GenomeNet

Database: RefSeq
Entry: NC_016818
LinkDB: NC_016818
Original site: NC_016818 
LOCUS       NC_016818            4861101 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Rahnella aquatilis CIP 78.65 = ATCC 33071, complete genome.
ACCESSION   NC_016818
VERSION     NC_016818.1  GI:383187966
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02261385
            Assembly: GCF_000241955.1
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Rahnella aquatilis CIP 78.65 = ATCC 33071
  ORGANISM  Rahnella aquatilis CIP 78.65 = ATCC 33071
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Rahnella.
REFERENCE   1  (bases 1 to 4861101)
  AUTHORS   Martinez,R.J., Bruce,D., Detter,C., Goodwin,L.A., Han,J., Han,C.S.,
            Held,B., Land,M.L., Mikhailova,N., Nolan,M., Pennacchio,L.,
            Pitluck,S., Tapia,R., Woyke,T. and Sobecky,P.A.
  TITLE     Complete genome sequence of Rahnella aquatilis CIP 78.65
  JOURNAL   J. Bacteriol. 194 (11), 3020-3021 (2012)
   PUBMED   22582378
REFERENCE   2  (bases 1 to 4861101)
  AUTHORS   Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
            Peters,L., Ovchinnikova,G., Held,B., Detter,J.C., Han,C., Tapia,R.,
            Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Sobecky,P.,
            Martinez,R. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4089211
            Source DNA and organism available from Robert Martinez
            (rmartinez@bama.ua.edu)
            Contacts: Robert Martinez (rmartinez@bama.ua.edu)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Rahnella aquatilis CIP 78.65
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Host
            num_replicons       :: 4
            ref_biomaterial     :: Missing
            biotic_relationship :: Missing
            trophic_level       :: Missing
            rel_to_oxygen       :: Facultative
            isol_growth_condt   :: Missing
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi06369
            Type Strain         :: Yes
            Funding Program     :: DOE-CSP 2010
            Gene Calling Method :: Prodigal 1.4, GenePRIMP
            Isolation Site      :: drinking water
            Host Name           :: Water, humans
            Cell Shape          :: Rod-shaped
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram-
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/07/2014 02:16:28
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,923
            CDS                          :: 4,796
            Pseudo Genes                 :: 26
            CRISPR Arrays                :: 2
            rRNAs                        :: 22 ( 5S, 16S, 23S )
            tRNAs                        :: 76
            ncRNA                        :: 3
            Frameshifted Genes           :: 17
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4861101
                     /organism="Rahnella aquatilis CIP 78.65 = ATCC 33071"
                     /mol_type="genomic DNA"
                     /strain="CIP 78.65"
                     /isolation_source="drinking water"
                     /culture_collection="ATCC:33071"
                     /db_xref="taxon:745277"
     gene            489..1880
                     /gene="dnaA"
                     /locus_tag="RAHAQ2_RS00010"
                     /old_locus_tag="Rahaq2_0002"
     CDS             489..1880
                     /gene="dnaA"
                     /locus_tag="RAHAQ2_RS00010"
                     /old_locus_tag="Rahaq2_0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011055851.1"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_014333276.1"
                     /db_xref="GI:504099282"
                     /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELNDNTLALYAPN
                     RFVLDWVRDKYLNNINGLLNDFCGTDAPLLRFEVGSKPVIQRVSQPVAASVSSQAAPA
                     IPRLAPSRPSWDSSPAQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGA
                     YNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNAIEEF
                     KRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVED
                     RLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEG
                     ALNRVIANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLS
                     KRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDI
                     KEDFSNLIRTLSS"
     gene            1885..2985
                     /locus_tag="RAHAQ2_RS00015"
                     /old_locus_tag="Rahaq2_0003"
     CDS             1885..2985
                     /locus_tag="RAHAQ2_RS00015"
                     /old_locus_tag="Rahaq2_0003"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976672.1"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_013573353.1"
                     /db_xref="GI:503338692"
                     /translation="MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTDGALSL
                     TGTDLEMEMVAKVALSQPHEAGATTVPARKFFDICRGLPEGAEISVALDGDRMLVKSG
                     RSRFSLSTLPATDFPNLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLF
                     ETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVMELVRLLDGGDTTLQLQI
                     GSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLQAGCDLLKQAFARAAILSNE
                     KFRGVRLYVSHNQLKITANNPEQEEAEEILDVGYEGTEMEIGFNVSYVLDVLNALKCE
                     DVNLLLTDSVSSVQIEDAASQSAAYVVMPMRL"
     gene            2995..4083
                     /gene="recF"
                     /locus_tag="RAHAQ2_RS00020"
                     /old_locus_tag="Rahaq2_0004"
     CDS             2995..4083
                     /gene="recF"
                     /locus_tag="RAHAQ2_RS00020"
                     /old_locus_tag="Rahaq2_0004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573354.1"
                     /note="Required for DNA replication; binds preferentially
                     to single-stranded, linear DNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase F"
                     /protein_id="WP_014333277.1"
                     /db_xref="GI:504099283"
                     /translation="MALTRLLIKDFRNIEAADLDPSPGFNFLVGPNGSGKTSVLEAVY
                     TLGHGRAFRSLQAGRVIRHDQPEFVLHARVDDGGDRELSIGLSKSRQGDSKVRIDGSD
                     GHKVSELAQMLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHHDPGFFIAWSNLRRLLK
                     QRNAALRQVGRYAQIRAWDQELIPLAERISEWRAAYSEAIAADISATCAQFLPEFALS
                     FSFQRGWDKETEYGELLERNFERDRALTYTASGPHKADFRIRADGTPVEDLLSRGQLK
                     LLMCALRLAQGEFLTRQSGRRCLYLLDDFASELDADRRRLLADRLKATQAQVFVSAIS
                     AEQVTDMMGEKGKMFRVEQGKIAVLSQD"
     gene            4103..6517
                     /gene="gyrB"
                     /locus_tag="RAHAQ2_RS00025"
                     /old_locus_tag="Rahaq2_0005"
     CDS             4103..6517
                     /gene="gyrB"
                     /locus_tag="RAHAQ2_RS00025"
                     /old_locus_tag="Rahaq2_0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005121480.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_014333278.1"
                     /db_xref="GI:504099284"
                     /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
                     DNAIDEALAGHCKEIQVTIHADNSVSVQDDGRGIPTGIHEEEGVSAAQVIMTVLHAGG
                     KFDDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKVHTQTYVHGEPQDPLKVIGDT
                     DATGTTVRFWPSFNTFTNHTEFEYDILAKRLRELSFLNSGVAIRLLDKRDGKNDHFHY
                     EGGIKAFVEYLNKNKTPIHPTVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQR
                     DGGTHLAGFRSAMTRTLNAYMDKEGYSKKSKISATGDDAREGLIAVVSVKVPDPKFSS
                     QTKDKLVSSEVKTAVETLMNEKLVDYLMENPSDAKIVVGKIIDAARAREAARKAREMT
                     RRKGALDLAGLPGKLADCQERDPAHSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKI
                     LNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRT
                     LLLTFFYRQMPEIVERGHVFIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIAMDGATL
                     HANAHAPALAGEPLEKLVAEHHSVQKMIGRMERRYPRALLNNLIYQPTLPGSDLTDQA
                     KVQAWMESLVARLNEKEQHGSSYSAIVRENREHQLFEPVLRIRTHGVDTDYDLDADFV
                     QGGEYRKICALGEQLRGLIEEDAFIERGERRQPVTSFEQALEWLVKESRRGLSIQRYK
                     GLGEMNPDQLWETTMDPEQRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALK
                     AANIDI"
     gene            6674..7489
                     /locus_tag="RAHAQ2_RS00030"
                     /old_locus_tag="Rahaq2_0006"
     CDS             6674..7489
                     /locus_tag="RAHAQ2_RS00030"
                     /old_locus_tag="Rahaq2_0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573356.1"
                     /note="YidA; catalyzes the dephosphorylation of erythrose
                     4-phosphate (preferred substrate), mannose 1-phosphate and
                     p-nitrophenyl phosphate; hydrolyzes the
                     alpha-D-glucose-1-phosphate but not the beta form; member
                     of the haloacid dehalogenase-like hydrolases superfamily
                     and Cof family of proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate phosphatase"
                     /protein_id="WP_014333279.1"
                     /db_xref="GI:504099285"
                     /translation="MAIELIAIDMDGTLLNPQHEVTPAVKKALSEARAKGVQIVLATG
                     RPFIGVQRYLMELDLQQEGCYCITNNGALVHNAKDGSVIAEIALTIEDYHYFEELARQ
                     LGVHFHALTKTDLFTANRHISKYSVHESFTTGIPLQFCPAEEMDPALTFPKVMMIDDP
                     QLLDRAISQIPAEARERYTIMKSSPYFLEILDKRVNKGEGVKALAEKLGIARESVMTL
                     GDQENDIAMLEYAGIGVAMGNALDSVKAVSQFVTKTNMEDGVAFAIEKFVLNV"
     gene            7515..8777
                     /locus_tag="RAHAQ2_RS00035"
                     /old_locus_tag="Rahaq2_0007"
     CDS             7515..8777
                     /locus_tag="RAHAQ2_RS00035"
                     /old_locus_tag="Rahaq2_0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter Tol"
                     /protein_id="WP_014333280.1"
                     /db_xref="GI:504099286"
                     /translation="MEKQLTADARGHQLTNINVWTPDSQWLVYDVRPHGGSFTGSTIE
                     RVNVETGEVQVLYQAPDGAHVGVVTVSPDLPARYAFIHGPENPDESWQYDFHHRRGVI
                     VSEPAREKAVTLDAMDITAPFTAGALRGGTHVHVFSPDGSRLSFTYNDHVLHQHDPAL
                     DLRNVGVALSGYPVVSPKHHPREYDGSHFSILVSETTPYPHPGSDEINRAYEEGWVGR
                     EGYLKPDGRRQRWALAFIGDTLSVRGEKHPEIFVVDLPHNDKDYRQAGDNPLQGTPEL
                     LPAPPAGVKQRRITFTENGIALQPRHWLRASPDGAQIAFLMKDRSGVVQVWTVSPNGG
                     EPVQISHSGQGIQSAFSWSPDGKSLALVCDNSVMRLDWESGKMQRLTQRSEIAPCADA
                     VVYSPDGSKVAFMRQCEGYSQICVADSH"
     gene            complement(8819..9196)
                     /locus_tag="RAHAQ2_RS00040"
                     /old_locus_tag="Rahaq2_0008"
     CDS             complement(8819..9196)
                     /locus_tag="RAHAQ2_RS00040"
                     /old_locus_tag="Rahaq2_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333281.1"
                     /db_xref="GI:504099287"
                     /translation="MMKFALTPLMTGCVFLATSGCSSVMSHTGGDTGYYSGARADVNM
                     MKSDDTSWAMTPLLLIDLPFSALLDTVLLPYDYFRSGKVTTRDRVKASEEHNIAMSNG
                     VDIDHIPPMTTTPRQQKSPTHKK"
     gene            9577..9987
                     /locus_tag="RAHAQ2_RS00045"
                     /old_locus_tag="Rahaq2_0009"
     CDS             9577..9987
                     /locus_tag="RAHAQ2_RS00045"
                     /old_locus_tag="Rahaq2_0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573359.1"
                     /note="with IbpB associates with aggregated proteins to
                     stabilize and protect them from irreversible denaturation
                     and extensive proteolysis during heat shock and oxidative
                     stress; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein IbpA"
                     /protein_id="WP_014333282.1"
                     /db_xref="GI:504099288"
                     /translation="MRNFDLSPLYRSAIGFDRLFNLIESGQNQGGGYPPYNVELVDEN
                     HYRIAIAVAGFAESELDITAHDNMLLVKGAHAPADTGRTYLYQGIAERNFERKFQLAE
                     HIQIKAANLSNGLLYIDLERVVPESSKPRRIEIR"
     gene            10144..10578
                     /locus_tag="RAHAQ2_RS00050"
                     /old_locus_tag="Rahaq2_0011"
     CDS             10144..10578
                     /locus_tag="RAHAQ2_RS00050"
                     /old_locus_tag="Rahaq2_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333284.1"
                     /note="16 kDa heat shock protein B; associates with
                     aggregated proteins, together with ibpA, to stabilize and
                     protect them from irreversible denaturation and extensive
                     proteolysis during heat shock and oxidative stress;
                     ATP-independent; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-shock protein"
                     /protein_id="WP_014333284.1"
                     /db_xref="GI:504099290"
                     /translation="MRNYDISPLLRQWIGFDKLASSMQGADQVFPPYNIEKSDDNHYR
                     ISLALAGFQQSELNIEVEGPRLTVSGTPAQPENQVEYLHQGLVIKPFTLSFTLAEHMR
                     VSAAEFTHGLLHINLVREVPEALQPQKIAIGTEKPALENQSE"
     gene            complement(10656..11909)
                     /gene="avtA"
                     /locus_tag="RAHAQ2_RS00055"
                     /old_locus_tag="Rahaq2_0012"
     CDS             complement(10656..11909)
                     /gene="avtA"
                     /locus_tag="RAHAQ2_RS00055"
                     /old_locus_tag="Rahaq2_0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333285.1"
                     /note="transaminase C; catalyzes transamination of
                     alanine, valine, and 2-aminobutyrate with their respective
                     2-keto acids; also catalyzes terminal step in valine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valine--pyruvate aminotransferase"
                     /protein_id="WP_014333285.1"
