(333742..334461)
                     /locus_tag="BSVBI22_A0322"
                     /db_xref="GeneID:11727797"
     CDS             complement(333742..334461)
                     /locus_tag="BSVBI22_A0322"
                     /note="identified by similarity to GP:12837556; match to
                     protein family HMM PF01755"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_005154023.1"
                     /db_xref="GI:376280017"
                     /db_xref="GeneID:11727797"
                     /translation="MNVKAFIIHLKRATDRAPQVEKLIKELPVKAEVIEAVDSRALNK
                     DEIARIYKRRLHTPRYPFALSRNEIACFLSHRKAWQAIIDRKLDAGFIVEDDIALTEN
                     FMGAYRAAVDHLEPGGFIRFTFRDDREHGREVFRDEAVRIIIPNPIGLGMVAQLVSYD
                     AAQKLLDITQTFDRPVDTTVQMRWVTGLQPLSVIPGGVKEISSQLGGTTIQHKKNFSD
                     KLAREILRPIYRMRVRAYSSK"
     misc_feature    complement(333928..334452)
                     /locus_tag="BSVBI22_A0322"
                     /note="Glycosyltransferase family 25 [lipooligosaccharide
                     (LOS) biosynthesis protein] is a family of
                     glycosyltransferases involved in LOS biosynthesis. The
                     members include the beta(1,4) galactosyltransferases: Lgt2
                     of Moraxella catarrhalis, LgtB and LgtE of...; Region:
                     Glyco_transf_25; cd06532"
                     /db_xref="CDD:133474"
     gene            complement(334591..335265)
                     /locus_tag="BSVBI22_A0323"
                     /db_xref="GeneID:11727798"
     CDS             complement(334591..335265)
                     /locus_tag="BSVBI22_A0323"
                     /note="identified by similarity to GP:15157577"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154024.1"
                     /db_xref="GI:376280018"
                     /db_xref="GeneID:11727798"
                     /translation="MFAEHLQPFGKTSGVKAGKMKKTLVIVGNGPLTRDLSSEIDSAD
                     YVLRFNEPRESIGMSGSKTDLLMLATSSKQMQQWLKYPTFLNSAIFRNAQELLFAFHP
                     AIIRQFHHRPNFLSRWLKGRRADWTTKAIEVLGAQGKEIRIMPPQFYLGVCEELGITA
                     DKMAELFPSTGFFGIWYMLRNFPQSQWNIRICGFSWQGWKHHDWSAERQWIEEKIKSG
                     MITPLI"
     misc_feature    complement(<334726..>335202)
                     /locus_tag="BSVBI22_A0323"
                     /note="Glycosyltransferase family 29 (sialyltransferase);
                     Region: Glyco_transf_29; pfam00777"
                     /db_xref="CDD:250125"
     gene            complement(335357..335590)
                     /locus_tag="BSVBI22_A0324"
                     /db_xref="GeneID:11727799"
     CDS             complement(335357..335590)
                     /locus_tag="BSVBI22_A0324"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154025.1"
                     /db_xref="GI:376280019"
                     /db_xref="GeneID:11727799"
                     /translation="MEPLQLKAIHLCEEAMMEGQVIFYKNDRIIYRHHIDVQEDDYSK
                     GVNDAPIAFQRNYAGFDLASDDIHIRFKKPGDV"
     gene            complement(335633..336523)
                     /locus_tag="BSVBI22_A0325"
                     /db_xref="GeneID:11727800"
     CDS             complement(335633..336523)
                     /locus_tag="BSVBI22_A0325"
                     /note="identified by match to protein family HMM PF00126;
                     match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005154026.1"
                     /db_xref="GI:376280020"
                     /db_xref="GeneID:11727800"
                     /translation="MNLRSFQAFAEVVRQGGFSAAARTINATQSTVSKAVKQLEEELQ
                     LVLLDRAVSPPRLTAAGEIVYRRARAMLTEKDDMLAELGELRGLKRGLLRLGLPPIGS
                     SVLFAPVFAAYTSLYPDIDIQLVEHGSKRLEELLLAGDVELAASLLPVEESFAWQDVR
                     CEPVVALLPASHPVSDDDGVTLREIANLPFILFESGFALNHIILSACQRHGFSPNVAV
                     RSSQIDFIVELVAAGMGIGFLPQMIAKQRHHPGVCIHRVKDADVNWHMAFVWRKGAFL
                     SHAARAWLALCEGASTPAKA"
     misc_feature    complement(335672..336523)
                     /locus_tag="BSVBI22_A0325"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(336338..336517)
                     /locus_tag="BSVBI22_A0325"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(335663..336232)
                     /locus_tag="BSVBI22_A0325"
                     /note="The C-terminal substrate binding domain of
                     LysR-like transcriptional regulator CidR, contains the
                     type 2 periplasmic binding fold; Region: PBP2_CidR;
                     cd08438"
                     /db_xref="CDD:176129"
     misc_feature    complement(order(335828..335833,335837..335842,
                     335858..335875,336146..336166,336170..336172,
                     336182..336184,336191..336196,336200..336205))
                     /locus_tag="BSVBI22_A0325"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176129"
     gene            336645..337064
                     /locus_tag="BSVBI22_A0326"
                     /db_xref="GeneID:11727801"
     CDS             336645..337064
                     /locus_tag="BSVBI22_A0326"
                     /note="identified by similarity to OMNI:NTL03PA03432;
                     match to protein family HMM PF03788"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154027.1"
                     /db_xref="GI:376280021"
                     /db_xref="GeneID:11727801"
                     /translation="MNAPRKAHDLKIRLRYALHNSRLMQIATLVGFWLAGEAVVRLAG
                     LPLPGGIVGMALVLALLLSGRISLFSMKRGAEWFLAEMLLFFIPAVLAILEHRELIGM
                     LGLKIMAVILLGTLTVMSVTALTVDLCYRWSLRYAAR"
     misc_feature    336711..337061
                     /locus_tag="BSVBI22_A0326"
                     /note="Putative effector of murein hydrolase LrgA [General
                     function prediction only]; Region: COG1380"
                     /db_xref="CDD:224298"
     gene            337051..337758
                     /locus_tag="BSVBI22_A0327"
                     /db_xref="GeneID:11727802"
     CDS             337051..337758
                     /locus_tag="BSVBI22_A0327"
                     /note="identified by similarity to OMNI:NTL03PA03431;
                     match to protein family HMM PF04172"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154028.1"
                     /db_xref="GI:376280022"
                     /db_xref="GeneID:11727802"
                     /translation="MLPGDPLGNPFVATLFWSAATILLYLAAKRVYRRFPLWWLTPLA
                     VTPLLLMALVIGLDENYRVYFSATHWLVALLGPATVAFAIPIYQQCATIRRYWPVLLA
                     GVLVGSSAAMASAWGLAHLLGLNEAISLSLMPRSMSTPFAMTVSGDIGGRPDLTAIFV
                     VLTGIFGAALGEIMLHWLPVRSALARGALFGMGAHGAGVARAHQIGSEEGSIAGLVMV
                     LVGLVNVLAAPLIAHFL"
     misc_feature    337075..337755
                     /locus_tag="BSVBI22_A0327"
                     /note="Putative effector of murein hydrolase [Cell
                     envelope biogenesis, outer membrane]; Region: LrgB;
                     COG1346"
                     /db_xref="CDD:224265"
     gene            337881..338267
                     /locus_tag="BSVBI22_A0328"
                     /db_xref="GeneID:11727803"
     CDS             337881..338267
                     /locus_tag="BSVBI22_A0328"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154029.1"
                     /db_xref="GI:376280023"
                     /db_xref="GeneID:11727803"
                     /translation="MASFYAFFERWPICITVMHYWSLLANRASDRYTYIEFASSQNSI
                     RNTALLLPSRIQDQAAHPPPARPFSFSGTDFDFSRSALAISASGGLGPCVTHKPQQPD
                     TLLIVDKSGVGRDCSVKDILTANFPV"
     gene            338305..339546
                     /locus_tag="BSVBI22_A0329"
                     /db_xref="GeneID:11727804"
     CDS             338305..339546
                     /locus_tag="BSVBI22_A0329"
                     /note="identified by similarity to GP:15155313"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_005154030.1"
                     /db_xref="GI:376280024"
                     /db_xref="GeneID:11727804"
                     /translation="MRRIVLRFAPALLVCFSLLAGCASRPEGVLVPIGETVPQASEVN
                     LLVATTRAPSGNPGTLFSGERGKKISLTDIIVSIPPDRNRKVGEVQWPKRLPPNPLKD
                     FATIAVEPLHGDAAAQHWINTHLPRTKRVMIFIHGFNNTFEDSVYRFAQIVHDSGADV
                     APIIFTWPSRASVFDYNYDKESTNYSRDALEHVLRVVANDPQVRDVTIMAHSMGAWLA
                     MEALRQMAIRDRRVNAKITDVILASPDIDVDVFGKQFQAMGSHHPRFTLFTSRDDKAL
                     ALSRRISGNIDRLGQIDPSVEPYRSKLEKAGIVVIDLTQLKAGDRLNHSKFASSPEVV
                     QLIGRRLVAGQTITDSEIGIGDRLGAVALGTAQGVGSAASLVVTAPIAVFDPRTRRTY
                     DEQIDRFGRAVGNTVGAVIMP"
     misc_feature    338353..339477
                     /locus_tag="BSVBI22_A0329"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4782"
                     /db_xref="CDD:227121"
     misc_feature    338695..>339036
                     /locus_tag="BSVBI22_A0329"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     gene            339633..340514
                     /gene="panC"
                     /locus_tag="BSVBI22_A0330"
                     /db_xref="GeneID:11727805"
     CDS             339633..340514
                     /gene="panC"
                     /locus_tag="BSVBI22_A0330"
                     /note="catalyzes the formation of (R)-pantothenate from
                     pantoate and beta-alanine"
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="YP_005154031.1"
                     /db_xref="GI:376280025"
                     /db_xref="GeneID:11727805"
                     /translation="MQIIHTIEELRQALAPARQQGKKIGFVPTMGYLHKGHLELVRRA
                     RVENDVTLVSIFVNPLQFGANEDLGRYPRDLERDAGLLHDAQVDYLFAPTVSDMYPRP
                     MQTVVDVPPLGNQMEGEARPGHFAGVATVVSKLFNIVGPDAAYFGEKDFQQLVIIRRM
                     VDDMAIPVRIVGVETVREDDGLACSSRNVYLTPEQRRAAIIVPQALDEADRLYRSGMD
                     DPDALEAAIRTFISRQPLAVPEVIAIRDPETLERLPALQGRPILVALFVRVGATRLLD
                     NRVIGHAAPQITQERAA"
     misc_feature    339633..340463
                     /gene="panC"
                     /locus_tag="BSVBI22_A0330"
                     /note="Pantoate-beta-alanine ligase; Region: PanC;
                     cd00560"
                     /db_xref="CDD:185673"
     misc_feature    order(339714..339725,339732..339734,339738..339743,
                     339750..339752,339804..339806,339813..339815,
                     339843..339845,340014..340016,340023..340028,
                     340068..340073,340077..340082,340089..340091,
                     340152..340160,340182..340193)
                     /gene="panC"
                     /locus_tag="BSVBI22_A0330"
                     /note="active site"
                     /db_xref="CDD:185673"
     misc_feature    order(339714..339722,339732..339734,339741..339743,
                     339750..339752,339813..339815,340023..340028,
                     340068..340073,340077..340082,340089..340091,
                     340155..340160,340179..340184)
                     /gene="panC"
                     /locus_tag="BSVBI22_A0330"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:185673"
     misc_feature    order(339714..339716,339720..339722,339804..339806,
                     339813..339815,340023..340028,340035..340037,
                     340089..340091)
                     /gene="panC"
                     /locus_tag="BSVBI22_A0330"
                     /note="pantoate-binding site; other site"
                     /db_xref="CDD:185673"
     misc_feature    339732..339743
                     /gene="panC"
                     /locus_tag="BSVBI22_A0330"
                     /note="HXXH motif; other site"
                     /db_xref="CDD:185673"
     gene            340516..341343
                     /gene="panB"
                     /locus_tag="BSVBI22_A0331"
                     /db_xref="GeneID:11727806"
     CDS             340516..341343
                     /gene="panB"
                     /locus_tag="BSVBI22_A0331"
                     /note="catalyzes the formation of tetrahydrofolate and
                     2-dehydropantoate from 5,10-methylenetetrahydrofolate and
                     3-methyl-2-oxobutanoate"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="YP_005154032.1"
                     /db_xref="GI:376280026"
                     /db_xref="GeneID:11727806"
                     /translation="MSAPVTRKRLTPKVIQAMKGECPIVSLTAYTTPVARLLDPHCDL
                     LLVGDSLGMVLYGMESTLAVTLDMMIMHGQAVMRGTSHACVIVDMPFGSYQESKEQAF
                     RNAARVMQETGCDGVKLEGGEEMAETVAFLVRRGIPVFGHVGLMPQQVNTVGGFRSLG
                     RGDDEAGKIRRDAQAIAQAGAFAVVIEGTVEPLAREITALIDIPTVGIGASSACDGQV
                     LVSDDMLGLFQDFTPRFVKRFAHLAPQVSQAAEAYAEEVRARRFPGPEHVFGAKPGA"
     misc_feature    340558..341304
                     /gene="panB"
                     /locus_tag="BSVBI22_A0331"
                     /note="Ketopantoate hydroxymethyltransferase (KPHMT) is
                     the first enzyme in the pantothenate biosynthesis pathway.
                     Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes
                     the first committed step in the biosynthesis of
                     pantothenate (vitamin B5), which is a...; Region:
                     KPHMT-like; cd06557"
                     /db_xref="CDD:119342"
     misc_feature    order(340597..340599,340651..340653,340657..340665,
                     340777..340779,340867..340869,340939..340941,
                     340954..340956,341074..341076,341167..341169,
                     341173..341175)
                     /gene="panB"
                     /locus_tag="BSVBI22_A0331"
                     /note="active site"
                     /db_xref="CDD:119342"
     misc_feature    order(340606..340617,340624..340626,340666..340668,
                     340672..340689,340699..340704,340717..340719,
                     340726..340731,340738..340740,340747..340749,
                     340786..340791,340819..340821,340831..340833,
                     340840..340845,340858..340860,340912..340929,
                     340957..340962,340966..340977,341059..341061,
                     341179..341181,341188..341193,341233..341235,
                     341242..341256)
                     /gene="panB"
                     /locus_tag="BSVBI22_A0331"
                     /note="oligomerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:119342"
     misc_feature    order(340660..340662,340777..340779,340867..340869)
                     /gene="panB"
                     /locus_tag="BSVBI22_A0331"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119342"
     gene            complement(341540..342316)
                     /gene="fpr"
                     /locus_tag="BSVBI22_A0332"
                     /db_xref="GeneID:11727807"
     CDS             complement(341540..342316)
                     /gene="fpr"
                     /locus_tag="BSVBI22_A0332"
                     /note="identified by similarity to SP:Q44532; match to
                     protein family HMM PF00175; match to protein family HMM
                     PF00970"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin--NADP reductase"
                     /protein_id="YP_005154033.1"
                     /db_xref="GI:376280027"
                     /db_xref="GeneID:11727807"
                     /translation="MSSNFNQETVTDIHHWTDTLFSFRTTRDPGFRFQSGQFIMMGLE
                     VNGKPLTRAYSIASSLYEDGLEFFSIKVPNGPLTSKLQHLKKGDQIIVSKKPVGTLLY
                     DNLKPGKHLWLLSTGTGLAPFLSIIRDLEVYERFEKVILVHGVRQVAELAYTDFISNE
                     LPQDEFLGEMVKNQLIYYPTVTREPYKNRGRLTDLIRSGQLFKDVGLPEFNHEDDRMM
                     LCGSPEMLAETKQILEERGFTEGSQSEPGEFVIEKAFVEK"
     misc_feature    complement(341552..342316)
                     /gene="fpr"
                     /locus_tag="BSVBI22_A0332"
                     /note="Flavodoxin reductases (ferredoxin-NADPH reductases)
                     family 1 [Energy production and conversion]; Region: Hmp;
                     COG1018"
                     /db_xref="CDD:223949"
     misc_feature    complement(341555..342292)
                     /gene="fpr"
                     /locus_tag="BSVBI22_A0332"
                     /note="Ferredoxin-NADP+ (oxido)reductase is an
                     FAD-containing enzyme that catalyzes the reversible
                     electron transfer between NADP(H) and electron carrier
                     proteins such as ferredoxin and flavodoxin. Isoforms of
                     these flavoproteins (i.e. having a non-covalently...;
                     Region: FNR1; cd06195"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(341555..341557,341963..341965,
                     342083..342088,342092..342094,342101..342103,
                     342107..342109,342113..342115,342152..342163,
                     342203..342205))
                     /gene="fpr"
                     /locus_tag="BSVBI22_A0332"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(342152..342157,342161..342163))
                     /gene="fpr"
                     /locus_tag="BSVBI22_A0332"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(342023..342025,342029..342031,
                     342056..342058,342074..342076,342083..342085,
                     342092..342094))
                     /gene="fpr"
                     /locus_tag="BSVBI22_A0332"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(341951..341953,341957..341968,
                     341978..341980))
                     /gene="fpr"
                     /locus_tag="BSVBI22_A0332"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(341651..341656,341879..341887,
                     341960..341965))
                     /gene="fpr"
                     /locus_tag="BSVBI22_A0332"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     gene            342438..342530
                     /locus_tag="BSVBI22_A0333"
                     /db_xref="GeneID:11727808"
     CDS             342438..342530
                     /locus_tag="BSVBI22_A0333"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154034.1"
                     /db_xref="GI:376280028"
                     /db_xref="GeneID:11727808"
                     /translation="MELCILPRQAALIAINCGLYAAFRMASANS"
     gene            342719..343069
                     /locus_tag="BSVBI22_A0334"
                     /db_xref="GeneID:11727809"
     CDS             342719..343069
                     /locus_tag="BSVBI22_A0334"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154035.1"
                     /db_xref="GI:376280029"
                     /db_xref="GeneID:11727809"
                     /translation="MEVAIISRNGVPKSGLSGVRSPAAWVMLVPFARRKGGSWLSVSR
                     KRGESRQGFQIPLKIDICGATAEGEGSPRQLPGNFPDNAVADLCFCHKLLISLRINSG
                     KASDALSRHASQLC"
     gene            343108..344205
                     /gene="nspC"
                     /locus_tag="BSVBI22_A0335"
                     /db_xref="GeneID:11727810"
     CDS             343108..344205
                     /gene="nspC"
                     /locus_tag="BSVBI22_A0335"
                     /note="identified by similarity to EGAD:19651; match to
                     protein family HMM PF00278; match to protein family HMM
                     TIGR01047"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxynorspermidine decarboxylase"
                     /protein_id="YP_005154036.1"
                     /db_xref="GI:376280030"
                     /db_xref="GeneID:11727810"
                     /translation="MIQTPYYLIDKTKLKRNMEKIAYVREKSGARALLALKCFATWSV
                     FDLMSEYMDGTTSSSLNEVRLGHEKFGGETHAYSVAYADHEIDEVISHADKIIFNSIG
                     QLERFADKASGIKRGLRLNPGVSSSSFDLADPARPFSRLGEWDVAKVEKVMDRITGFM
                     IHNNCENSDFSLFDRMLSDIEEKFGSLLHRVEWVSLGGGIHFTGEDYPVDAFCARLKS
                     FSEKFGVQVYLEPGEASITRTTTLEVTVLDTLFNGKNLAIVDSSIEAHMLDLLIYREK
                     AKMAPNNGGHSYMVCGKSCLAGDIFGEFTFDKPLAIGDRLSFEDAAGYTMVKKNWFNG
                     VKMPAIAVRELDGTVKLVREFDYADFEGSLS"
     misc_feature    343111..344199
                     /gene="nspC"
                     /locus_tag="BSVBI22_A0335"
                     /note="carboxynorspermidine decarboxylase; Region: nspC;
                     TIGR01047"
                     /db_xref="CDD:233247"
     misc_feature    343117..344139
                     /gene="nspC"
                     /locus_tag="BSVBI22_A0335"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Carboxynorspermidine Decarboxylase; Region:
                     PLPDE_III_CANSDC; cd06829"
                     /db_xref="CDD:143502"
     misc_feature    order(343117..343119,343216..343218,343279..343284,
                     343288..343293,343354..343356,343402..343404,
                     343411..343413,343423..343425,343504..343515,
                     343846..343857,343873..343875,343879..343881,
                     343885..343887,343894..343896,343981..343983,
                     343987..343995,344002..344004,344086..344094,
                     344101..344109)
                     /gene="nspC"
                     /locus_tag="BSVBI22_A0335"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143502"
     misc_feature    order(343210..343212,343216..343218,343273..343275,
                     343339..343341,343462..343464,343591..343593,
                     343600..343602,343699..343704,343795..343806,
                     343990..343995,344077..344079,344089..344091,
                     344101..344103)
                     /gene="nspC"
                     /locus_tag="BSVBI22_A0335"
                     /note="active site"
                     /db_xref="CDD:143502"
     misc_feature    order(343210..343212,343216..343218,343273..343275,
                     343339..343341,343462..343464,343591..343593,
                     343600..343602,343699..343704,343795..343806,
                     343990..343992,344077..344079)
                     /gene="nspC"
                     /locus_tag="BSVBI22_A0335"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143502"
     misc_feature    order(343216..343218,343990..343992)
                     /gene="nspC"
                     /locus_tag="BSVBI22_A0335"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143502"
     misc_feature    order(343600..343602,343804..343806,343990..343995,
                     344077..344079,344089..344091,344101..344103)
                     /gene="nspC"
                     /locus_tag="BSVBI22_A0335"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143502"
     gene            344386..345627
                     /locus_tag="BSVBI22_A0336"
                     /db_xref="GeneID:11727811"
     CDS             344386..345627
                     /locus_tag="BSVBI22_A0336"
                     /note="identified by similarity to GP:15141437; match to
                     protein family HMM PF03435"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154037.1"
                     /db_xref="GI:376280031"
                     /db_xref="GeneID:11727811"
                     /translation="MKKNVLIIGAGGVAQVVAHKCAQNSDVLGDIHIASRTVEKCRRI
                     IDSVREKKSLKTEVKLEAHALDAMDVEATKALIRKTGVQIVINVGSAFLNMSVLRACI
                     DTGVAYMDTAIHEDPKKICETPPWYGNYEWKHLKECEEKGITAILGIGFDPGVVNAYA
                     RLAADDYLDEVKSIDIVDINAGSHGRWFSTNFDPEINFREFTGTVYSWQNGQWQSNKM
                     FEVGQTFDLPVVGLSKAYMTGHDEVHSLSKNYPNADVRFWMGFGDHYINVFTVLKNLG
                     LLSEQPVKTAEGLEVVPLKVVKAVLPDPASLAPDYTGKTCIGDFVKGTKDGKEKEVFI
                     YNVADHKDAYNEVGSQGISYTAGVPPVAAAILIASGEWDVKKMVNVEELNPKPFLHIL
                     NQIGLPSRIKDENGDRALDFA"
     misc_feature    344386..>344955
                     /locus_tag="BSVBI22_A0336"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    344389..345621
                     /locus_tag="BSVBI22_A0336"
                     /note="Saccharopine dehydrogenase and related proteins
                     [Amino acid transport and metabolism]; Region: LYS9;
                     COG1748"
                     /db_xref="CDD:224662"
     gene            complement(345643..345858)
                     /locus_tag="BSVBI22_A0337"
                     /db_xref="GeneID:11727812"
     CDS             complement(345643..345858)
                     /locus_tag="BSVBI22_A0337"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154038.1"
                     /db_xref="GI:376280032"
                     /db_xref="GeneID:11727812"
                     /translation="MALLTLSTTRLTLRCKAKRRLEGEVQMELETHRWSTAPSFLRPP
                     DPSRRPCGPPQDEDRENKKPRRSGVFR"
     gene            complement(345883..346911)
                     /locus_tag="BSVBI22_A0338"
                     /db_xref="GeneID:11727813"
     CDS             complement(345883..346911)
                     /locus_tag="BSVBI22_A0338"
                     /note="identified by similarity to GP:9695312; match to
                     protein family HMM PF05544"
                     /codon_start=1
                     /transl_table=11
                     /product="proline racemase"
                     /protein_id="YP_005154039.1"
                     /db_xref="GI:376280033"
                     /db_xref="GeneID:11727813"
                     /translation="MRSTKVIHIVGCHAEGEVGDVIVGGVAPPPGETVWEQSRFIAND
                     ETLRNFVLNEPRGGVFRHVNLLVPPKDPRAQMGFIIMEPADTPPMSGSNSICVSTVLL
                     DSGIIAMQEPVTHMVLEAPGGIIEVEAECRNGKAERISVRNVPSFADRLDAPLDVTGL
                     GTIMVDTAYGGDSFVIVDAAQIGMKIEPGQARELAEIGVKITKAANEQLGFRHPERDW
                     RHISFCQITEPVTREGDVLTGVNTVAIRPAKLDRSPTGTGCSARMAVLHAKGQMKAGE
                     RFIGKSVLGTEFHCRLDKVLELGGKPAISPIISGRAWVTGTSQLMLDPSDPFPHGYRL