                     /db_xref="GI:504099291"
                     /translation="MTFSAFGDKFTRFSGITRLMGDMNDGLRTPGAVMLGGGNPAQIP
                     EMQDYFQTLLTEMLAAGMLTEALCNYDGPQGKDVLRHALAEMLQKELGWQLDAQNIAL
                     TNGSQSAFFYLFNLFAGRRADGSMSKVLFPLAPEYLGYADAGLDENLFVSAKPNIELL
                     PEGQFKYHVDFDHLNITDDIGLICVSRPTNPTGNVITDEELIRLDALAQQKDIPLLID
                     NAYGVPFPGIVFTDATPLWNPNIILCMSLSKLGLPGSRCGIVIADEKIIKAISNMNGI
                     ISLSPGSVGPAIAHEMIVRGDLLRLSEDVIKPFYFQRVQETIATLRRYLPEERCLIHK
                     PEGAIFLWLWFKDLPITTEVLYQRLKQRGVLMVPGDYFFPGLEHPWPHTHQCMRMNYV
                     PDAEQIERGVKILAEEVEKAHAENL"
     gene            12168..13376
                     /locus_tag="RAHAQ2_RS00060"
                     /old_locus_tag="Rahaq2_0013"
     CDS             12168..13376
                     /locus_tag="RAHAQ2_RS00060"
                     /old_locus_tag="Rahaq2_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333286.1"
                     /db_xref="GI:504099292"
                     /translation="MKKSIIIMNLVMAGGGDYALGKKIKEIARSTQAEGMLFTVDAES
                     RHSRIKTQEHFNPGKPVNYTNPIIIVTPHSIMTPHILASVLKTFLYENKINATTIILI
                     DEMDALRDNESNDLDYKAVLNHLGFKNIIIHSLGFSEKSLGYLPMPEQEVISIKKSAK
                     QDVIKLLDSYNLSLPESCALYFAYLSSDAEVTCSQVFIINTLIEEKDFQNNSAYVFVC
                     REKNAITRVLKGLNNCFSKPPYNDLFSECHFSTMKDESTIMSHGNIRGTGNKKIHICI
                     TTTLPSTTFKNLTSVSKTGMMSGDQSLSDYLSLKESLPYYDKQSWKEPLIDGLNARAR
                     ELGGEELFNKLQTMVAGRRPFTGTITFKLLTAGDVPTPTLKNSLLAFNNEIYARKADR
                     NIREMLMKYL"
     gene            complement(13439..14416)
                     /locus_tag="RAHAQ2_RS00065"
                     /old_locus_tag="Rahaq2_0014"
     CDS             complement(13439..14416)
                     /locus_tag="RAHAQ2_RS00065"
                     /old_locus_tag="Rahaq2_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573365.1"
                     /note="catalyzes the formation of glycolate from
                     glyoxylate  and glycerate from hydroxypyruvate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional glyoxylate/hydroxypyruvate
                     reductase B"
                     /protein_id="WP_014333287.1"
                     /db_xref="GI:504099293"
                     /translation="MKPSIVLYKKLPADLHQRLEEHFTITEFDGITESNRSQVFDALQ
                     NAEGLLGSGGKIDKELFDHAPRLRAVSTISVGYDNFDVKELTRRQIPMMHTPTALTDT
                     VADTVMALVLATARRVVNVAERVKAGEWNDNIGADWFGTDVHHKTMGIVGMGRIGLAL
                     AQRAHFGFDMPILYNARSQHKEAEEKFGARKCELDELLKESDFVCILLPMTEQTFHLI
                     GKNELAQMKSSAILINAGRGPVIDEPALIDALKAKTIYGAGLDVFETEPLPKDSPLLS
                     LPNVVALPHIGSATHETRYDMAACAVDNLIAALKGDVKQFCVNPEVLKK"
     gene            complement(14413..15705)
                     /locus_tag="RAHAQ2_RS00070"
                     /old_locus_tag="Rahaq2_0015"
     CDS             complement(14413..15705)
                     /locus_tag="RAHAQ2_RS00070"
                     /old_locus_tag="Rahaq2_0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014333288.1"
                     /db_xref="GI:504099294"
                     /translation="MNQSRIAARRWWYIMPIVFITYSLAYVDRSNFSFASAAGINDDL
                     GITKGMSSLLGALFFLGYFFFQIPGTIYAERRSVKKLIFWCLLLWGGFASLTGVVTNI
                     PMLAVIRFALGVVEAAVMPAMLVYISNWFTKSERSRANTFLILGNPVTVLWMSVLSGY
                     LIKSFGWREMFIFEGIPAIAWAVIWWFTVKDKPEEVSWLSDREKQALAAQLEKEQKNI
                     QAVGGYREAFRSRNVVLLCLQYFFWSIGVYGFVLWLPSILRDGKSMGMVEAGWLSSAP
                     YLAATLAMILVSWASDKMQNRKLFVWPLLLVGALAFFGSWAAGTNNFWLSYSLLVIAA
                     AAMYAPYGPFFAIIPEMLPKNVAGGAMALINSLGALGSFFGSWFVGYLNGNTGSPAAS
                     FIFMAVSLLVSAGLTLLVRPRKANIPPKEVSLTQGSKS"
     gene            complement(15749..16498)
                     /locus_tag="RAHAQ2_RS00075"
                     /old_locus_tag="Rahaq2_0016"
     CDS             complement(15749..16498)
                     /locus_tag="RAHAQ2_RS00075"
                     /old_locus_tag="Rahaq2_0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333289.1"
                     /db_xref="GI:504099295"
                     /translation="MKREIVIVTAAYGNSVVKARGGQAELLSVIADAKADGVEIRREL
                     FSAEELDSLPALAEKIKNHGLFAVYSVPFPLFSPAGKLNPDAPQYFEEARILNARTIK
                     FSLGEFVPGQDLTPLKVVLATSPVKLVVENDQSPDCGILSRINAFMFAAESLHLPLSM
                     TFDMANWLWVGQDPAVAAERLARHVGYVHVKAAQKRSGKWHAVALDDSDGSWEPLLKS
                     LPQDVPRGIEFPLEGDDLTAVTHHYVELLRQ"
     gene            complement(16712..17746)
                     /locus_tag="RAHAQ2_RS00080"
                     /old_locus_tag="Rahaq2_0017"
     CDS             complement(16712..17746)
                     /locus_tag="RAHAQ2_RS00080"
                     /old_locus_tag="Rahaq2_0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_014333290.1"
                     /db_xref="GI:504099296"
                     /translation="MSKKQEPGATVRATIRDVASAAKTGKTSVSRYLNGEQHLLSDSL
                     KERIGRAISLLDYQPSQMARSLKSGQTRLVGLILADITNPYSVEVMRGVEAACRQEGL
                     TLLVCNTNNELDQEKHYLQLLSSYRVDGIVVNAVGMREAAISTLQQANLPMVLIDRKV
                     ANFACDVIGLNNVEATQMMTGHLLKQGFEALLFISEPATINTRFDRLHAFLKCMQQYP
                     QNIAEQGEIELSNTEGLDNLLKAFVARHADKHKAVMCVNGALTLQVARAMQRLNLRWG
                     PDIGLSGFDELVWADLAGVGITTLRQPTYDMGVAALRQLVTRIQGNSDPVTDLEFSGE
                     LIARGSTAAR"
     gene            complement(17814..19100)
                     /gene="lacY"
                     /locus_tag="RAHAQ2_RS00085"
                     /old_locus_tag="Rahaq2_0018"
     CDS             complement(17814..19100)
                     /gene="lacY"
                     /locus_tag="RAHAQ2_RS00085"
                     /old_locus_tag="Rahaq2_0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333291.1"
                     /note="lactose/proton symporter; mediates lactose/proton
                     symport through the membrane by utilizing the proton
                     gradient to drive transport of galactosides; member of
                     major facilitator superfamily; functions as a monomer with
                     12 transmembrane segments; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligosaccharide:H+ symporter"
                     /protein_id="WP_014333291.1"
                     /db_xref="GI:504099297"
                     /translation="MNPTQTSDHCFYKNNTNFWIFGSYFFLYFFIMATCYPFLPIWLS
                     DVIGLSKTETGIVFSSMSLFAILFQPVFGIISDKLGLKKHLLWIIAVLLFLFAPFFIY
                     VFAPLLKLNIVLGAILGGAYIGFVFAGGSGATEAYIERVSRNSSFEYGKARMFGCFGW
                     GICASTAGVLFNINPDIVFWMGSGAAIILMILLLIARPQENKNAQVLDKLGANQPQFS
                     LKTAAMLLKERKLWMLILYVIGVACVYDVFDQQFATFFKTFFASPQQGTEMFGYVTTA
                     GELCNALIMFCSPWIINRIGAKNTLLLAGTIMSIRIVGSSFATTAIEVILLKMLHALE
                     VPFLLVGVFKYITQIFDVRFSATLYLIGFNFAKQLAAIFLSAFAGNLYDRIGFSDTYL
                     ILGGIAFGVTIISAFTLSSRPKVEVVPPVETAEGLR"
     gene            complement(19160..21286)
                     /locus_tag="RAHAQ2_RS00090"
                     /old_locus_tag="Rahaq2_0019"
     CDS             complement(19160..21286)
                     /locus_tag="RAHAQ2_RS00090"
                     /old_locus_tag="Rahaq2_0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="WP_014333292.1"
                     /db_xref="GI:504099298"
                     /translation="MENQIVHLTAAHTSLIVRCTPFAEILYWGKRLSQFSADDIISLS
                     RAVPNGRIDVEAPVNFSADTGRGSFGTPGMEGHRDGLDWSPVFNTTQVKHNGNQLTLI
                     TEDPLAGLQFRSELRLDDSGVLQARNSLTNLKPGTYQVTRLAVTLPLPERAAEVMAFH
                     GRWIKEFQPHRTQLDHGGIIQENRRGKTSSEYFPAMMIGHPGFSEEQGEIWGIHLGWS
                     GNHRLRADIKIDGRRLVQAEALYFPGEQRLKQGETLETPWLYASYSASGLNRMSQQFH
                     RFVREQILRFPDEKPRPVHLNTWEGIYFDHDPDYIMQMATESAALGVERFIIDDGWFR
                     GRDHDRAALGDWYLDEKKYPNGLKPVIDHVKKLGMEFGIWVEPEMINPDSDLYRAHPD
                     WLLALPGYQQPSGRHQYVLDLNNPQVFDYLVERMSWLLGEHDVDYVKWDMNREIVQPG
                     HDGRAALTAQTQQFYRLLDVLGERFPQIEFESCASGGGRIDFEVLKRSHRFWTSDNND
                     ALERQKIQRGMSYFFPPEVMGSHIGNKLCHATSRQHSIEFRGLTALFGHMGIELDPVK
                     EGEAERAGFAKYTRLHQQLRPLLHSGDVYRVDTHDGTMLINGVVSETRDSAVFLVSQL
                     AMPTWSLPGVLRVPGLKPDARYRVTVLDEPPLLAGGGSGHTMRVQPAWLHESPVLSGE
                     WLANAGLTLPVLDPESALLLGFEEVR"
     gene            complement(21428..22435)
                     /locus_tag="RAHAQ2_RS00095"
                     /old_locus_tag="Rahaq2_0020"
     CDS             complement(21428..22435)
                     /locus_tag="RAHAQ2_RS00095"
                     /old_locus_tag="Rahaq2_0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014333293.1"
                     /db_xref="GI:504099299"
                     /translation="MSLKAIAKDLGISVTTVSRALNGYDDVSAETKARVQAAANVRGY
                     RPNTLARRLKMGKIDAVGLIFPFSSHPLSNSAFIEMVGCITRELAKHEIDLLLVPDEL
                     GTFSWRRLIESKRVDAMLVAHTLDNDPRLLDLQQRNFPFLALGRSGCLTQDYAWFDFD
                     NRAGMQMAVDHLAALGHQRIAFLGENNQQSFIGQRYQGYLDGLRANALAVNADYIHKI
                     TPSRRAGYQATQALLALPVPPTAIVCDCNMHGEGAALALHEAGLLLSGGVSLIIFDGL
                     PCDSVPDVAVTAVRQGTREAVGLQIANMTMSLIRNEPLSNLQVLWQPELQAGVTAHSP
                     R"
     gene            complement(22540..23202)
                     /locus_tag="RAHAQ2_RS00100"
                     /old_locus_tag="Rahaq2_0021"
     CDS             complement(22540..23202)
                     /locus_tag="RAHAQ2_RS00100"
                     /old_locus_tag="Rahaq2_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein"
                     /protein_id="WP_014333294.1"
                     /db_xref="GI:504099300"
                     /translation="MSKRLLVVAGVLCVTLGLSACTTNPYTGESEAGKSGIGAGIGAA
                     LGAGVGMLSSSKHDRGKGALIGAAAGAALGGGAGYYMDVQEAKLRDKMKGTGVSVTRQ
                     GDNIVLNMPNNVTFDTNSSTLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGTRAL
                     NMKLSQQRADGVGSALITQGVEGSRVRTTGAGPDNPIASNSTEAGKAQNRRVEITLSP
                     LQ"
     gene            complement(23423..23866)
                     /locus_tag="RAHAQ2_RS00105"
                     /old_locus_tag="Rahaq2_0022"
     CDS             complement(23423..23866)
                     /locus_tag="RAHAQ2_RS00105"
                     /old_locus_tag="Rahaq2_0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_014333295.1"
                     /db_xref="GI:504099301"
                     /translation="MIRAARPADTEAILMLWLRSSLLSHAFIAESYWIESLQMVREDF
                     LPKARTWVDCDQDDQVCGFISVLNQQFIGALFVEASHYGDGTAQRLMAAAKEEYPVLL
                     LEVYQQNDRAVSFYRKENFEITANTRHPGTDMPTYILRWHRPLSE"
     gene            complement(23863..24435)
                     /locus_tag="RAHAQ2_RS00110"
                     /old_locus_tag="Rahaq2_0023"
     CDS             complement(23863..24435)
                     /locus_tag="RAHAQ2_RS00110"
                     /old_locus_tag="Rahaq2_0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase"
                     /protein_id="WP_014333296.1"
                     /db_xref="GI:504099302"
                     /translation="MATTRCSWVSKEPIYLEYHDKEWGVPVKDGRELFEMLCLEGQQA
                     GLSWITVLRKRDGYRQNFHHFDPVRIAKMTDDDVERLVLDAGIIRHRGKIKAIISNAQ
                     AYLAMQAGGEDFSEFIWNFVGGQPVINNPLGPEGVPATTIVSDAMSKALKKKGFKFIG
                     STICYAFMQAAGLVNDHQSYCFCHPANQPS"
     gene            24627..26633
                     /locus_tag="RAHAQ2_RS00115"
                     /old_locus_tag="Rahaq2_0024"
     CDS             24627..26633
                     /locus_tag="RAHAQ2_RS00115"
                     /old_locus_tag="Rahaq2_0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="WP_014333297.1"
                     /db_xref="GI:504099303"
                     /translation="MAGKKKSILRLSQGAFAVALCLGLQASAQAFDQLYVFGDSLSDT
                     GNIGRWTFDSSSHQLYDEILANNIGTTLTPSSKGGLNYAEGGGVAVPGLDSDYTTQAQ
                     VQSYLASTGGQADPNGLYVHWIGGNDLAAAALSLNPVTAVEIATNSATQAASQVSDLL
                     KAGAGTVVVPTVPNIGLTPVLMEGVIQVGLLPVQQQALEAAYRYLNAQNTPDADARTG
                     AIHNALAAAAAEGSNIPLVQDIIGKGLAAAYDALKEVAGGLTDTYNTTEDIALAKTGG
                     NIARVDINGLFGEVVADPALYGFANTAGTACPVGTSASECTSGLPGFDSSKAFLFSDH
                     FHPTPQAHALIAQYMQSVLDGPLEASALSQGSLSLARNTQGLLDSRYQQLRTQDNDAG
                     TFGMFGGYAGQSADSKFSPSLGLGDGDLTSNSLNIGMDYQMTDRWMMGLMLSGSDDKD
                     DPTDHYSYRTRGWMATAFTGIKIAENGWINGDVHYGSLNYDDIKRRITLGPTTRTERG
                     ETDGKQIGGRVTAGWDFPVLPVLKTGPVAQYSWDYSSVDGYSEKGNNSTSMRFGDQTS
                     HSQIGALGWRVNAELGIVNPYAQVTYDRQFGDKTYSTTGAIKSTRTRFSRTTGEQDDD
                     WVDMTAGLNVQITHSISAFAAISQTTGLDSGEQTSYNAGLSARF"
     gene            26800..27714
                     /locus_tag="RAHAQ2_RS00120"
                     /old_locus_tag="Rahaq2_0025"
     CDS             26800..27714
                     /locus_tag="RAHAQ2_RS00120"
                     /old_locus_tag="Rahaq2_0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009638840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit alpha"
                     /protein_id="WP_014333298.1"
                     /db_xref="GI:504099304"
                     /translation="MQKFDTKTFQGLILTLQDYWAQQGCTIVQPLDMEVGAGTSHPMT
                     SLRALGPEPFAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVMIKPSPENIQELYLGSL
                     KELGLDPLIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVT
                     GEITYGLERLAMYIQGVDSVYDLVWSNGPLGKTTYGDVFHQNEVEQSTYNFEYADVDF
                     LFTCFEQHEKEAQTLLALEKPLALPAYERILKAAHCFNLLDARKAISVTERQRYILRI
                     RTLTKAVAEAYYASREVLGFPMCKKNEK"
     gene            27724..29793
                     /gene="glyS"
                     /locus_tag="RAHAQ2_RS00125"
                     /old_locus_tag="Rahaq2_0026"
     CDS             27724..29793
                     /gene="glyS"
                     /locus_tag="RAHAQ2_RS00125"