                     SDTWPRDE"
     misc_feature    complement(345889..346911)
                     /locus_tag="BSVBI22_A0338"
                     /note="Proline racemase [Amino acid transport and
                     metabolism]; Region: COG3938"
                     /db_xref="CDD:226448"
     misc_feature    complement(345910..346875)
                     /locus_tag="BSVBI22_A0338"
                     /note="hydroxyproline-2-epimerase; Provisional; Region:
                     PRK13971; cl19687"
                     /db_xref="CDD:268040"
     gene            complement(346966..347073)
                     /locus_tag="BSVBI22_A0339"
                     /db_xref="GeneID:11727814"
     CDS             complement(346966..347073)
                     /locus_tag="BSVBI22_A0339"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154040.1"
                     /db_xref="GI:376280034"
                     /db_xref="GeneID:11727814"
                     /translation="MPEEATHHEIDFSSSDWGRNGFLILARKRKFPSHN"
     gene            347364..348779
                     /locus_tag="BSVBI22_A0340"
                     /db_xref="GeneID:11727815"
     CDS             347364..348779
                     /locus_tag="BSVBI22_A0340"
                     /note="identified by similarity to SP:O82855; match to
                     protein family HMM PF01554; match to protein family HMM
                     TIGR00797"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance protein NorM, putative"
                     /protein_id="YP_005154041.1"
                     /db_xref="GI:376280035"
                     /db_xref="GeneID:11727815"
                     /translation="MDGTFDAGFREPTISKANRWGREMVVALKLGWPLIFTNLSQAAL
                     TATDVIFIGRLGADTLASALLATSFYHTLMIFSMGLVSAVMPMIAIALGKNRHSVRDV
                     RRTVRQGFWSAIMIVIPLWVVLWHCEEIFLFLGQRPDIAARSTDFMHTLQWALLPYLF
                     YIVLRSFFAAMEKPMWTLLVAALAIGFNALAGWTLIFGHFGFAPMGLHGAGMATTASS
                     TMMFLGLAFITLRHPRFRRYHLFGRFWRPDWPRLIELWRIGLPMALTFVFETSIFYAA
                     VVMMGRIGPTAMAAHAVAIQIASLSFMVPLGFGQVATVRVGRAYGRGDPKAIAYAGWS
                     AYALGVGFMALMGILMVLMPRVFIGIFLNLNDPQNLPVMELAVTFLALAALFQIVDGA
                     QAVAAGMLRGLRDTRIPMLLALFGYWGVGLPLGAVLAFQFGMGGVGIWLGLAAGLGMV
                     AVLMTIRWRRHLAHVSAVAAA"
     misc_feature    347430..348755
                     /locus_tag="BSVBI22_A0340"
                     /note="Subfamily of the multidrug and toxic compound
                     extrusion (MATE)-like proteins similar to Vibrio cholerae
                     NorM; Region: MATE_NorM_like; cd13131"
                     /db_xref="CDD:240536"
     misc_feature    347445..348776
                     /locus_tag="BSVBI22_A0340"
                     /note="multidrug efflux protein; Reviewed; Region:
                     PRK01766"
                     /db_xref="CDD:234981"
     misc_feature    order(348168..348170,348180..348182,348258..348260,
                     348267..348269,348519..348521,348531..348533,
                     348612..348614,348690..348692,348702..348704)
                     /locus_tag="BSVBI22_A0340"
                     /note="cation binding site [ion binding]; other site"
                     /db_xref="CDD:240536"
     gene            complement(348825..349347)
                     /locus_tag="BSVBI22_A0341"
                     /note="invasion protein B, authentic frameshift; this gene
                     contains a frame shift which is not the result of
                     sequencing error;identified by similarity to SP:P35641"
                     /pseudo
                     /db_xref="GeneID:11727816"
     gene            349595..350976
                     /locus_tag="BSVBI22_A0342"
                     /note="sensor histidine kinase, authentic frameshift; this
                     gene contains a frame shift which is not the result of
                     sequencing error;identified by similarity to GP:13641465"
                     /pseudo
                     /db_xref="GeneID:11727817"
     gene            350973..351614
                     /locus_tag="BSVBI22_A0343"
                     /db_xref="GeneID:11727818"
     CDS             350973..351614
                     /locus_tag="BSVBI22_A0343"
                     /note="identified by match to protein family HMM PF00072;
                     match to protein family HMM PF00196"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family DNA-binding response regulator"
                     /protein_id="YP_005154042.1"
                     /db_xref="GI:376280036"
                     /db_xref="GeneID:11727818"
                     /translation="MTNECKIRVLLVDNHPLVLDGLRAVLETYDDIDIAGAASNARVA
                     LEMALAVNPDVVLMDINMPLLNGIDAIELFKRQLPNVRILMLSMHDSREYISTSIMRG
                     ASGYILKDVSTNEIVTAIHAVASGGTYFSSGVSEALLESGEKRSEGLSARENDVLVLV
                     AEGGSNREIAARLGISEATVETHRKNIKKKLGIASTAGLTRYAIENRLCLSSL"
     misc_feature    350991..351599
                     /locus_tag="BSVBI22_A0343"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    351000..351344
                     /locus_tag="BSVBI22_A0343"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(351009..351014,351147..351149,351171..351173,
                     351231..351233,351288..351290,351297..351302)
                     /locus_tag="BSVBI22_A0343"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    351147..351149
                     /locus_tag="BSVBI22_A0343"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(351156..351161,351165..351173)
                     /locus_tag="BSVBI22_A0343"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    351297..351305
                     /locus_tag="BSVBI22_A0343"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    351417..351587
                     /locus_tag="BSVBI22_A0343"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(351420..351428,351465..351473,351495..351500,
                     351504..351509,351513..351527,351558..351560)
                     /locus_tag="BSVBI22_A0343"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(351453..351455,351459..351461,351465..351467,
                     351558..351566,351573..351575,351582..351587)
                     /locus_tag="BSVBI22_A0343"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            351902..352450
                     /locus_tag="BSVBI22_A0344"
                     /db_xref="GeneID:11727819"
     CDS             351902..352450
                     /locus_tag="BSVBI22_A0344"
                     /note="identified by similarity to GP:15162042; match to
                     protein family HMM PF04290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154043.1"
                     /db_xref="GI:376280037"
                     /db_xref="GeneID:11727819"
                     /translation="MSVLLALSRAIDAANNFIGKSVSWLVLVAVLISAINAVTRKLFN
                     VSSNAWLEAQWYLFSAVFLIAAGYTLLHSEHVKVDLLYSRYSRRTQLLVEIFGTIFFL
                     LPFCIITIYLSWPIVEAKIASGETSNNTGGLVLWPVWLLIPIGFSLLALQGISELIKR
                     IAILQGRIPDTVAIEDAEAQAL"
     misc_feature    351902..352447
                     /locus_tag="BSVBI22_A0344"
                     /note="TRAP-type mannitol/chloroaromatic compound
                     transport system, small permease component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: FcbT2; COG4665"
                     /db_xref="CDD:227011"
     gene            352462..354030
                     /locus_tag="BSVBI22_A0345"
                     /db_xref="GeneID:11727820"
     CDS             352462..354030
                     /locus_tag="BSVBI22_A0345"
                     /note="identified by match to protein family HMM
                     TIGR00786"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter subunit DctM"
                     /protein_id="YP_005154044.1"
                     /db_xref="GI:376280038"
                     /db_xref="GeneID:11727820"
                     /translation="MVAFFAENLAPLMFLSLVVVLLLGYPVAFALAFVGFAFGFIGIE
                     LGLLPVNLFGAIPDRIFGQMSNETLLAIPFFTFMGLILERSGMAEDLLDTIGQLFGPV
                     RGGLAYAVIIVGALLAATTGVVAASVISMGLISLPIMLRYGYDRKVASGTIAAAGTLA
                     QIIPPSLVLIVLADQLGRSVGDMYKGALVPGLLLVGIYVGFIVVMSILRPNSVPALPL
                     QARTLKGWKLARRVVLSLVPPLVLIFLVLGTIFIGVATPTEGGAMGAVGALLLAIIND
                     RLNLKMLTSALYATTKLSSFVIFILLGARVFSLTFYGVNGHVWVEHLMTSVPGGEVGF
                     LIVANILVFFLAFFLDYFELAFIIIPLLAPVADSLGIDLIWFGVMLAMNMQTSFMHPP
                     FGFSLFYLRSVAPSRPYKDKVTGATIPPVTSGQIYMGSIPFLLIQVVAVGVIIAFPGL
                     VTHYKGNHPQVDPASIQINVPMPDAGGGNPFGNAPAPFGAPSLAVEPLPAPSFGSRAP
                     SFGQGADQKEKPAQ"
     misc_feature    352471..353841
                     /locus_tag="BSVBI22_A0345"
                     /note="TRAP-type mannitol/chloroaromatic compound
                     transport system, large permease component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: FcbT3; COG4664"
                     /db_xref="CDD:227010"
     misc_feature    352531..353811
                     /locus_tag="BSVBI22_A0345"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     gene            354092..355210
                     /locus_tag="BSVBI22_A0346"
                     /db_xref="GeneID:11727821"
     CDS             354092..355210
                     /locus_tag="BSVBI22_A0346"
                     /note="identified by match to protein family HMM PF03480;
                     match to protein family HMM TIGR01409"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_005154045.1"
                     /db_xref="GI:376280039"
                     /db_xref="GeneID:11727821"
                     /translation="MKETLSRRSFLTKGAAIGAAAATSGAALATPAIAAELPTLRWRL
                     TSGFPNNLDTIYGGAVYMADAVSKMTDGKFQIQVFQAGEIVPAPQAIDAVQANTVEMA
                     HTCGYYFTGKNPTFAIGTALPFGMNTRLQNAWLYHGGGNELYNEFLSDYGIVGIVGGN
                     TAAQMGGWYRKEIKSAEDLKGLKMRIAGVAGEVMSRLGAVPQQLPGGDIYPSLERGTI
                     DAAEWVGPYDDEKLGFYQIAPYYYYPAFWEGGASVHFFINKKQYESLPEAYKVALNTA
                     AEAATQNMIALYDVKNTAAIRSLVSKGVKLQPLPRDVLDAAYKVSFDLYAEYNEKNPA
                     WAKIYPAWKKFRDEGFEWFRVAEYTYDSYVYAAQAAGK"
     misc_feature    354197..355189
                     /locus_tag="BSVBI22_A0346"
                     /note="TRAP-type mannitol/chloroaromatic compound
                     transport system, periplasmic component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: FcbT1; COG4663"
                     /db_xref="CDD:227009"
     gene            complement(355293..356111)
                     /locus_tag="BSVBI22_A0347"
                     /db_xref="GeneID:11727822"
     CDS             complement(355293..356111)
                     /locus_tag="BSVBI22_A0347"
                     /note="identified by similarity to OMNI:NTL02ML3955"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154046.1"
                     /db_xref="GI:376280040"
                     /db_xref="GeneID:11727822"
                     /translation="MSRNYYAPTGGLPPQTQLLTDRAMFTEAYAVIPKGTFSDIVTSF
                     LPFWEKTRLWVIARPLSGFAETFSQYIMEVQPGGGSDRAELDEGAEGVLFVVEGEVSV
                     TVAGKTHRLDEGGYAYLPPKSGWRLRNEGATTARFHWIRKAYEYVDGLDVPEPLFLNE
                     KDIAPSPMPDTGGAWATTRFVDPNDLRHDMHVTVVTFEPGGVIPFAETHVMEHGLYVL
                     EGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGKFRYLLYKDVNRHMKLA"
     misc_feature    complement(355296..356108)
                     /locus_tag="BSVBI22_A0347"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11171"
                     /db_xref="CDD:183011"
     misc_feature    complement(355680..355928)
                     /locus_tag="BSVBI22_A0347"
                     /note="Protein of unknown function (DUF861); Region:
                     Cupin_3; pfam05899"
                     /db_xref="CDD:147835"
     misc_feature    complement(355329..355634)
                     /locus_tag="BSVBI22_A0347"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            complement(356124..357551)
                     /locus_tag="BSVBI22_A0348"
                     /db_xref="GeneID:11727823"
     CDS             complement(356124..357551)
                     /locus_tag="BSVBI22_A0348"
                     /note="identified by similarity to OMNI:NTL02ML3956; match
                     to protein family HMM PF01522"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154047.1"
                     /db_xref="GI:376280041"
                     /db_xref="GeneID:11727823"
                     /translation="MKYPRNLVGYGRNTPDPRWPGGANIAVQFVVNYEEGGECCILDG
                     DPASECLLSEIVGAQPWRGQRNLNMESIYEYGARSGFWRLWRAFTRRNMPVTVYGVTL
                     AMARNPEAVAAMKEAGWEIASHGLRWWEYKDVPEEIEREHIREAVRLHTEVTGSRPLG
                     IYQGKPSDNTLKLVMEEGGFLYSADSYADELPYWVKGPKGPHLIVPYTLDANDMRFAT
                     PQGFNSGDQFFTYLKDSFDVLYREGEEGAPKMMSIGLHCRLAGRPGRMAALERFLDYV
                     QSHDKVWVAKRVDIARHWHKHHQPVVADVVPSKADRQAFVARYGSIFEHSPWIAERAY
                     DARLTVEEDSASGLAAAMTKVFRTAAPDERLAVLKAHPDLAGKLAQARRLTAESTAEQ
                     ASAGLDALTDTEKQAFTELNDAYTAKFGFPFIIAVKGRNKQEILDAFRRRVSNDRDTE
                     FETACAQVERIALLRLKDILPETLY"
     misc_feature    complement(356652..357545)
                     /locus_tag="BSVBI22_A0348"
                     /note="putative urate catabolism protein; Region:
                     uraD_N-term-dom; TIGR03212"
                     /db_xref="CDD:211797"
     misc_feature    complement(356673..357497)
                     /locus_tag="BSVBI22_A0348"
                     /note="Catalytic domain of bacterial PuuE allantoinases,
                     Schizosaccharomyces pombe chitin deacetylase 1 (SpCDA1),
                     and similar proteins; Region: CE4_PuuE_SpCDA1; cd10977"
                     /db_xref="CDD:200599"
     misc_feature    complement(order(356784..356786,357057..357065,
                     357168..357170,357180..357182,357399..357401,
                     357450..357452,357456..357458))
                     /locus_tag="BSVBI22_A0348"
                     /note="active site"
                     /db_xref="CDD:200599"
     misc_feature    complement(order(356784..356786,357450..357452))
                     /locus_tag="BSVBI22_A0348"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200599"
     misc_feature    complement(order(356751..356753,356757..356765,
                     356826..356828,356835..356840,356847..356852,
                     356859..356864,356871..356873,356880..356894,
                     356904..356909,356922..356927,356973..356975,
                     356982..356996,357048..357056,357060..357062,
                     357153..357158,357231..357236,357294..357296,
                     357303..357308,357315..357323,357327..357344,
                     357348..357353,357357..357362,357384..357392,
                     357423..357428,357438..357440,357444..357446))
                     /locus_tag="BSVBI22_A0348"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:200599"
     misc_feature    complement(356127..356633)
                     /locus_tag="BSVBI22_A0348"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3195"
                     /db_xref="CDD:225736"
     gene            357819..358094
                     /locus_tag="BSVBI22_A0349"
                     /db_xref="GeneID:11727824"
     CDS             357819..358094
                     /locus_tag="BSVBI22_A0349"
                     /note="identified by similarity to GP:15140674"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154048.1"
                     /db_xref="GI:376280042"
                     /db_xref="GeneID:11727824"
                     /translation="MGQEQNGYGRLRMRIPDQASGKPAANPCMELHPIGKRQAENLEE
                     APIREAGHRSVAFRNSVHLRFGICGGKAHYRLPRLVSPFSCSTCWGS"
     misc_feature    357843..358091
                     /locus_tag="BSVBI22_A0349"
                     /note="Transthyretin_like.  This domain is present in the
                     transthyretin-like protein (TLP) family which includes
                     transthyretin (TTR) and a transthyretin-related protein
                     called 5-hydroxyisourate hydrolase (HIUase).  TTR and
                     HIUase are homotetrameric proteins...; Region:
                     Transthyretin_like; cl17222"
                     /db_xref="CDD:266566"
     misc_feature    order(357870..357881,357987..357992,357996..357998,
                     358008..358016,358059..358061,358065..358085)
                     /locus_tag="BSVBI22_A0349"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100112"
     misc_feature    order(358041..358043,358047..358049,358053..358055,
                     358074..358076,358080..358082)
                     /locus_tag="BSVBI22_A0349"
                     /note="active site"
                     /db_xref="CDD:100112"
     gene            358100..359578
                     /locus_tag="BSVBI22_A0350"
                     /db_xref="GeneID:11727825"
     CDS             358100..359578
                     /locus_tag="BSVBI22_A0350"
                     /note="identified by similarity to OMNI:NTL02ML3958; match
                     to protein family HMM PF00111; match to protein family HMM
                     PF00941; match to protein family HMM PF01799; match to
                     protein family HMM PF03450"
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase"
                     /protein_id="YP_005154049.1"
                     /db_xref="GI:376280043"
                     /db_xref="GeneID:11727825"
                     /translation="MGQSARHEIRFLLNGETIVLDRVSPTETLLDYLRLSARLRGTKE
                     GCGEGDCGACTVLVGRVVDGGLVYESVNACIRFVGSLDGCHVVTIEYLRGADGDLHPV
                     QKAMVEFHGSQCGFCTPGFVMSLYALWMRDPRPADAAIEKALQGNLCRCTGYEAIMRA
                     ARAISDYGNVAQDPLAAERAHVLQRLTALRDGARVEVGAGKDRLIVPADLDDFAPILA
                     AEPKATIVAGSTDVGLWVTKMMRDISPVVFIGHLEELHSIREENGVVTIGAGVTYTQA
                     FGFLAGRIPALGQLINRIGGEQVRNMGTIGGNIANGSPIGDTPPPLIALGATLTLRKG
                     AERRTIALEDFFIAYGKQDRGAGEFVEAVHVPLPGEGSRFAAYKVSKRREEDITASLG
                     AFHLMLDAAGNVAHIRIAYGGMAATPKRAHAVETALMGKPWTEATVEAALEAYAQDYT
                     PLTDMRATAEYRLLVARNMLRRFYLETTGSGETLGALRGEAA"
     misc_feature    358100..359575
                     /locus_tag="BSVBI22_A0350"
                     /note="Xanthine dehydrogenase, iron-sulfur cluster and
                     FAD-binding subunit A [Nucleotide transport and
                     metabolism]; Region: XdhA; COG4630"
                     /db_xref="CDD:226977"
     misc_feature    358124..>358291
                     /locus_tag="BSVBI22_A0350"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    order(358223..358228,358235..358237,358244..358246,
                     358250..358261)
                     /locus_tag="BSVBI22_A0350"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    order(358235..358237,358250..358252,358259..358261)
                     /locus_tag="BSVBI22_A0350"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     misc_feature    358361..358588
                     /locus_tag="BSVBI22_A0350"
                     /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
                     /db_xref="CDD:250876"
     misc_feature    358697..359203
                     /locus_tag="BSVBI22_A0350"
                     /note="FAD binding domain in molybdopterin dehydrogenase;
                     Region: FAD_binding_5; pfam00941"
                     /db_xref="CDD:250245"
     misc_feature    359222..359530
                     /locus_tag="BSVBI22_A0350"
                     /note="CO dehydrogenase flavoprotein C-terminal domain;
                     Region: CO_deh_flav_C; pfam03450"
                     /db_xref="CDD:251962"
     gene            359591..361933
                     /locus_tag="BSVBI22_A0351"
                     /db_xref="GeneID:11727826"
     CDS             359591..361933
                     /locus_tag="BSVBI22_A0351"
                     /note="identified by match to protein family HMM PF01315;
                     match to protein family HMM PF02738"
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase"
                     /protein_id="YP_005154050.1"
                     /db_xref="GI:376280044"
                     /db_xref="GeneID:11727826"
                     /translation="MNRHSATDIKAARIRGGVATEQKHDSAHKHVTGTAVYIDDIPEP
                     EGTLHIGVGYASVAHGRIKSMDLEAVRAAPGVVDILTCKDVPGENDVSPSGMHDDPIF
                     AVDKVEFHGQPIFAVIAKTRDQARRAARLAKIEYEEAPGIYSIDMLDGLKDRLVTPPL
                     TLERGNARAAIDAAPHRIRNRMYLGGQDHFYLEGQVSLAVPGEDEDVTVYCSTQGPSE
                     TQHLVAHALGVSSHSVTVEVRRMGGGFGGKETQANQWAAIAAIAAKKHKRAVKIRLDR
                     DEDMTSTGKRHGFVIDYEVGFDDDGTILGVDYLYALNAGFSADLSGPVGDRALFHCDN
                     AYFYPAVHAQSAPLYTNTAFRGFGGPQGMAGAERVIDEVAFALGKDPLEIRKRNFYDE
                     MGKDGTRNVTPYHQKVEDCIIQRIVAQLEESADYAKRREAIREFNAKSRYVKRGIALT
                     PVKFGISFTKTESNQAGALVHVYADGSVHMNHGGTEMGQGLHMKVAQVVAEEFQIDID
                     RVKITATTTAKVPNTAPTAASSGADLNGMAAQDAARQIRKRLIRFAAQQYQVPEDQIM
                     FLPNRVRVGNQEISFNDLVNQAYIGRVQLSAAGHYKTPKIHWDRAKGRGHAFYYYAYG
                     AACSEVSVDTLTGEYVVERTDILHDTGRSLNRAIDIGQIEGGFVQGMGWLTTEELVWD
                     EKGRLRTHAPSTYKIPLASDRPKIFNVALTDWSEAYEPTIHRSKAVGEPPLPLGLSVL
                     HALADAVASVADYKVCPRLDAPATPERVLMTVERLRKQNG"
     misc_feature    359591..361930
                     /locus_tag="BSVBI22_A0351"
                     /note="Xanthine dehydrogenase, molybdopterin-binding
                     subunit B [Nucleotide transport and metabolism]; Region:
                     XdhB; COG4631"
                     /db_xref="CDD:226978"
     misc_feature    359684..360010
                     /locus_tag="BSVBI22_A0351"
                     /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
                     hammerhead domain; Region: Ald_Xan_dh_C; smart01008"
                     /db_xref="CDD:214971"
     misc_feature    360056..361702
                     /locus_tag="BSVBI22_A0351"
                     /note="Molybdopterin-binding domain of aldehyde
                     dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
                     /db_xref="CDD:251506"
     gene            362064..362810
                     /locus_tag="BSVBI22_A0352"
                     /db_xref="GeneID:11727827"
     CDS             362064..362810
                     /locus_tag="BSVBI22_A0352"
                     /note="identified by similarity to OMNI:CC2617"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone XdhC"
                     /protein_id="YP_005154051.1"
                     /db_xref="GI:376280045"
                     /db_xref="GeneID:11727827"
                     /translation="MLVARDTIFRTIGGGQLEYMAIEHARKILSGGRDTPLDVPLGPE
                     IGQCCGGRVSLSFRLMTHGLADELVGKVDTEIAMRPHVYIFGAGHVGGALAHALSLTP
                     VRIIMVDTREAELMKFQEKWEPVFRPGFHGNYICDVPGVETCLSAIPEQAVRSAPPHS
                     AFIILTHDHALDFLIAAEALQRQDAAYVGMVGSKTKKATFKNWLKREAGREDLFENLV
                     CPIGGAVVKDKRPEVIAALAAAEILTAVLV"
     misc_feature    362064..362762
                     /locus_tag="BSVBI22_A0352"
                     /note="xanthine dehydrogenase accessory protein XdhC;
                     Region: xanthine_xdhC; TIGR02964"
                     /db_xref="CDD:234073"
     misc_feature    <362064..362186
                     /locus_tag="BSVBI22_A0352"
                     /note="XdhC and CoxI family; Region: XdhC_CoxI; pfam02625"
                     /db_xref="CDD:251428"
     misc_feature    362307..362729
                     /locus_tag="BSVBI22_A0352"
                     /note="XdhC Rossmann domain; Region: XdhC_C; pfam13478"
                     /db_xref="CDD:257802"
     gene            complement(362891..363805)
                     /locus_tag="BSVBI22_A0353"
                     /db_xref="GeneID:11727828"
     CDS             complement(362891..363805)
                     /locus_tag="BSVBI22_A0353"
                     /note="identified by match to protein family HMM PF00126;
                     match to protein family HMM PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005154052.1"
                     /db_xref="GI:376280046"
                     /db_xref="GeneID:11727828"
                     /translation="MSYLDNLRVFVRVVELGNLSAAGRDQRASPAVVSNRIKELEKNL
                     GVRLFNRTTRKLTPTEHGRVFYDGALKILEAVDEAEAAVAELAKNPKGSIRITAPLGF
                     GRRLIASGIPEFHDRYPDIEVRLRLSDHEVDIMSEGVDVAFKLGVLENSNLRMRGIMN
                     CERVVCAAPQYLERHGTPQSPEALLSDRHHCLLLRFPGSKEYYWLLQTPEGLRKFEVT
                     GPYDSDDGDVLTQWALGGRGIINKPLFEVKEYIRDGRLTPILQHTPPAPIQLAAIYPH
                     KRLQDPKVRLIIDFMTERCQRLIREALA"
     misc_feature    complement(362912..363796)
                     /locus_tag="BSVBI22_A0353"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(363617..363796)
                     /locus_tag="BSVBI22_A0353"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(362933..363532)
                     /locus_tag="BSVBI22_A0353"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(362996..362998,363077..363079,
                     363128..363130,363323..363325,363329..363331,
                     363371..363373,363488..363490,363500..363502))
                     /locus_tag="BSVBI22_A0353"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(363101..363103,363110..363115,
                     363134..363148,363236..363238,363425..363445,
                     363449..363451,363461..363463,363470..363475,
                     363479..363484,363494..363499))