                     /old_locus_tag="Rahaq2_0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573379.1"
                     /note="glycine--tRNA ligase beta chain; glyS; class II
                     aminoacyl tRNA synthetase; tetramer of alpha(2)beta(2);
                     catalyzes a two-step reaction; first charging a glycine
                     molecule by linking the carboxyl group to the
                     alpha-phosphate of ATP; second by transfer of the
                     aminoacyl-adenylate to its tRNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase"
                     /protein_id="WP_014333299.1"
                     /db_xref="GI:504099305"
                     /translation="MTEKTFLVEIGTEELPPKALRSLAESFAANLTAELDAANLPHGD
                     VKWFAAPRRLALKVSGLHESQADREVEKRGPAVAQAFDAEGKPSKAAEGWARGCGITV
                     DQADRLVTDKGEWLVYRAHVKGESAQQLLPAMIATSLAKLPIPKLMRWGDSDVQFVRP
                     VHTVTLLLGDELIPAKILGIDSARTLRGHRFMGEPEFTIDNADQYPQILLERGKVIAD
                     YEQRKTLIKQDAEKAAKEIGGIADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEA
                     LVYTMKGDQKYFPVYDAAGKLLPNFIFVANIESKDPQQIISGNEKVVRPRLADAEFFF
                     NTDRKKRLEDNLPRLETVLFQKQLGTLRDKTDRIQALSGWIADKIGANVENAKRAGLL
                     SKCDLMTNMVFEFTDTQGVMGMHYARHDGEQEEVAVALNEQYQPRFAGDELPASLVAC
                     ALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAV
                     RLYGDKLTNARVVDDVVDFMLGRFRAWYQEEGHAVDTIQAVLARRPTKPADFDARVKA
                     VSYFRTLDEAATLAAANKRVSNILAKSTDVLLDHVHASVLKEPAELKLATHLVVLRDK
                     LEPLFAAGQYKEALVELAALRETVDTFFDTVMVMDENEAVRINRLTLLSKLRELFLQV
                     ADISLLQ"
     gene            30253..30975
                     /locus_tag="RAHAQ2_RS00130"
                     /old_locus_tag="Rahaq2_0027"
     CDS             30253..30975
                     /locus_tag="RAHAQ2_RS00130"
                     /old_locus_tag="Rahaq2_0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333300.1"
                     /db_xref="GI:504099306"
                     /translation="MAVGIRSGAFSRWLAPFIALLVVFQLTACGDKEPEQRKAFIDYL
                     QNTVMRSGQNLPSLSEDQKQRFGNYANDYGIILSFSRQMKGAVEGSLVPVVSAIGQVR
                     TPQDYMTQRSALQQAASTLSLLNAQLRDSKVKADTAMAALKQPDDLKAVYSQVYNSVV
                     TQPANVLTPLVPALQSFTQDIVSVGDFLQQQGTQVAFANGGVQFPTQQQATQYNTMMS
                     NLVGKQQTLLQAQKVAQGDFSN"
     gene            31304..31750
                     /gene="cmtB"
                     /locus_tag="RAHAQ2_RS00135"
                     /old_locus_tag="Rahaq2_0028"
                     /note="PTS system mannitol-specific transporter subunit
                     IIA; disrupted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
     gene            31781..33184
                     /locus_tag="RAHAQ2_RS00140"
                     /old_locus_tag="Rahaq2_0029"
     CDS             31781..33184
                     /locus_tag="RAHAQ2_RS00140"
                     /old_locus_tag="Rahaq2_0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333302.1"
                     /note="CmtA with CmtB possibly forms the mannitol-like
                     permease component of the cryptic mannitol
                     phosphotransferase system, which phosphorylates and
                     transports various carbohydrates and polyhydric alcohols
                     in Escherichia coli; cytoplasmic protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannitol transporter subunit IIBC"
                     /protein_id="WP_014333302.1"
                     /db_xref="GI:504099308"
                     /translation="MANKSIRARVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWT
                     PNSHFGQLVSPMITYLLPLMIGSTGGHLMGGKRGAVMGGIGTMGVIVGADIPMFIGAM
                     VMGPLGGYLIKVVDKALEKRIPAGFEMVINNFSLGILGMLLCLLAYEVIGPAVMEANN
                     FVKQGIEALVATGYLPLLSVINEPAKVLFLNNAIDQGVYYPLGMQDTAVAGKSIYFMV
                     ASNPGPGLGILLAFSLFGKGLSKKSAPGAMIIHFLGGIHELYFPYVLMKPLMIIAMIA
                     GGMTGIYVFELFGAGLVAGPSPGSIFAYLALTPRGGFIGTCAGVLAGTVVSFVVASAI
                     LKFDKSPAEDSFADSQAASKKRKAEGKSGIQPVAASIRLIAFVCDAGMGSSAMGATTF
                     RKKLQKAGYEIEVKHYSIENIPADADIIVTHASLEGRAQRVTDRPLILIKNYLGDPAL
                     DVLFTDITSPAQQGATA"
     gene            33181..34449
                     /locus_tag="RAHAQ2_RS00145"
                     /old_locus_tag="Rahaq2_0030"
     CDS             33181..34449
                     /locus_tag="RAHAQ2_RS00145"
                     /old_locus_tag="Rahaq2_0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-sorbose 1-phosphate reductase"
                     /protein_id="WP_014333303.1"
                     /db_xref="GI:504099309"
                     /translation="MKTKVAAIYGKKDVRIREFELPDITDDELLVNVVSDSVCLSTYK
                     AALLGEEHKRVPENTADHPAITGHECAGVIVQVGKNLTGRFEAGKRFVLQPAMGLPSG
                     YSAGYSYETFGGNATYMIIPKQAIDLGCVLPYEGRYFAAASLAEPMCCIIGAYHASYH
                     TTQYVYEHQMGIKAGGNLALLACAGPMGIGAIDYAINGDVRPARIVVVDIDQQRLARA
                     EQLLPVAMAAEKGIELVYINSKTLSDPATALRDMTGGAGFDDVFVYAAVAEVIELGDA
                     LLGEDGCLNFFAGPVDKNFRVPFNFYNVHYASTHIVGTSGGSTGDMEEALALTAAGRI
                     QPSYMITHIGGLDAVPETVLNLPDISGGKKLIYNGISLPLTAIDDFAELGKTDPLFAL
                     LAERVAPTHGVWNEQAEQALLNHFGVSTGL"
     gene            34492..35019
                     /locus_tag="RAHAQ2_RS00150"
                     /old_locus_tag="Rahaq2_0031"
     CDS             34492..35019
                     /locus_tag="RAHAQ2_RS00150"
                     /old_locus_tag="Rahaq2_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol repressor"
                     /protein_id="WP_014333304.1"
                     /db_xref="GI:504099310"
                     /translation="MTVLTEDQVLETLSGQTNLNDFLHAANAILLSGIKQFLPHLFIN
                     NDEDIREFAVKPLLAKSGPLDSIDVSLRLIYALGKIQKPVYADILLFSQLDEHLKAGS
                     DIVEFHEETAYEFIQNLSCVSHNTLMFQSVEKMKFAGFDIFNNARYGNLVRTALSLAV
                     TDLLKELTNERDADH"
     gene            34997..35704
                     /locus_tag="RAHAQ2_RS00155"
                     /old_locus_tag="Rahaq2_0032"
     CDS             34997..35704
                     /locus_tag="RAHAQ2_RS00155"
                     /old_locus_tag="Rahaq2_0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate hydrolase"
                     /protein_id="WP_014333305.1"
                     /db_xref="GI:504099311"
                     /translation="MNVTLTINGLTTQAFFPDSDIEQLHLPLLRRFSRQQRLLNQPLI
                     VFLVAPPGTGKSTLSAFWQKLSNETPDLVPLQTLPMDGFHQRNAWLDAHNLRHRKGAP
                     ETFDVAKLRHALMALREPGSNWPEYSRMLHEPVDGAIRVTAPLLIVEGNWLLLEDDGW
                     RQLVEYCDVSVFIHASPDILRDRLTERKIRGGLTPAQAGEFYDVTDGPNVTRVLAHSL
                     RADINLHMRDDGSYHSE"
     gene            35819..36613
                     /locus_tag="RAHAQ2_RS00160"
                     /old_locus_tag="Rahaq2_0033"
     CDS             35819..36613
                     /locus_tag="RAHAQ2_RS00160"
                     /old_locus_tag="Rahaq2_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_014333306.1"
                     /db_xref="GI:504099312"
                     /translation="MKRQMMTLLASLVLAPTLAAAADSATADFTPAQQEAIGKIAADY
                     MLQHPEILVQVSQKLQAQQADQQQQQTLSAVLANSKALVNDPATPSYGPKDANVAFVE
                     FFDYQCLYCSHMAPVVEQTVKANPNVRFVFKEWPIFGDRWKASITAAETGMAIWKEKG
                     SQAYFDYHNSIYRSGHDEGKLTDADIAGAVKAAKATAPTDAQRKATHEAIAANDELAR
                     TLGFSGTPGFVVMPTRGATAENTSVLPGAVSAEELQAAIVKAQGGK"
     gene            36847..37026
                     /locus_tag="RAHAQ2_RS00165"
                     /old_locus_tag="Rahaq2_0034"
     CDS             36847..37026
                     /locus_tag="RAHAQ2_RS00165"
                     /old_locus_tag="Rahaq2_0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333307.1"
                     /db_xref="GI:504099313"
                     /translation="MIVQFADYAALKKNERRENRSVKEATGLHKVIDLSAWQEFAEYE
                     KAKARVQEAAAKLDW"
     gene            37060..38619
                     /locus_tag="RAHAQ2_RS00170"
                     /old_locus_tag="Rahaq2_0035"
     CDS             37060..38619
                     /locus_tag="RAHAQ2_RS00170"
                     /old_locus_tag="Rahaq2_0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxycytidylate deaminase"
                     /protein_id="WP_014333308.1"
                     /db_xref="GI:504099314"
                     /translation="MTVPAQKIIPIEKLNRSTEHDSIDALQRHRSQELIIGLCGASGS
                     GVNTLKEKLIEQLTAGSYHVEHIRLSTLMANTKPHDIASELISLKGYEHYVQLQDLGD
                     ALRKEHGAMIAAQMAIRNISSLRNKLLELRQAEGAHGKTTSKVAYIIDQFKHPSEIEL
                     LREVYRNNFYLLGVLRTLKERRSNLRRDGISRDDIDKLVERDRRSPLKYGQQVEETLQ
                     CSDYFIKNISDIRIENAVQRFVNLIHGAKNLTPTRDETGLFNASTAALRSACLSRQVG
                     AAIMDDNNNILATGCNDVPTAGGGLYSCENVDNDKRCFADGGCQNDQHKNLVRKEIDV
                     VLQKFDCTRTQFTTISEEIMKTTKLKSLIEYSRAIHAEMDAITTMARIAQVSTVGKTL
                     YCTTYPCHNCARHIIAAGIKRVVYIEPYEKSLAEDLHGDSISHGEPAGDDISKVVFDN
                     FEGTAPRRYAKFFGYNRPRKNQQGKSITYDIRTSHHVDSQQLYSYTDFELKIVKDVTT
                     KIGKEISLPPA"
     gene            39121..41034
                     /locus_tag="RAHAQ2_RS00175"
                     /old_locus_tag="Rahaq2_0036"
     CDS             39121..41034
                     /locus_tag="RAHAQ2_RS00175"
                     /old_locus_tag="Rahaq2_0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333309.1"
                     /note="catalyzes the phosphorylation of incoming sugar
                     substrates concomitant with their translocation across the
                     cell membrane; subunit IIC forms the translocation channel
                     and contains the specific substrate-binding site; subunit
                     IIA is phosphorylated and transfers the phosphoryl group
                     to the IIB subunit; subunit IIB transfers the phosphoryl
                     group to the substrate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannitol transporter subunit IIABC"
                     /protein_id="WP_014333309.1"
                     /db_xref="GI:504099315"
                     /translation="MFSPDVKIKVQNFGRFLSNMVMPNIGAFIAWGIITALFIPTGWI
                     PNETLAKLVGPMITYLLPLLIGFTGGRLVGGDRGGVVGAITVMGVIVGADMPMFLGAM
                     IAGPLGGWCIKRFDRWVDGKIKSGFEMLVNNFSAGIIGMLLAILAFLAIGPLVEALSK
                     VLAAGVHIMVIHNLLPLASIFVEPAKILFLNNAINHGIFSPLGIQQATETGKSIFFLI
                     EANPGPGMGVLMAYMFFGRGSAKQSAGGAAIIHFLGGIHEIYFPYVLMNPRLLLAVIL
                     GGMTGVFTLTLLNGGLVSPASPGSILAVLAMTPKGAYFANIAAIVAAFAVSFVISALL
                     LKTTKAKDGDDLDEATRRMQDMKAQSKGGKPAVAGVAGDLSTVRKIIVACDAGMGSSA
                     MGAGVLRKKVQDAGLTNISVTNSAINNLPDDVDLVITHRDLTERAMRQVPHAQHISLT
                     NFLDSGLYTDLTSRLVEVNKASQYKEKVTTTLGDSIVADNENENLFRISESNIFLGLN
                     AATKEDAIRFAGEQLVKGGYVQAEYVEAMLAREQLTSTYLGESIAVPHGTIEAKDRVL
                     KTGIVFCQYPAGIRWGDDEDDRARLVVGIAARNNEHINVITKLTTALDEDGVIERLAN
                     TTSVEEVLTILRG"
     gene            41177..42325
                     /locus_tag="RAHAQ2_RS00180"
                     /old_locus_tag="Rahaq2_0037"
     CDS             41177..42325
                     /locus_tag="RAHAQ2_RS00180"
                     /old_locus_tag="Rahaq2_0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol-1-phosphate 5-dehydrogenase"
                     /protein_id="WP_014333310.1"
                     /db_xref="GI:504099316"
                     /translation="MKALHFGAGNIGRGFIGKLLADAGIELTFADVSPALLDALNSRK
                     GYDVHVVGEQATIEPVSNVNAVNSAGQEAINLIAEVDLVTTAVGPTVLEKIAPNVAKG
                     LVLRHQQGNEKPLNIIACENMVRGTSQFKQHVFNALPEEEKAWVEAHIGFVDSAVDRI
                     VPPAAAGTTDPLEVTVETFSEWIVDKTQFKGDLPQIAGMELTDNLMAFVERKLFTLNT
                     GHAITAYLGQQAGHATIRDAILDEKVRLVVRGAMEESGEVLIRRYGFDPEKHFAYIEK
                     ILTRFENPYLHDDVERVGRQPLRKLSAGDRLIKPLLGTQEYRLPNDNLVRGIAAAMHY
                     RSEQDPQAKELVELLDKVGPKAALAQISGLPEDGEVVAKAVALYESMH"
     gene            42462..43010
                     /locus_tag="RAHAQ2_RS00185"
     CDS             42462..43010
                     /locus_tag="RAHAQ2_RS00185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_037040815.1"
                     /db_xref="GI:739176851"
                     /translation="MEKAQAFENRVLEKLNAGKTVRSFLMTAVELLAEALDILVVQVF
                     RKDDYAVKYAVEPLLTGTGPLGDLSVRLKLIYALGVISRHEYEDAELLMALREELNYD
                     GEEYRFTDDEILGPFGELHCVAELPPAPTFLKPGEADESLIAMQRQRYQQIVRSTMVL
                     SVTGLIAHISNQQPSRLSPVQK"
     gene            complement(43143..43751)
                     /locus_tag="RAHAQ2_RS00190"
                     /old_locus_tag="Rahaq2_0040"
     CDS             complement(43143..43751)
                     /locus_tag="RAHAQ2_RS00190"
                     /old_locus_tag="Rahaq2_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333313.1"
                     /db_xref="GI:504099319"
                     /translation="MIDTAFVSYVTVMSITPGPNNLLLAASGVNFGLRRSVPMMLGIT
                     LGCVVQCALMTSMLAILLSWMTVVRLPMAAVGCAYLFWLSWKIYRSGSPKEGAKQQPM
                     NMINGALFQAVNPKAWLMATNVAILFTPPDGNMLHHTLLICIGFALINLPCILVWVVM
                     GDRLRQALRVEWKLKMFNTIMGGMMALTALWLLVGEVRHALN"
     gene            43896..45389
                     /locus_tag="RAHAQ2_RS00195"
                     /old_locus_tag="Rahaq2_0041"
     CDS             43896..45389
                     /locus_tag="RAHAQ2_RS00195"
                     /old_locus_tag="Rahaq2_0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014333314.1"
                     /db_xref="GI:504099320"
                     /translation="MTDTADFSDTRYNQLAEQLADAIRRGTLAPGSRLPSVRRSAQTW
                     SVSINTVVAAYRRLEDRGFIEARPQSGFYVRAALPALHHQPQEQPQTPAAEPADEVLD
                     LIDKVFASQIDPTYTNLSLACPQSNDFYPTGKLGRIMSSLLRRQPNLIGQYALPPGSP