                     /locus_tag="BSVBI22_A0353"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            363986..365230
                     /locus_tag="BSVBI22_A0354"
                     /db_xref="GeneID:11727829"
     CDS             363986..365230
                     /locus_tag="BSVBI22_A0354"
                     /note="identified by similarity to GP:15140681"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154053.1"
                     /db_xref="GI:376280047"
                     /db_xref="GeneID:11727829"
                     /translation="MYDFAVAWDWLGFAVRWLHVTTAIAWIGSSFYFIALDLGLRQRP
                     GLPEGAYGEEWQVHGGGFYQIQKYLVAPAQMPEHLTWFKWESYATWLSGFTLLCIVYY
                     AGADLYLVDPNVLDVSVPVAIAISLAFGWIAYNTICNMMLGRSDTLLMVILYCILVVM
                     AWGYTHLFTGRAAFLHLGAFTATIMSANVFMIIIPNQKIVVADLIAGRKPDPKYGKIA
                     KQRSTHNNYLTLPVLFLMLSNHYPLAFGTEFNWIIASLVFLMGVTIRHWFNTRHARKG
                     NPTWTWLVTVILFIIIIWLSTVPKILTGEPENPKVSALQQSFLNDPHFDKVRDTVLGR
                     CSMCHATEPGWEGIIAPPKGVVLDTDRNIAAHAREIYLQAGRSHAMPPANVTGVTDEE
                     RQLLASWYQSVTTGPKEGTKTE"
     misc_feature    363992..365206
                     /locus_tag="BSVBI22_A0354"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3748"
                     /db_xref="CDD:226271"
     misc_feature    363992..364879
                     /locus_tag="BSVBI22_A0354"
                     /note="Protein of unknown function (DUF989); Region:
                     DUF989; pfam06181"
                     /db_xref="CDD:253604"
     misc_feature    364955..365194
                     /locus_tag="BSVBI22_A0354"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            365227..366531
                     /locus_tag="BSVBI22_A0355"
                     /db_xref="GeneID:11727830"
     CDS             365227..366531
                     /locus_tag="BSVBI22_A0355"
                     /note="Catalyzes the deamination of guanine"
                     /codon_start=1
                     /transl_table=11
                     /product="guanine deaminase"
                     /protein_id="YP_005154054.1"
                     /db_xref="GI:376280048"
                     /db_xref="GeneID:11727830"
                     /translation="MTKLLIRGRVLTFRDEPQSLDDSHAYRYIEDGAVLVENGRILRL
                     GDYAEVSGEAGADVKLADHRPHLVVPGFIDTHIHYPQTQVVASYAANLLEWLNTYTFV
                     AEQKFADEQHAEFIAEHFLDELIRHGTTTAVAYCSVHPQSVDAYFRASQHRNMRMLGG
                     KVMMDRNAPPALCDTAQSGYDDTKALIARWQGQGRLDYVITPRFAITSTPEQLEASQT
                     LVREHPECFVQTHLSENHDEIAFTRSLYPDAPDYLGIYEHYSLLGNKTLLGHSIHLEE
                     REVRLMAETGSIAVFCPTSNLFLGSGLFDRDRLKAAGVRMAVATDIGGGTSFSMLRTM
                     DEGYKVLQLRGQRLNPFQSFYMMTLGNARALSMEDRIGTLEEGTEADIVVLDSSATSP
                     MRLRMAAGATLEQELFLLQTLGDDRAIVETYVAGKPMKADLL"
     misc_feature    365227..366525
                     /locus_tag="BSVBI22_A0355"
                     /note="guanine deaminase; Provisional; Region: PRK09228"
                     /db_xref="CDD:236419"
     misc_feature    365242..366504
                     /locus_tag="BSVBI22_A0355"
                     /note="Guanine deaminase (GDEase). Guanine deaminase is an
                     aminohydrolase responsible for the conversion of guanine
                     to xanthine and ammonia, the first step to utilize guanine
                     as a nitrogen source. This reaction also removes the
                     guanine base from the pool and...; Region: GDEase;
                     cd01303"
                     /db_xref="CDD:238628"
     misc_feature    order(365452..365454,365458..365460,365917..365919,
                     365926..365928,366034..366036,366187..366189)
                     /locus_tag="BSVBI22_A0355"
                     /note="active site"
                     /db_xref="CDD:238628"
     gene            366611..367897
                     /locus_tag="BSVBI22_A0356"
                     /db_xref="GeneID:11727831"
     CDS             366611..367897
                     /locus_tag="BSVBI22_A0356"
                     /note="identified by similarity to EGAD:40602; match to
                     protein family HMM PF05161"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate reductase"
                     /protein_id="YP_005154055.1"
                     /db_xref="GI:376280049"
                     /db_xref="GeneID:11727831"
                     /translation="MSAIADPKKFLTNLFDAAVAAADPELVIRANLPEKPKGRTIVIG
                     AGKGSAQMAAAFERAWAEKHDAPLEGVVVTRYGYGAPCERIRIIEAAHPVPDGAGLAA
                     SRRLFNAVSGLSEDDLVVALISGGGSALLPSPPEGMTLEDEIAVNKALLASGAPISAM
                     NAVRKHLSTIKGGRLAAAAHPAKVFSLVVSDIPGDNPAFVASGPTVPDETSRDEALKI
                     IERYRLDLPQAALAHIKSENAHAPQPDDGVFARNEVRVIASAAVSLEAAAREASRHGV
                     EAVILSDSVEGEAREVAHVHAAIAREVAERDRPFKKPVVILSGGETTVTIGSPGGKGG
                     RNSEFLLSFALDIDGYANIHALAADTDGIDGSEDNAGAFADGGTVSRLQKLGEDGMAR
                     LNANDAWTAFDALGDLFVPGPTGTNVNDLRAILITV"
     misc_feature    366614..367891
                     /locus_tag="BSVBI22_A0356"
                     /note="Putative glycerate kinase [Carbohydrate transport
                     and metabolism]; Region: GckA; COG2379"
                     /db_xref="CDD:225254"
     misc_feature    366635..367312
                     /locus_tag="BSVBI22_A0356"
                     /note="Domain of unknown function (DUF4147); Region:
                     DUF4147; pfam13660"
                     /db_xref="CDD:257967"
     misc_feature    367547..367870
                     /locus_tag="BSVBI22_A0356"
                     /note="MOFRL family; Region: MOFRL; pfam05161"
                     /db_xref="CDD:253053"
     gene            complement(367878..368036)
                     /gene="ccoS"
                     /locus_tag="BSVBI22_A0357"
                     /db_xref="GeneID:11727832"
     CDS             complement(367878..368036)
                     /gene="ccoS"
                     /locus_tag="BSVBI22_A0357"
                     /note="identified by match to protein family HMM PF03597;
                     match to protein family HMM TIGR00847"
                     /codon_start=1
                     /transl_table=11
                     /product="cbb3-type cytochrome oxidase maturation protein"
                     /protein_id="YP_005154056.1"
                     /db_xref="GI:376280050"
                     /db_xref="GeneID:11727832"
                     /translation="MSGLIFLIPIALFLGLLGLAAFLWSLKSGQYDDLDGAANRILLD
                     DESKPLSK"
     misc_feature    complement(367899..368033)
                     /gene="ccoS"
                     /locus_tag="BSVBI22_A0357"
                     /note="Cytochrome oxidase maturation protein cbb3-type;
                     Region: CcoS; pfam03597"
                     /db_xref="CDD:252047"
     gene            complement(368033..370291)
                     /locus_tag="BSVBI22_A0358"
                     /db_xref="GeneID:11727833"
     CDS             complement(368033..370291)
                     /locus_tag="BSVBI22_A0358"
                     /note="identified by match to protein family HMM PF00122;
                     match to protein family HMM PF00403; match to protein
                     family HMM PF00702; match to protein family HMM TIGR01494;
                     match to protein family HMM TIGR01511; match to protein
                     family HMM TIGR01525"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation protein FixI"
                     /protein_id="YP_005154057.1"
                     /db_xref="GI:376280051"
                     /db_xref="GeneID:11727833"
                     /translation="MSCCVENAQIATVIQSVSPEEMQIASRALGDGLRQLDLSVPGVH
                     CGLCIKTIEDALGKISGVAYVRVNLTARRVTLRWKDGETPPNVVDTLRRLGYEAHIFD
                     MAQDKDPTFTRLLIALGVAAFASSNVMLLSVAVWSGADAATRDMFHWISGLIAFPTLV
                     YSGRIFYVSAWNALRAGRVNMDVPIALAISLAFAMSVYETIHHGQHAYFDASVTLLFF
                     LLIGRTLDYMMRARARSAVRGLAQLGSRGAVVIGENDERNYLPVNEIRPGMRIILAAG
                     ERVPVDAKVEEGRSELDCSIASGESDAVPVGPGSDIRAGTLNLSTPLVIRATAEARDS
                     FLSEMVRLMDIAEDGRAHYRRLADRASELYVPMVHATAFLAFAGWMFYTGGDWYRSIY
                     IAISTLIITCPCALALAVPIVQVVAARRLFENGIMIKDGSAMERMAEIDTAVFDKTGT
                     LTLGQPWLINAQEIEPHYLEIAAELSLYSRHPLSRALALFSGATPMTPFTRIEEVPGA
                     GIEAELDGTIYRLGKQEWACGKAETAQPSGPETCLSIDGRLVQVFRFEDRPREDAANA
                     IAALKRNGLKLGIISGDKQAAVKKLADYLGVNDYHSGVLPADKSKLVQELSSEGRKVL
                     MVGDGLNDAPALVAAHVSMAPATAADIGRNAADFVFLRESLSAVPLAFAVSKEAGKLV
                     SQNFGLSIGYNIIAVPIAVFGYVTPLVAALSMSLSSIVVVTNALRLRAGKQKQQARQS
                     GAPATTMKEAHK"
     misc_feature    complement(368105..370195)
                     /locus_tag="BSVBI22_A0358"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: ZntA; COG2217"
                     /db_xref="CDD:225127"
     misc_feature    complement(369995..370183)
                     /locus_tag="BSVBI22_A0358"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(370148..370150,370157..370165))
                     /locus_tag="BSVBI22_A0358"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    complement(368984..369649)
                     /locus_tag="BSVBI22_A0358"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    complement(368375..368659)
                     /locus_tag="BSVBI22_A0358"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(368549..368551)
                     /locus_tag="BSVBI22_A0358"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(370288..370785)
                     /locus_tag="BSVBI22_A0359"
                     /db_xref="GeneID:11727834"
     CDS             complement(370288..370785)
                     /locus_tag="BSVBI22_A0359"
                     /note="identified by similarity to EGAD:10086; match to
                     protein family HMM PF05751"
                     /codon_start=1
                     /transl_table=11
                     /product="FixH protein"
                     /protein_id="YP_005154058.1"
                     /db_xref="GI:376280052"
                     /db_xref="GeneID:11727834"
                     /translation="MSTNSKTSGTFTGWHMLGIMFMFFGVIIAVNLLMAYNAIHSWSG
                     LVVQNTYVASQEFNDKAKTGKEQAALNWQSKPAYENGVFTWQLADHNGKAVAMTGGTV
                     DFKRPVGDAHDTKVTLTVREPGILTAPLELGEGAWIMEVNADAGLEDPYRHIIRVLVK
                     DGKIL"
     misc_feature    complement(370291..370785)
                     /locus_tag="BSVBI22_A0359"
                     /note="Predicted integral membrane protein linked to a
                     cation pump [Inorganic ion transport and metabolism];
                     Region: COG5456"
                     /db_xref="CDD:227743"
     gene            complement(370785..372335)
                     /locus_tag="BSVBI22_A0360"
                     /db_xref="GeneID:11727835"
     CDS             complement(370785..372335)
                     /locus_tag="BSVBI22_A0360"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster-binding protein"
                     /protein_id="YP_005154059.1"
                     /db_xref="GI:376280053"
                     /db_xref="GeneID:11727835"
                     /translation="MSDDVERIDVQAVNSPKTRQSLYASRVKIFPKRVQGTFRRFKWI
                     VMFITLGIYYLTPWLRWDRGAYAPDQAVLIDLANRRFYFFFIEIWPQEFYYVAGLLIM
                     AGLGLFLVTSVAGRAWCGYTCPQTVWVDLFLVVERAVEGDRNARMKLDKAPWTFDKVW
                     KRLAKHSIWIVIGVLTGGAWIFYFADAPTLLKDFVTGHAAPVAYFTVAILTATTYIFG
                     GLMREQVCTYMCPWPRIQAAMLDENSLTVTYNDWRGEPRSRHSKKAIAAGETVGDCVD
                     CNACVAACPMGIDIRDGQQLECITCALCIDACDSVMDKIGKPRGLISYATLADYDANM
                     ALATNNGIAPTDPARVYEAPNKFSDKVQNLSWKKVLRPRSMFYFAIWALIGVVLIVSL
                     STRQRIGINVLHDRTPQYVLLSDGSIRNGYTVKLLNMIPTPRTFQLSIQGLPEATLTV
                     QDETPDANGNYAIAVEPDKLKNLRVFVTMPHDAVTEPRKDYEIEVRAEDGSEGARYKA
                     TFMAPERK"
     misc_feature    complement(370797..372224)
                     /locus_tag="BSVBI22_A0360"
                     /note="cytochrome c oxidase accessory protein FixG;
                     Region: ccoG_rdxA_fixG; TIGR02745"
                     /db_xref="CDD:233993"
     misc_feature    complement(<371940..372041)
                     /locus_tag="BSVBI22_A0360"
                     /note="4Fe-4S binding domain; Region: Fer4_5; pfam12801"
                     /db_xref="CDD:257308"
     misc_feature    complement(371463..371663)
                     /locus_tag="BSVBI22_A0360"
                     /note="4Fe-4S dicluster domain; Region: Fer4_18;
                     pfam13746"
                     /db_xref="CDD:258039"
     misc_feature    complement(<371379..>371531)
                     /locus_tag="BSVBI22_A0360"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     misc_feature    complement(370803..371162)
                     /locus_tag="BSVBI22_A0360"
                     /note="IG-like fold at C-terminal of FixG, putative
                     oxidoreductase; Region: FixG_C; pfam11614"
                     /db_xref="CDD:256531"
     gene            complement(372495..373358)
                     /gene="ccoP"
                     /locus_tag="BSVBI22_A0361"
                     /db_xref="GeneID:11727836"
     CDS             complement(372495..373358)
                     /gene="ccoP"
                     /locus_tag="BSVBI22_A0361"
                     /note="identified by match to protein family HMM PF00034;
                     match to protein family HMM TIGR00782"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, cbb3-type subunit III"
                     /protein_id="YP_005154060.1"
                     /db_xref="GI:376280054"
                     /db_xref="GeneID:11727836"
                     /translation="MTDKQIDEVSGVSTTGHEWDGIKELDNPMPRWWLWTFYATIFWA
                     IAYVIAYPAWPLISGSTAGLTGWSSRGQFWQENAKIAASRQGIIDQIKAKDVHEILAD
                     EELRQYAIAGGAAAFRVNCVQCHGSGAQGAPGYPNLNDDDWLWGGSIDDIVTTIRHGV
                     RSPDDPETRLSEMTAFADVLEPQQIRDVAAYVVNLSGTPHDPSMVPEGQKVFAENCAV
                     CHGADAKGLREFGAPNLTDAIWLYGSGEDAIIRQVSHPKHGVMPAWEARLGDATVKQL
                     AIFVHSLGGGE"
     misc_feature    complement(372498..373349)
                     /gene="ccoP"
                     /locus_tag="BSVBI22_A0361"
                     /note="cytochrome c oxidase, cbb3-type, subunit III;
                     Region: ccoP; TIGR00782"
                     /db_xref="CDD:129864"
     misc_feature    complement(373182..373331)
                     /gene="ccoP"
                     /locus_tag="BSVBI22_A0361"
                     /note="N-terminal domain of cytochrome oxidase-cbb3, FixP;
                     Region: FixP_N; pfam14715"
                     /db_xref="CDD:258852"
     misc_feature    complement(372771..373031)
                     /gene="ccoP"
                     /locus_tag="BSVBI22_A0361"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     misc_feature    complement(372519..372746)
                     /gene="ccoP"
                     /locus_tag="BSVBI22_A0361"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     gene            complement(373351..373509)
                     /gene="ccoQ"
                     /locus_tag="BSVBI22_A0362"
                     /db_xref="GeneID:11727837"
     CDS             complement(373351..373509)
                     /gene="ccoQ"
                     /locus_tag="BSVBI22_A0362"
                     /note="identified by similarity to EGAD:125983; match to
                     protein family HMM PF05545"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, cbb3-type, CcoQ subunit"
                     /protein_id="YP_005154061.1"
                     /db_xref="GI:376280055"
                     /db_xref="GeneID:11727837"
                     /translation="MDYNSLRTFADSWGLFGMALFFVFVVLYAFRPGSKKKADEAKEI
                     PFKDDKND"
     misc_feature    complement(373369..373509)
                     /gene="ccoQ"
                     /locus_tag="BSVBI22_A0362"
                     /note="Cytochrome cbb oxidase CcoQ.  Cytochrome cbb3
                     oxidase, the terminal oxidase in the respiratory chains of
                     proteobacteria, is a multi-chain transmembrane protein
                     located in the cell membrane. Like other cytochrome
                     oxidases, it catalyzes the reduction of O2...; Region:
                     cbb3_Oxidase_CcoQ; cd01324"
                     /db_xref="CDD:238647"
     gene            complement(373524..374255)
                     /gene="ccoO"
                     /locus_tag="BSVBI22_A0363"
                     /db_xref="GeneID:11727838"
     CDS             complement(373524..374255)
                     /gene="ccoO"
                     /locus_tag="BSVBI22_A0363"
                     /note="identified by match to protein family HMM PF02433;
                     match to protein family HMM TIGR00781"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, cbb3-type subunit II"
                     /protein_id="YP_005154062.1"
                     /db_xref="GI:376280056"
                     /db_xref="GeneID:11727838"
                     /translation="MSILKNHSKLEKNATLLLIASLAVVTVGGLVEIAPLFYLENTIE
                     KVEGMRPYSPLELAGRDIYVREGCYLCHSQMIRPFRDEVERYGHYSLAAESMYDHSFQ
                     WGSKRTGPDLARVGGRYSNEWHVQHLVRPRDVVPESVMPSYAFLKERPLKADDIAAHL
                     KANVAVGVPYTQEMIDKALDDLKAQATPDADTSGMEERYPKARVGDFDGNPQMISEMD
                     ALIAYLQMLGTLVDFSTYDQSPKAR"
     misc_feature    complement(373560..374237)
                     /gene="ccoO"
                     /locus_tag="BSVBI22_A0363"
                     /note="Cytochrome C oxidase, mono-heme subunit/FixO;
                     Region: FixO; pfam02433"
                     /db_xref="CDD:111339"
     gene            complement(374270..375895)
                     /gene="ccoN"
                     /locus_tag="BSVBI22_A0364"
                     /db_xref="GeneID:11727839"
     CDS             complement(374270..375895)
                     /gene="ccoN"
                     /locus_tag="BSVBI22_A0364"
                     /note="identified by match to protein family HMM PF00115;
                     match to protein family HMM TIGR00780"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, cbb3-type subunit I"
                     /protein_id="YP_005154063.1"
                     /db_xref="GI:376280057"
                     /db_xref="GeneID:11727839"
                     /translation="MNYAAGTVLSGLGALFAVLLAGFSHDELFRTHMWILFATLAIFT
                     ILLMRNADYGLTPKKVDQSTYMDGPIRYGVIATVFWGVVGFLVGVLIAAQLAFPDLNL
                     QPYFNFGRLRPVHTSAVIFAFGGNALICSSFYVVQRTCRARLFGGDLAWFVFWGYQLF
                     IVMAATGYLLGITQSREYAEPEWYVDIWLTIVWVAYLVVFMGTLLRRKEPHIYVANWF
                     YLSFIITIAMLHIINNLAIPVSFLGVKSYSAFAGVQDAVTQWWYGHNAVAFFLTVPFL
                     AMMYYFVPKQANRPVYSYRLSIVHFWSIIFLYIWAGPHHLHYTAVPDWAQTLGMVFSI
                     MLWMPSWGGMINGLMTLSGAWDKVRTDPIIRLMVAAIAFYGMATFEGPMLSIKAVNSL
                     SHYTDWTIGHVHAGALGWNGMISFAAVYYLAPKLWNRQRLYSIRMVNWHFWLATLGIV
                     LYASSMWVAGIQQGLMWREYDNQGFLVYSFAETVLAMFPYYVIRTIGGVFYLTGGLLM
                     AWNVYQTIRGRLRNEAPMGGTRPVAGATMQPAE"
     misc_feature    complement(374348..375823)
                     /gene="ccoN"
                     /locus_tag="BSVBI22_A0364"
                     /note="Cytochrome cbb3 oxidase subunit I.  Cytochrome cbb3
                     oxidase, the terminal oxidase in the respiratory chains of
                     proteobacteria, is a multi-chain transmembrane protein
                     located in the cell membrane. Like other cytochrome
                     oxidases, it catalyzes the reduction...; Region:
                     cbb3_Oxidase_I; cd01661"
                     /db_xref="CDD:238831"
     misc_feature    complement(374396..375688)
                     /gene="ccoN"
                     /locus_tag="BSVBI22_A0364"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:249600"
     misc_feature    complement(order(374429..374431,374540..374542,
                     374672..374674,374684..374686,375680..375682))
                     /gene="ccoN"
                     /locus_tag="BSVBI22_A0364"
                     /note="Low-spin heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238831"
     misc_feature    complement(order(374495..374497,374711..374716,
                     374726..374728,375125..375130,375143..375145))
                     /gene="ccoN"
                     /locus_tag="BSVBI22_A0364"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238831"
     misc_feature    complement(order(374690..374692,374951..374956,
                     375104..375106))
                     /gene="ccoN"
                     /locus_tag="BSVBI22_A0364"
                     /note="Binuclear center (active site) [active]"
                     /db_xref="CDD:238831"
     misc_feature    complement(order(374492..374497,374711..374716,
                     374951..374953))
                     /gene="ccoN"
                     /locus_tag="BSVBI22_A0364"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238831"
     gene            complement(376113..376571)
                     /locus_tag="BSVBI22_A0365"
                     /db_xref="GeneID:11727840"
     CDS             complement(376113..376571)
                     /locus_tag="BSVBI22_A0365"
                     /note="identified by match to protein family HMM PF01475"
                     /codon_start=1
                     /transl_table=11
                     /product="FUR family transcriptional regulator"
                     /protein_id="YP_005154064.1"
                     /db_xref="GI:376280058"
                     /db_xref="GeneID:11727840"
                     /translation="MLFDPHKAPTSQPKPAKVKSILQQAGLRPTRQRMALGRLLFLDQ
                     NRHVTPDLLYEEALQAGVTLSVATVYNTLNQFAEAGLVRRISIHGERTYFDTDTGDHT
                     HFYIAEEGRIIDIPSENVSIGPLPAPPDGYRISKVDITIQIERDPGSKRI"
     misc_feature    complement(376149..376481)
                     /locus_tag="BSVBI22_A0365"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(376230..376232,376260..376262,
                     376266..376268,376287..376289,376431..376433))
                     /locus_tag="BSVBI22_A0365"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(376335..376379)
                     /locus_tag="BSVBI22_A0365"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(376161..376163,376263..376265,
                     376269..376271))
                     /locus_tag="BSVBI22_A0365"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(376149..376166,376170..376178,
                     376203..376208,376248..376256))
                     /locus_tag="BSVBI22_A0365"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     gene            376570..376896
                     /locus_tag="BSVBI22_A0366"
                     /db_xref="GeneID:11727841"
     CDS             376570..376896
                     /locus_tag="BSVBI22_A0366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154065.1"
                     /db_xref="GI:376280059"
                     /db_xref="GeneID:11727841"
                     /translation="MSASFALREAAFADAVFDSPVLAQWQSCLPPGRANEKPVAAKII
                     GLEAVSRCQENHLGASDIANGLQLQSKAGGAYPSMKIEPIVQWTGFAGNVLNPRGFRY
                     SALRLP"
     gene            377013..377627
                     /locus_tag="BSVBI22_A0367"
                     /db_xref="GeneID:11727842"
     CDS             377013..377627
                     /locus_tag="BSVBI22_A0367"
                     /note="identified by similarity to GP:13235366; match to
                     protein family HMM PF01323; match to protein family HMM
                     TIGR01409"
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocation pathway signal
                     sequence domain-containing protein"
                     /protein_id="YP_005154066.1"
                     /db_xref="GI:376280060"
                     /db_xref="GeneID:11727842"
                     /translation="MMNRRQILAATAAGAATFALSGGSGLAQRVPSVAEVLYDKEIPV
                     LGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVRKDGNVRLVMKDWIIFGETSAYAARL
                     VLAAEKSGNYEKAMEALMTTPGRLTRDQVDGALKKAGLDAAKLQAAYKADAKRIDGIL
                     QRNMKQGEAFNFAGTPSFVIGTRLYGGVMKEKELLEAIKNARKT"
     misc_feature    <377091..377621
                     /locus_tag="BSVBI22_A0367"
                     /note="Protein-disulfide isomerase [Posttranslational
                     modification, protein turnover, chaperones]; Region: DsbG;
                     COG1651"
                     /db_xref="CDD:224565"
     misc_feature    377148..377609
                     /locus_tag="BSVBI22_A0367"
                     /note="DsbA family, Com1-like subfamily; composed of
                     proteins similar to Com1, a 27-kDa outer
                     membrane-associated immunoreactive protein originally
                     found in both acute and chronic disease strains of the
                     pathogenic bacteria Coxiella burnetti. It contains a
                     CXXC...; Region: DsbA_Com1_like; cd03023"
                     /db_xref="CDD:239321"
     misc_feature    order(377196..377198,377205..377207)
                     /locus_tag="BSVBI22_A0367"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239321"
     gene            complement(377676..379121)
                     /locus_tag="BSVBI22_A0368"
                     /db_xref="GeneID:11727843"
     CDS             complement(377676..379121)
                     /locus_tag="BSVBI22_A0368"
                     /note="identified by match to protein family HMM PF00171"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase family protein"
                     /protein_id="YP_005154067.1"
                     /db_xref="GI:376280061"
                     /db_xref="GeneID:11727843"
                     /translation="MPAIGFIIDGKESGGASGKTFERKDPITGKVATVAAAASLADVD
                     TVAEAAAKAFESWSETGPNARRALLNKAADLMDSRTAEFTRLMLEETGATAPWAGFNV
                     HLGANILREAAALTTQITGEIIPSDKPGIMSMAVRQPVGVVLGMAPWNAPVILGVRAV
                     AAALACGNTVILRSSETCPGVHHLIIKILNDAGFPAGVANVISNAPDDAPEIVAALIA
                     HPAIRRINFTGSTQVGRIIARRAAGHLKPVLLELGGKAPFIVLEDADLDQAVDAAAFG
                     AFMNQGQICMSTERFIVHEKVADAFAEKLAAKARSLPAGDPRGNVVLGSLVDLKSAQR
                     MDALIADAVAKGGRVLAGGKRDGAVVEATIIDGVTPQMDIYTQESFGPVKPIIRVKSA
                     EEAIRVANDTEYGLSSAIFSQNVKRALALSRKLETGICHINGPTVADEAQVPFGGVKS
                     SDYGRFGGKAAINEFTELRWITIEGPQHYPF"
     misc_feature    complement(377703..378998)
                     /locus_tag="BSVBI22_A0368"
                     /note="Salicylaldehyde dehydrogenase, DoxF-like; Region:
                     ALDH_SaliADH; cd07105"
                     /db_xref="CDD:143423"
     misc_feature    complement(order(377787..377789,377904..377906,
                     377982..377984,377988..377990,378267..378269,
                     378363..378371,378411..378416,378423..378425,
                     378432..378443,378594..378599,378603..378605,
                     378648..378650,378672..378686))
                     /locus_tag="BSVBI22_A0368"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143423"
     misc_feature    complement(order(378267..378269,378276..378278,
                     378369..378371,378672..378674))
                     /locus_tag="BSVBI22_A0368"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143423"
     gene            379320..380405
                     /gene="ada"
                     /locus_tag="BSVBI22_A0369"
                     /db_xref="GeneID:11727844"
     CDS             379320..380405
                     /gene="ada"
                     /locus_tag="BSVBI22_A0369"
                     /note="identified by similarity to EGAD:7337; match to
                     protein family HMM PF00165; match to protein family HMM
                     PF01035; match to protein family HMM PF02805; match to
                     protein family HMM TIGR00589"
                     /codon_start=1
                     /transl_table=11
                     /product="ada regulatory protein"
                     /protein_id="YP_005154068.1"
                     /db_xref="GI:376280062"
                     /db_xref="GeneID:11727844"
                     /translation="MNLMIPKTHDPDESRWQKVLDRDKASDGKFVYAVRTTGVYCRPS
                     CPSRRGKRENVQFFNGCEDAERAGFRPCLRCKPDLSDTLATQNNARHAEMVASACRFI
                     ETAETQPSLEEIANVVKASPAHFHRVFKAFTGLTPKAYADAHRAGRMRAALDMPQIRV
                     TDAIYDAGYNSSSRFYEASDRILGMTPKAYRAGGKDADIRFVIGQSTLGAVLVAASGK
                     GVCAIFMGDDPQGLIHDLEKRFPKANLIGADRNFENLVAEVVGFVEAPGIGLDLPLDL
                     RGTAFQQRVWRALCEIPAGETVSYTDIAERISAPRAVRAVAQACAANKIAVAVPCHRV
                     VRNDGGISGYRWGVERKRDLLERERKA"
     misc_feature    379329..380399
                     /gene="ada"
                     /locus_tag="BSVBI22_A0369"
                     /note="bifunctional DNA-binding transcriptional dual
                     regulator/O6-methylguanine-DNA methyltransferase;
                     Provisional; Region: PRK15435"
                     /db_xref="CDD:185333"
     misc_feature    379356..379553
                     /gene="ada"
                     /locus_tag="BSVBI22_A0369"
                     /note="Metal binding domain of Ada; Region:
                     Ada_Zn_binding; pfam02805"
                     /db_xref="CDD:251541"
     misc_feature    379623..379739
                     /gene="ada"
                     /locus_tag="BSVBI22_A0369"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    380160..380396
                     /gene="ada"
                     /locus_tag="BSVBI22_A0369"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    order(380160..380165,380217..380222,380244..380246,
                     380253..380255,380259..380264,380268..380270,
                     380277..380282,380286..380288,380310..380312,
                     380325..380327,380346..380348)
                     /gene="ada"
                     /locus_tag="BSVBI22_A0369"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     misc_feature    order(380217..380219,380310..380315,380319..380321,
                     380391..380393)
                     /gene="ada"
                     /locus_tag="BSVBI22_A0369"
                     /note="active site"
                     /db_xref="CDD:119438"
     gene            380587..380937
                     /locus_tag="BSVBI22_A0370"
                     /db_xref="GeneID:11727845"
     CDS             380587..380937
                     /locus_tag="BSVBI22_A0370"
                     /note="identified by similarity to GP:15073235; match to
                     protein family HMM PF03960; match to protein family HMM
                     TIGR01617"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154069.1"
                     /db_xref="GI:376280063"
                     /db_xref="GeneID:11727845"
                     /translation="MSVTIYGIKNCDTMKKARIWLEDHGIDYAFHDYKKEGLDAETLD
                     RFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLERDGKLM
                     VGFKPAQYEAYFKL"
     misc_feature    380593..380907
                     /locus_tag="BSVBI22_A0370"
                     /note="Arsenate Reductase (ArsC) family, Yffb subfamily;
                     Yffb is an uncharacterized bacterial protein encoded by
                     the yffb gene, related to the thioredoxin-fold arsenic
                     reductases, ArsC. The structure of Yffb and the
                     conservation of the catalytic cysteine...; Region:
                     ArsC_Yffb; cd03035"
                     /db_xref="CDD:239333"
     misc_feature    order(380617..380619,380755..380757,380860..380862,
                     380899..380901)
                     /locus_tag="BSVBI22_A0370"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239333"
     gene            381274..382317
                     /locus_tag="BSVBI22_A0371"
                     /db_xref="GeneID:11727846"
     CDS             381274..382317
                     /locus_tag="BSVBI22_A0371"
                     /note="identified by similarity to GP:15156192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154070.1"
                     /db_xref="GI:376280064"
                     /db_xref="GeneID:11727846"
                     /translation="MQQGVTNILQHWLASWRDSLMACVAGSLAWLICEELLGQPKPIF
                     AMVTGVACLAPNLPNHGKQAIRVVLGVTAGVIVAELSLFLPQTVSVLHTGMVAFIAMV
                     LATTFGTAPAIPIQAGVSAILVLAMGPQEAGLSRLTDVLVGAGVGLLFSQILLTPDPV
                     RVIDRAVRGLLEPIASGLKKSAAVLKDDNPEEANTTITQFIEAHRALVALSDGLALVR
                     SDARWSLRGRLVASEITDMASRYERRGIRLYAAALLFGEALGNALRKKETEPPAWLME
                     SLQIVIANCSMEPGREPHRIPPIPKDLPFGWRECVLRLEGVQDTLLHFLNSDQPDSVL
                     VPKCEAKPQVDAV"
     misc_feature    381292..382311
                     /locus_tag="BSVBI22_A0371"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4129"
                     /db_xref="CDD:226614"
     misc_feature    381355..381723
                     /locus_tag="BSVBI22_A0371"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; pfam13515"
                     /db_xref="CDD:257835"
     gene            382467..383546
                     /locus_tag="BSVBI22_A0372"
                     /note="membrane protein, putative, authentic point
                     mutation; this gene contains a premature stop which is not
                     the result of sequencing error;identified by similarity to
                     OMNI:NTL02ML5834"
                     /pseudo
                     /db_xref="GeneID:11727847"
     gene            383768..385015
                     /gene="bacA"
                     /locus_tag="BSVBI22_A0373"
                     /db_xref="GeneID:11727848"
     CDS             383768..385015
                     /gene="bacA"
                     /locus_tag="BSVBI22_A0373"
                     /note="in Escherichia coli SbmA is involved in uptake of
                     microcin J25; functions along with FhuA, TonB, and ExbB/D
                     in this capacity; in Sinorhizobium meliloti, BacA is
                     essential and required for symbiosis; defects appear to
                     affect the cell envelope"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_005154071.1"
                     /db_xref="GI:376280065"
                     /db_xref="GeneID:11727848"
                     /translation="MFASFFPRPKLFFISALLWTLLAVLGWYMGGENLGSVFGLAPAA
                     SDAAPLIGAHVFWSRPFLWFYIYFAVITFAFYGFWVRFSPHPWQRWSILGSALILFAT
                     YFNVQVSVAINTWYGPFYDMVQKGLTTPGAVSAAEFYWGLADFAGIAFLAITIGVLNL
                     FFVSHYIFRWRTAMNDYYMSHWPKLRHIEGAAQRVQEDTMRFSTTLEQLGVSLVKSVM
                     TLIAFLPVLFTFSQKVSTLPIIGYVPHALVWAAVIWALFGTGFLALVGIKLPGLEFNN
                     QRVEAAYRKELVYGEDHADRAEPITMRELFKNVRHNYFRLYFHYVYFNVARIFYLQVD
                     NIFPLIILIPSIVAGKLTLGLMSQITNVFDQVRGSFQYLVNSWTTIIELLSIYKRLRA
                     FEAAIHGEPLQAVDRINLEPGAG"
     misc_feature    383768..384997
                     /gene="bacA"
                     /locus_tag="BSVBI22_A0373"
                     /note="microcin B17 transporter; Reviewed; Region:
                     PRK11098"
                     /db_xref="CDD:182960"
     gene            complement(385054..386052)
                     /locus_tag="BSVBI22_A0374"
                     /db_xref="GeneID:11727849"
     CDS             complement(385054..386052)
                     /locus_tag="BSVBI22_A0374"
                     /note="identified by similarity to OMNI:NTL02ML5836"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154072.1"
                     /db_xref="GI:376280066"
                     /db_xref="GeneID:11727849"
                     /translation="MRFPLSRLVAFCAFAVTSLAGQALAGEPPKTQYVLISFDGAHDN
                     TLWTRSRELARKNNAHFTYFLSCVFLMTKQDRSGYKPPHKKAGASNVGFALSRDEVAT
                     RLDNIWQAHLEGNEIASHGCGHFDGTKWSTADWKKEIGEFRRIVADAYRNNGIGGEPE
                     GWRALALTGINDFRAPYLAAGKPVQDVLKATGFRYQASSVTRGPELPQMTDRLASFGL
                     PLVPEGPSQRPVVAMDYNLYVRHSKAVEAPQKAVEFEARAYKAFRAAFDKQYAGKRIP
                     LQLGFHFVLMNDGAYWRALERLVSEVCTKPDVKCTTYGAYLDQLQNTGSNTAHNRS"
     misc_feature    complement(385078..385971)
                     /locus_tag="BSVBI22_A0374"
                     /note="Putative catalytic domain of uncharacterized
                     bacterial hypothetical proteins similar to insect chitin
                     deacetylase-like proteins; Region: CE4_CDA_like_3;
                     cd10976"
                     /db_xref="CDD:200598"
     misc_feature    complement(order(385207..385209,385213..385215,
                     385456..385458,385525..385527,385531..385533,
                     385678..385695,385933..385944))
                     /locus_tag="BSVBI22_A0374"
                     /note="NodB motif; other site"
                     /db_xref="CDD:200598"
     misc_feature    complement(order(385207..385209,385519..385527,
                     385681..385683,385693..385695,385933..385938))
                     /locus_tag="BSVBI22_A0374"
                     /note="putative active site [active]"
                     /db_xref="CDD:200598"
     misc_feature    complement(order(385207..385209,385936..385938))
                     /locus_tag="BSVBI22_A0374"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:200598"
     gene            386298..386969
                     /locus_tag="BSVBI22_A0375"
                     /db_xref="GeneID:11727850"
     CDS             386298..386969
                     /locus_tag="BSVBI22_A0375"
                     /note="identified by similarity to OMNI:NTL02ML5837"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154073.1"
                     /db_xref="GI:376280067"
                     /db_xref="GeneID:11727850"
                     /translation="MADDSFIREVNEELRSERAKQVWRNFGPALIGVAVAVVLGTAGW
                     VGYQHWTDSKASASGDKFLAALDLAAAGKTDEALAAFTDLEKTGYGSYPVLARLRVAS
                     VLADKGDAAAAVKAFDEISADNSVPEPLRNIARLRAGYLLVDNGSYDDVAKRVEPLSA
                     DGNPMRTSAREALGLAAWKAERFDDAAKLFKLVAEDGLAPANARQRANIMLDLMHSAG
                     VAAQG"
     misc_feature    386298..386960
                     /locus_tag="BSVBI22_A0375"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4649"
                     /db_xref="CDD:226996"
     gene            386991..388442
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /db_xref="GeneID:11727851"
     CDS             386991..388442
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="EngA; essential Neisserial GTPase; synchronizes
                     cellular events by interacting with multiple targets with
                     tandem G-domains; overexpression in Escherichia coli
                     suppresses rrmJ mutation; structural analysis of the
                     Thermotoga maritima ortholog shows different nucleotide
                     binding affinities in the two binding domains"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein EngA"
                     /protein_id="YP_005154074.1"
                     /db_xref="GI:376280068"
                     /db_xref="GeneID:11727851"
                     /translation="MGFTLAIVGRPNVGKSTLFNRLVGRKLALVDDLPGVTRDRRIHD
                     AKLYDLKFQVIDTAGLEEAANDSLEARMRAQTEAAISEADAVLFVIDAKAGITPADST
                     FAEAVRRSGKPVVLVANKAEARGSEAGMYDAFQLGLGEPCPISAEHGQGMPDLRDAIV
                     ELLGEERVFAEERQEEAADEVFTPAAVGALVGDDIEDPDAEEIPAYDATKPLRIAIVG
                     RPNAGKSTLINTMLGEDRLLTGPEAGITRDSISADWEWHGRKIKLFDTAGMRRKARVQ
                     EKLEKLSVADGLRAIRFAEVVIIVLDATIPFEKQDLQIADLIIREGRAPVIAFNKWDL
                     IEDRQMVLADLYEKTARLLPQVRGLRAVPISGERGQGIDKLMENVVKTHEIWNRRIST
                     GRLNRWLEGVIAHQPPPAVSGRRLKVKYMTQVKTRPPGFVVSCSRPDAMPQSYVRYLI
                     NGLRETFDMPGVPIRLSLRTSDNPFAGRAKKKK"
     misc_feature    386997..388409
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="GTP-binding protein Der; Reviewed; Region:
                     PRK00093"
                     /db_xref="CDD:234628"
     misc_feature    387006..387479
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="EngA1 GTPase contains the first domain of EngA;
                     Region: EngA1; cd01894"
                     /db_xref="CDD:206681"
     misc_feature    387015..387038
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G1 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    order(387024..387026,387030..387041,387345..387350,
                     387354..387356,387423..387431)
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206681"
     misc_feature    order(387069..387089,387099..387110)
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206681"
     misc_feature    387099..387101
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G2 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    order(387153..387170,387234..387239)
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206681"
     misc_feature    387156..387167
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G3 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    387345..387356
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G4 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    387423..387431
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G5 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    387618..388139
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="EngA2 GTPase contains the second domain of EngA;
                     Region: EngA2; cd01895"
                     /db_xref="CDD:206682"
     misc_feature    387642..387665
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G1 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    order(387651..387653,387657..387668,387978..387983,
                     387987..387989,388083..388091)
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206682"
     misc_feature    order(387687..387689,387696..387737)
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206682"
     misc_feature    387726..387728
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G2 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    387783..387794
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G3 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    order(387792..387797,387867..387872)
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206682"
     misc_feature    387978..387989
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G4 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    388083..388091
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="G5 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    388155..388397
                     /gene="engA"
                     /locus_tag="BSVBI22_A0376"
                     /gene_synonym="yfgK; yphC"
                     /note="KH-domain-like of EngA bacterial GTPase enzymes,
                     C-terminal; Region: KH_dom-like; pfam14714"
                     /db_xref="CDD:258851"
     gene            388601..389917
                     /locus_tag="BSVBI22_A0377"
                     /db_xref="GeneID:11727852"
     CDS             388601..389917
                     /locus_tag="BSVBI22_A0377"
                     /note="identified by similarity to SP:P04475"
                     /codon_start=1
                     /transl_table=11
                     /product="HSP70 family protein"
                     /protein_id="YP_005154075.1"
                     /db_xref="GI:376280069"
                     /db_xref="GeneID:11727852"
                     /translation="MTPSDQGVEQSGVTLGIDFGTTNTVLSVAAPDGTTAVLSVPKDG
                     VEITGYRSILCFWQDRETGERTAESGPWTVDAFVNAPHSTRMLQSFKTFAASKSFKDT
                     PVFGRRFKFEDILQTFLETVAAKLGDRLPPKGNRVVIGRPVIFAGNAPDEALAMLRYE
                     KAFRAFGFTDIHYVYEPVAAAYFYAQQLTADSNVLVADFGGGTSDFSIVRFEVGKEGL
                     RFTPLSQTGLGIAGDTFDYRIIDNAVSPLLGKGTEYESFGKRLTVPNYYYANFARWNT
                     LFLMNSPTTIRELDELARQAVDPKPLESFIHLIENDYGYEIYRAVSELKVRLSSQHIA
                     ELHFKADDFEIRSDITRNDFENWIDGDVRQIERSVQQAVEKAGLASSAIDRVFLTGGT
                     SFVPVIRTVFESRFPDAMVTSSNQFDSIANGLALIGQSGDIDRWSV"
     misc_feature    388631..>389914
                     /locus_tag="BSVBI22_A0377"
                     /note="Molecular chaperone [Posttranslational
                     modification, protein turnover, chaperones]; Region: DnaK;
                     COG0443"
                     /db_xref="CDD:223520"
     misc_feature    388643..389887
                     /locus_tag="BSVBI22_A0377"
                     /note="Escherichia coli YegD, a putative chaperone
                     protein, and related proteins; Region: YegD_like; cd10231"
                     /db_xref="CDD:212673"
     misc_feature    order(388652..388654,388658..388669,388862..388864,
                     389024..389026,389126..389128,389192..389209,
                     389213..389215,389294..389299,389564..389566,
                     389573..389578,389768..389776,389780..389785,
                     389849..389851)
                     /locus_tag="BSVBI22_A0377"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212673"
     misc_feature    order(388730..388732,388799..388801,388811..388813,
                     388820..388825,388982..388987,389534..389536,
                     389543..389548,389555..389557,389567..389569,
                     389609..389611,389615..389620)
                     /locus_tag="BSVBI22_A0377"
                     /note="putative NEF/HSP70 interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212673"
     misc_feature    order(389057..389062,389066..389071,389114..389119,
                     389123..389125,389258..389269)
                     /locus_tag="BSVBI22_A0377"
                     /note="SBD interface [polypeptide binding]; other site"
                     /db_xref="CDD:212673"
     gene            complement(390007..390132)
                     /locus_tag="BSVBI22_A0378"
                     /db_xref="GeneID:11727853"
     CDS             complement(390007..390132)
                     /locus_tag="BSVBI22_A0378"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154076.1"
                     /db_xref="GI:376280070"
                     /db_xref="GeneID:11727853"
                     /translation="MQVQRIPVSSQPDCAPSLCFVALSNVSKRDQKSVQWTDFPA"
     gene            390354..391643
                     /locus_tag="BSVBI22_A0379"
                     /db_xref="GeneID:11727854"
     CDS             390354..391643
                     /locus_tag="BSVBI22_A0379"
                     /note="identified by similarity to GP:14026921"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154077.1"
                     /db_xref="GI:376280071"
                     /db_xref="GeneID:11727854"
                     /translation="MRLVSLRALFGRSCAAAEPVWHYPVTGYCPEDGRYYGVRAKPRQ
                     IPHKQHWLVPFVLAASAYLFNSNAIAFQDMASLVPAADLGTHRWTAFIARAPVGSVHQ
                     AEMPFVDATTVTGSIATNGIEVPGIGHVALSGGGKTAKLGVDDPNPDENRINRADKTN
                     RLVSVKPKAPAKAFTAGSMFEKISLISRPPEKIDTRMAFTRKLEGKEIGITMAFHRVK
                     PPKPKAELPTQLAKLINNEQPDVLALGYAPATPDYGKTSPFESILRPDQSEGRFVPPI
                     GDQDHDWAATPLPPSAFSPREQKCLAEAVYYEARGESVKGQVAVAQVVLNRVRNPAYP
                     GSICGVVYQNRDWLNACQFSFACDGQKHRVTEPAQWRMAQQVAKTVSAGQIWLPEVGS
                     ATHYHATYVRPFWAPTMKKLTKIGLHIFYRTYGGGWS"
     misc_feature    390891..391640
                     /locus_tag="BSVBI22_A0379"
                     /note="Cell wall hydrolyses involved in spore germination
                     [Cell envelope biogenesis, outer membrane]; Region: SleB;
                     COG3773"
                     /db_xref="CDD:226296"
     misc_feature    391281..391619
                     /locus_tag="BSVBI22_A0379"
                     /note="Cell Wall Hydrolase; Region: Hydrolase_2;
                     pfam07486"
                     /db_xref="CDD:254227"
     gene            391671..391775
                     /locus_tag="BSVBI22_A0380"
                     /db_xref="GeneID:11727855"
     CDS             391671..391775
                     /locus_tag="BSVBI22_A0380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154078.1"
                     /db_xref="GI:376280072"
                     /db_xref="GeneID:11727855"
                     /translation="MLESSFSREIAAGQMQRIRPPFSIFGRKMSRTIG"
     gene            391805..391930
                     /locus_tag="BSVBI22_A0381"
                     /db_xref="GeneID:11727856"
     CDS             391805..391930
                     /locus_tag="BSVBI22_A0381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154079.1"
                     /db_xref="GI:376280073"
                     /db_xref="GeneID:11727856"
                     /translation="MKQLLDRLDLRAACQYVARNLEMGLESSHFLKKGAANGARG"
     gene            391914..392312
                     /locus_tag="BSVBI22_A0382"
                     /db_xref="GeneID:11727857"
     CDS             391914..392312
                     /locus_tag="BSVBI22_A0382"
                     /note="identified by similarity to EGAD:21946"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase protein I"
                     /protein_id="YP_005154080.1"
                     /db_xref="GI:376280074"
                     /db_xref="GeneID:11727857"
                     /translation="MARGAEPEKPSGTIKDAKREPGSGELDQRLKRLEAELAKKGVLK
                     QPASEEERSETSSSVAQAMKLSSEFIAGILVGALIGWFLDRYAGTSPWGLIVLLLLGF
                     GAGTLNVLRSAGYVAEQGNNKSSAEKDDRK"
     misc_feature    391971..392309
                     /locus_tag="BSVBI22_A0382"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5336"
                     /db_xref="CDD:227641"
     gene            392420..393169
                     /gene="atpB"
                     /locus_tag="BSVBI22_A0383"
                     /db_xref="GeneID:11727858"
     CDS             392420..393169
                     /gene="atpB"
                     /locus_tag="BSVBI22_A0383"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. Subunit A is part of the
                     membrane proton channel F0"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit A"
                     /protein_id="YP_005154081.1"
                     /db_xref="GI:376280075"
                     /db_xref="GeneID:11727858"
                     /translation="MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFL
                     YLTSSGRGLIPTRLQSVSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIG
                     LFPYFYTVTSQIIVTFALSLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLI
                     EIISFLSRPISLSVRLFANMLAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAI
                     TALEFLVAFLQAYVFTVLTCMYINDAVHPGH"
     misc_feature    392420..393163
                     /gene="atpB"
                     /locus_tag="BSVBI22_A0383"
                     /note="F0F1-type ATP synthase, subunit a [Energy
                     production and conversion]; Region: AtpB; COG0356"
                     /db_xref="CDD:223433"
     gene            393237..393464
                     /gene="atpE"
                     /locus_tag="BSVBI22_A0384"
                     /db_xref="GeneID:11727859"
     CDS             393237..393464
                     /gene="atpE"