                     ALRQQIARRALALGMILEPADITITHGCMEALQLALRVTTKPGDSVGLETPTYFYLLP
                     MLASLGLKAVEIPTDPQTGLSLDVLEMLLTEKRLNAVIAMPTAQNPLGFTMPLAAKKR
                     LARLMNDHQVPLIEDGLYAEIQFGATLSPAVKAFDRDGWILFCTSFTKTLAPDFRIGW
                     VDGGRFADKLHKLKAVSSMAESALLSQTLTLFLESGGYDHHLRVLRRRYASQVEQARA
                     LIARHFPQGTRATQPAGGFVIWVDFPPGVDCVTLFRQLLKDKICMTPGQLYSPSGRYS
                     NGLRLSCCYVFDTRYISAMIRIGERACEMCGLPPGLEATGTDYFPDK"
     gene            complement(45358..45780)
                     /locus_tag="RAHAQ2_RS00200"
                     /old_locus_tag="Rahaq2_0042"
     CDS             complement(45358..45780)
                     /locus_tag="RAHAQ2_RS00200"
                     /old_locus_tag="Rahaq2_0042"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333315.1"
                     /db_xref="GI:504099321"
                     /translation="MKPTFSRDHRIEMHLNNGMFNGKPLYIHYTSAETFPKIIASRCF
                     MARPNYDRRGAAAKSGIYMVRGRHAFNALQAFQQLFLGEPKYRDSAKYCFLFTFNSEP
                     YLTGNLISAGSTVEELIHPGNLSFSKINIIYQGSNPFL"
     gene            45947..46306
                     /locus_tag="RAHAQ2_RS00205"
                     /old_locus_tag="Rahaq2_0043"
     CDS             45947..46306
                     /locus_tag="RAHAQ2_RS00205"
                     /old_locus_tag="Rahaq2_0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333316.1"
                     /db_xref="GI:504099322"
                     /translation="MKEVEKAEIKRLSDMLDALNHKDATVIQAGNAELIASHEEEKEK
                     LAAEIARLKEVRVKKLSTEAQKLEKLFSREITKKEQADMGTLKKTVRGIVVVHPMTAL
                     GREMGLKAVTGFAKKAF"
     gene            complement(46390..47328)
                     /locus_tag="RAHAQ2_RS00210"
                     /old_locus_tag="Rahaq2_0044"
     CDS             complement(46390..47328)
                     /locus_tag="RAHAQ2_RS00210"
                     /old_locus_tag="Rahaq2_0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013248387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS116/IS110/IS902 family"
                     /protein_id="WP_014333317.1"
                     /db_xref="GI:504099323"
                     /translation="MNQSPKAFVGVDISKETFDVFINVGNFYQKFTNNQTGHVDFINL
                     LKNYEVAQIVMEATGRYHCVLAANLSVENYPVSVVNPRQVKHFSLSLGNLAKTDKLDA
                     MVLSRFAQVVLPPLTVASDEQTQRLAQMVTRRRQLIDMRTMEKNRLDGVHLDVAELIH
                     HHIEWLNSQIKDLDDDIGRQLRVMPLWQEKAKILSSVKGVGPTTTATLLALLPELGTL
                     SRRKISALVGVCPYSHDSGKLKGKRAIWGGRSAVRAALYMAALVAKKNNKEIKRFYDG
                     LIARGKLKKVALTACIRKLVTILNAMVRDGREWAAN"
     gene            complement(47659..48339)
                     /locus_tag="RAHAQ2_RS00215"
                     /old_locus_tag="Rahaq2_0045"
     CDS             complement(47659..48339)
                     /locus_tag="RAHAQ2_RS00215"
                     /old_locus_tag="Rahaq2_0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-N-hydroxylaminopurine resistance protein"
                     /protein_id="WP_014333318.1"
                     /db_xref="GI:504099324"
                     /translation="MHYPDVYIGTIEQYPDFSPSAIAKRQVDGGVALTPCGLEGDQQA
                     EKAYHGGADRALCHFPREHYAWLRQQFPEEEDRFHPPAFGENLSTLGMTEDNVFIGDI
                     FRWGDALIQVTQPRAPCYKLNHFLDCKNLSPLLQQSGRCGWLYRVVSTGNVSGDRPLE
                     LLTRNSEVSVAQAISIAFNMPFDEEQYRRLMSAAGISASWSKTMQMRLVNRKIEDFGR
                     RLFGAEGK"
     gene            complement(48446..50392)
                     /locus_tag="RAHAQ2_RS00220"
                     /old_locus_tag="Rahaq2_0046"
     CDS             complement(48446..50392)
                     /locus_tag="RAHAQ2_RS00220"
                     /old_locus_tag="Rahaq2_0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_014333319.1"
                     /db_xref="GI:504099325"
                     /translation="MSNGSGLSQWMNNLKVGTKLGLGFGLVLLIAAIITTAGMIKFND
                     ISQRAEKVDFSNQMNALLNDARLSRTLYQLNYNPVYLKQNQDNIDALSQLISQSKDKL
                     EWDAAGQTELDQVPVKIHEYQQAQTAFKQAVDRKDAVRASWNLSETEAIVKRLQDQLR
                     VEDADPSIRLSLAEVIQKLINVRYDVRGLLLNISKESEAKLLKSIDDTQANAKKLNAL
                     LLPDQQATLAPLMSALATYKDHVMAYMPAYEDEQKNSQLLSVKAAEMNALVAKIFKNE
                     LDNTHKDISNAQMLMMVITLIVMLAGIIIAWRITRQIAQPLRDTLKTAEAIARGDLTV
                     AQPTTRRDELGMLMNAVSAMSQNLSTMIYEIRSGVSQVSHAAAEIAAGNTDLSSRTEQ
                     QAAAVEETAASMEQLSATVKQNADNAHHASKLASEASGTATLGGKQVGEVVDTMQQIS
                     GSSKRIAEITSVINSIAFQTNILALNAAVEAARAGEQGRGFSVVASEVRILAQRSAQA
                     AKEIEGLIAESVERVNTGAKLVENTGRTMQDIVKSVSHVRDIMGEIASASDEQSRGIS
                     QISQAIVEMDSTTQQNAALVEQSSAAADSLEDQAATLTQAVSVFRLADNGDMLAAPAS
                     AALRRPALPLPVQGKTSQDNWETF"
     gene            complement(50664..51284)
                     /locus_tag="RAHAQ2_RS00225"
                     /old_locus_tag="Rahaq2_0047"
     CDS             complement(50664..51284)
                     /locus_tag="RAHAQ2_RS00225"
                     /old_locus_tag="Rahaq2_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573393.1"
                     /note="SodA; manganese binding; only present under aerobic
                     conditions; destroys free radicals; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="WP_014333320.1"
                     /db_xref="GI:504099326"
                     /translation="MSYSLPSLPYAYDALEPHFDKETMEIHHTKHHQTYVNNANAALE
                     SLPELAALPVEELITKLDQVPADKKVVLRNNAGGHANHSLFWKGLKTGTTLQGELKSA
                     IERDFGSVDAFKEAFEKAAATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAISGAS
                     GYPLLGLDVWEHAYYLKYQNKRPDYIKAFWAVVNWDEAAKRLAEAK"
     gene            complement(51525..53066)
                     /locus_tag="RAHAQ2_RS00230"
                     /old_locus_tag="Rahaq2_0048"
     CDS             complement(51525..53066)
                     /locus_tag="RAHAQ2_RS00230"
                     /old_locus_tag="Rahaq2_0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004918721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitin-binding domain-containing protein"
                     /protein_id="WP_014333321.1"
                     /db_xref="GI:504099327"
                     /translation="MSNYNITAKWVRYNDWYWHLYFNLTNNSSASLLLPDVKVQLAKN
                     QACAPYIAYTFVQNDVYLEGSLLQEVLPVDIGETVEFAVGVSILEMNAPGDLPVMYWV
                     NGEAVSPAAADTQAPTAPGKPVVSSVTASTVSLSWNAATDNVGVDDYVVYYYPTATDV
                     SFALTTATKTTNITLKNLSSETNYSIQIKARDAQGNESPFTSVVSVTTIQGTDASAGY
                     AAYLDVSINATWYPEISVNTQYTQWAVDHNVDKLYLAFLAYSVTKGGLVWVNDNFDYD
                     YAKPLTDMINTSNTQAVIAFGGAKGIDPSYHVSVDTLVGMYQKVLSDFHSNHIDLNFE
                     GGTKYNSTVALTAAARVQASNPDVKFSLTMQINDQGLRPEALAMVELAKSLNVVLDVQ
                     IMTMCFARSNVGQASIDVAEKVYEQLAAVYKDKTPAQIYAMIVMVEEIGQNGGGTGMG
                     IFTFADTDLVSNYVKERGMHTLAIWALNRDFPGDVGMETPTASGDPEQTQPYEFSNRF
                     LSNLH"
     gene            complement(53269..54111)
                     /locus_tag="RAHAQ2_RS00235"
                     /old_locus_tag="Rahaq2_0049"
     CDS             complement(53269..54111)
                     /locus_tag="RAHAQ2_RS00235"
                     /old_locus_tag="Rahaq2_0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase accessory protein"
                     /protein_id="WP_014333322.1"
                     /db_xref="GI:504099328"
                     /translation="MDVHQVNELGEKDDKKVTQIIGASQKPVMQRAHLNEPQDDWIAQ
                     EVPVALVYNGISHVVMMASPKDLQAFALGFSLSEGIIESVSDIYGMEVTPNCHGIEVN
                     IELSSRRFAGLKERRRAMAGRTGCGVCGIEQLGDLFRPLAPLPFTQTFELANLDNALH
                     QLKSVQEIGQLTGCTHAAAWITPQGELTGGCEDVGRHVALDKMLGMRAKQRDWQNGAA
                     LVSSRASYEMVQKAAMCGIEILFAVSAATTLAVDVAEKCNLTLVGFSKPGRATVYTHP
                     QRLR"
     gene            54893..57304
                     /locus_tag="RAHAQ2_RS00240"
     CDS             54893..57304
                     /locus_tag="RAHAQ2_RS00240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003843751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase"
                     /protein_id="WP_037040795.1"
                     /db_xref="GI:739176830"
                     /translation="MTNNWVDIKNANVILIMGGNAAEAHPVGFKWVIEAKTKNNAKVI
                     VVDPRFNRSAAVADIYAPIRAGSDTAFLLGMINYLIIHNKIQTEYVLEYTNASLLVRE
                     DYEFNDGLFSGFDAAKKSYNKESWHYQLDEKGFAKQDKTLQDPRCVWNLLKEHVSRYT
                     PELVERLCGTPKEDFLLISSILAETCARDKTSTILYALGWTHHTGGAQIIRCAAMIQL
                     LLGNIGMPGGGVNALRGHSNIQGYTDLGLLSLNLPGYMPLPSEKQTNFTDYLHQITPA
                     PLVDGQVNFWKNTPNFFVSMMKSFWGEHATAENDWGFDWLPKWDKSYDVLQQAELMTE
                     GKLNGYIVQGFNPLAAFPDKNKSSRALSKLKYMVVIDPLVTESSNFWQNHGAMNDVQT
                     ADIQTEVFRLPSSCFAEENGSIVNSGRWLQWHFQASEPPGEALHDGKIIARLFMKLRE
                     LYQKEGGANPLPVMNMAWDYQDPLDPLPEEIAREANGKALADIHDEQGNLLAKKGQQL
                     STFAHLKNDGSTASFCWIYTGSWTEAGNQMARRDNADPSGLGCTSGWAWCWPLNRRIL
                     YNRASADPQGQPWDPKREIIRWDGAKWTGFDVPDYSAAAPGSGVGPFIMQQEGVGRLF
                     ATDKMADGPFPEHYEPIESPIGTNPLHPAVISNPVARIFASDLPNMGTAKDFPYVATT
                     YSITELFRHWTKHALLNAIAQPEQFIEIGEGLAASKGIAQGDEVKVSSKRGFIVAKAV
                     VTKRIRPLTIDGKHVDTIGIPCHWGFEGATRKGYLANTLTPSVGDANSQTPEFKAFLV
                     NVEKV"
     gene            57317..58228
                     /locus_tag="RAHAQ2_RS00245"
                     /old_locus_tag="Rahaq2_0051"
     CDS             57317..58228
                     /locus_tag="RAHAQ2_RS00245"
                     /old_locus_tag="Rahaq2_0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333324.1"
                     /note="beta subunit; involved in the use of formate as an
                     electron donor during aerobic respiration; acts to
                     transfer electrons from the major(alpha subunit) to the
                     cytochrome b556(gamma subunit); Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-N subunit beta"
                     /protein_id="WP_014333324.1"
                     /db_xref="GI:504099330"
                     /translation="MAMQSQDILRKSATNGFTPAPRARDHQQEVAKLIDVTTCIGCKG
                     CQVACSEWNDLRDEVGINTGVYDNPMDLSAKSWTVMRFSEVEENGKLEWLIRKDGCMH
                     CADPGCLKACPAEGAILQYTNGIVDFQSEHCIGCGYCIAGCPFNIPRINKQDNRAYKC
                     TLCVDRVSVGQEPACVKTCPTGAIHFGTKTAMQDLAAERVSELKGRGFEHAGLYDPQG
                     VGGTHVMYVLHHADNPELYHGLPKDPAISAAVTLWKGVWKPLAAVGFAVTFAAAAFHF
                     LGVGPNYVKEEEHAEEEGKHDDEEKRP"
     gene            58225..58878
                     /locus_tag="RAHAQ2_RS00250"
                     /old_locus_tag="Rahaq2_0052"
     CDS             58225..58878
                     /locus_tag="RAHAQ2_RS00250"
                     /old_locus_tag="Rahaq2_0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333325.1"
                     /note="cytochrome b556(FDO) component; heme containing;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-N subunit gamma"
                     /protein_id="WP_014333325.1"
                     /db_xref="GI:504099331"
                     /translation="MKKEKLIQRYNLAERLNHWIVAFCFVTLALSGIGFFFPSFNWLM
                     NVYGTPQLARILHPFFGVVMFVSFLGMFFRYWKHNLPEKDDIVWAKNIGKVLTNHEVG
                     DTGRYNFGQKCVFWAAISCLVLLMASGVMIWRPWFADYFPIPLIRLALLVHSLAGIGL
                     ILVIIMHVYAATWAKGSIAAMTGGKVPASWAKYHHPRWYRQVREEEQKKEQDERKAG"
     gene            58875..59789
                     /locus_tag="RAHAQ2_RS00255"
                     /old_locus_tag="Rahaq2_0053"
     CDS             58875..59789
                     /locus_tag="RAHAQ2_RS00255"
                     /old_locus_tag="Rahaq2_0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333326.1"
                     /note="required for the formation of active formate
                     dehydrogenase; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase accessory protein FdhE"
                     /protein_id="WP_014333326.1"
                     /db_xref="GI:504099332"
                     /translation="MSIQIVSQDELADGKTTAGNIPPVLFANLKTLYQRRADRLRALA
                     EDSPLDGYLNFAAAICDAQQRVLKEFPLSIDLSQELEKAAGKPPLDCRLFPRTPHWLT
                     LLDALILVLKHGASEPVPGVLERLEQSPSLQREMMATQLLNQDFKHVPADKAPFIWAA
                     LSLYWAQMAAQLRGVGRADYGENRQFCPVCGSVPVSAVVAFGAHSGLRYLHCNLCESE
                     WHVVRAKCSNCDEMEHVNLWSIDDEQATVKAEACDDCGAYLKVIYQDKDPQADAVADD
                     LATLLLDDRMEDKGFSGSGINPFLFPAE"
     gene            59875..60516
                     /locus_tag="RAHAQ2_RS00260"
                     /old_locus_tag="Rahaq2_0054"
     CDS             59875..60516
                     /locus_tag="RAHAQ2_RS00260"
                     /old_locus_tag="Rahaq2_0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_014333327.1"
                     /db_xref="GI:504099333"
                     /translation="MKLIGSYTSPYVRKISVMLLEKGIPFDFINDTPHEPGCKIIQYN
                     PLGKVPALVADDGEVFYDSPIIVQFIELMNVAPTLLPWQPLDALRVRQIEALADGVTD
                     AAVALVLEGRRDADKRNEAWILRQREKLLRGLDALEKHAENRTLLNSESLNVADIAVA
                     CCLGYLNFRRIAPGWCVEHPELIKLVERLFQRESFACTTPPGSGNASFAAKKV"
     gene            60618..62156
                     /locus_tag="RAHAQ2_RS00265"
                     /old_locus_tag="Rahaq2_0055"
     CDS             60618..62156
                     /locus_tag="RAHAQ2_RS00265"
                     /old_locus_tag="Rahaq2_0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333328.1"
                     /note="catalyzes the oxidation of acetaldehyde,
                     benzaldehyde, propionaldehyde and other aldehydes; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_014333328.1"
                     /db_xref="GI:504099334"
                     /translation="MAYDKNPHAVKPEEYGFPLKLKKQYDNFIGGEWVAPVKKQYYDN
                     LTPVTGEVLCQVASSSTDDVDLALDAAHQAKDAWGKMPVQQRANLLLKVADRMEQNLE
                     LLANAETWDNGKPIRETSGADVPLAIDHFRYFASCVRAQEGGISEIDSETVAYHFHEP
                     LGVVAQIIPWNFPLLMACWKMAPALAAGNCIVLKPAKLTPLSVLLLMELVQDILPAGV