                     /locus_tag="BSVBI22_A0384"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. Subunit C is part of the
                     membrane proton channel F0"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit C"
                     /protein_id="YP_005154082.1"
                     /db_xref="GI:376280076"
                     /db_xref="GeneID:11727859"
                     /translation="MEAEAAKYIGAGLACFGMAGTALGLGNIFGQYLSGALRNPSAAD
                     SQFGRLVFGFAVTEALGIFSLLIALLLLFAV"
     misc_feature    393237..393419
                     /gene="atpE"
                     /locus_tag="BSVBI22_A0384"
                     /note="F0F1 ATP synthase subunit C; Validated; Region:
                     PRK07558"
                     /db_xref="CDD:181027"
     gene            393636..394262
                     /locus_tag="BSVBI22_A0385"
                     /db_xref="GeneID:11727860"
     CDS             393636..394262
                     /locus_tag="BSVBI22_A0385"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. Subunit B' is part of the
                     membrane proton channel."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit B'"
                     /protein_id="YP_005154083.1"
                     /db_xref="GI:376280077"
                     /db_xref="GeneID:11727860"
                     /translation="MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSG
                     VFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLK
                     QDADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERI
                     AAIKAKAMSDVGNIAEETTATIVEQLLGLTADKASVSEAVKAIRASNA"
     misc_feature    393636..394253
                     /locus_tag="BSVBI22_A0385"
                     /note="F0F1 ATP synthase subunit B'; Validated; Region:
                     PRK09174"
                     /db_xref="CDD:169692"
     misc_feature    393786..394250
                     /locus_tag="BSVBI22_A0385"
                     /note="F0F1-type ATP synthase, subunit b [Energy
                     production and conversion]; Region: AtpF; COG0711"
                     /db_xref="CDD:223783"
     gene            394273..394752
                     /gene="atpF"
                     /locus_tag="BSVBI22_A0386"
                     /db_xref="GeneID:11727861"
     CDS             394273..394752
                     /gene="atpF"
                     /locus_tag="BSVBI22_A0386"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. Subunit B is part of the
                     membrane proton channel."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit B"
                     /protein_id="YP_005154084.1"
                     /db_xref="GI:376280078"
                     /db_xref="GeneID:11727861"
                     /translation="MDATFWAFIALVIFVVIVVYMKVPGMIGRTLDERADRIKKELEE
                     ARTLREEAQQLLAEYHRKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKL
                     AEQKIATAETDAINAVRASAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKSHLN"
     misc_feature    394273..394749
                     /gene="atpF"
                     /locus_tag="BSVBI22_A0386"
                     /note="F0F1 ATP synthase subunit B; Validated; Region:
                     PRK09173"
                     /db_xref="CDD:169691"
     misc_feature    394285..394743
                     /gene="atpF"
                     /locus_tag="BSVBI22_A0386"
                     /note="F0F1-type ATP synthase, subunit b [Energy
                     production and conversion]; Region: AtpF; COG0711"
                     /db_xref="CDD:223783"
     gene            complement(394875..395537)
                     /gene="rnhB"
                     /locus_tag="BSVBI22_A0387"
                     /db_xref="GeneID:11727862"
     CDS             complement(394875..395537)
                     /gene="rnhB"
                     /locus_tag="BSVBI22_A0387"
                     /note="RNH2; RNase HII; binds manganese; endonuclease
                     which specifically degrades the RNA of RNA-DNA hybrids"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="YP_005154085.1"
                     /db_xref="GI:376280079"
                     /db_xref="GeneID:11727862"
                     /translation="MKRSASDSPLLFDLPLAPDFSQEQQLMKRGLKHIAGIDEAGRGP
                     LAGPVVAAAVVLDQNDLPEGLDDSKRLTAARREALYEIILTKAITVSVASLSARSIDA
                     SDIRKAALEAMRRAVIGLTLKPCHALVDGRDVPPGLPCPGSALVKGDQRSVSIAAASI
                     VAKVTRDRMMIRAGAAHPPYGLEIHAGYATQKHRAAIESEGPVPGLHRYTFAPIKGRF
                     DC"
     misc_feature    complement(394899..395435)
                     /gene="rnhB"
                     /locus_tag="BSVBI22_A0387"
                     /note="Bacterial Ribonuclease HII-like; Region:
                     RNase_HII_bacteria_HII_like; cd07182"
                     /db_xref="CDD:260003"
     misc_feature    complement(order(394899..394907,394968..394976,
                     394980..394988,395049..395051,395091..395093,
                     395097..395102,395142..395150,395220..395228,
                     395331..395333,395409..395426))
                     /gene="rnhB"
                     /locus_tag="BSVBI22_A0387"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:260003"
     misc_feature    complement(order(395091..395093,395148..395150,
                     395421..395426))
                     /gene="rnhB"
                     /locus_tag="BSVBI22_A0387"
                     /note="active site"
                     /db_xref="CDD:260003"
     gene            complement(395714..396886)
                     /locus_tag="BSVBI22_A0388"
                     /db_xref="GeneID:11727863"
     CDS             complement(395714..396886)
                     /locus_tag="BSVBI22_A0388"
                     /note="identified by similarity to GP:15073771; match to
                     protein family HMM PF04055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154086.1"
                     /db_xref="GI:376280080"
                     /db_xref="GeneID:11727863"
                     /translation="MAVIHQAEIIGQADRLAFGAGRAEHANAVIGEAGLRIDHARRRG
                     RGAGINPSGRFEPTVRQEFDDGWSTLEELPAFKTDVQIEKPRTIITRNDSPDISFDRS
                     INPYRGCEHGCIYCFARPTHSYMGLSAGLDFETRLFAKPDAPRLLERELARPGYQPKT
                     IAIGTNTDPYQPVEKKWRIMREILEVLEAANHPVGIVTKSALVVRDIDILSRMAEKGL
                     AKVALSVTTLDAHLARTMEPRASTPSLRLQAIRRLTDAGIPASVMMGPVIPGINDHEI
                     ERILDAAYAQGAREAGYVLLRLPLEVAPLFKDWLLRNYPDRYRHVMSLVRSMRDGKDY
                     DAEWGKRMRGTGPYAWQIGRRFEIAARKLGFNTQRLRLRTDLFEPIQKGGKQLSLF"
     misc_feature    complement(395786..396676)
                     /locus_tag="BSVBI22_A0388"
                     /note="DNA repair photolyase [DNA replication,
                     recombination, and repair]; Region: SplB; COG1533"
                     /db_xref="CDD:224450"
     misc_feature    complement(395885..396580)
                     /locus_tag="BSVBI22_A0388"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(395945..395950,396083..396085,
                     396215..396217,396290..396298,396383..396388,
                     396392..396394,396536..396544,396548..396550,
                     396554..396556,396560..396562))
                     /locus_tag="BSVBI22_A0388"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            397022..397528
                     /locus_tag="BSVBI22_A0389"
                     /db_xref="GeneID:11727864"
     CDS             397022..397528
                     /locus_tag="BSVBI22_A0389"
                     /note="identified by similarity to GP:15155690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154087.1"
                     /db_xref="GI:376280081"
                     /db_xref="GeneID:11727864"
                     /translation="MLSVIIETLNSERPLACTLSGLVPAVVEGLLRRVTVIDHGSGDG
                     TALVAEGAGCAFHGLAERDVALNGIRTDWVLFLKPGAMPQEGWGEAVRRHMEGGGGPA
                     RFSLPEEGRLGNIRKIFGGGPSLDAGLLVRLDLVQPLFLEGIGSDDLPRRLKPLRLKH
                     RILPPERH"
     misc_feature    397025..>397339
                     /locus_tag="BSVBI22_A0389"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    order(397040..397042,397046..397048,397130..397132,
                     397253..397255,397259..397261)
                     /locus_tag="BSVBI22_A0389"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(397608..397880)
                     /locus_tag="BSVBI22_A0390"
                     /db_xref="GeneID:11727865"
     CDS             complement(397608..397880)
                     /locus_tag="BSVBI22_A0390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154088.1"
                     /db_xref="GI:376280082"
                     /db_xref="GeneID:11727865"
                     /translation="MPSKGATRRIRKMKKFALAALAVALSAGAAYAENPYVGQPANMA
                     AQNKAFMQGGSTPVRGNTDYTAPASIKAPVYQDGSAHRFGDASPSN"
     gene            397870..397977
                     /locus_tag="BSVBI22_A0391"
                     /db_xref="GeneID:11727866"
     CDS             397870..397977
                     /locus_tag="BSVBI22_A0391"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154089.1"
                     /db_xref="GI:376280083"
                     /db_xref="GeneID:11727866"
                     /translation="MDGIEAFQGLPGGKHAIHRGDNCVSQKIWEETSGS"
     gene            complement(398024..398299)
                     /locus_tag="BSVBI22_A0392"
                     /db_xref="GeneID:11727867"
     CDS             complement(398024..398299)
                     /locus_tag="BSVBI22_A0392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154090.1"
                     /db_xref="GI:376280084"
                     /db_xref="GeneID:11727867"
                     /translation="MTFGLPRREPSYGDRKMKKFVLAAAALALSAGAALAENPHVGEP
                     ANLYANDRTPVATQKLDYTAPASIKAPVYQDGSAHRFGDASPSSYQN"
     gene            complement(398371..398604)
                     /locus_tag="BSVBI22_A0393"
                     /db_xref="GeneID:11727868"
     CDS             complement(398371..398604)
                     /locus_tag="BSVBI22_A0393"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154091.1"
                     /db_xref="GI:376280085"
                     /db_xref="GeneID:11727868"
                     /translation="MREFSREMVLQNSPIVHFYCTINPYTLFAPFEQRRLHNKHVKAD
                     IPNKPLIILIYFIRFVKISENWVHECVIRKTFS"
     gene            complement(398567..398713)
                     /locus_tag="BSVBI22_A0394"
                     /db_xref="GeneID:11727869"
     CDS             complement(398567..398713)
                     /locus_tag="BSVBI22_A0394"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154092.1"
                     /db_xref="GI:376280086"
                     /db_xref="GeneID:11727869"
                     /translation="MKIRAGLQFLRTAFLPEPDLSPIVFVLSTDRYAAPVFARIFARN
                     GIAK"
     gene            complement(398658..399557)
                     /gene="ispE"
                     /locus_tag="BSVBI22_A0395"
                     /db_xref="GeneID:11727870"
     CDS             complement(398658..399557)
                     /gene="ispE"
                     /locus_tag="BSVBI22_A0395"
                     /note="identified by match to protein family HMM PF00288;
                     match to protein family HMM TIGR00154"
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /protein_id="YP_005154093.1"
                     /db_xref="GI:376280087"
                     /db_xref="GeneID:11727870"
                     /translation="MTAFQNAGPSITRLAPAKINLALHVTGRRDDGYHLLDMLVVFAD
                     HGDRIHIEKAGSDSFTVSGPFASGIPAGRGNLVLKARDALRQHGGPDLSPVAIHLEKN
                     LPIASGIGGGSSDAAATLLALNTLWQLDLDFEMLAAIGLSLGADLPMCLHGAAHGTPL
                     IARGIGEELNDVSGIAALPMLLVNDGTALATPDVFRALTRRENAPLPPPACEGTDALC
                     AYLRETRNDLLPAAISLAPQIEPKLALLRAKGALYAQMSGSGATCFAIFSDESALTRA
                     AKEIADENPGWFAVPSHSFPSRA"
     misc_feature    complement(398682..399545)
                     /gene="ispE"
                     /locus_tag="BSVBI22_A0395"
                     /note="4-diphosphocytidyl-2-C-methyl-D-erythritol kinase;
                     Provisional; Region: PRK14608"
                     /db_xref="CDD:237765"
     misc_feature    complement(399099..399269)
                     /gene="ispE"
                     /locus_tag="BSVBI22_A0395"
                     /note="GHMP kinases N terminal domain; Region:
                     GHMP_kinases_N; pfam00288"
                     /db_xref="CDD:249743"
     misc_feature    complement(398703..398915)
                     /gene="ispE"
                     /locus_tag="BSVBI22_A0395"
                     /note="GHMP kinases C terminal; Region: GHMP_kinases_C;
                     pfam08544"
                     /db_xref="CDD:254869"
     gene            complement(399587..399808)
                     /locus_tag="BSVBI22_A0396"
                     /db_xref="GeneID:11727871"
     CDS             complement(399587..399808)
                     /locus_tag="BSVBI22_A0396"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154094.1"
                     /db_xref="GI:376280088"
                     /db_xref="GeneID:11727871"
                     /translation="MRDGAQAQGHEVMPQLIFLLLIIAAAWYGYRSFKREAARVSQRV
                     RQAEKEAQNRAHGTLVQDPKTGEYYVRKD"
     misc_feature    complement(<399641..>399772)
                     /locus_tag="BSVBI22_A0396"
                     /note="FHIPEP family; Region: FHIPEP; cl07980"
                     /db_xref="CDD:263518"
     gene            complement(400239..401345)
                     /locus_tag="BSVBI22_A0397"
                     /db_xref="GeneID:11727872"
     CDS             complement(400239..401345)
                     /locus_tag="BSVBI22_A0397"
                     /note="identified by match to protein family HMM PF01343"
                     /codon_start=1
                     /transl_table=11
                     /product="protease IV"
                     /protein_id="YP_005154095.1"
                     /db_xref="GI:376280089"
                     /db_xref="GeneID:11727872"
                     /translation="MSFPAPPFRPFAAISCCGRRPDQSAANPLWKADESPEAKNFGRF
                     LCVFHFASYIASTYCTERLQAASSLLRRSSLEFALPGLLKRLIPRRFRAVETEIPVVR
                     LHGAIMTGGTSLRPTLSLASTAGILEKAFADKHAPAVAISINSPGGAPVQSRLIYRRI
                     RDLAVEHQKKVFVFVEDVAASGGYMIALAGDEIIADPSSIVGSIGVVSASFGFPELLK
                     KIGVERRVYTAGSNKVTLDPFQPEKAEDIERLKALQLEIHATFIDMVKERRAGKLGDN
                     PDLFSGLFWTGTTAASLGLIDGLGDMRSFLRKTYGDKVKLKLIQPQRGLLGRKLPGIG
                     MDSGSVEPAQIAAHLGDGLLCVAEEKAIWARYGL"
     misc_feature    complement(400251..401204)
                     /locus_tag="BSVBI22_A0397"
                     /note="Periplasmic serine proteases (ClpP class)
                     [Posttranslational modification, protein turnover,
                     chaperones / Intracellular trafficking and secretion];
                     Region: SppA; COG0616"
                     /db_xref="CDD:223689"
     misc_feature    complement(400422..401054)
                     /locus_tag="BSVBI22_A0397"
                     /note="Signal peptide peptidase A (SppA), a serine
                     protease, has catalytic Ser-Lys dyad; Region:
                     S49_Sppa_N_C; cd07023"
                     /db_xref="CDD:132934"
     misc_feature    complement(order(400479..400481,400488..400490,
                     400494..400502,400572..400574,400719..400730,
                     400752..400754,400758..400760,400803..400805,
                     400920..400922,401034..401036))
                     /locus_tag="BSVBI22_A0397"
                     /note="tandem repeat interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132934"
     misc_feature    complement(order(400566..400568,400578..400580,
                     400665..400679,400683..400685,400884..400886,
                     400962..400964,400983..400985))
                     /locus_tag="BSVBI22_A0397"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132934"
     misc_feature    complement(400803..400805)
                     /locus_tag="BSVBI22_A0397"
                     /note="active site residues [active]"
                     /db_xref="CDD:132934"
     gene            complement(401266..402447)
                     /gene="nhaA"
                     /locus_tag="BSVBI22_A0398"
                     /db_xref="GeneID:11727873"
     CDS             complement(401266..402447)
                     /gene="nhaA"
                     /locus_tag="BSVBI22_A0398"
                     /note="identified by similarity to SP:P13738; match to
                     protein family HMM TIGR00773"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter"
                     /protein_id="YP_005154096.1"
                     /db_xref="GI:376280090"
                     /db_xref="GeneID:11727873"
                     /translation="MNHSPQSARPVSIMRRFLDSEAAGGITLMAAAALALIVANSPFA
                     QTYFDALHLYIGPLSLAHWINDALMAIFFLLVGLEIKREMLDGQLASWPNRMLPGIAA
                     AGGVILPAIIFAVLNHDNPAKLRGWAVPSATDIAFALGVLSLLGSRAPSSLKVFLATL
                     AILDDLAAVVIIAIFYTAEISMPYLGAAFITAAVLFVMNRMGVVKLLPYLISAVILWF
                     FVFNSGVHATVAGVVAALMIPLKPAPGRPDDMTSPLHKLEHALAKPVAFIVVPIFGFA
                     NAGISFKGLEASVLGDTLTLGILLGLFLGKQFGVFGAAWLAIKTGLAEKPMGASWVQL
                     YGVAILCGIGFTMSIFIGLLSFPSDLMQTETKIGVLSGSALSAICGYLLLRAAARPKR
                     G"
     misc_feature    complement(401272..402420)
                     /gene="nhaA"
                     /locus_tag="BSVBI22_A0398"
                     /note="pH-dependent sodium/proton antiporter; Reviewed;
                     Region: nhaA; PRK09560"
                     /db_xref="CDD:236568"
     gene            complement(402467..402688)
                     /locus_tag="BSVBI22_A0399"
                     /db_xref="GeneID:11727874"
     CDS             complement(402467..402688)
                     /locus_tag="BSVBI22_A0399"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154097.1"
                     /db_xref="GI:376280091"
                     /db_xref="GeneID:11727874"
                     /translation="MQMMFSRAFRCYCRLCICLLACGKLAGFARFSLGTVRFLLKRHM
                     RPNISGTEIFVLPFRPVFIPTVPKVILRR"
     gene            complement(402737..403495)
                     /locus_tag="BSVBI22_A0400"
                     /db_xref="GeneID:11727875"
     CDS             complement(402737..403495)
                     /locus_tag="BSVBI22_A0400"
                     /note="identified by similarity to GP:15073779"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154098.1"
                     /db_xref="GI:376280092"
                     /db_xref="GeneID:11727875"
                     /translation="MEETLDVFHRGAFHLVQPALKGHRSGVDAMILASAVPGGFAGRA
                     ADLGSGAGAAGLAVAARCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEAD
                     VALKGKARVFAGLADNSFDFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTA
                     AAIVKPGGGIAIIARPGSIRPILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSR
                     AGLSLMPALILHGDEGHGFTARADAINNGLSSLF"
     misc_feature    complement(402740..403495)
                     /locus_tag="BSVBI22_A0400"
                     /note="Predicted O-methyltransferase [General function
                     prediction only]; Region: COG4123"
                     /db_xref="CDD:226608"
     misc_feature    complement(402977..403315)
                     /locus_tag="BSVBI22_A0400"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     gene            complement(403516..403743)
                     /locus_tag="BSVBI22_A0401"
                     /db_xref="GeneID:11727876"
     CDS             complement(403516..403743)
                     /locus_tag="BSVBI22_A0401"
                     /note="identified by similarity to GP:15073778"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154099.1"
                     /db_xref="GI:376280093"
                     /db_xref="GeneID:11727876"
                     /translation="MIELIRTNDSVLLSFAEALMKEAGIAYFIADTNMSIIEGSLGVL
                     PRRLMVDEDQMEEARQILIDAKIEHELRDNK"
     misc_feature    complement(403546..403740)
                     /locus_tag="BSVBI22_A0401"
                     /note="Domain of unknown function (DUF2007); Region:
                     DUF2007; pfam09413"
                     /db_xref="CDD:255348"
     gene            404006..405028
                     /locus_tag="BSVBI22_A0402"
                     /db_xref="GeneID:11727877"
     CDS             404006..405028
                     /locus_tag="BSVBI22_A0402"
                     /note="identified by match to protein family HMM PF00348"
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl synthetase family protein"
                     /protein_id="YP_005154100.1"
                     /db_xref="GI:376280094"
                     /db_xref="GeneID:11727877"
                     /translation="MALGVVLNLDGKMKQEGSVQPLVDLTRADMARVNELILSRAGSD
                     VEMIPEVANHLISSGGKRLRPMMTLASARMFGYEGDGHVRLATSVEFMHTATLLHDDV
                     VDESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVDVGSFDALDVLATSASIIAE
                     GEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPIIAGAQRSDRAALRDYGLN
                     LGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYRRGTDEERAFWKGAIE
                     GGASYDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKASPQKDALIEVVDF
                     CISRVN"
     misc_feature    404132..405019
                     /locus_tag="BSVBI22_A0402"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-tail; Region: Trans_IPPS_HT; cd00685"
                     /db_xref="CDD:173833"
     misc_feature    order(404279..404281,404288..404296,404300..404308,
                     404312..404317,404330..404335,404489..404491,
                     404498..404500,404561..404566,404573..404575,
                     404684..404689,404696..404698,404726..404728,
                     404741..404743,404756..404758)
                     /locus_tag="BSVBI22_A0402"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173833"
     misc_feature    404288..404317
                     /locus_tag="BSVBI22_A0402"
                     /note="chain length determination region; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(404303..404308,404315..404317,404330..404335,
                     404498..404500,404561..404563,404684..404689,
                     404696..404698,404726..404728,404741..404743,
                     404756..404758)
                     /locus_tag="BSVBI22_A0402"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(404303..404308,404315..404317,404330..404335,
                     404561..404563,404684..404689)
                     /locus_tag="BSVBI22_A0402"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(404303..404308,404315..404317,404330..404335,
                     404498..404500,404561..404563)
                     /locus_tag="BSVBI22_A0402"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(404321..404365,404705..404710,404726..404743,
                     404750..404764)
                     /locus_tag="BSVBI22_A0402"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(404684..404689,404696..404698,404726..404728,
                     404741..404743,404756..404758)
                     /locus_tag="BSVBI22_A0402"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173833"
     gene            405332..407197
                     /locus_tag="BSVBI22_A0403"
                     /db_xref="GeneID:11727878"
     CDS             405332..407197
                     /locus_tag="BSVBI22_A0403"
                     /note="identified by match to protein family HMM PF00515"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154101.1"
                     /db_xref="GI:376280095"
                     /db_xref="GeneID:11727878"
                     /translation="MRLGSKHRPLYGLLLSLLAGIAISTSGALAKTTPDPVRAQVRAG
                     SFAGAYLAGRTAESDDNLSAAVDFYRQAMAFDPNNSQIKQDLMLVLLTEGRFKDALPL
                     AHELQNVTAIERFSRLALAIDAINRQQYRKVGPLLMFSLQSDMDRLLINLMNAWVKVG
                     QGNPKEALADVQKMDGPEWYDLFRTYNAALIADLAGRKQEARDYYQQAIDDRRGGSAA
                     PDTYERVVMAFAAFKLRQGDRAGAIKTLKDAEELLNGRMTITEMREKIEAGHKYGRLV
                     KTAQDGAAETLYTLGTAINRSGAEAFAKLYLQMSLPLRPDNDATLYQLGDISAKLHEP
                     QKAVEYYGRVPEQSPYRRDAEMQRALNLAENDQSAEAIKQLKVLLGRDKSDMRTYLAL
                     GGVYAQDKNFADAAKIYDAAVEQIKTPARKDWPLFYQRGIAYERLQEWDKAEPNFRKA
                     LELYPDQPQVLNYLGYSWVDRNENLDEALNMIRKAVELRPQDGYIVDSLGWAYYQLGR
                     YNDAVVELEKAVKLRPEDPTINDHMGDAYWRVGRLLEATFQWNHAIAGKPEPEELAKI
                     KEKLKKGLPDIPGQSAADATKPAGKKPDEAKPEAPAPSATPAAPSDKAPEKPTTD"
     misc_feature    405443..>406711
                     /locus_tag="BSVBI22_A0403"
                     /note="poly-beta-1,6 N-acetyl-D-glucosamine export porin
                     PgaA; Region: PGA_TPR_OMP; TIGR03939"
                     /db_xref="CDD:234406"
     misc_feature    406184..406459
                     /locus_tag="BSVBI22_A0403"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(406184..406189,406193..406198,406205..406210,
                     406295..406300,406304..406309,406316..406321,
                     406397..406402,406409..406414,406421..406426)
                     /locus_tag="BSVBI22_A0403"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(406202..406204,406238..406240,406250..406252,
                     406259..406261,406304..406306,406340..406342,
                     406352..406354,406361..406363,406406..406408,
                     406442..406444,406454..406456)