                     INVVNGAGGEIGEYLATSKRIAKVAFTGSTEVGQRIAGYAAQNLIPATLELGGKSPNI
                     FFADVMDKEDEFFDKALEGFALFAFNQGEVCTCPSRALVQESIYERFMERAIKRVEAI
                     KTGNPLDMETQMGAQVSAGQMKTILDYIEIGKKEGAEVLTGGAKKKLEGSLNEGYYLQ
                     PTILLGKNNMRVFQEEIFGPVLAVTTFKDMDDALQIANDTAYGLGAGVWSRDGNVAYH
                     MGRNIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKCLLVSYSSKP
                     LGLF"
     gene            62433..63095
                     /locus_tag="RAHAQ2_RS00270"
                     /old_locus_tag="Rahaq2_0056"
     CDS             62433..63095
                     /locus_tag="RAHAQ2_RS00270"
                     /old_locus_tag="Rahaq2_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_014333329.1"
                     /db_xref="GI:504099335"
                     /translation="MSRKLLYFFIYTLFICLLSIGCTVAYYQYVVLDSGAESLIQMDE
                     GKVSNSPLKDSDVLVEIMSYGCHFCAINDKAITELETRLPQGVRVVRLHLENTGSRGL
                     ARYARLFATLQVMGIEPQYREKVYAAIIDDNKDLSDNIILNRWLSTNSIDVEKYHAVE
                     ASQETTDLIKYMNDVSHYYDVSATPAFIVNKRWVAFQDRDFDKFGDHLLSLLKNNKPL
                     EQ"
     gene            63092..64042
                     /locus_tag="RAHAQ2_RS00275"
                     /old_locus_tag="Rahaq2_0057"
     CDS             63092..64042
                     /locus_tag="RAHAQ2_RS00275"
                     /old_locus_tag="Rahaq2_0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_037040785.1"
                     /db_xref="GI:739176820"
                     /translation="MMRFLPVWIYMQSLFLLSKIERQGLIFLLRGLKQTRWVLNKIPL
                     GVIFAGLHTVRLLRLTGKDQNARSLVASENKRCLTGDDGKVDFTWTAQRRKALDYAAT
                     YGKNKKVISQLDACAAELDKIVVPLHQAKKPVMLAPLHMVSDILAGIVASKTCPGKGT
                     VIVSSNAEHYIEQDRMKGGINLDYCSIHNKSQDVAKNMISACMEAAENKSNIIIFPDI
                     TPDYTIATDSAYSSKLKCRLFDRPAKLHNGVVRLAKMLSADVVFYYLYYDRGLKIRIF
                     PAVSAKNVAEKMPEIIEHSIRSHPQDWLLWHLHSLYFINE"
     gene            64061..66199
                     /locus_tag="RAHAQ2_RS00280"
                     /old_locus_tag="Rahaq2_0058"
     CDS             64061..66199
                     /locus_tag="RAHAQ2_RS00280"
                     /old_locus_tag="Rahaq2_0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014333331.1"
                     /db_xref="GI:504099337"
                     /translation="MSRIIPEMVSQSEINECGLACIAMLADTQGVSVTLPQLRDAYPI
                     SVHGTSLDTLATILSDYAIPVYPVLFSPDEIQDLPLPAILHYGAGHYVVLAYRKGERV
                     CVMNPAIGQQFLTFDALKKDISGYALIIDEEAEPKETKSAPDPAAPNKSFFACLSLEQ
                     TSKIKGIYFLMTLAFLVSLTLFIMPAMVGQAINDVLSAAGKEDFPYLLFLLAFVISTA
                     LALWVRSVTEQCVKRFAVLNSTAGFSRLLSNSLRFFERRAPGEVFSRFSAWETAALQK
                     IELDNGLRTDWIIGLLAFIVMAYMSFSLALVSLAGVTLMGLVSVWAIYRDRFYAQQMQ
                     ERIAEQNEYILESIHGFTTIKSAGLYEQRKSMFATYTLALFNCIQKKQIYEQVKNSIY
                     QMAGSLEMVLFMFLALPLLKNGVISLGSFFAYSFIRQIFSSYITKIFFAVLQKNQLHI
                     IDQRAADLFPATDVSGKAPARQAQVCEPFSFTGQLKFEDIAFRYDSAKPTLHSMTFAV
                     EQGHTVAIVGESGAGKSTLIKIIAGLLIPDEGQISLQGNEITSHQIEKLCFLQSQEDI
                     LFNTSVLENITLFDPHYDDSQQNRISALLEGLGLTGVIGQLPGGMNARIRESHTGLSL
                     GQRQRLLLARAMYSNRPVLVLDEPTANLDDEMASQVMMSVMAHCHEQGKTLIVVTHSK
                     TILNQFDHVYHLDHGHLLPHDSRVIQGCVA"
     gene            66196..67368
                     /locus_tag="RAHAQ2_RS00285"
                     /old_locus_tag="Rahaq2_0059"
     CDS             66196..67368
                     /locus_tag="RAHAQ2_RS00285"
                     /old_locus_tag="Rahaq2_0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide transporter"
                     /protein_id="WP_014333332.1"
                     /db_xref="GI:504099338"
                     /translation="MNVLRRYRVFSIASLTLCVFIAATALLIAHRTDNSATRHHIDVI
                     GRGDIQTTVMTTGVLQPLKKISVGAQVNGQLKKLHVKQGDRVKKGQLLAEIDPVIQQN
                     ELRNAQAELHSNRAQMQSDKALLKQYQLALTRQNKMARDSAGVQSDLESAQAQYDVQR
                     EQLNMDAARVVQAEISVETAKANLGYTRIIAPIDGEVLGIITQEGQTIVSSQTAPTIM
                     VLADMSVMRIQTRISETDILKTHPGQSVWFYVMADPTRRYESVMGAIQDAPEEALRES
                     NESSGNTQQSTAVYYNGEFTISNEQRRLKTSMTAEAYIIIGEVKNALLVPLTAVGERS
                     PEGRYHVQVREKDKITDRLIELGIRDNKFAEVKSGLAQGDRVVSTTSAPGDADASQ"
     gene            67355..69307
                     /locus_tag="RAHAQ2_RS00290"
                     /old_locus_tag="Rahaq2_0060"
     CDS             67355..69307
                     /locus_tag="RAHAQ2_RS00290"
                     /old_locus_tag="Rahaq2_0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333333.1"
                     /note="with MacA is involved in the export of macrolide;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide ABC transporter ATP-binding protein"
                     /protein_id="WP_014333333.1"
                     /db_xref="GI:504099339"
                     /translation="MPASEPLILLHHVSRVFSSGDQQVSVLDDVSLSVQAGEMLAIVG
                     PSGSGKSTLMNILGGLDIPDSGEVRIAGIDTLNASHEQLAALRSSNIGFIFQRYHLMP
                     YLTAAENVAVPAQYTAMPENVQEQRAAYLLEHLGLKERMQHKPSQLSGGQQQRVSIAR
                     ALMNGAPIILADEPTGALDAQSGQEMMAILHGLHQSGHTIILVTHDRNVASQAERIIE
                     ISDGKIIADTPNPSVHQASVPVVLLPAVNTGRSSWRQSLHDAIKMAWRALNGHRVRAL
                     LSMLGIIIGVTSVITSMAVGEGAKLKIIRDISALGTSTVAVRPGLGWDNPRPDLSDSL
                     TLGDVSTLSELPFAVHVSPVFTRNLEAQVGGRQMFFNLTGVSSDYFAVHDLALKEGRK
                     LNEHDVDAREPVLLIDSASAETLFHEDKNPLGETIYLNNVPLRVVGITAPKGLKNMGG
                     GLNAWMAYTTLQERLTGRMPVGAIEIQVAKGMTLKEAQRRIEYVLEKSHGRRDFFIET
                     DDMMLETLQKTSDSLTLLIATIAGISLVVGGVGVMNIMLVSVAERMHEIGIRLAVGAR
                     AVDIMRQFLIESVVVCLFGCVVGVIVTFVAGTLFSVLTNRFEMVFTPLPIFYSCCFSA
                     LIGLGFGFFPARFAARMKPTEALARE"
     gene            69304..>70662
                     /locus_tag="RAHAQ2_RS00295"
                     /old_locus_tag="Rahaq2_0061"
     CDS             69304..>70662
                     /locus_tag="RAHAQ2_RS00295"
                     /old_locus_tag="Rahaq2_0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333334.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_037040793.1"
                     /db_xref="GI:739176828"
                     /translation="MKILFTAILACCLAGCGAFLKTPYQQPELNLPQDWQNKQTGTAW
                     LTHTPQWWRVFNDPQFSQMISDVLIHNDDLAIAGYRLRQAALDAGLSNTNLTPDVSAG
                     GEASNSKNTRRNTAAHENYNASVTTSYELDLWGKLARTREQAQWQMNATALDRQNTAL
                     MLIGTTGQYYWQIAALNEQIGNTEKSIQLAMETERITRSGYEAGAINQLDVLQARQSV
                     IDQTNSLRELNQQREEARNALAILFGRAPSARAPEKMFLDPRQTIGLTPDLPLSVISR
                     RPDVQSAEWKLRASLAASDVARLNFYPSLSLGATLGAGSAVFSEWFSNPARTLSSGLT
                     LPFVQWNTVQLTVERSELDVRQAAATFRQSVYSALSDVENTTSQRNTYQAQREDLLVS
                     LGLGEQRLRLAKSQYLAGAVSLQTWLDAQSSLLSAENQLADAQARYLNATLQLWLALG
                     GEV"
     gene            70727..71980
                     /locus_tag="RAHAQ2_RS00300"
                     /old_locus_tag="Rahaq2_0062"
     CDS             70727..71980
                     /locus_tag="RAHAQ2_RS00300"
                     /old_locus_tag="Rahaq2_0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_014333335.1"
                     /db_xref="GI:504099341"
                     /translation="MDKSHSLKRVVVTGYGAITPLGMNAHQSWDAIMAYETGYRYIDR
                     RSGGIKSRFFGLIEGELNLKFLPAGIRRRLPRFAHLALIAAREAMEMAFGDTSLTQYH
                     AELDRGAIIGTGWGGLDETVSNHDKYRASGLGSTFGCFYSMPSIATAACSQHWMLRGY
                     QNTPSAACATGTIAIGDAFNAIQTGRATMMLAGGAESLRTDTAVWNIDVLSALTREEQ
                     DITKASCPFSLERNGFVLSEGAAVLCLEDREIALARGATILGEITGYGNFSDAVDFTA
                     PAEDKLARVNTIQAALSQAGLSAGELDYINAHGTSTQLNDRNETESVKLALGEKAYDI
                     PVSSTKGYSGHLIAAAGSFESIVCLQALEHQIMPATHHLRLADPACDLDFIREGHRPA
                     SLQNTLNLSFGFGGANAALVISRGE"
     gene            71980..72780
                     /locus_tag="RAHAQ2_RS00305"
                     /old_locus_tag="Rahaq2_0063"
     CDS             71980..72780
                     /locus_tag="RAHAQ2_RS00305"
                     /old_locus_tag="Rahaq2_0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004874991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC-like protein"
                     /protein_id="WP_014333336.1"
                     /db_xref="GI:504099342"
                     /translation="MNLFYGEQDAQAWAKFSGDYNPIHFDLQHAQAMGLESLTVHGMR
                     ALLDMKNHLSHAVAPMNSDYYQFSARLRQAVKCQTPYRLISALNVAGSAASSQLTELD
                     SGLCCFSGKLNGTLKRPDVDIPLKQTLTEEELAVLIAAYPSEKSETMSWEVLDAVLFE
                     RIVNIPETLDCVREAIPHLSAMSLADVFKLIPVVQTHHDVFFNHQHLITPAREAVGRP
                     FRYGLLPVLIIGNAEQGFVIRMTIQGGYDAHPSIMTAITLKTWPVQTH"
     gene            72798..73049
                     /locus_tag="RAHAQ2_RS00310"
                     /old_locus_tag="Rahaq2_0064"
     CDS             72798..73049
                     /locus_tag="RAHAQ2_RS00310"
                     /old_locus_tag="Rahaq2_0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_014333337.1"
                     /db_xref="GI:504099343"
                     /translation="MSEVIKSEIYSIVCEMLCDAKDLEPETLSEDLPLKSLKLDSLDY
                     VELMVLVKREFDISLSADMFIEHPDMTLGEMCQMLEALR"
     gene            73049..73786
                     /locus_tag="RAHAQ2_RS00315"
                     /old_locus_tag="Rahaq2_0065"
     CDS             73049..73786
                     /locus_tag="RAHAQ2_RS00315"
                     /old_locus_tag="Rahaq2_0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_014333338.1"
                     /db_xref="GI:504099344"
                     /translation="MNTRKWILITGGSRGIGKAMVIRLSKKYDIVFTWNTNADQAQSV
                     EKDCADTFGEVRGYCCDGRNEEQVSLLARLLLTERGAPYCIIHNAGITRDALHIKQTS
                     ADWHDVINTNLNAIFHWNQHLLPPMLARGEGSVIMMSSVSAQKGNVGQVAYSATKAAM
                     TGITRSLALEVARFGIRVNSLLPGVIETEMTAALRDEERKALRSHIPLRRLGKADEIA
                     LMADFLLSESGSYITGQSIIIDGGLSA"
     gene            74142..74324
                     /locus_tag="RAHAQ2_RS00320"
                     /old_locus_tag="Rahaq2_0066"
     CDS             74142..74324
                     /locus_tag="RAHAQ2_RS00320"
                     /old_locus_tag="Rahaq2_0066"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333339.1"
                     /db_xref="GI:504099345"
                     /translation="MKKITTEVAKEIIGGKDSCESSYQWNGNRCEYQTRCYDKHGNLS
                     SKSATQAGSTYYCQPK"
     gene            complement(74394..75629)
                     /locus_tag="RAHAQ2_RS00325"
                     /old_locus_tag="Rahaq2_0067"
     CDS             complement(74394..75629)
                     /locus_tag="RAHAQ2_RS00325"
                     /old_locus_tag="Rahaq2_0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_037040782.1"
                     /db_xref="GI:739176817"
                     /translation="MHNSPNTASLLGRQALLFPLCLVLFEFATYIGNDMIQPGMLAVV
                     ANFNAGEEWVPTSMTAYLAGGMFLQWLLGPLSDRRGRRPVMLAGVSFFIITCLAILFA
                     QNIEQFMVMRFLQGISLCFIGAVGYAAIQESFEESVCIKITAMMANVALIAPLLGPLA
                     GAALIHVAPWQSMFVIFAVLAAIALWGLWKSMPETASRLGEPFSMPSLLRDYKHVLKN
                     RQFLCGALAIGFASLPLLTWIAQSPVILISGESLAAYDYGLLQVPIFGALIIGNVTLA
                     RLSGKRTVEYLIKLGAGPMVVGLLIAAVATLFSAHAYLWMTAGLSLYAFGIGVANAGL
                     YRLTLFSSDMSKGTVSAAMGVISMMIFTLGIELAKVAYVEGGTGMFNLFNLISGLAWL
                     ALVVVFLRSRQIVITGASA"
     gene            75868..76863
                     /locus_tag="RAHAQ2_RS00330"
                     /old_locus_tag="Rahaq2_0068"
     CDS             75868..76863
                     /locus_tag="RAHAQ2_RS00330"
                     /old_locus_tag="Rahaq2_0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573402.1"
                     /note="involved in enterobacterial common antigen
                     biosynthesis; catalyzes the addition of O-acetyl groups to
                     the N-acetyl-D-glucosamine residues of the trisaccharide
                     repeat units of the enterobacterial common antigen;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-acetyltransferase"
                     /protein_id="WP_014333341.1"
                     /db_xref="GI:504099347"
                     /translation="MSQKISWIDNLRALACMMVVMIHASTSLVVNFAAVHTAEWTVAN
                     LLNSASRVCVPLFFMISGALFLGEKSAQKRHFLRVTLCLLFYSAVSLIYILTMTKIGF
                     WPSLRLIVEKPVFYHLWFFYAIIVIYLLSPLINVKAVSGRYLLIAGMLLGVLANPQLP
                     AVTWQKIHLLPLDLYISGDTFYYVLYALMGRAISQLNTEKTAITLAASGTFILSTLAI
                     ATGTYRQMQINQNFADTFYVYSGPLVFISAIALFVVFKNTLAHRILPGFALISRHSLA
                     IYGFHALIIIGLRNQHLDFPQFPLLNLVFLFICGLGGGLLLAMGLGKIDRRNWVS"
     gene            complement(76883..78874)
                     /locus_tag="RAHAQ2_RS00335"
                     /old_locus_tag="Rahaq2_0069"
     CDS             complement(76883..78874)
                     /locus_tag="RAHAQ2_RS00335"
                     /old_locus_tag="Rahaq2_0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_014333342.1"
                     /db_xref="GI:504099348"
                     /translation="MFKITDLIDLQTLAESVELEFKQAQGQDGQGKLPQDFWPTYSAM
                     ANTRGGYVVLGVKEKKGEFIPVGINDPEKIKKELFNNLNNPNLVNINLLTDADVQTTL
                     LDSKLILVIHIPIATRHQKPIFLKKNPLEFTYIRLHEGDRHCSQEQVKRMLAEQVEDS
                     RDDKILTGFDLNDIEQESLNAYKQLLAIAKPQHLWLELNNFDLMAKIGGWRKDRQSGQ
                     EGITLAGILMFGTWQAIQDAVPHYFVDYQERPEAKTELRWVDRLCPDGTWSGNIFDFY
                     RRTYRKLTTDLKIPFKIKDGVRQDDTLIHVALREALVNTLVHSDYTGRASILIVKRPD
                     MFGFRNPGLMRIPPEIAIKGGETDCRNRRMHQMFLNIGAGERAGSGIPKIYSGWQSAN
                     WRAPKLYEKTEHTEQTLLELSTASLIPEYISAQLQKLFGTRFSTLDDFERMIVTTAAI
                     EGWINHQRACQLTSKHTRDVTLALPRLEAKGFLVSSGERKDKSYSLPGMEQPPSPEEV
                     FSNALSLISDFTHSEGDLTHSEGDSTHSKSNPISHDAMIPRIDEHRDPHGRFISPLLD
                     RPFVDQLDVLELSFKNNLLSLAKPARVKRRLTNEEMRDVISTLCNEHYIAISVLSDFT
                     NRTSQNIRQSHLKPMVEKGELKLAFPNKPNTPKQGYTVT"
     gene            complement(78975..79889)
                     /locus_tag="RAHAQ2_RS00340"
                     /old_locus_tag="Rahaq2_0070"
     CDS             complement(78975..79889)
                     /locus_tag="RAHAQ2_RS00340"
                     /old_locus_tag="Rahaq2_0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014333343.1"
                     /db_xref="GI:504099349"
                     /translation="MQRNVYFVTLPGVMSLDLTGPAEALRLSGQFRLHYIGPQPEVMM
                     STGLMVSHLQPLPQSLPEGSILIMPGVAESAENFSSMVAQTTCDWLHQQKSVIDAGDL
                     TLVCICSGSLLAGKAGLLDGYQCTTHHDVIGQLRQQVPAAQVKDNRIFVEDRSVLTSA
                     GISAGIDLALHLIATHLGPQAALDVAREMVVYFRRGGDDPQLSPWLRYRNHLHPAVHR
                     AQNLMAAEPESAWQVEEVAARAHISARHLTRLFRQHLGISVRDYHEQLRIAVAQQRLQ
                     QGAGIEKAALAAGFSSARQLRRAQERWA"
     gene            complement(79925..80479)
                     /locus_tag="RAHAQ2_RS00345"
                     /old_locus_tag="Rahaq2_0071"
     CDS             complement(79925..80479)
                     /locus_tag="RAHAQ2_RS00345"
                     /old_locus_tag="Rahaq2_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014333344.1"
                     /db_xref="GI:504099350"
                     /translation="MTQSALLNIDVQRSFEHKDFWQQDDLPAFSEALIRLIDGCQTRN
                     VPVIDVFHVNPDGDFSLASGLVTPMTFLTHQPQHVVHKHVHNALTESGLDGWLRENGI
                     THLIIAGMRTEQCCETTARVASDLGYSVTFVTEATLTFPMTHASGVTLSAQDIKLRTE
                     LVLADRFATLTDVTGALAELDRAV"
     gene            complement(80611..81207)
                     /locus_tag="RAHAQ2_RS00350"
                     /old_locus_tag="Rahaq2_0072"
     CDS             complement(80611..81207)
                     /locus_tag="RAHAQ2_RS00350"
                     /old_locus_tag="Rahaq2_0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biogenesis protein ThiJ"
                     /protein_id="WP_014333345.1"
                     /db_xref="GI:504099351"
                     /translation="MVKDNAKKQVALLLADGFEEGEAVIVLDILERLEIQVTTLACQK
                     SLTLRTYHGIQMQANELLSAQGDRLFDAVVMPGGPEGSVALAASKEVVEFVRRHDEAG
                     KLICPLCSAAARVLGGNGLLKGRRYVCSGDLYKDVKDGVYVNQSFVEDGNLLSGKGLG
                     LAFDFAFQLAYRLTGDAETTNFQADHIDYHHWRADQKF"
     gene            complement(81295..82326)
                     /locus_tag="RAHAQ2_RS00355"
                     /old_locus_tag="Rahaq2_0073"
     CDS             complement(81295..82326)
                     /locus_tag="RAHAQ2_RS00355"
                     /old_locus_tag="Rahaq2_0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333346.1"
                     /note="NAD-binding; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-idonate 5-dehydrogenase"
                     /protein_id="WP_014333346.1"
                     /db_xref="GI:504099352"
                     /translation="MTIATQSCVVTGKKDVSVIHQTLDYTGQGTLVKITRGGICGSDL
                     HYYEHGAVGDFRVREAMVLGHEVVGVVEKSDNPRLQPGQKVALNPSKPCKACKYCLSG
                     DENQCTTMKFFGSAMYFPHINGAFTQYKIVDSDQCIAYDNQVSDRLMVFAEPLAVAIH
                     AVNQAGDIHGKTVFVSGVGPIGCLIVLAAKAKGAAQIVVTDPSERCRTLALAVGASKA
                     LDAAQGDFSEYQAEKGFFNVSFDASGHPSSIHRCLEVTRARGTLVQVGMGPVVNEFPL
                     MMLIAKEINWVGSFRFTEEFNTAVEWLANKTVDPMPLLSAEFPQESLVEALEYALDKS
                     KASKVQLVF"
     gene            complement(82449..83651)
                     /locus_tag="RAHAQ2_RS00360"
                     /old_locus_tag="Rahaq2_0074"
     CDS             complement(82449..83651)
                     /locus_tag="RAHAQ2_RS00360"
                     /old_locus_tag="Rahaq2_0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333347.1"
                     /db_xref="GI:504099353"
                     /translation="MASRLSLQNLTFSAVIAGFVAVLVGYTSSAAIIFQAAEAAGASV
                     AQIGGWLSMLGLGMGVTSIGLSLYYRTPVVTAWSTPGAALLVTSLPGTSLNEAIGVFV
                     FATGLILLCGVTGLFARLMHYIPQALSAAMLGGILLRFGLNAFTSLQSNFALAGTMCL
                     VYLLAKRALPRYAVVLALVAGLTVAGLQGDIALHGQTLTFAAPAFVMPHFTLSSIIGI
                     GIPFFVVTMASQNAPGIATLKAHGYHLPVSPLISWTALTALILAPFGGFTICIAAITA
                     AICMGEDIHPDPKKRYMAAVAAGIFYLIAGVFGGSIGMVFTALPQALIHTIAGLALLG
                     TIAGSLYRALENERQRDAAIITFLITASGVTLLGVGSAFWGLAGGVATHLILSIPARN
                     RDKSAGKS"
     gene            83790..84356
                     /locus_tag="RAHAQ2_RS00365"
                     /old_locus_tag="Rahaq2_0075"
     CDS             83790..84356
                     /locus_tag="RAHAQ2_RS00365"
                     /old_locus_tag="Rahaq2_0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014333348.1"
                     /db_xref="GI:504099354"
                     /translation="MQELTDHIGSQLKAVRSERGWSLSQTAEHTGVSKAMLGQIERGE
                     SSPTVATLWKIASGLNVSFSEFLETPPAQSAALHRHGLLTTFNSDTSGMRVVPLFPFD
                     TTLRMDMFVIDLEPGGCSESTPHEAGVIEHVIVIEGELMLTVDGVTRVLQAGEGLRFA
                     ADCPHAYRNESGHSVRFHDLIHYPQSRP"
     gene            84385..84837
                     /locus_tag="RAHAQ2_RS00370"
                     /old_locus_tag="Rahaq2_0076"
     CDS             84385..84837
                     /locus_tag="RAHAQ2_RS00370"
                     /old_locus_tag="Rahaq2_0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family N-acetyltransferase"
                     /protein_id="WP_014333349.1"
                     /db_xref="GI:504099355"
                     /translation="MSQPHDVIIRPLAPADREGWEVLWRDYLDFYQSTLDPAQFDYTF
                     RRLSQPDYASMFGYVAVHEGKLVGLVNCINHDHGWHMQQVVYLQDLYVDDGARKLGIG
                     QKLIEAVYAYADENNKANVYWTTQTSNHTARKLYDRVGRLTDFIKYAR"
     gene            complement(84834..85304)
                     /locus_tag="RAHAQ2_RS00375"
                     /old_locus_tag="Rahaq2_0077"
     CDS             complement(84834..85304)
                     /locus_tag="RAHAQ2_RS00375"
                     /old_locus_tag="Rahaq2_0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_014333350.1"
                     /db_xref="GI:504099356"
                     /translation="MTVLVPMSTAFYAEFAEQLARDYAEENVTAGLWQADTALERARS
                     STQSALPQGIDTPDHYLYEIRAQEHSETAGYLWFANIERYGVRSAFVYELTVYPQFRR
                     QGHAAAAFRLMEERLRALGSVAIELNVFASNPGAQALYASLGYVTTKMNMRKPL"
     gene            complement(85319..85858)
                     /locus_tag="RAHAQ2_RS00380"
                     /old_locus_tag="Rahaq2_0078"
     CDS             complement(85319..85858)
                     /locus_tag="RAHAQ2_RS00380"
                     /old_locus_tag="Rahaq2_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333352.1"
                     /db_xref="GI:504099358"
                     /translation="MKSWLLPLLLLAPLCSQAASTPKEIKARFSQFKVGDKTICLDDV
                     TYANNSKMKVIENGFVVSKRKNVLVYQSNSLFLLGNDVTVNIKAVIESKAGKTGFSNQ
                     FKQAMIRVDGMDDPTRASEKAKIIQSFEEVISDKNNETPYSSVALTDKGYIITQMESH
                     STTISECYVTPYKKVETRQ"
     gene            complement(86074..86553)
                     /locus_tag="RAHAQ2_RS00385"
                     /old_locus_tag="Rahaq2_0079"
     CDS             complement(86074..86553)
                     /locus_tag="RAHAQ2_RS00385"
                     /old_locus_tag="Rahaq2_0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="WP_014333353.1"
                     /db_xref="GI:504099359"
                     /translation="MSNPAYLFLTGVEGSPIVGGSLVSGREGAIELKSVTHNMHIPAD
                     RNTGKLTGTRIHSPITLQKEFDRTTPLLYRALSEGQTLKSATIKMYHILEAGIEAEYF
                     NIILENVKVTSIAPNLYPGNQTGTHFETIQLRYESITWKYVNGNIIYKDTWNERITA"
     gene            complement(86576..86767)
                     /locus_tag="RAHAQ2_RS00390"
                     /old_locus_tag="Rahaq2_0080"
     CDS             complement(86576..86767)
                     /locus_tag="RAHAQ2_RS00390"
                     /old_locus_tag="Rahaq2_0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017799353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040778.1"
                     /db_xref="GI:739176813"
                     /translation="MKKAANAAVGQIGAILGGASVWFSLFFVFYFDTWLERLLAISAM
                     VFVIWIIGKLIDKYYPQDN"
     gene            complement(86789..87439)
                     /locus_tag="RAHAQ2_RS00395"
                     /old_locus_tag="Rahaq2_0081"
     CDS             complement(86789..87439)
                     /locus_tag="RAHAQ2_RS00395"
                     /old_locus_tag="Rahaq2_0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333355.1"
                     /db_xref="GI:504099361"
                     /translation="MDNSEEIAQRIADIIISPDSAIGLVHGILSVPVDLGYLAYGFFD
                     TDSYHAHETETIRIIEAIKRGILEHDRITDAIQTILNDFDKYVSESEQNKTYSRSFFS
                     VVGRTVTNTVIAGKVAIAIAQGTSFFVKVRGGVIGNILLVGGMKERCIRASEKLSVEV
                     PELYATLRLKDYDLLYFLFEPALSPFVDALSVRHQQGSPAFDKILKIVDSKVGARG"
     gene            87735..88364
                     /locus_tag="RAHAQ2_RS00400"
                     /old_locus_tag="Rahaq2_0082"
     CDS             87735..88364
                     /locus_tag="RAHAQ2_RS00400"
                     /old_locus_tag="Rahaq2_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333356.1"
                     /note="catalyzes the formation of
                     2,4-dinitrophenyl-S-glutathione from
                     1-chloro-2,4-dinitrobenzene and glutathione; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_014333356.1"
                     /db_xref="GI:504099362"
                     /translation="MSQPSLILYSDANFFSPYVMSAFVALTEKGIPFELEKVDLANAE
                     NLKENYSAISVTRRVPTLTNGDFVLSESSAIDEYVEELFPAPTFPAIYPADPENRAKA
                     REVQAWLRSDLMPIREERSTEVVFAGAKRPALSANGQQAAEKLYAAAAFLLGDKEHLF
                     GEWCIADVDLALMINRLHLNGDPVPEKLAAYADAQWQRPSVKEWLALSA"
     gene            complement(88356..88802)
                     /locus_tag="RAHAQ2_RS00405"
                     /old_locus_tag="Rahaq2_0083"
     CDS             complement(88356..88802)
                     /locus_tag="RAHAQ2_RS00405"
                     /old_locus_tag="Rahaq2_0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biphenyl 2,3-dioxygenase"
                     /protein_id="WP_014333357.1"
                     /db_xref="GI:504099363"
                     /translation="MKTRLSHAPTESDLEEIKTALRDFNRNFIPKPTFRELGIFVEDE
                     SGKKLAGIVAETVGHWMYIKMLWVDESLRGKDVGTQLITEAEEEAKARGCRYSLVDTF
                     SFQARPFYERMGYSMQMALEDYIPDSRAPDDAPSTHTRFFLTKTLS"
     gene            complement(88822..89457)
                     /locus_tag="RAHAQ2_RS00410"
                     /old_locus_tag="Rahaq2_0084"
     CDS             complement(88822..89457)
                     /locus_tag="RAHAQ2_RS00410"
                     /old_locus_tag="Rahaq2_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_014333358.1"
                     /db_xref="GI:504099364"
                     /translation="MTVTESLLSYALAAGILTLTPGLDTALVLRTAASQGSKKALSTA
                     FGISSGCLVWGAMVALGLGAVLAASEIAFNVLKWIGAAYLAWLGLQMLFKPRSKMNMD
                     APESRHKALRIGNSPFVKGLFGNVLNPKVGVFYVSFLPQFVATGYPVGPYIFGLAAMH
                     AVIGTLWSVTMISATRPLSRWLRRPAVVRTLDRLTGTVFIAFAVRLATTKR"
     gene            complement(89614..89871)
                     /locus_tag="RAHAQ2_RS00415"
                     /old_locus_tag="Rahaq2_0085"
     CDS             complement(89614..89871)
                     /locus_tag="RAHAQ2_RS00415"
                     /old_locus_tag="Rahaq2_0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multiple stress resistance protein BhsA"
                     /protein_id="WP_014333359.1"
                     /db_xref="GI:504099365"
                     /translation="MKNVKIFAVAATLSLISFGSFAAQQINQPTSDMQKIGVISAANS
                     TSISGLEAKLSQQAQEAGASSYRIISVTGNNKLHADAEIYK"
     gene            90276..90524
                     /locus_tag="RAHAQ2_RS00420"
                     /old_locus_tag="Rahaq2_0086"
     CDS             90276..90524
                     /locus_tag="RAHAQ2_RS00420"
                     /old_locus_tag="Rahaq2_0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333360.1"
                     /db_xref="GI:504099366"
                     /translation="MGILSWIIFGLIAGILAKWIMPGKDGGGFILTIVLGVVGAVVGG
                     YISTFFGFGRVDGFNFGSFVVAVIGAIVVLFIYRKIRN"
     gene            complement(<90663..90923)
                     /locus_tag="RAHAQ2_RS00425"
     CDS             complement(<90663..90923)
                     /locus_tag="RAHAQ2_RS00425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012197990.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040791.1"
                     /db_xref="GI:739176826"
                     /translation="MSRYKIAREAQDDLFDIQRYSQAHWGKAQSDKYLSELSDLFSLL
                     ATHPDMGRPVSFHKDLFRFPHQHHVAYFLTTPAGLIFIAIMHK"
     gene            complement(90925..91185)
                     /locus_tag="RAHAQ2_RS00430"
                     /old_locus_tag="Rahaq2_0088"
     CDS             complement(90925..91185)
                     /locus_tag="RAHAQ2_RS00430"
                     /old_locus_tag="Rahaq2_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death protein"
                     /protein_id="WP_014333362.1"
                     /db_xref="GI:504099368"
                     /translation="MKSLSANEVKTQFGDVLLRVQREPVQINRNGKPVAVMLSIEDYQ
                     MLEEIKMRLLKEKVARAEADIAHGDVMDGETFFAQLMSGKRD"
     gene            complement(91275..91658)
                     /locus_tag="RAHAQ2_RS00435"
                     /old_locus_tag="Rahaq2_0089"
     CDS             complement(91275..91658)
                     /locus_tag="RAHAQ2_RS00435"
                     /old_locus_tag="Rahaq2_0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040776.1"
                     /db_xref="GI:739176811"
                     /translation="MMKIKSQEALVRQRKRWIMLAVLVAVIAGCHQWWKQGKLVSEEW