                     /locus_tag="BSVBI22_A0403"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    406229..407038
                     /locus_tag="BSVBI22_A0403"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    406496..406804
                     /locus_tag="BSVBI22_A0403"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(406499..406504,406511..406516,406613..406618,
                     406622..406627,406634..406639,406715..406720,
                     406727..406732,406739..406744)
                     /locus_tag="BSVBI22_A0403"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(406508..406510,406544..406546,406556..406558,
                     406565..406567,406622..406624,406658..406660,
                     406670..406672,406679..406681,406724..406726,
                     406763..406765,406775..406777,406784..406786)
                     /locus_tag="BSVBI22_A0403"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    406706..407008
                     /locus_tag="BSVBI22_A0403"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(406706..406711,406715..406720,406727..406732,
                     406820..406825,406829..406834,406841..406846,
                     406922..406927,406934..406939,406946..406951)
                     /locus_tag="BSVBI22_A0403"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(406724..406726,406763..406765,406775..406777,
                     406784..406786,406829..406831,406865..406867,
                     406877..406879,406886..406888,406931..406933,
                     406967..406969,406979..406981,406988..406990)
                     /locus_tag="BSVBI22_A0403"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            407349..408275
                     /gene="glyQ"
                     /locus_tag="BSVBI22_A0404"
                     /db_xref="GeneID:11727879"
     CDS             407349..408275
                     /gene="glyQ"
                     /locus_tag="BSVBI22_A0404"
                     /note="glycine--tRNA ligase alpha chain; GlyRS; class II
                     aminoacyl tRNA synthetase; tetramer of alpha(2)beta(2);
                     catalyzes a two-step reaction; first charging a glycine
                     molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP; second by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit alpha"
                     /protein_id="YP_005154102.1"
                     /db_xref="GI:376280096"
                     /db_xref="GeneID:11727879"
                     /translation="MHPTRSFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTL
                     RSLGPKPWKAAYVQPSRRPKDGRYGENPNRLQHYYQYQVLIKPSPPNLQDLYLGSLKA
                     IGLDPTLHDVRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGE
                     LTYGLERLAMYVQGVDNVYDLNFNGLEGDEKVTYGDVFLQAEQEYSRYNFEMANTETL
                     HQHFIDAERECEAILKAGSTGENSLHKCVFPAYDQCIKASHVFNLMDARGVISVTERQ
                     SYILRVRNLARQCGEAFLLTDAGGFNFKREGE"
     misc_feature    407364..408230
                     /gene="glyQ"
                     /locus_tag="BSVBI22_A0404"
                     /note="Class II Glycyl-tRNA synthetase (GlyRS) alpha
                     subunit core catalytic domain. GlyRS functions as a
                     homodimer in eukaryotes, archaea and some bacteria and as
                     a heterotetramer in the remainder of prokaryotes and in
                     arabidopsis. It is responsible for the...; Region:
                     GlyRS_alpha_core; cd00733"
                     /db_xref="CDD:238375"
     misc_feature    order(407370..407372,407382..407384,407394..407396,
                     407418..407423,407427..407429,407433..407444,
                     407490..407492,407517..407519,407529..407531,
                     407577..407579,407895..407897,407949..407951,
                     407958..407963,407982..407984,407988..407990,
                     407997..407999,408006..408011,408018..408023,
                     408030..408032,408039..408041,408051..408053,
                     408084..408095,408102..408104,408114..408116)
                     /gene="glyQ"
                     /locus_tag="BSVBI22_A0404"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238375"
     misc_feature    407415..407438
                     /gene="glyQ"
                     /locus_tag="BSVBI22_A0404"
                     /note="motif 1; other site"
                     /db_xref="CDD:238375"
     misc_feature    order(407451..407453,407457..407459,407532..407534,
                     407580..407582,407586..407588,407592..407600,
                     407763..407768,407778..407780,407826..407831,
                     407835..407840,407844..407849)
                     /gene="glyQ"
                     /locus_tag="BSVBI22_A0404"
                     /note="active site"
                     /db_xref="CDD:238375"
     misc_feature    407529..407540
                     /gene="glyQ"
                     /locus_tag="BSVBI22_A0404"
                     /note="motif 2; other site"
                     /db_xref="CDD:238375"
     misc_feature    407838..407849
                     /gene="glyQ"
                     /locus_tag="BSVBI22_A0404"
                     /note="motif 3; other site"
                     /db_xref="CDD:238375"
     gene            408394..410727
                     /gene="glyS"
                     /locus_tag="BSVBI22_A0405"
                     /db_xref="GeneID:11727880"
     CDS             408394..410727
                     /gene="glyS"
                     /locus_tag="BSVBI22_A0405"
                     /note="glycine--tRNA ligase beta chain; glyS; class II
                     aminoacyl tRNA synthetase; tetramer of alpha(2)beta(2);
                     catalyzes a two-step reaction; first charging a glycine
                     molecule by linking the carboxyl group to the
                     alpha-phosphate of ATP; second by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit beta"
                     /protein_id="YP_005154103.1"
                     /db_xref="GI:376280097"
                     /db_xref="GeneID:11727880"
                     /translation="MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAAT
                     AYWTPRRLALDIRGLTVRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSD
                     PKKGDFYVAHLTKPGRAAEDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQ
                     SILCTFGPETEETKVIDFDVDGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFV
                     VLDAERRKEIISQDAHNLAFASGLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIP
                     PEVIRLTIRANQKCFVTRKQGDASRLASPAPQHEEIQALSNEFILVSNVAARDGGTEI
                     AYGNGKVVRARLSDALYFWHTDQHDLPDLDKLAASAEKFGLDLKKPLDQRMARLDALN
                     VTFHAKLGTQGQRVERIRELAAQIAPLVGADPKLAQRAAVLAKADLQTEVVGEFPELQ
                     GAMGRKYALLQGEDKAVAAALEEHYKPQGPSDVVPKNPVSVAVALADKLDTLVGFWAI
                     DEKPTGSKDPYALRRAALGVIRPLLSQEWKFPLLPLFRSAFAALQEGQMQRKLREFEA
                     KLAAENSGDVDGEQDVDNALANYEKEIRAEAEASCGPVLADLLSFFHDRFKVHLKEEG
                     ARYDAIDAVLTPEADNLLLVARRLEALIVFINEVDGKNLLAGAKRAANILAAEEKKGT
                     KVADRVDPALLREAEEKALFDAVTLASREVGEAIAREDFNGAMLALAKLRGPVDIFFD
                     KVLVNDEDGNVRANRLALLDQIRAATGKVADFSKIAG"
     misc_feature    408394..410724
                     /gene="glyS"
                     /locus_tag="BSVBI22_A0405"
                     /note="glycyl-tRNA synthetase subunit beta; Validated;
                     Region: glyS; PRK01233"
                     /db_xref="CDD:234925"
     misc_feature    408403..410295
                     /gene="glyS"
                     /locus_tag="BSVBI22_A0405"
                     /note="Glycyl-tRNA synthetase beta subunit; Region:
                     tRNA_synt_2f; pfam02092"
                     /db_xref="CDD:251082"
     misc_feature    410380..410682
                     /gene="glyS"
                     /locus_tag="BSVBI22_A0405"
                     /note="DALR anticodon binding domain; Region: DALR_1;
                     pfam05746"
                     /db_xref="CDD:253366"
     gene            410866..411837
                     /locus_tag="BSVBI22_A0406"
                     /db_xref="GeneID:11727881"
     CDS             410866..411837
                     /locus_tag="BSVBI22_A0406"
                     /note="identified by match to protein family HMM PF01300;
                     match to protein family HMM PF03481; match to protein
                     family HMM TIGR00057"
                     /codon_start=1
                     /transl_table=11
                     /product="Sua5/YciO/YrdC family protein"
                     /protein_id="YP_005154104.1"
                     /db_xref="GI:376280098"
                     /db_xref="GeneID:11727881"
                     /translation="MTETLKFDDGAVLRAVEVLRRGGLVAIPTETVYGLAADAANGEG
                     VAGIFAAKGRPQFNPLIAHVDGIAMAGRYVAFDPVSRRLAEAFWPGPLTIVLPLKERQ
                     DTERPIHPLVTAGLSTLAVRMPHGRVRDVITALDSPVAAPSANTSGRISPTSAAAVAG
                     DLGGRIDLILDAGPCGVGVESTIVKVDGDQVHLLRPGGLAAEEIEAFLGQKLRRAEHA
                     AAIQAPGMMESHYAPDASMRLAVSDVKPGEALLAFGPHRVAESNRAAAVLNLSATGDL
                     REAAANLFDFMRRLDATGAATIAVEPIPLDGLGEAINDRLKRAAAPR"
     misc_feature    410866..411492
                     /locus_tag="BSVBI22_A0406"
                     /note="Putative translation factor (SUA5) [Translation,
                     ribosomal structure and biogenesis]; Region: SUA5;
                     COG0009"
                     /db_xref="CDD:223088"
     misc_feature    411460..411828
                     /locus_tag="BSVBI22_A0406"
                     /note="Putative GTP-binding controlling metal-binding;
                     Region: SUA5; pfam03481"
                     /db_xref="CDD:251991"
     gene            411863..413275
                     /locus_tag="BSVBI22_A0407"
                     /db_xref="GeneID:11727882"
     CDS             411863..413275
                     /locus_tag="BSVBI22_A0407"
                     /note="identified by match to protein family HMM PF01565;
                     match to protein family HMM PF02913"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, FAD-binding protein"
                     /protein_id="YP_005154105.1"
                     /db_xref="GI:376280099"
                     /db_xref="GeneID:11727882"
                     /translation="MPDTALIERFAAIVGEKNALTAPEDIAAYLIEQRDLYHGRTPLV
                     LRPGSTEEVAAIMKLATETRTPVVPQGGNTGLVGGQQPDESGAAIILSLGRMNRIRNL
                     DTVGNLVTLEAGVILKNLQDAAEKAGRLFPLSLGAEGSCQIGGNLGSNAGGTAVLAYG
                     NMRELCLGLEVVLPTGEILNDLRYVKKDNTGYDLKDIFVGSEGTLGVITAAVLKIFPQ
                     PKGKGVAYAGLRSPEDVLRLFQLATEHAGPSLTGFELMPRVGVEFTVRHVDGVRDPLE
                     SPHDWYVLIDISSSRSEEDARTTLETILTEAFENDLIQDAAIAESVAQAQSFWKMREE
                     MSWAQKPEGGSIKHDISVPVASIPAFIHEANAATLDMIPGARVVCFGHIGDGNLHYNV
                     SQPVGADKEAFLARWHDLNHRIHTIVASYGGSISAEHGIGQLKREELVFFKQDIALDL
                     MRRIKAAFDPAGIMNPGKVL"
     misc_feature    411887..413272
                     /locus_tag="BSVBI22_A0407"
                     /note="FAD/FMN-containing dehydrogenases [Energy
                     production and conversion]; Region: GlcD; COG0277"
                     /db_xref="CDD:223354"
     misc_feature    411989..412402
                     /locus_tag="BSVBI22_A0407"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    412517..413269
                     /locus_tag="BSVBI22_A0407"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            complement(413313..413630)
                     /locus_tag="BSVBI22_A0408"
                     /db_xref="GeneID:11727883"
     CDS             complement(413313..413630)
                     /locus_tag="BSVBI22_A0408"
                     /note="identified by similarity to OMNI:VCA0423; match to
                     protein family HMM PF05016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154106.1"
                     /db_xref="GI:376280100"
                     /db_xref="GeneID:11727883"
                     /translation="MKVIVSPAARDYIKSEIAYLKLRSPSAAVQLSEDLKRLKRDLGR
                     FSQMGHFTEELPVPGIRRFVMGAYLIDYEIRADAILIFAIRHGRERPPILPPDEDFDF
                     EQS"
     misc_feature    complement(413355..413630)
                     /locus_tag="BSVBI22_A0408"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     gene            complement(413627..413887)
                     /locus_tag="BSVBI22_A0409"
                     /db_xref="GeneID:11727884"
     CDS             complement(413627..413887)
                     /locus_tag="BSVBI22_A0409"
                     /note="identified by similarity to GP:3337067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154107.1"
                     /db_xref="GI:376280101"
                     /db_xref="GeneID:11727884"
                     /translation="MKNQHLSDPITMRIPRDLLAEIEEIASLTERSRSWVIVRAMKAY
                     LAAEGREIRDIAKARCAIENGEGIDLDTVIEEAEAIIKGAAA"
     misc_feature    complement(413660..413857)
                     /locus_tag="BSVBI22_A0409"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG3905"
                     /db_xref="CDD:226420"
     gene            complement(413996..414169)
                     /locus_tag="BSVBI22_A0410"
                     /db_xref="GeneID:11727885"
     CDS             complement(413996..414169)
                     /locus_tag="BSVBI22_A0410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154108.1"
                     /db_xref="GI:376280102"
                     /db_xref="GeneID:11727885"
                     /translation="MFREPVIPASLIELLLFVELENRRRSLPAALTSWVNFFLPFPLV
                     SRLQPGVRIRKFF"
     gene            414198..414764
                     /locus_tag="BSVBI22_A0411"
                     /db_xref="GeneID:11727886"
     CDS             414198..414764
                     /locus_tag="BSVBI22_A0411"
                     /note="identified by similarity to GP:15155604"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154109.1"
                     /db_xref="GI:376280103"
                     /db_xref="GeneID:11727886"
                     /translation="MMSKGLKPDWAGRELRLDPFHFPQVVTYASHDGSSDVTFTINER
                     GAVIRQVLPSSGLPMSIALPACAFVGVAARAVEDEFGEITVTLELMHEDPLLSVPLLV
                     AHDLGDIAADWRAWSAAFNLPMMLVEEDGVARPLYESTGPVRTGQPQARRQGQEPRRR
                     RPRFLARRKTGTLGVRLVISGKEIIARH"
     gene            complement(414907..415659)
                     /locus_tag="BSVBI22_A0412"
                     /db_xref="GeneID:11727887"
     CDS             complement(414907..415659)
                     /locus_tag="BSVBI22_A0412"
                     /note="Catalyzes the reversible hydration of unsaturated
                     fatty acyl-CoA to beta-hydroxyacyl-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="YP_005154110.1"
                     /db_xref="GI:376280104"
                     /db_xref="GeneID:11727887"
                     /translation="MSEHILIERKGAVQVIRLNRPEKKNAITRAMYAAMAKALKDGDA
                     DDAVRAHVFLGVPGAFSSGNDMQDFMAAATGDTSFGSEILDFLIPLAETKKPIVSGVD
                     GLAIGVGTTIHFHCDLTFATPRALFRTPFVDLGLVPEAGSSLLAPLLMGHQKAFALLA
                     LGHGFTAEAAQKSGIVYQIVDEEALEAEVMKAAEEIAAKPPQAMQIARALMRLPAENI
                     ADRITREAKHFAERLTSDEAREAVMAFLSRKK"
     misc_feature    complement(414916..415659)
                     /locus_tag="BSVBI22_A0412"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK06023"
                     /db_xref="CDD:168351"
     misc_feature    complement(415072..415647)
                     /locus_tag="BSVBI22_A0412"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(415258..415260,415267..415272,
                     415336..415344,415348..415350,415462..415476,
                     415486..415488,415582..415584,415588..415590))
                     /locus_tag="BSVBI22_A0412"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(415336..415338,415468..415470))
                     /locus_tag="BSVBI22_A0412"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(415072..415077,415084..415086,
                     415129..415131,415138..415140,415171..415173,
                     415180..415185,415189..415194,415198..415203,
                     415216..415221,415225..415233,415237..415239,
                     415255..415266,415300..415311,415372..415374,
                     415396..415398))
                     /locus_tag="BSVBI22_A0412"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            complement(415662..417440)
                     /locus_tag="BSVBI22_A0413"
                     /db_xref="GeneID:11727888"
     CDS             complement(415662..417440)
                     /locus_tag="BSVBI22_A0413"
                     /note="identified by match to protein family HMM PF00441;
                     match to protein family HMM PF02770"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase family protein"
                     /protein_id="YP_005154111.1"
                     /db_xref="GI:376280105"
                     /db_xref="GeneID:11727888"
                     /translation="MYRAPVSEISHTLMKVAGLEKALEENRFPEFSADLAAAILEEAG
                     KFAADRIEPLRITGDKNGATVKDGVVTTAPGWKELYRNWIAGGWNSLTGTPEYGGQGL
                     PTMMSVAVSEMWNSGTLAFAIAPTLTMGAVEALEKHASRELKDIYLEKLISGEWMGTM
                     NLTEPQAGSDLGALRTRAERRDDGTYRIFGQKIFITYGEHDLTDNIVHLVLARLPDAP
                     AGTKGISLFLVPKFLVNEDGSLGRRNDLFCSGLEHKMGIHASPTCTMIYGDGFVKGEE
                     QGAVGYLIGEENRGLACMFTMMNNARLLVGIQGVGVAEAAYQQALAYAKERKQGRALG
                     ADPKQGMSPIIEHPDVQRMLLTMKALTQVARSITYACAHAIDMSHVTDGADAQFWSDR
                     AGLLTPLAKSFATDAGVDVSSLGIQIHGGMGFIEETGAAQLLRDARITPIYEGTNGIQ
                     AIDLVMRKLPLQKGDHIKGFLAELQGDADKATASNRAELGETGARLSKAISEAREATD
                     WLQKATAEGRAEEALSGATPYQRLLSLTAGGAYLARAALAGDDAARAALCRFFAENML
                     AEVSSLKDTVITGAASLTAAKSALEA"
     misc_feature    complement(416046..417341)
                     /locus_tag="BSVBI22_A0413"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(416064..417326)
                     /locus_tag="BSVBI22_A0413"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(416097..416099,416103..416105,
                     416109..416117,416853..416855,416859..416861,
                     416955..416957,416961..416963,417051..417053))
                     /locus_tag="BSVBI22_A0413"
                     /note="active site"
                     /db_xref="CDD:173838"
     misc_feature    complement(415686..416033)
                     /locus_tag="BSVBI22_A0413"
                     /note="Acetyl-CoA dehydrogenase C-terminal like; Region:
                     Acyl-CoA_dh_C; pfam12806"
                     /db_xref="CDD:257313"
     gene            417758..418908
                     /locus_tag="BSVBI22_A0414"
                     /note="GGDEF domain, authentic frameshift; this gene
                     contains a frame shift which is not the result of
                     sequencing error;identified by similarity to GP:15140377"
                     /pseudo
                     /db_xref="GeneID:11727889"
     gene            complement(418921..420204)
                     /gene="purD"
                     /locus_tag="BSVBI22_A0415"
                     /db_xref="GeneID:11727890"
     CDS             complement(418921..420204)
                     /gene="purD"
                     /locus_tag="BSVBI22_A0415"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="YP_005154112.1"
                     /db_xref="GI:376280106"
                     /db_xref="GeneID:11727890"
                     /translation="MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELA
                     DIGVDDHAALIAFAKEKHIDLVVVGPEAPLVTGLADEMRAEGIRVFGPSRAAAQLEGS
                     KGFTKDLCARFNIPTGAYGRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQ
                     EALDAVDSCFEGAFGAAGAEVVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDG
                     DTGPNTGGMGAYAPAPVMTPEMVARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSD
                     GPKLIEYNTRFGDPECQVLMMRLNSDLLALINAAVDGRLDEVSLEWKDEPALTVVMAA
                     EGYPANVKKGSVIRDLEKLESIDGVKLFHAGTALKDGAIVAGGGRVLNITATAATVAQ
                     AQARAYEALKLIDWPEGFYRSDIGWRAVEREKANR"
     misc_feature    complement(418939..420204)
                     /gene="purD"
                     /locus_tag="BSVBI22_A0415"
                     /note="phosphoribosylamine--glycine ligase; Provisional;
                     Region: PRK00885"
                     /db_xref="CDD:234856"
     misc_feature    complement(419905..420201)
                     /gene="purD"
                     /locus_tag="BSVBI22_A0415"
                     /note="Phosphoribosylglycinamide synthetase, N domain;
                     Region: GARS_N; pfam02844"
                     /db_xref="CDD:251569"
     misc_feature    complement(419329..419904)
                     /gene="purD"
                     /locus_tag="BSVBI22_A0415"
                     /note="Phosphoribosylglycinamide synthetase, ATP-grasp (A)
                     domain; Region: GARS_A; pfam01071"
                     /db_xref="CDD:250341"
     misc_feature    complement(418945..419229)
                     /gene="purD"
                     /locus_tag="BSVBI22_A0415"
                     /note="Phosphoribosylglycinamide synthetase, C domain;
                     Region: GARS_C; pfam02843"
                     /db_xref="CDD:251568"
     gene            420349..421350
                     /gene="ubiA"
                     /locus_tag="BSVBI22_A0416"
                     /db_xref="GeneID:11727891"
     CDS             420349..421350
                     /gene="ubiA"
                     /locus_tag="BSVBI22_A0416"
                     /note="UbiA prenyltransferase family catalyzes the
                     transfer of a prenyl group to various acceptors with
                     hydrophobic ring structures in the biosynthesis of
                     respiratory quinones, hemes, chlorophylls, vitamin E, and
                     shikonin"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate polyprenyltransferase"
                     /protein_id="YP_005154113.1"
                     /db_xref="GI:376280107"
                     /db_xref="GeneID:11727891"
                     /translation="MQQPQANSDIQSRAARGRVKDAPSGHWVYRVLPQWLWPYAQLAR
                     WDRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMRGAGCT
                     YNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVVLQALVGLAVVLQFNWFSVALGI
                     FSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWTI
                     GYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPA
                     LAGLLAAGAHLYRQILVLDIDNPDQCLRLFKSNNIVGWLIFLGLVFGTLWVAVKPLV"
     misc_feature    420475..421317
                     /gene="ubiA"
                     /locus_tag="BSVBI22_A0416"
                     /note="4-Hydroxybenzoate polyprenyltransferase; Region:
                     PT_UbiA_COQ2; cd13959"
                     /db_xref="CDD:260122"
     misc_feature    order(420670..420672,420682..420684,421030..421032,
                     421042..421044)
                     /gene="ubiA"
                     /locus_tag="BSVBI22_A0416"
                     /note="putative active site [active]"
                     /db_xref="CDD:260122"
     gene            complement(421390..422016)
                     /gene="pdxH"
                     /locus_tag="BSVBI22_A0417"
                     /db_xref="GeneID:11727892"
     CDS             complement(421390..422016)
                     /gene="pdxH"
                     /locus_tag="BSVBI22_A0417"
                     /note="catalyzes the formation of pyridoxal 5'-phosphate
                     from pyridoxamine 5'-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="YP_005154114.1"
                     /db_xref="GI:376280108"
                     /db_xref="GeneID:11727892"
                     /translation="MEPVKMTNSSDDFTQSAEPFKLFAEWLADAAKSEPNDPNAVALA
                     TVDPDGLPNVRMVLLKDFDETGFVFYTNYESKKGQEILSAEKAAMCFHWKSLRRQVRV
                     RGPVEKVSDAEADAYYASRPRGSRIGAWASKQSRPLESRFALEKAVAEYTAKYAIGDI
                     PRPPYWSGFRIRPVSIEFWHDRPFRLHDRVLFTRPTPEGDWNKDRLYP"
     misc_feature    complement(421393..421968)
                     /gene="pdxH"
                     /locus_tag="BSVBI22_A0417"
                     /note="pyridoxamine 5'-phosphate oxidase; Provisional;
                     Region: PRK05679"
                     /db_xref="CDD:235555"
     misc_feature    complement(421678..421938)
                     /gene="pdxH"
                     /locus_tag="BSVBI22_A0417"
                     /note="Pyridoxamine 5'-phosphate oxidase; Region:
                     Pyridox_oxidase; pfam01243"
                     /db_xref="CDD:250471"
     misc_feature    complement(421393..421521)
                     /gene="pdxH"
                     /locus_tag="BSVBI22_A0417"
                     /note="Pyridoxine 5'-phosphate oxidase C-terminal
                     dimerization region; Region: PNPOx_C; pfam10590"
                     /db_xref="CDD:256075"
     gene            422275..422745
                     /locus_tag="BSVBI22_A0418"
                     /db_xref="GeneID:11727893"
     CDS             422275..422745
                     /locus_tag="BSVBI22_A0418"
                     /note="identified by similarity to GP:14026958"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154115.1"
                     /db_xref="GI:376280109"
                     /db_xref="GeneID:11727893"
                     /translation="MAARPARHDRNDRTRIRRTIFTRNAAFAILMLSLGGCAMGGFSI
                     EKAVPDASAITGSVQQAEPAETDTGKLSDQSAIKNVVSALNFTQWGKKPVPWANPDTG
                     SQGTITTIAESSTNNKLCRQFETSREAFDGVSIYRGETCMERGGQWTVTAFAPI"
     gene            422890..423831
                     /locus_tag="BSVBI22_A0419"
                     /db_xref="GeneID:11727894"
     CDS             422890..423831
                     /locus_tag="BSVBI22_A0419"
                     /note="identified by match to protein family HMM PF00226;
                     match to protein family HMM PF01556"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein DnaJ"
                     /protein_id="YP_005154116.1"
                     /db_xref="GI:376280110"
                     /db_xref="GeneID:11727894"
                     /translation="MRDPYSVLGVAKTAKPEEIKSAFRKLAKKHHPDQNQDDPKAQER
                     FAEVNQAYEIIGDKDKRAQFDRGEIDAEGKPVFQGFAGGQGFGGAHGDPFAGFRQGGG
                     NSHFEFRGGPGGFQGGGFGGAEDILNDLFGGAFGGGRSGARQRGPSKGADLSASIDIS
                     LSQAVGAEKVEAIFPNGKHLKIKLPKFVEDGQTIRLKGQGEPLMGGTPGDALVTIRFK
                     PHSRFRLEGRDVHVDLPVSIDDAVLGGKQEVETLDGRISVKIPAWSSSDRVLRLKEKG
                     LPLKAGGRGDLYVHVRIMLPEGGDKELEDFLQKRRVV"
     misc_feature    422893..423816
                     /locus_tag="BSVBI22_A0419"
                     /note="DnaJ-class molecular chaperone with C-terminal Zn
                     finger domain [Posttranslational modification, protein
                     turnover, chaperones]; Region: DnaJ; COG0484"
                     /db_xref="CDD:223560"
     misc_feature    422896..423060
                     /locus_tag="BSVBI22_A0419"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    order(422980..422988,423013..423015,423022..423027,
                     423034..423039)
                     /locus_tag="BSVBI22_A0419"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    423340..423780
                     /locus_tag="BSVBI22_A0419"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    order(423601..423606,423613..423618,423676..423687,
                     423772..423780)
                     /locus_tag="BSVBI22_A0419"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199909"
     gene            complement(423835..423942)
                     /locus_tag="BSVBI22_A0420"
                     /db_xref="GeneID:11727895"
     CDS             complement(423835..423942)
                     /locus_tag="BSVBI22_A0420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154117.1"
                     /db_xref="GI:376280111"
                     /db_xref="GeneID:11727895"
                     /translation="MPYRTGFAILQAIADKKAGIVTLLAQSDNTFASTD"
     gene            423975..424793
                     /gene="fabI-1"
                     /locus_tag="BSVBI22_A0421"
                     /db_xref="GeneID:11727896"
     CDS             423975..424793
                     /gene="fabI-1"
                     /locus_tag="BSVBI22_A0421"
                     /note="Catalyzes a key regulatory step in fatty acid
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-ACP reductase"
                     /protein_id="YP_005154118.1"
                     /db_xref="GI:376280112"
                     /db_xref="GeneID:11727896"
                     /translation="MTAQSGLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQ
                     GDALKKRVEPLAEELGAFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKD
                     ELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYN
                     VMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAP
                     LRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGMKAVDAPDISVVKD"
     misc_feature    423975..424790
                     /gene="fabI-1"
                     /locus_tag="BSVBI22_A0421"
                     /note="enoyl-(acyl carrier protein) reductase;
                     Provisional; Region: PRK08159"
                     /db_xref="CDD:181260"
     misc_feature    424002..424748
                     /gene="fabI-1"
                     /locus_tag="BSVBI22_A0421"
                     /note="Enoyl acyl carrier protein (ACP) reductase (ENR),
                     divergent SDR; Region: ENR_SDR; cd05372"
                     /db_xref="CDD:187630"
     misc_feature    order(424023..424031,424041..424046,424104..424106,
                     424173..424181,424257..424268,424338..424340,
                     424413..424421,424449..424451,424470..424472,
                     424548..424559,424563..424574)
                     /gene="fabI-1"
                     /locus_tag="BSVBI22_A0421"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187630"
     misc_feature    order(424074..424076,424179..424190,424197..424199,
                     424293..424313,424320..424325,424332..424337,
                     424344..424349,424356..424358,424368..424370,
                     424377..424379,424425..424430,424434..424445,
                     424449..424454,424461..424466,424473..424478,
                     424485..424490,424494..424511,424515..424520,
                     424599..424601,424608..424610,424626..424637,
                     424653..424655,424662..424667,424674..424676,
                     424689..424691,424695..424733,424737..424748)
                     /gene="fabI-1"
                     /locus_tag="BSVBI22_A0421"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(424179..424190,424293..424313,424320..424325,
                     424332..424337,424344..424349,424356..424358,
                     424365..424370,424377..424379,424425..424430,
                     424434..424442,424449..424454,424461..424466,
                     424473..424478,424485..424490,424494..424502,
                     424506..424514)
                     /gene="fabI-1"
                     /locus_tag="BSVBI22_A0421"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(424263..424265,424269..424271,424419..424421,
                     424449..424451,424458..424460,424470..424472,
                     424569..424574,424581..424583,424590..424592)
                     /gene="fabI-1"
                     /locus_tag="BSVBI22_A0421"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(424341..424343,424419..424421,424458..424460,
                     424470..424472)
                     /gene="fabI-1"
                     /locus_tag="BSVBI22_A0421"
                     /note="active site"
                     /db_xref="CDD:187630"
     gene            424845..425488
                     /locus_tag="BSVBI22_A0422"
                     /note="phosphoglycerate mutase family protein, authentic
                     frameshift; this gene contains a frame shift which is not
                     the result of sequencing error;identified by similarity to
                     OMNI:CC1351"
                     /pseudo
                     /db_xref="GeneID:11727897"
     gene            complement(425623..425802)
                     /locus_tag="BSVBI22_A0423"
                     /db_xref="GeneID:11727898"
     CDS             complement(425623..425802)
                     /locus_tag="BSVBI22_A0423"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154119.1"
                     /db_xref="GI:376280113"
                     /db_xref="GeneID:11727898"
                     /translation="MKPKPLVELKNFTVPFAILNSFQFARLKYSELPFAADFYEFERN
                     TGGRYPRRNIREQNR"
     gene            425750..425958
                     /locus_tag="BSVBI22_A0424"
                     /note="cold-shock family protein, authentic frameshift;
                     this gene contains a frame shift which is not the result
                     of sequencing error;identified by similarity to SP:Q9Z3S6;
                     match to protein family HMM PF00313"
                     /pseudo
                     /db_xref="GeneID:11727899"
     gene            complement(426056..426205)
                     /locus_tag="BSVBI22_A0425"
                     /db_xref="GeneID:11727900"
     CDS             complement(426056..426205)
                     /locus_tag="BSVBI22_A0425"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154120.1"
                     /db_xref="GI:376280114"
                     /db_xref="GeneID:11727900"
                     /translation="MGTLDFRFRRTMSVIAPGTNIITGLCRLFKIVMFHLILLCYGPS
                     TKQQK"
     gene            426461..426640
                     /locus_tag="BSVBI22_A0426"
                     /db_xref="GeneID:11727901"
     CDS             426461..426640
                     /locus_tag="BSVBI22_A0426"
                     /note="identified by similarity to GP:15160282"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154121.1"
                     /db_xref="GI:376280115"
                     /db_xref="GeneID:11727901"
                     /translation="MTLFKPNLSRMEAKSAVTDKTAKAILDTERAAVEAKTERLRAAR
                     LASEENKPQVASKRK"
     gene            426735..427397
                     /locus_tag="BSVBI22_A0427"
                     /db_xref="GeneID:11727902"
     CDS             426735..427397
                     /locus_tag="BSVBI22_A0427"
                     /note="identified by similarity to GP:14027592; match to
                     protein family HMM PF04028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154122.1"
                     /db_xref="GI:376280116"
                     /db_xref="GeneID:11727902"
                     /translation="MKSPVAIKFITSVGTAYLRFVWWSSRNTAGRNETNPLAQAGPCI
                     VAMWHGQMFLAAFARPPEKKFVAAVSKSRDGELVAQMLGKLGIRAIRGSGAGQRKGNR
                     QGGAAALRQMLYALRNGESIVMAAETNKKVFRCGEGVIALARLSGCPIYPASARTSFT
                     RTLNSWDRAELPMPFGRRSVVIGEPIFVPRDASDEELEQYRLQVEQVINQAYAAAKLA
                     CS"
     misc_feature    426786..427364
                     /locus_tag="BSVBI22_A0427"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: DUF374; Region:
                     LPLAT_DUF374-like; cd07983"
                     /db_xref="CDD:153245"
     misc_feature    order(426879..426881,426888..426890,426894..426896,
                     426939..426950,427116..427124)
                     /locus_tag="BSVBI22_A0427"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153245"
     gene            complement(427542..427793)
                     /locus_tag="BSVBI22_A0428"
                     /db_xref="GeneID:11727903"
     CDS             complement(427542..427793)
                     /locus_tag="BSVBI22_A0428"
                     /note="identified by similarity to GP:15073831"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154123.1"
                     /db_xref="GI:376280117"
                     /db_xref="GeneID:11727903"
                     /translation="MHYLIGLILIIAALFSTVAMAEDAEGKITDINKDSETITLDDGE
                     TYKLPGEFDIGAINPGMKVLIIYDIVDHTRFITDIQEAP"
     misc_feature    complement(427554..427736)
                     /locus_tag="BSVBI22_A0428"
                     /note="Protein of unknown function (DUF1344); Region:
                     DUF1344; pfam07076"
                     /db_xref="CDD:191683"
     gene            428069..429163
                     /gene="aroC"
                     /locus_tag="BSVBI22_A0429"
                     /db_xref="GeneID:11727904"
     CDS             428069..429163
                     /gene="aroC"
                     /locus_tag="BSVBI22_A0429"
                     /note="catalyzes the formation of chorismate from
                     5-O-(1-carboxyvinyl)-3-phosphoshikimate in aromatic amino
                     acid biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="YP_005154124.1"
                     /db_xref="GI:376280118"
                     /db_xref="GeneID:11727904"
                     /translation="MSHNSFGHLFRVTTWGESHGLALGCVVDGCPPGITFTEAEIQSF
                     LDKRKPGQSKYTTQRREPDQVRVLSGVLLGEDGVTMTTTGTPISMMIENTDQRSKDYG
                     EIARQYRPGHADYAYDVKYGIRDYRGGGRSSARETAARVAAGAIARKVVPGLEVRGAL
                     VSIGAHDIDRSRWNWAEVDNNPFFTPDAGSVEVFADYLDGIRKNGSSVGAIIEIVAEG
                     VPAGIGAPIYGKLDQDIASYLMSINAVKGVEIGNGFEAARLTGEENADEMRMGNDGKP
                     IFLSNHAGGVLGGIATGAPVVARFAVKPTSSILTPRRSIDKDGNEVDVMTRGRHDPCV
                     GIRAVPIGEAMVACAIADHYLRHRGQTGRV"
     misc_feature    428096..429127
                     /gene="aroC"
                     /locus_tag="BSVBI22_A0429"
                     /note="Chorismase synthase, the enzyme catalyzing the
                     final step of the shikimate pathway; Region:
                     Chorismate_synthase; cd07304"
                     /db_xref="CDD:143612"
     misc_feature    order(428099..428119,428138..428140,428144..428146,
                     428150..428152,428162..428167,428264..428269,
                     428273..428278,428315..428320,428324..428326,
                     428330..428332,428336..428338,428417..428431,
                     428459..428464,428486..428488,428669..428671,
                     428684..428701,428732..428734,428738..428746,
                     428756..428758,428762..428767,428774..428782,
                     428786..428791,428795..428797,428804..428818,
                     428825..428830,428834..428839,428849..428854,
                     428915..428917,428924..428932,428936..428944,
                     428963..428965,428969..428980,428987..428989,
                     429101..429103)
                     /gene="aroC"
                     /locus_tag="BSVBI22_A0429"
                     /note="Tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143612"
     misc_feature    order(428123..428125,428210..428212,428399..428404,
                     428462..428473,428480..428482,428795..428800,
                     428972..428977,428981..428989,429068..429070,
                     429080..429082)
                     /gene="aroC"
                     /locus_tag="BSVBI22_A0429"
                     /note="active site"
                     /db_xref="CDD:143612"
     misc_feature    order(428399..428407,428459..428461,428465..428467,
                     428792..428800,428975..428977,428981..428989,
                     429059..429061,429068..429070,429077..429079)
                     /gene="aroC"
                     /locus_tag="BSVBI22_A0429"
                     /note="FMN-binding site [chemical binding]; other site"
                     /db_xref="CDD:143612"
     gene            429299..430414
                     /gene="ribAB"
                     /locus_tag="BSVBI22_A0430"
                     /db_xref="GeneID:11727905"
     CDS             429299..430414
                     /gene="ribAB"
                     /locus_tag="BSVBI22_A0430"
                     /note="identified by match to protein family HMM PF00925;
                     match to protein family HMM PF00926; match to protein
                     family HMM TIGR00506"
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone-4-phosphate
                     synthase/GTP cyclohydrolase II"
                     /protein_id="YP_005154125.1"
                     /db_xref="GI:376280119"
                     /db_xref="GeneID:11727905"
                     /translation="MSYNQKQVVDAIRAFERGEIVVVMDDDGRENEGDLIVAAVHCTP
                     EKMAFIVRHTSGIVCTPMTREEAKRLNLTPMVAENESAHTTAFTVTVDYRHGTTTGIS
                     AEDRTLTVRNLANPNAGASDFVRPGHIFPLVAREGGVLMRSGHTEAAVDLCKLANLPP
                     IGVICELVNDDGTVKRGPDVAAFAEEHKLHRVTVADLIAYRQRKETLVRRIGDAPVET
                     CAGKAHAYSYELPWEPMRHVAVVFGDIRDGEEVPVRLHREDVLNDVFGKGGSNLDAIM
                     QRMGQEGRGILVYLREGSVGVRSDHRDARAREALQGEHEAHAEAVAREEEWRQIGLGA
                     QILKDLGVSSIVLLASRERHYVGLEGFGICITRTEII"
     misc_feature    429305..429913
                     /gene="ribAB"
                     /locus_tag="BSVBI22_A0430"
                     /note="3,4-dihydroxy-2-butanone 4-phosphate synthase
                     [Coenzyme metabolism]; Region: RibB; COG0108"
                     /db_xref="CDD:223186"
     misc_feature    429311..430396
                     /gene="ribAB"
                     /locus_tag="BSVBI22_A0430"
                     /note="bifunctional 3,4-dihydroxy-2-butanone 4-phosphate
                     synthase/GTP cyclohydrolase II protein; Provisional;
                     Region: PRK09314"
                     /db_xref="CDD:181775"
     misc_feature    429914..430411
                     /gene="ribAB"
                     /locus_tag="BSVBI22_A0430"
                     /note="GTP cyclohydrolase II [Coenzyme metabolism];
                     Region: RibA; COG0807"
                     /db_xref="CDD:223878"
     misc_feature    order(429929..429949,429971..429973,429977..429985,
                     430004..430006,430010..430012,430016..430018,
                     430070..430072,430076..430081,430085..430099,
                     430112..430117,430124..430126,430163..430165,
                     430169..430171,430187..430192,430199..430204,
                     430208..430213,430220..430222)
                     /gene="ribAB"
                     /locus_tag="BSVBI22_A0430"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238348"
     misc_feature    order(430058..430075,430079..430081,430109..430111,
                     430172..430177,430196..430198,430208..430210,
                     430217..430219,430274..430276,430280..430282,
                     430343..430351,430358..430360)
                     /gene="ribAB"
                     /locus_tag="BSVBI22_A0430"
                     /note="active site"
                     /db_xref="CDD:238348"
     gene            430567..431580
                     /locus_tag="BSVBI22_A0431"
                     /db_xref="GeneID:11727906"
     CDS             430567..431580
                     /locus_tag="BSVBI22_A0431"
                     /note="identified by match to protein family HMM PF00850"
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase family protein"
                     /protein_id="YP_005154126.1"
                     /db_xref="GI:376280120"
                     /db_xref="GeneID:11727906"
                     /translation="MHFPRRRRFTYFLRKMLYSGCMTTRLYWHPIYLEHLTPPGHPER
                     PDRIRALMSELEGPDFYRLDRVEAPHAGEAAILLAHPEEHLEAVRSKIPEPVEDGEAS
                     QPIVKLDGDTYVSPKSMDAALTAIGAAMAAVDDVMSGAADNVFVASRPPGHHAERSRA
                     MGFCVFNNIAIAARHAQRHHGLERIAIVDWDVHHGNGTQDIFKDDPGVMFCSTHQFPL
                     YPGSGDKHETGVGNIVNAPLSPNTGSREFREAFNSRILPALDNFRPDLILISAGFDAH
                     FRDPLAEINLDESDFDWATGKLMERAERFCDHRLVSVLEGGYDLEGLSQSASVHITRL
                     LKG"
     misc_feature    430687..431571
                     /locus_tag="BSVBI22_A0431"
                     /note="Histone deacetylases and histone-like deacetylases,
                     classII; Region: HDAC_classII_2; cd11599"
                     /db_xref="CDD:212541"
     misc_feature    order(431023..431028,431050..431055,431137..431139,
                     431143..431145,431386..431388,431512..431514)
                     /locus_tag="BSVBI22_A0431"
                     /note="putative active site [active]"
                     /db_xref="CDD:212541"
     misc_feature    order(431137..431139,431143..431145,431386..431388)
                     /locus_tag="BSVBI22_A0431"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:212541"
     gene            431585..431839
                     /gene="xseB"
                     /locus_tag="BSVBI22_A0432"
                     /db_xref="GeneID:11727907"
     CDS             431585..431839
                     /gene="xseB"
                     /locus_tag="BSVBI22_A0432"
                     /note="catalyzes the bidirectional exonucleolytic cleavage
                     of DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII small subunit"
                     /protein_id="YP_005154127.1"
                     /db_xref="GI:376280121"
                     /db_xref="GeneID:11727907"
                     /translation="MVTEPSNADIAVMSFEDALKQLEKIVDDLERGDVPLEESIRIYE
                     RGEALKKHCDTLLKSAEDKVEKIRIGRDGQPVGTEPLDPE"
     misc_feature    431600..431836
                     /gene="xseB"
                     /locus_tag="BSVBI22_A0432"
                     /note="exodeoxyribonuclease VII small subunit;
                     Provisional; Region: PRK00977"
                     /db_xref="CDD:179195"
     gene            complement(431846..432364)
                     /locus_tag="BSVBI22_A0433"
                     /db_xref="GeneID:11727908"
     CDS             complement(431846..432364)
                     /locus_tag="BSVBI22_A0433"
                     /note="identified by match to protein family HMM PF00597"
                     /codon_start=1
                     /transl_table=11
                     /product="dedA family protein"
                     /protein_id="YP_005154128.1"
                     /db_xref="GI:376280122"
                     /db_xref="GeneID:11727908"
                     /translation="MHFVESYLATYGTLALFFIIYSESFGAPLPGESALIASSLLALH
                     GTLHIQTVLITVFIASVLGDSTGYLIGRFGGRKLILRYGYLVKLTPERLNQFEKIFAE
                     KGIYVVATARFVVLLRQLNGLVAGSMKMNPLHFLAANMVGAAGWTLIWGLGPYLLSGV
                     LAPYVAHLKALF"
     misc_feature    complement(431849..432358)
                     /locus_tag="BSVBI22_A0433"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     gene            complement(432606..432866)
                     /locus_tag="BSVBI22_A0434"
                     /db_xref="GeneID:11727909"
     CDS             complement(432606..432866)
                     /locus_tag="BSVBI22_A0434"
                     /note="identified by similarity to OMNI:NTL02ML3629; match
                     to protein family HMM PF04226"
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="YP_005154129.1"
                     /db_xref="GI:376280123"
                     /db_xref="GeneID:11727909"
                     /translation="MSVISWIILGLIAGFIGSKIVNKSGQGMFLDIALGVVGAIIGGV
                     IFTFFGAQGVTGLNIYSLIVSVIGAVIVLWIYHAVTGKRSIG"
     misc_feature    complement(432621..432866)
                     /locus_tag="BSVBI22_A0434"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2261"
                     /db_xref="CDD:225170"
     gene            433029..433580
                     /locus_tag="BSVBI22_A0435"
                     /db_xref="GeneID:11727910"
     CDS             433029..433580
                     /locus_tag="BSVBI22_A0435"
                     /note="identified by similarity to OMNI:NTL02ML3630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154130.1"
                     /db_xref="GI:376280124"
                     /db_xref="GeneID:11727910"
                     /translation="MGSYDDNSGNSPIPGGSLAKPVMIALGALLIGKLLKGNSDDAPA
                     TQAQPVPEQPQAGGGLLGGILGGLGGLLGSAAAGNASAAPAPGPLGGGLGGLLDQLKQ
                     SGLGDKVDSWVGQGENHPIEPGQLGNAIGQTTLEQIAAHAGIDQQELLNQLSQVLPGL
                     VDKLTANGQVPDANTLSKLLQGR"
     misc_feature    <433320..433577
                     /locus_tag="BSVBI22_A0435"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3753"
                     /db_xref="CDD:226276"
     gene            433784..434656
                     /locus_tag="BSVBI22_A0436"
                     /db_xref="GeneID:11727911"
     CDS             433784..434656
                     /locus_tag="BSVBI22_A0436"
                     /note="identified by similarity to OMNI:CC3178; match to
                     protein family HMM PF02678; match to protein family HMM
                     PF05726"
                     /codon_start=1
                     /transl_table=11
                     /product="pirin-related protein"
                     /protein_id="YP_005154131.1"
                     /db_xref="GI:376280125"
                     /db_xref="GeneID:11727911"
                     /translation="MDSIETLVIPRTSDIGGLEVRRALPTARRRLVGPFIFFDRMGPA
                     ILRDGEALDVRPHPHIGLSTVTYLFDGHIRHRDSLGTEMVIRPGDVNLMTAGRGIVHS
                     ERSPEEERAGPMPISGVQTWLALPDAMEEIDPAFHHINASDLPLMDDAAFSGRLIIGS
                     LHGLSSPVIQHAETLYADIRIHQGGRFQIPPTTEERAIYTLEGNVGIGGEVFPPDRLL
                     AFRPGDDIVVQAGPEGAHIMLFGGAPLGSRRYIWWNFVASSKERIEQAKEEWRTGRFD
                     IVPGDEQDFIPLPE"
     misc_feature    433784..434611
                     /locus_tag="BSVBI22_A0436"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    433832..434152
                     /locus_tag="BSVBI22_A0436"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     misc_feature    434309..434611
                     /locus_tag="BSVBI22_A0436"
                     /note="Pirin C-terminal cupin domain; Region: Pirin_C;
                     pfam05726"
                     /db_xref="CDD:253351"
     gene            434799..436730
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /db_xref="GeneID:11727912"
     CDS             434799..436730
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /note="catalyzes the formation of 1-deoxy-D-xylulose
                     5-phosphate from pyruvate and D-glyceraldehyde
                     3-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="YP_005154132.1"
                     /db_xref="GI:376280126"
                     /db_xref="GeneID:11727912"
                     /translation="MSRPSTPLLDKAPTPDRLRALPEQDLPQLAEELRTELIDAVSTT
                     GGHLGAGLGVVELTVALHHVFNTPYDRIIWDVGHQAYPHKILTGRRDRIRTLRQAGGL
                     SGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKRNVIAVIGDGSMSAGMAYE
                     AMNNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLVSGRTYRSVREAAKQVAQKLP
                     KFLQDKARKSEEYARAFFTGGTLFEELGFYYVGPIDGHNLDHLLPVLKNVRDTQKGPV
                     LIHVVTQKGKGYAPAEAAADKYHGVNKFDVITGKQAKPPANVPSYTKIFGTSLIEEAR
                     HDDKIVAVTAAMPTGTGLDLFGEAFPKRVFDVGIAEQHAVTFAAGLASEGYKPFCAIY