                     SPNKQYVVREYKTFEFIPRMTMPGDGGHYSGYMRVYNRDGKQFYEEYSDLLDFIEGPF
                     WAKEGVYWMGNENQDIVRLPTSPVE"
     gene            complement(91744..92442)
                     /locus_tag="RAHAQ2_RS00440"
                     /old_locus_tag="Rahaq2_0090"
     CDS             complement(91744..92442)
                     /locus_tag="RAHAQ2_RS00440"
                     /old_locus_tag="Rahaq2_0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter ATP-binding protein"
                     /protein_id="WP_014333364.1"
                     /db_xref="GI:504099370"
                     /translation="MLQVNELNQFYGGSHILRGLSFEAKIGEVTCLLGRNGVGKTTLL
                     KCLMGLIPAKSGTIRWQDQVINSRKPHQRVQAGIAYVPQGREIFPRLTVEENLLMGLS
                     RFSGSHAKQVPDEIYHLFPILLEMKHRRGGDLSGGQQQQLAIGRALACKPSLLILDEP
                     TEGIQPSVIKEIGAVIKQLAARGDMAILLVEQFYDFAAELADSYLVMSRGSIVKRGRG
                     DEMEAEGVRGLVAI"
     gene            complement(92454..93251)
                     /locus_tag="RAHAQ2_RS00445"
                     /old_locus_tag="Rahaq2_0091"
     CDS             complement(92454..93251)
                     /locus_tag="RAHAQ2_RS00445"
                     /old_locus_tag="Rahaq2_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter ATP-binding protein"
                     /protein_id="WP_037040789.1"
                     /db_xref="GI:739176824"
                     /translation="MTMTEDLFTQPQLADRHREQTDPILQLENINVSFDGFKALTNLS
                     LNISVGELRCVIGPNGAGKTTLMDVITGKTKPQSGRVFYDQRTDLTKLDPVQIAQSGI
                     GRKFQKPTVFEALTVFENLEIAQKTNKSVWACLRAKMNSEQRDRIDEMLGTLRLAAER
                     HRPAGLLSHGQKQFLEIGMLLVQEPHLLLLDEPAAGMTDAETEYTAELFKQLAGRHSL
                     MVVEHDMGFVETIADHVTVLHQGQVLAEGSLRDVQANEQVIDVYLGR"
     gene            complement(93260..94333)
                     /locus_tag="RAHAQ2_RS00450"
                     /old_locus_tag="Rahaq2_0092"
     CDS             complement(93260..94333)
                     /locus_tag="RAHAQ2_RS00450"
                     /old_locus_tag="Rahaq2_0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_014333366.1"
                     /db_xref="GI:504099372"
                     /translation="MSQPLTITGVQKAPKIAISVGTLVLIILIVMPFLALLPATNPLA
                     ISTYTLTLIGKILCYAIVAIALDLVWGYAGLLSLGHGLFFALGGYAMGMYLMRQAAGS
                     GLPDFMSFLSWTELPWFWAGTQHFAWALCLIVLVPGALAFVFGYFAFRSKIKGVYFSI
                     MTQALTYAGMLLFFRNETGFGGNNGFTGFTTLLGFPVTATGTRVGLFLATVLVLVASL
                     ALGFALARSKYGRVLTAVRDAENRLIFCGYDPKGFKLFVWTISAMLCGLAGALYVPQV
                     GIINPSEMSPTNSIEAAIWVALGGRGTLIGPIIGAGIVNGAKSWFTVAIPEYWQFVLG
                     GMFILVTLFLPQGVIGLLRKRKS"
     gene            complement(94333..95901)
                     /locus_tag="RAHAQ2_RS00455"
                     /old_locus_tag="Rahaq2_0093"
     CDS             complement(94333..95901)
                     /locus_tag="RAHAQ2_RS00455"
                     /old_locus_tag="Rahaq2_0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter permease"
                     /protein_id="WP_014333367.1"
                     /db_xref="GI:504099373"
                     /translation="MRILIRSLLFLLCCLPLLAEAGAANDFAAASRSQQATLLQQWAA
                     DPQPERLPLLEALKQENVVTDEAKHAFTQNGDQLTPLEGDVKPQGEVKKVWLNNRLRI
                     LIANALSAHRLVSTDSAVRLQAAKSLQREAQADQLPLLTHRLEQEKDSTVHDALSIAL
                     ANLQLADTRPQVRLKAVELLGTSGDPDTQGRLQSLTDPKTEPDATVRNAALASLKAVQ
                     HRLMMGDLLGQAFTGLSLGSILLLAALGLAITYGLLGVINMAHGEMLMLGSYSTYMVQ
                     SLFQHYAPGLLALYPLVALPVAFFITAGTGMALERTVIRHLYGRPLETLLATWGISLI
                     LIQGVRVLFGAQNVEVANPGWLSGGIQLLPNLVLPYNRIAVIIFVLLVLGLTWLLLNK
                     TRLGMNVRAVTQNRAMAACCGVPTGRVDMLAFGLGSGIAGLGGVALSQLSNVGPELGQ
                     GYIIDSFLVVVLGGVGQLAGTVVAAFGLGIVNKILEPEIGAVLGKILILALIILFIQK
                     RPQGLFAFKGRVID"
     gene            complement(96092..97360)
                     /locus_tag="RAHAQ2_RS00460"
                     /old_locus_tag="Rahaq2_0094"
     CDS             complement(96092..97360)
                     /locus_tag="RAHAQ2_RS00460"
                     /old_locus_tag="Rahaq2_0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014333368.1"
                     /db_xref="GI:504099374"
                     /translation="MQRRRFIKAFALSASVVSMGLAWSAQAAETIKVGIMHSLSGTMA
                     ISETPLKDIALMTIDDINAKGGVLGKKLEPVVVDPASNWPLFAEKARQLLTQDKVAVV
                     FGCWTSVSRKSVLPVFEELNGLLFYPVQYEGEEMSPNVFYTGAAPNQQAIPAVEYLMS
                     EDGGAAKRFFLLGTDYVYPRTTNKILRAFLHSKGVKDSDIEEVYTPFGYSDYQTIVSN
                     IKKFSAGGKTAVISTINGDSNVPFYKELANQGVKATDVPVVAFSVGEEELRGIDTKPL
                     VGDLAAWNYFQSVDNPTNKKFVAEWKAYAKAHKLPNADNAVTNDPMEATYVGIHMWAQ
                     AVEKAGTTDVDKVRAAMAGQTFAAPSGFTLTMDKTNHHLHKPVMIGEIESNGQFNVVW
                     QTDKPIRAQPWSPYIAGNDKKPDTPVKTVN"
     gene            complement(97446..98168)
                     /locus_tag="RAHAQ2_RS00465"
                     /old_locus_tag="Rahaq2_0095"
     CDS             complement(97446..98168)
                     /locus_tag="RAHAQ2_RS00465"
                     /old_locus_tag="Rahaq2_0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014333369.1"
                     /db_xref="GI:504099375"
                     /translation="MQLTGSKSSRSKSRPEGLAERIYQQLKDDIFSFRLLPGDRFSEN
                     DIADRMEVSRTPVRQALFWLEHEGYVEVFFRSGWQVRPFDFDFFEQLYDLRIVLELEA
                     VKRLCALPPAAQPLQLAELKAFWVDQPQLAEGQLVSRYDEEFHMTLVAAAGNAEMARI
                     HRELTEKIRIIRRLDFTKGERVNATYKEHASILLAIIQQHTEEAQRQLHDHIAVSKAE
                     VRKITLHMLHRARAESDEGNPS"
     gene            complement(98197..101829)
                     /locus_tag="RAHAQ2_RS00470"
                     /old_locus_tag="Rahaq2_0096"
     CDS             complement(98197..101829)
                     /locus_tag="RAHAQ2_RS00470"
                     /old_locus_tag="Rahaq2_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea amidolyase"
                     /protein_id="WP_014333370.1"
                     /db_xref="GI:504099376"
                     /translation="MFNTVLIANRGEIACRAIRTLKRLGITSVAVYSDADRNAPHVTQ
                     ADIAIALGGEKASESYLMIDKILAAAKETGAQAIYPGYGFLSESAEFADACEAAGIAF
                     IGPTAGQIREFGLKHRARELAGAANVPMTPGTGLLDSMDDAVKAAAEIGYPIMLKSTA
                     GGGGIGLTRCDDEEALRAAWDSVKRLGEQFFRDAGVFLERFVDRARHVEVQIFGDGKG
                     HVVALGERDCSLQRRNQKVVEETPAPNLPQASREALHRAAVQLGQSVNYRSAGTVEFI
                     YDAARDEFYFLEVNTRLQVEHPVTEMVTGLDLIECMLNVAANEPADWPAMAKAPQGAS
                     MEVRIYAEDPLKNFQPSPGVLTEVFFPDDVRVDGWVSTGSEVSAFYDPMIAKLIVHGT
                     DRQDALAKMSAALAATRLHGIATNIDYLRQVVATPVFRDGEMWTRMLDSFVYAPHAIE
                     VIAPGTYSSVQDYPGRLGYWDIGVPPSGPMDDFAFRLANRIVGNHPDAAGLEFTLQGP
                     TLRFHCDAVIALTGARCPATLDGEPVSYWQPVEVKAGQTLTLGRATQGCRTCLAVRNG
                     FDVPVYLGSRSTFALGQFGGHAGRTLRVADMLTVSQPELAACTTPAPVSLPQAAAENI
                     VPPYGELWNIGVLYGPHGAPDFFTKESIDTFFAAEWQVHYNSNRLGVRLVGPKPQWAR
                     QDGGEAGLHPSNVHDCEYAIGAINFTGDFPVILTRDGPSLGGFVCPVTIAKAELWKVG
                     QVKPGDKIRFHPISFEQAQALERAQQGTLDSLMPVNAMALPVPSLLPDTTASATVLAA
                     LPATADRPSVEYRQAGDGYVLIEYGDNVLDLAVRMRIYLLMNAIRAAGQQGIEELSPG
                     VRSLQIRYDSRVLHQTALLQHLLTLEHNLDDVSQLKIPTRIVHMPMAFEDAATLGAVE
                     RYQQTVRADAPWLPNNVDFIQRTNGLSSRDEVKNIIFDASYLILGLGDVYLGAPCAVP
                     VDPRHRLLSSKYNPARTFTAEGTVGIGGMYMCIYGMDSPGGYQLVGRTLPIWNKFLKN
                     EQFKNGEPWLLHFFDQVRFYEVTEAELDIQREAFREGRAQIHIEETEFDFAQYTQFLA
                     DNAADIADFRARQADAFTREVAHWHEAESVAVEAAANAVQLVEDDADQDGHLVSADLN
                     GNVWKILVQPGQQVEEGQPLIVVEAMKMELSVNAPCAGTVLKISCQQGRPVGPGDALL
                     WLDAAV"
     gene            complement(101840..103687)
                     /locus_tag="RAHAQ2_RS00475"
                     /old_locus_tag="Rahaq2_0097"
     CDS             complement(101840..103687)
                     /locus_tag="RAHAQ2_RS00475"
                     /old_locus_tag="Rahaq2_0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333371.1"
                     /note="catalyzes the hydrolysis of allophanate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase"
                     /protein_id="WP_014333371.1"
                     /db_xref="GI:504099377"
                     /translation="MASASDTVASPFHGFTLREWQQHYRNAPDSLRSTLSLVLGSLSE
                     TDNAWIYLATAEQLEAQITRLETLRDQAEGSLSALPLFGVPFAVKDNMDIAGWPTTAA
                     CPAFAYTAQADATVIANLKAKGAVVIGKTNLDQFATGLVGTRSPYGAVRNTFNPDYVS
                     GGSSSGSASVLARGLVAFSLGTDTAGSGRVPAGFNNIVGLKPTKGWLSNTGVVPACRL
                     NDAVSIFALTVADAQTVAHAAGGYDAADAYSRKNPHTAPVAFSAQPRIAMPDRLEFCG
                     DDLAQAAFSEALDRMRHHGVTLEPIDFTPFRELAEQLYYGAWVAERTVAVGEIFEESP
                     EAMDPVVRGIVANGLNYSACDAWRAEYLRAELARKINLALEGFDALVVPTSPTIRTQE
                     ELVREPVLYNSQFGIYTNFTNLADLSALALPSGLRADGLPAGITLIAPAWHDDALASF
                     GRQWQRSLSLPLGATGLTMKPEEFMSAAPVSTASVRVAVVGAHLTGMPLNFQLTRRHA
                     VRVEQTTTAAAYKLYALANTTPPKPGLVRAEGGSAIVVELWDIPLARLGEFVAEIPAP
                     LGIGTLELADGRTVKGFICEPWAISGATDITAFGGWRSYIQNLNSPVKS"
     gene            103973..105418
                     /locus_tag="RAHAQ2_RS00480"
                     /old_locus_tag="Rahaq2_0098"
     CDS             103973..105418
                     /locus_tag="RAHAQ2_RS00480"
                     /old_locus_tag="Rahaq2_0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333372.1"
                     /db_xref="GI:504099378"
                     /translation="MQLRHLSERLKKLLLALVLVIITLLAVRTYDALQGPPLEPWHKL
                     VPDELSVEQLDKSDWSAYLRAEQQAFVEVKQQVTDKLDREDRIPLNRYYDRSPIYPEH
                     FAQDWNRSYELMPDGKPAGAVVLLHGLTDSPYSLRHIAQDYRRRGFVVVGIRLPGHGT
                     VPGGLTRVDWEQWLAATRLAVREARRTAGAEVPLQLVGFSNGGALAMKYTLDSLDDPA
                     LARPSRVVLISPMIGVTSFARFAGYAGWPAIFPAFAKTAWLNLMPEFNPFKYNSFPVK
                     AARQSYLLTHILQQQISKDAQSGKLAQLPPLLAFQSVVDSTVSSRAVVTALFNQLPAN
                     GSQLVLFDINRSAYVGPLLRPSSETAAERLLPAPPRTYQTTVVTNASPDDAAAVAKTT
                     AAGESAATVSPLGLNYPPEFYSLSHVSLPFPTDDSLYGRNPQGPAQFGIRLGTLAARG
                     ENGALVVSMDQLMRVSSNPFYPYMLQRIEGF"
     gene            105491..105949
                     /locus_tag="RAHAQ2_RS00485"
                     /old_locus_tag="Rahaq2_0099"
     CDS             105491..105949
                     /locus_tag="RAHAQ2_RS00485"
                     /old_locus_tag="Rahaq2_0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_037040768.1"
                     /db_xref="GI:739176802"
                     /translation="MTTDTDSTPNSMLHLDQQMCFALYSANLALHKVYRKLLGQLELT
                     YPQYLVMLVLWQRDEVTVSEIGEKLFLDSATLTPLLKRLEAAGLLVRQRAKADERQVI
                     ISLTEAGKTLREKAQGIPEAILCATECDIGEIVALKQQLEVLRAKLQDKA"
     gene            106084..106506
                     /locus_tag="RAHAQ2_RS00490"
                     /old_locus_tag="Rahaq2_0100"
     CDS             106084..106506
                     /locus_tag="RAHAQ2_RS00490"
                     /old_locus_tag="Rahaq2_0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ohr subfamily peroxiredoxin"
                     /protein_id="WP_013573432.1"
                     /db_xref="GI:503338771"
                     /translation="MSIEKVVYRAHASATGGRDGRATSDDGVLDVKLGVPKEMGGMGG
                     GTNPEQLFAAGYSACFLGALKAVAAQEKIKIPADAKIEGAVGIGAIPGGYGIEVQLDI
                     TLPGFERSEAEALVAKAHQVCPYSNATRGNIDVTLNVK"
     gene            106778..108457
                     /locus_tag="RAHAQ2_RS00495"
                     /old_locus_tag="Rahaq2_0101"
     CDS             106778..108457
                     /locus_tag="RAHAQ2_RS00495"
                     /old_locus_tag="Rahaq2_0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573433.1"
                     /note="catalyzes the addition of a phosphoethanolamine
                     group to the outer Kdo residue of lipopolysaccharide;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoethanolamine transferase"
                     /protein_id="WP_014333374.1"
                     /db_xref="GI:504099380"
                     /translation="MNRVKTLSQQNISLLLAIYIGIFLNVSVFQRRFAALVNHFTSAE
                     LVQAVTEVCAIVLFTFFVLRLLSLGGRLFFRIIASLLVLISVAASYYMVMFNVVIGYG
                     IVVSVMTTDIDLSKEIIGYHLFIWMALVSAIPLFLIWKNNLRLTLIEQMKTPGQRVLP
                     LGVLLAAALLVWLPLRTLDHAQSVNEKKTNVDLPSYGGVVAHSYLPSNWLAALGLYAY
                     TQVDESQDASHYFDPAKEFTYVPPADIDDTYVVFIIGETTRWDHLGILGYERDTTPRL
                     SKEKNLVAFRGTSCDTATKLSLRCMFVREGGTVDNPQRTLKEQNIFAVMKSLGFTSEL
                     FAMQSELWFYNNADTNNFSFREIIASEKRNDGKPVDDMLLVNELAQSLKTHPKGKHLV
                     ILHTKGSHYLYSQRYPRSYARYTPECKSNTCTKAELINAFDNSVLYTDTFIDNVIDQL
                     RDKKALVFYASDHGESIDENSHLHGTPREMAPPEQFRVPMMVWASDSFLEQPDHKLAF
                     EQLQAQQRVGAKKRHVELFDSILGCLGYTSPDGGINPANNWCAKPQTEQKL"
     gene            108558..108634
                     /locus_tag="RAHAQ2_RS00500"
                     /old_locus_tag="Rahaq2_0102"
     tRNA            108558..108634
                     /locus_tag="RAHAQ2_RS00500"
                     /old_locus_tag="Rahaq2_0102"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:108592..108594,aa:Pro,seq:tgg)
     gene            complement(109029..109508)
                     /locus_tag="RAHAQ2_RS00505"
                     /old_locus_tag="Rahaq2_0105"
     CDS             complement(109029..109508)
                     /locus_tag="RAHAQ2_RS00505"
                     /old_locus_tag="Rahaq2_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin"
                     /protein_id="WP_014333375.1"
                     /db_xref="GI:504099381"
                     /translation="MHNQAMEINGWTLLAHPLILQQIQALTDQVVLLRRKDPAGYKSK
                     NATKRLAAINKLMFDVIPQDPARVEFRQGDTLGGEFSHWFRAKFFQQYRLFFRYNLKS
                     RIIIYAWVNDDKELRAYESKTDAYRMFRKMLKSGEPPDNWQALVESCSHELAEQKLP"