                     STFLQRGYDQVVHDVSIQNLPVRFPIDRAGLVGADGPTHAGSFDTGFLAALPGFVVMA
                     ASDEAELRHMVRTAAEYDEGPISFRYPRGDGVGVDLPERGSVLEIGKGRIVREGTKVA
                     LLSFGTRLQECLAAAEELGAAGLSTTVADARFAKPLDHDLIRRLAREHEVLVMVEEGA
                     VGGFGSHVLQFLATDGLLDRGLKVRALTLPDIYQDHGKPDAMYAEAGLDRTGIVRTVF
                     AALHRDELGHEALPTPFRA"
     misc_feature    434805..436679
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /note="1-deoxy-D-xylulose-5-phosphate synthase;
                     Provisional; Region: PRK05444"
                     /db_xref="CDD:235470"
     misc_feature    434931..435662
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /note="Thiamine pyrophosphate (TPP) family, DXS subfamily,
                     TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate
                     synthase (DXS) is a regulatory enzyme of the
                     mevalonate-independent pathway involved in terpenoid
                     biosynthesis. Terpeniods are plant natural products...;
                     Region: TPP_DXS; cd02007"
                     /db_xref="CDD:238965"
     misc_feature    order(435159..435161,435243..435254,435333..435335,
                     435339..435341)
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /note="TPP-binding site; other site"
                     /db_xref="CDD:238965"
     misc_feature    435765..436232
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /note="Pyrimidine (PYR) binding domain of
                     1-deoxy-D-xylulose-5-phosphate synthase (DXS),
                     transketolase (TK), and related proteins; Region:
                     TPP_PYR_DXS_TK_like; cd07033"
                     /db_xref="CDD:132916"
     misc_feature    order(435807..435809,435813..435815,435831..435833,
                     435882..435884,435891..435893,435897..435914,
                     435921..435926,435930..435938,435990..435992,
                     435999..436004,436077..436079,436086..436088,
                     436134..436139,436200..436202)
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    order(435831..435833,435891..435893,435900..435908,
                     435987..435992,435996..435998,436077..436079,
                     436083..436085,436110..436115,436119..436124,
                     436128..436130)
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    order(435900..435902,435906..435908,435981..435983,
                     435990..435992)
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    436284..436655
                     /gene="dxs"
                     /locus_tag="BSVBI22_A0437"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            436736..437497
                     /gene="tlyA"
                     /locus_tag="BSVBI22_A0438"
                     /db_xref="GeneID:11727913"
     CDS             436736..437497
                     /gene="tlyA"
                     /locus_tag="BSVBI22_A0438"
                     /note="identified by similarity to EGAD:20008; match to
                     protein family HMM PF01479; match to protein family HMM
                     PF01728; match to protein family HMM TIGR00478"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin A"
                     /protein_id="YP_005154133.1"
                     /db_xref="GI:376280127"
                     /db_xref="GeneID:11727913"
                     /translation="MNGQSTDNRPRLDQLLVERGFFATRSRARDAIQRGTVKVDGRPI
                     TKPGQMVVRDAALAVDDPASAYVSRAALKLVAALDHFDLNVKGRTALDIGASTGGFTQ
                     VLLERGAHHVIAIDVGHDQLHESLRHDPRVTSKEGVNARALELAHLDTRAVDCIVSDV
                     SFISLRLALPPALALAEKGAICALLVKPQFEAGREAIGKGGILRDPAYGERMAQELKS
                     WLETQPGWRALGLCPSPIEGGDGNREYLLAGKKDR"
     misc_feature    436757..437494
                     /gene="tlyA"
                     /locus_tag="BSVBI22_A0438"
                     /note="Predicted rRNA methylase [Translation, ribosomal
                     structure and biogenesis]; Region: COG1189"
                     /db_xref="CDD:224110"
     misc_feature    436766..436987
                     /gene="tlyA"
                     /locus_tag="BSVBI22_A0438"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(436766..436768,436802..436807,436811..436816,
                     436820..436825,436832..436837,436841..436843,
                     436862..436885,436889..436891)
                     /gene="tlyA"
                     /locus_tag="BSVBI22_A0438"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    437000..437344
                     /gene="tlyA"
                     /locus_tag="BSVBI22_A0438"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(437012..437032,437081..437086,437153..437161,
                     437210..437212)
                     /gene="tlyA"
                     /locus_tag="BSVBI22_A0438"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            437494..438741
                     /locus_tag="BSVBI22_A0439"
                     /db_xref="GeneID:11727914"
     CDS             437494..438741
                     /locus_tag="BSVBI22_A0439"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="YP_005154134.1"
                     /db_xref="GI:376280128"
                     /db_xref="GeneID:11727914"
                     /translation="MTSSKTGQITIRSIGAGGDGVANLPDGQIYVPFTLPGEVVNVAR
                     DKNRATLMALLEASPERQNPACRHFEDCGGCALQHWQDEPYRLWKRELVVGALKGRGI
                     DVEVAPLVACNPHTRRRAVFAARKTEKGVLLGFNRHQSHEIIDIVECPVTVPEIIARL
                     DDLREVGALLAPGSGPFKLAATLTESGLDLAASGCGKLNDEQRRALTALVIKKDFARL
                     SHEGEIIVEPKKPLIHFGKVPVPVPPGCFLQATAEAEETMAALVLAHLGKARRVADLF
                     CGVGTFALRIAEKSAVHAVENDAAALAALDRGVRHVQGLKPVSIERRDLFRRPLMPKE
                     LLPYNAVVFDPPRAGAEEQALELAKSKVEKVVAISCNPVTLARDLAILQKGGYRIERV
                     TPIDQFLWSAHVEAVAVLTKGRQ"
     misc_feature    437506..438711
                     /locus_tag="BSVBI22_A0439"
                     /note="SAM-dependent methyltransferases related to tRNA
                     (uracil-5-)-methyltransferase [Translation, ribosomal
                     structure and biogenesis]; Region: TrmA; COG2265"
                     /db_xref="CDD:225174"
     misc_feature    <438139..438729
                     /locus_tag="BSVBI22_A0439"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            complement(438861..439463)
                     /locus_tag="BSVBI22_A0440"
                     /db_xref="GeneID:11727915"
     CDS             complement(438861..439463)
                     /locus_tag="BSVBI22_A0440"
                     /note="identified by similarity to GP:15074050; match to
                     protein family HMM PF03641; match to protein family HMM
                     TIGR00730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154135.1"
                     /db_xref="GI:376280129"
                     /db_xref="GeneID:11727915"
                     /translation="MSEIRSICVYCGSSTGQNSLYREAGLALGRSIAEHGIRLVYGGG
                     TRGIMGAVAQGVMEAGGEVTGIIPTFLLDKEASLERAKELSELIIVDDMHERKHLMFQ
                     RSDAFVTLPGGIGTVEEIVEMMTWAQLGKHRKPMVFANINNFWQPMLALLDHMRAEGF
                     IHTAHQVQPLIVDKAEDIVPAIIAANGRRKAGDLEIIGKM"
     misc_feature    complement(438909..439454)
                     /locus_tag="BSVBI22_A0440"
                     /note="Predicted Rossmann fold nucleotide-binding protein
                     [General function prediction only]; Region: COG1611"
                     /db_xref="CDD:224527"
     gene            439593..439958
                     /locus_tag="BSVBI22_A0441"
                     /db_xref="GeneID:11727916"
     CDS             439593..439958
                     /locus_tag="BSVBI22_A0441"
                     /note="identified by similarity to GP:15157092"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154136.1"
                     /db_xref="GI:376280130"
                     /db_xref="GeneID:11727916"
                     /translation="MKMWTLAKMSVAAAALSFAASAASASEITIKLPDSVKVSTNSIL
                     YKCGAKDLSVTYYNAGDISLAKLELEDETVVASNVISGSGAKYAGSVYIWWTKGKTAS
                     LYNLIDNPEEDKPISCVEQ"
     misc_feature    439671..439955
                     /locus_tag="BSVBI22_A0441"
                     /note="Predicted periplasmic protein [General function
                     prediction only]; Region: COG3895"
                     /db_xref="CDD:226411"
     gene            440145..441359
                     /locus_tag="BSVBI22_A0442"
                     /db_xref="GeneID:11727917"
     CDS             440145..441359
                     /locus_tag="BSVBI22_A0442"
                     /note="identified by match to protein family HMM PF01476"
                     /codon_start=1
                     /transl_table=11
                     /product="LysM domain-containing protein"
                     /protein_id="YP_005154137.1"
                     /db_xref="GI:376280131"
                     /db_xref="GeneID:11727917"
                     /translation="MQKYWSWLLGVGLVVIAGGLAFYWNSLTRTADAPKVDNASIASP
                     VTPGPAKEKPAQAQQTPATAMPATAKAVDVPVFDVLRVEADGSVVIAGQAAPNSAVDV
                     VAGAEVVGQARAGANGDFAVVLDRALSPGDHQLVLRATSSDKHVATSAQTAIVSVPAT
                     ADGPVLALVEEPEQASRLITKPKTAPEGSAAGAPSGGEMQAGAAGETEQAKPDADRPI
                     AIEAVEIEGSSVFVAGKAKDGARVIVHANDVLLGTSAISPEGRFLVQGERPLAIGDYI
                     IRADLLDGTNRILATARVPFRREAGENILAVAPAANQQAGSANTQADGAQDTAALQKV
                     DGSVIIRRGDNLWTISKRTYGEGTRYTTIYLANRDQIRNPDLIWPGQVFVMPKEPLRD
                     NEVKRKLLEKNP"
     misc_feature    440643..441323
                     /locus_tag="BSVBI22_A0442"
                     /note="Uncharacterized protein containing LysM domain
                     [Function unknown]; Region: XkdP; COG1652"
                     /db_xref="CDD:224566"
     misc_feature    441153..441290
                     /locus_tag="BSVBI22_A0442"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     gene            441562..443448
                     /locus_tag="BSVBI22_A0443"
                     /db_xref="GeneID:11727918"
     CDS             441562..443448
                     /locus_tag="BSVBI22_A0443"
                     /note="identified by match to protein family HMM PF00005;
                     match to protein family HMM PF00664"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein/permease"
                     /protein_id="YP_005154138.1"
                     /db_xref="GI:376280132"
                     /db_xref="GeneID:11727918"
                     /translation="MNAPKTVSAESGETLKTLRNLWPYMWPSDRPDLRMRVVWATFYL
                     VLSKIVLILVPYFFKWVTNALNGQLHAPDYIPVVLVGAVMLVLAYNAAKIVQAGLNQL
                     RDALFASVGQYAVRQLAYKTFVHMHELSLRFHLERRTGGLSRVIERGTKGIETIVRFT
                     ILNTLPTILEFALTAVIFAFAYGLSYLVVVAATVWLYTWFTIRASDWRINIRREMNDS
                     DTDANTKAIDSLLNFETVKYFGNEAMEAKRFDGAMARYEKAATQTWTSLGWLNFGQAV
                     IFGAGMAIVMVMSAMEVQKGTQSLGDFVFINALLMQLSIPLNFIGFIYREIRQGLTDI
                     EQMFDLLDVKQEVKDKPGAPALKVDSGAISFKDVHFAYDPQRPILRGISFDVPAGKTV
                     AIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESLRKFIGMVPQDTVLFN
                     DTIAYNIRYGRTDASEEDVEKAAELAQIAGFIKHLPDGYKSMVGERGLKLSGGEKQRV
                     AIARTILKAPPILILDEATSALDTATEQEIQSALDIVSRGRTTLVIAHRLSTVIGADE
                     IIVLKDGLIAERGTHRHLLDQKGLYASMWDRQREASEAEERLRQVRESDDMGVVLRGT
                     PAAE"
     misc_feature    441679..442512
                     /locus_tag="BSVBI22_A0443"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    441865..443352
                     /locus_tag="BSVBI22_A0443"
                     /note="ABC-type transport system involved in Fe-S cluster
                     assembly, permease and ATPase components
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: ATM1; COG5265"
                     /db_xref="CDD:227590"
     misc_feature    442648..443355
                     /locus_tag="BSVBI22_A0443"
                     /note="ATP-binding cassette domain of iron-sulfur clusters
                     transporter, subfamily C; Region: ABCC_ATM1_transporter;
                     cd03253"
                     /db_xref="CDD:213220"
     misc_feature    442747..442770
                     /locus_tag="BSVBI22_A0443"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213220"
     misc_feature    order(442756..442761,442765..442773,442891..442893,
                     443131..443136,443227..443229)
                     /locus_tag="BSVBI22_A0443"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213220"
     misc_feature    442882..442893
                     /locus_tag="BSVBI22_A0443"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213220"
     misc_feature    443059..443088
                     /locus_tag="BSVBI22_A0443"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213220"
     misc_feature    443119..443136
                     /locus_tag="BSVBI22_A0443"
                     /note="Walker B; other site"
                     /db_xref="CDD:213220"
     misc_feature    443143..443154
                     /locus_tag="BSVBI22_A0443"
                     /note="D-loop; other site"
                     /db_xref="CDD:213220"
     misc_feature    443215..443235
                     /locus_tag="BSVBI22_A0443"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213220"
     gene            443553..444251
                     /locus_tag="BSVBI22_A0444"
                     /db_xref="GeneID:11727919"
     CDS             443553..444251
                     /locus_tag="BSVBI22_A0444"
                     /note="catalyzes the decarboxylaton of
                     phospatidyl-L-sering to phosphatidylethanolamine"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="YP_005154139.1"
                     /db_xref="GI:376280133"
                     /db_xref="GeneID:11727919"
                     /translation="MSLTDTIRNTFVPIHREGYPFIAGFFVVSLILGWLWDPLFWIGM
                     VLTVWCIYFYRDPERVTPMDDDLVISPADGKVSFVGLAVPPAELDLGYEPMTRVSVFM
                     NVFSVHINRSPVRGKIDKVVHRPGKFLNAELDKASTENERNSVLIESPHGKVGVVQIA
                     GLVARRIVCWSNQDDELSVGERFGLIRFGSRVDVYLPSDATVRVAVGQTAIAGETVLA
                     DYGTERGEPVVRIA"
     misc_feature    443589..444215
                     /locus_tag="BSVBI22_A0444"
                     /note="phosphatidylserine decarboxylase; Provisional;
                     Region: PRK05305"
                     /db_xref="CDD:235400"
     gene            444256..445092
                     /gene="pssA"
                     /locus_tag="BSVBI22_A0445"
                     /db_xref="GeneID:11727920"
     CDS             444256..445092
                     /gene="pssA"
                     /locus_tag="BSVBI22_A0445"
                     /note="identified by match to protein family HMM PF01066;
                     match to protein family HMM TIGR00473"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="YP_005154140.1"
                     /db_xref="GI:376280134"
                     /db_xref="GeneID:11727920"
                     /translation="METPFPPFEPNGRVDASRGPKLSQIPLRIVVPNVITVLAICAGL
                     TGIRLAFENRFELAVAMVLLAAFLDGIDGRIARMIKGSSKFGAQMDSLADIVNFGVAP
                     ALVLYAFMLDQARSFGWIAALLYAIACCLRLARFNVMLEDPNRPAWQNNYFIGVPAPA
                     GAMLVLLPVYLGFLGLMPTRALAFGVAAYTVAIAFLLVSRLPVYNGKSAGSLVRRDIV
                     MPLILCVVIYVALLMSFTWQTLSLTALAYLAFLPFSLAAWNKREAADRKKAAEEASSG
                     DN"
     misc_feature    444328..445041
                     /gene="pssA"
                     /locus_tag="BSVBI22_A0445"
                     /note="Phosphatidylserine synthase [Lipid metabolism];
                     Region: PssA; COG1183"
                     /db_xref="CDD:224104"
     misc_feature    444361..444861
                     /gene="pssA"
                     /locus_tag="BSVBI22_A0445"
                     /note="CDP-alcohol phosphatidyltransferase; Region:
                     CDP-OH_P_transf; cl00453"
                     /db_xref="CDD:260431"
     gene            complement(445177..445917)
                     /locus_tag="BSVBI22_A0446"
                     /db_xref="GeneID:11727921"
     CDS             complement(445177..445917)
                     /locus_tag="BSVBI22_A0446"
                     /note="identified by match to protein family HMM PF00106"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /protein_id="YP_005154141.1"
                     /db_xref="GI:376280135"
                     /db_xref="GeneID:11727921"
                     /translation="MNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGL
                     EELDDEIRKLGSSATLVPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIG
                     HVEAKTFEKVMNINVTSVWRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAAS
                     KAAVEVMARCWAEETKKMKLKINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIV
                     KLADPKLEVTGKLFDVRQDRFLDYHMPS"
     misc_feature    complement(445216..445911)
                     /locus_tag="BSVBI22_A0446"
                     /note="Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases) [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: FabG; COG1028"
                     /db_xref="CDD:223959"
     misc_feature    complement(445216..445890)
                     /locus_tag="BSVBI22_A0446"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(445339..445344,445348..445359,
                     445435..445437,445447..445449,445486..445494,
                     445573..445575,445639..445647,445723..445731,
                     445798..445806,445861..445872,445876..445878))
                     /locus_tag="BSVBI22_A0446"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(445435..445437,445447..445449,
                     445486..445488,445570..445572))
                     /locus_tag="BSVBI22_A0446"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(445986..447443)
                     /gene="purF"
                     /locus_tag="BSVBI22_A0447"
                     /db_xref="GeneID:11727922"
     CDS             complement(445986..447443)
                     /gene="purF"
                     /locus_tag="BSVBI22_A0447"
                     /note="Catalyzes first step of the de novo purine
                     nucleotide biosynthetic pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="YP_005154142.1"
                     /db_xref="GI:376280136"
                     /db_xref="GeneID:11727922"
                     /translation="MLDDDTLHEECGVFGILGHEDAAALTALGLHALQHRGQEAAGIV
                     SYHNRRFHSERHMGLVGDHFTDAATLNRLPGNRAIGHVRYSTTGETILRNVQPLFAEL
                     EVGGIAIAHNGNFTNGITLRKQLIASGAIFQATSDTEVVLHMIARSRHSSSTDRFVEA
                     IRQVEGGYAMLALTRTKLIAARDPIGIRPLVMGELDGKPIFCSETCALDIIGAKYIRD
                     VENGEVVVCEIQKDGSITTRSIKPENPQPERLCLFEYVYFARPDSVVGGRSVYVARKN
                     MGMNLAAEAGVDADVVVPVPDGGTPAALGFAQASGIPFEYGIIRNHYVGRTFIEPTQQ
                     IRALGVKLKHSANRAMIEGKRVVLVDDSIVRGTTSVKIVQMIRDAGATEVHMRVASPM
                     IFHPDFYGIDTPHADKLLANQHESLESMCRYIGADSLAFLSIDGLYKAVGGKPRDPKA
                     PTFTDHYFTGEYPTRLLDQEGESNVHTLSLLASNG"
     misc_feature    complement(446025..447440)
                     /gene="purF"
                     /locus_tag="BSVBI22_A0447"
                     /note="amidophosphoribosyltransferase; Provisional;
                     Region: PRK09123"
                     /db_xref="CDD:236384"
     misc_feature    complement(446649..447413)
                     /gene="purF"
                     /locus_tag="BSVBI22_A0447"
                     /note="Glutamine amidotransferases class-II (GN-AT)_GPAT-
                     type. This domain is found at the N-terminus of  glutamine
                     phosphoribosylpyrophosphate (Prpp) amidotransferase
                     (GPATase) . The glutaminase domain catalyzes amide
                     nitrogen transfer from glutamine to the...; Region:
                     GPATase_N; cd00715"
                     /db_xref="CDD:238367"
     misc_feature    complement(order(447033..447035,447105..447110,
                     447195..447197,447333..447338,447411..447413))
                     /gene="purF"
                     /locus_tag="BSVBI22_A0447"
                     /note="active site"
                     /db_xref="CDD:238367"
     misc_feature    complement(order(447003..447008,447015..447020,
                     447027..447029,447144..447146,447330..447332,
                     447351..447353,447360..447365))
                     /gene="purF"
                     /locus_tag="BSVBI22_A0447"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238367"
     misc_feature    complement(446232..446552)
                     /gene="purF"
                     /locus_tag="BSVBI22_A0447"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(446265..446267,446340..446354,
                     446358..446366,446550..446552))
                     /gene="purF"
                     /locus_tag="BSVBI22_A0447"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            447420..447662
                     /locus_tag="BSVBI22_A0448"
                     /db_xref="GeneID:11727923"
     CDS             447420..447662
                     /locus_tag="BSVBI22_A0448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005154143.1"
                     /db_xref="GI:376280137"
                     /db_xref="GeneID:11727923"
                     /translation="MQGVIIQHKGGIFRRMAGHCRKAFRLQRQLKHIAEKRRPVFRST
                     TCIKTSSASLSQDGFLLKAKSSPLRRYNLIDGSIAC"
     gene            complement(447758..448336)
                     /locus_tag="BSVBI22_A0449"
                     /db_xref="GeneID:11727924"
     CDS             complement(447758..448336)
                     /locus_tag="BSVBI22_A0449"
                     /note="identified by similarity to OMNI:NTL02ML6179; match
                     to protein family HMM PF02674"
                     /codon_start=1
                     /transl_table=11
                     /product="colicin V production protein"
                     /protein_id="YP_005154144.1"
                     /db_xref="GI:376280138"
                     /db_xref="GeneID:11727924"
                     /translation="MPITMLDGILLGITLVSAVLAMVRGFSREVLSLVSWAAAAAAAV
                     LLYKPVLPYVKPYISNDTIAMIAAMAAVFLVVLIVVSLITMKIADFIIDSRIGALDRT
                     LGFLFGAARGVLLVVVAMLFFNWLVPTNQPDWVTNAKSKPMLDSFGQQLIELLPADPD
                     KSLIEKLKPKVDAPAAGEPEEAPVPDDTPAQE"
     misc_feature    complement(447827..448330)
                     /locus_tag="BSVBI22_A0449"
                     /note="Uncharacterized membrane protein, required for
                     colicin V production [General function prediction only];
                     Region: CvpA; COG1286"
                     /db_xref="CDD:224205"
     gene            complement(448462..449865)
                     /gene="radA"
                     /locus_tag="BSVBI22_A0450"
                     /db_xref="GeneID:11727925"
     CDS             complement(448462..449865)
                     /gene="radA"
                     /locus_tag="BSVBI22_A0450"
                     /note="Sms; stabilizes the strand-invasion intermediate
                     during the DNA repair; involved in recombination of donor
                     DNA and plays an important role in DNA damage repair after
                     exposure to mutagenic agents"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="YP_005154145.1"
                     /db_xref="GI:376280139"
                     /db_xref="GeneID:11727925"
                     /translation="MAKTRVQFICQNCGAVHSRWAGKCDSCGEWNTLIEEGTNSGIGS
                     GPGAMLSKRKGRTVALTSLSGEIEDAPRIISGISELDRVTGGGFVRGSALLIGGDPGI
                     GKSTLLTQAAAALSNRGHRIVYVSGEEAVAQIRLRAQRLGVAASAVELAAETNVEDII
                     ATISSDNSGSKRPDLVIIDSIQTLWTDMADSAPGTVTQVRSSAQAMIRYAKQTGAAVV
                     LVGHVTKDGQIAGPRVVEHMVDGVLYFEGEGGHHYRILRTVKNRFGPTDEIGVFEMSD
                     GGLREVSNPSELFLGERNEKSPGAAVFAGMEGTRPVLVEIQALVAPSSLGTPRRAVVG
                     WDGGRLAMILAVLESHCGVRFGQHDVYLNVAGGYRISEPAADIAVAAALVSSMAGIAL
                     PPDCVYFGEISLSGAVRAVSHAVQRLKEAEKLGFRQAEVPNGSGELWKDRNFRLMETA
                     ALADLVARIAASGAGKK"
     misc_feature    complement(448480..449865)
                     /gene="radA"
                     /locus_tag="BSVBI22_A0450"
                     /note="DNA repair protein RadA; Provisional; Region:
                     PRK11823"
                     /db_xref="CDD:236994"
     misc_feature    complement(448708..449844)
                     /gene="radA"
                     /locus_tag="BSVBI22_A0450"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(449551..449559,449569..449574))
                     /gene="radA"
                     /locus_tag="BSVBI22_A0450"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(449326..449331,449485..449490,
                     449494..449496,449551..449559,449569..449571))
                     /gene="radA"
                     /locus_tag="BSVBI22_A0450"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(449329..449343)
                     /gene="radA"
                     /locus_tag="BSVBI22_A0450"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(448570..>448719)
                     /gene="radA"
                     /locus_tag="BSVBI22_A0450"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     gene            complement(449893..451398)
                     /gene="dnaB"
                     /locus_tag="BSVBI22_A0451"
                     /db_xref="GeneID:11727926"
     CDS             complement(449893..451398)
                     /gene="dnaB"
                     /locus_tag="BSVBI22_A0451"
                     /note="unwinds dou