     gene            complement(109515..109859)
                     /locus_tag="RAHAQ2_RS00510"
                     /old_locus_tag="Rahaq2_0106"
     CDS             complement(109515..109859)
                     /locus_tag="RAHAQ2_RS00510"
                     /old_locus_tag="Rahaq2_0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016956557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="WP_014333376.1"
                     /db_xref="GI:504099382"
                     /translation="MSASAVWGIKFEAESKVTRRFQTTIPATIRKALNLTENDRIQYK
                     ILPDGQVVISRQLEEAEDPVISAFLGFVAKDMLNNPENMQPVTLSLHEKINVLTAGMA
                     IDLESPLSDDDE"
     gene            complement(109941..110270)
                     /locus_tag="RAHAQ2_RS00515"
                     /old_locus_tag="Rahaq2_0107"
     CDS             complement(109941..110270)
                     /locus_tag="RAHAQ2_RS00515"
                     /old_locus_tag="Rahaq2_0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module toxin RelE"
                     /protein_id="WP_014333377.1"
                     /db_xref="GI:504099383"
                     /translation="MSEGLSGQRIDTFESHRFTKAFGRLPLSQQVIVEDEIERIQDDP
                     RLGELKKGDLSYLRVHKFPLEKQQALLGYCWREEKIELYLLSLDSQENFYQDHKNHRK
                     GDLKMMK"
     gene            complement(110239..110475)
                     /locus_tag="RAHAQ2_RS00520"
                     /old_locus_tag="Rahaq2_0108"
     CDS             complement(110239..110475)
                     /locus_tag="RAHAQ2_RS00520"
                     /old_locus_tag="Rahaq2_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333378.1"
                     /db_xref="GI:504099384"
                     /translation="MATSIRLDDDFVSDVKIHAEASHRSIPKQIEHWAKIGRIAEDNP
                     DLTYRFIVETLLAKSETDNNKVTRYVRRTERSKD"
     gene            complement(110687..112066)
                     /locus_tag="RAHAQ2_RS00525"
                     /old_locus_tag="Rahaq2_0109"
     CDS             complement(110687..112066)
                     /locus_tag="RAHAQ2_RS00525"
                     /old_locus_tag="Rahaq2_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylcitrate dehydratase"
                     /protein_id="WP_014333379.1"
                     /db_xref="GI:504099385"
                     /translation="MNVIEAIARWCCSQPDFSPAARRKAREAITDTLACLYAGQDDFS
                     SRAVRAASETYFTPHASSRLAGGGRAPAAIAALVNGTAAHAIDYDDNFAPGMSHASAV
                     LVPALLAVADDIRASGEQLVKAYLIGLQAQAFVGSGVAPSHYTAGWHGTSTVGCIGSA
                     AGVAWLMGLDQAGIARALSNAVSFASGTKGQFGTPVKPLHAGWAARNAVDAANFARQQ
                     MQGRIDILEAPQGFLEMFGGLTPPGWDIPAILGTHLHIIETTGVMPKRHPCCGSTHMV
                     IDALDDLRAQHDFSDDDVLTVDTLVGIANLRNLAYPQPVNEMQARFSMQYCVDTWLRH
                     GSLGVSDFTPARVAELAEPARLARISMRCYTPEQEAETPPGDRLTHEVTLTLRDGRTL
                     QAGRKLAKGSNREPFSDADRLRKFTDCCAAMHDASDLFRQLNRLEEQEDLAFLAPLLG
                     EPLRDGAQA"
     gene            complement(112086..112868)
                     /locus_tag="RAHAQ2_RS00530"
                     /old_locus_tag="Rahaq2_0110"
     CDS             complement(112086..112868)
                     /locus_tag="RAHAQ2_RS00530"
                     /old_locus_tag="Rahaq2_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014333380.1"
                     /db_xref="GI:504099386"
                     /translation="MTTFMNPAPPLTADRMIETVDLSIAFGKGTHSKTVVDSVTMHIA
                     RGESYGLIGESGCGKSTILRTLTGQNTRYSGAILYQNREQHPVRDKDYYRQVQMVFQD
                     PYASLHPRKMVYHTLLEPLVIHGMDRREARISDVLNALGLSDAFRYRYPHQLSGGQRQ
                     RVALARALIIEPQVLLLDEPTSALDVSVQAEILNLLKKLRRERNLTYLMVTHDLAVVA
                     HLCDRVAIMHQGKLLEELTAAEIRSGAAREPYTQQFLAASRH"
     gene            complement(112868..113734)
                     /locus_tag="RAHAQ2_RS00535"
                     /old_locus_tag="Rahaq2_0111"
     CDS             complement(112868..113734)
                     /locus_tag="RAHAQ2_RS00535"
                     /old_locus_tag="Rahaq2_0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_014333381.1"
                     /db_xref="GI:504099387"
                     /translation="MTETLLDVQNLNIRFKGHRQENHAVRGISFSVGREKVAIVGESG
                     SGKSLTGRSLLKLTPQGASVSADRMQLGDIDLLSTGERQMRKIRGKRISMIMQDPKFS
                     LNPLMRVGHQINEAYRIHFHVSEREARVKALAMLEAVNIRDPERVFDLYPHEISGGMG
                     QRIMIAMMLIPEPDLIIADEPTSALDVTVRQQVLSVLDALLARRKTGLLFITHDLSLV
                     SGFCDRALVMYAGRILEEIAADQLHNARHPYTRALLASQPDLQHPVDMLAIPARDPAW
                     LTGPVYRYGETC"
     gene            complement(113727..114662)
                     /locus_tag="RAHAQ2_RS00540"
                     /old_locus_tag="Rahaq2_0112"
     CDS             complement(113727..114662)
                     /locus_tag="RAHAQ2_RS00540"
                     /old_locus_tag="Rahaq2_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009635589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C550"
                     /protein_id="WP_014333382.1"
                     /db_xref="GI:504099388"
                     /translation="MTDSAKPHLTARPAFSLRAWLDAPVPATPWQARVQQSLNQWRRF
                     RRNTSARFGLIVILFIVAVAIFAPWLATHDIYAQNLHLRLAPPDREYWLGTDELGRDI
                     YSRLIYGARITLYITGLTALIVGPLGLLVGTLAGTVGGWTDTILMRIVDIFLAFPSLI
                     LALGFVAALGPGIENAIIAISLSAWPPIARLARAEALSIRKMDYVAAVRLQGASQMRI
                     ILRHIIPMCLPSVVVRLTLNMAGIILTASGLGFLGLGAQAPSPEWGAMLSSGRQFMMT
                     HWTIAAIPGLSILFTSLAFNLFGDGLRDVLDLRHD"
     gene            complement(114659..115744)
                     /locus_tag="RAHAQ2_RS00545"
                     /old_locus_tag="Rahaq2_0113"
     CDS             complement(114659..115744)
                     /locus_tag="RAHAQ2_RS00545"
                     /old_locus_tag="Rahaq2_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014333383.1"
                     /db_xref="GI:504099389"
                     /translation="MSQLDPTAAGMSPAEPLWLRLRESAARLGKLLVSVFCTLLGLAA
                     LTFFIGRLLPIDPVVSVLGDNASQEAYQKMYHLLGLDKPLWEQFLMYLKNVAMLDFGN
                     ALTTGNPVTTDIARVFPATLELATLAALIATCLGIPAGVLSAMYRNTWFDHCIRFIGL
                     LGHSAPNFWLGLMGLVLFYAGLGWIGGPGRIDFMYEFDVQKVTGFYLIDTALTGNWEA
                     FRNVFSHLILPASILGLSGLSYISRMTRSFMIEQLGQEYVITARVKGLSWARSVWIHA
                     FRNVAVQVVTVVALSYAFLLEGAVLTETVFAWPGFGRYLTNAMLAGDMNAVVGCSLLI
                     GVIFVALNLICDLLYRIFDPRTRQEQS"
     gene            complement(115773..117371)
                     /locus_tag="RAHAQ2_RS00550"
                     /old_locus_tag="Rahaq2_0114"
     CDS             complement(115773..117371)
                     /locus_tag="RAHAQ2_RS00550"
                     /old_locus_tag="Rahaq2_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014333384.1"
                     /db_xref="GI:504099390"
                     /translation="MLNTRIKMLATLTGLTLGCSAAQAATPADSLVMAWNIDAISTFD
                     PAQIGEVVTNEIIKNTCDTLVDFDPQDESKVIPRLAKSWDISPDRKQITFHLNTGMTF
                     PSGNKATAKDVAWSLQRVVLLGFGNSATLTEYGFTKENVKERITAPDDDTLVMTFDQP
                     YPTNLVLQAIAANNVSTTLDKALVEKNAVGDDMGNKYLTTHTACVGAYQLMRWNAGEG
                     VVLQANKDYWGEKPKLQRILIRHVAETGTQRLLLTQGDVDIARDLAPDDLRDLDKGGQ
                     VNVVKVLKPQLFFWTFNSEDPIFKNPKVRLAMRYLIDYQGLASTVMPYLGVPRASFAQ
                     LGAFGALDKDAGQPFKLDLAKARQLLTEAGYPDGFSARLIIGTLPHSAPIAQSTQENA
                     SKIGVKLSIESMANAQLFSRVRGREFQSAMMAWQTSVPDAHGNASRLVYNPDNSKEAK
                     KTQYPSWRASYFDPAMNKKVTEALLEPDEQKRIALYHSLQEEQMQQGPMAIMFQMYNT
                     AGLTRQVKDWTWNGFRVYYALASK"
     gene            complement(117585..119024)
                     /locus_tag="RAHAQ2_RS00555"
                     /old_locus_tag="Rahaq2_0115"
     CDS             complement(117585..119024)
                     /locus_tag="RAHAQ2_RS00555"
                     /old_locus_tag="Rahaq2_0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M20"
                     /protein_id="WP_014333385.1"
                     /db_xref="GI:504099391"
                     /translation="MNNASAQNKESVWSLVDAKKALFTALSDRVWGMPEICYTEYRSV
                     AEHTAMLKEQGFRVTENVADIPTAVMGEAGEGGPIIAILGEYDALPGLSQVAGIARPE
                     PLPGNGQGHGCGHNLLGSAAMLAATALKDWLAQTGTPGRVRYYGCPAEEGGAAKSFMA
                     RAGAFDGVDIAITWHPNAFSEVARAESLANTRMDFVFHGRSSHAAASPHLGRSALDAV
                     ELMNVGVNYLREHVPQDSRIHYAMLDSGGIAPNVVQARAAVRYAIRSRDVHAMFELNE
                     RVKKVAQGAAMMTETTVDISIMSAVANLLGNRPLEEAMQRNFALLGPLEFDAADKAFA
                     AEIQATLSPQDLQSAYRRIGLKKPQDASPLCEFIVPLETSGELMLGSTDVGDISWKMP
                     TVQAHVPTYAIGTPGHSWQLTAQGKMPAAHKGLAYVAKIMAATAIDTLTDSALMAAAK
                     QAHQELTAETPYVCPIPPEVKPPVQPRPE"
     gene            complement(119282..120208)
                     /locus_tag="RAHAQ2_RS00560"
                     /old_locus_tag="Rahaq2_0116"
     CDS             complement(119282..120208)
                     /locus_tag="RAHAQ2_RS00560"
                     /old_locus_tag="Rahaq2_0116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014333386.1"
                     /db_xref="GI:504099392"
                     /translation="MELKWFEDFLSVSQCYSFTRAASERNITQSALSRRIKQLEEWLG
                     VPLFDRKTYPIRLTPQGQDFLHTAAELVFSMTQLRSDLRERHAQKHTIVHFAALNTLS
                     LTFFPDWINQIDPSHQYGYIRLCDQQPSFSGNISLLLDGETDFLLTYAHDSVPLMKQL
                     ERFPYIELGKESALAVCAPDEDGNPLFALNTSGGTRVQLPYLSYGNRSFFAHALSALF
                     ASRPLPLKPIYENPMCSGLKAMTISGCGVAWLPASLISEELANGSLIRAGERSWDIQA
                     SIRLYRLEKFRTPQAERLWNKASQLHQTRAVA"
     gene            120937..122544
                     /locus_tag="RAHAQ2_RS00565"
                     /old_locus_tag="Rahaq2_0117"
     CDS             120937..122544
                     /locus_tag="RAHAQ2_RS00565"
                     /old_locus_tag="Rahaq2_0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333387.1"
                     /note="DppABCDF is involved in the transport of
                     dipeptides; also binds heme and mediates chemotaxis to
                     dipeptides; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014333387.1"
                     /db_xref="GI:504099393"
                     /translation="MTISLGKSGLLKFSMGLIALTVAASVQAKTLVYCSEGSPEGFNP
                     QLFTSGTTYDASSVPIYNRLVEFKIGTTEIQPGLAEKWDVSADGKTYTFHLRKGVKWQ
                     DNKEFKPTRDFNADDVVYSFERQLDKNNPYHGVSGGSYEYFEGMGMGDLINKIVKVDD
                     NTVQFVLNRPESPFLADLAMDFASILSAEYADNMLKAKTPEKVDLDPIGTGPFQLVQY
                     QKDSRILYKAFPGFWGTKPQIDRLVFSITPDASVRYAKLQKNECQVMPYPNPADIAAM
                     KKDKSINLMQQPGLNVGYLSFNVEKKPLDEVKVRQALTMAVNKKAIIDAVYQGAGQPA
                     KNLIPPTMWGYNKDVVDYEYNPEKAKELLKEAGHADGFAIDLWAMPVQRPYNPNARRM
                     AEMIQADWAKIGVKANIVTYEWGEYLKRAKNGEHQSVMMGWTGDNGDPDNFFATLFSC
                     AAAKDGSNYSRWCYKPFEDLIQPARAESDHAKRAALYQQAQVVMHDQAPALIIAHSTV
                     YEPVRKEVKGYVVDPLGKHHFENVSME"
     gene            122752..123771
                     /locus_tag="RAHAQ2_RS00570"
                     /old_locus_tag="Rahaq2_0118"
     CDS             122752..123771
                     /locus_tag="RAHAQ2_RS00570"
                     /old_locus_tag="Rahaq2_0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009110842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_014333388.1"
                     /db_xref="GI:504099394"
                     /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVTIMAGERGV
                     SPERHAQLMADMGLDKPLYQQYFHYVNGVLHGDLGTSLKSRTPVWQEFVPRFKATVEL
                     GICAMIFAIIVGIPVGVLAAVKRGSIFDHTAVGISLTGYSMPIFWWGIMLVMLVSVQL
                     NLTPVSGRISDTVFLDDSLPLTGFMLIDTLFWGEPGDFVDAVMHMILPAIVLGTIPLA
                     VIVRMTRSSMLEVLGEDYIRTARAKGVSRMRVIVVHALRNALLPVVTIIGLQVGTLLG
                     GAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATLIIVVNLLVDVLYGVVNPR
                     IRHKK"
     gene            123782..124696
                     /locus_tag="RAHAQ2_RS00575"
                     /old_locus_tag="Rahaq2_0119"
     CDS             123782..124696
                     /locus_tag="RAHAQ2_RS00575"
                     /old_locus_tag="Rahaq2_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter"
                     /protein_id="WP_014333389.1"
                     /db_xref="GI:504099395"
                     /translation="MSQTTEPVANELVTAAPVPMPPMREFWHYFKRNKGAVVGLVYII
                     IMLVIAIGANVIAPHLPAEQFRDALLRPPVWMEGGSWKFLLGTDDVGRDILSRLMYGA
                     RLSLLVGCLVVVLSLILGVVFGLFAGYYGGVVDAIIMRVVDIMLALPSLLLALVLVAI
                     FGPSIVNASLALTFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGSARQMFVNILPN
                     CLAPLIVQASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFP
                     GVIILLTVLAFNLMGDGLRDALDPKLKQ"
     gene            124749..125732
                     /gene="dppD"
                     /locus_tag="RAHAQ2_RS00580"
                     /old_locus_tag="Rahaq2_0120"
     CDS             124749..125732
                     /gene="dppD"
                     /locus_tag="RAHAQ2_RS00580"
                     /old_locus_tag="Rahaq2_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573447.1"
                     /note="DppD and DppF are the ATP-binding components of the
                     ABC dipeptide transport system DppABCDF; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_037040761.1"
                     /db_xref="GI:739176793"
                     /translation="MLTVDKLSVHFGDEGTPFRAVDRISYSVKQGEVVGIVGESGSGK
                     SVSSLALMGLIDFPGKVMAEKLEFGGRSLQGISEKERRQIVGAEVAMIFQDPMTSLNP
                     CYTVGFQIMEAIKVHQGGNKKTRRQRTIDLLNLVGIPDPASRLDVYPHQLSGGMSQRV
                     MIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLDLQQRENMALMLITHDLALVAEA
                     AQHIIVMYAGQVVESAKATEIFRAPRHPYTQALLRSLPEFAADKARLQSLPGVVPGKY
                     DRPAGCLLNPRCPYATDLCRKEEPALRDLANGRQSKCHYPLDDAGRPTYES"
     gene            125722..126744
                     /gene="dppF"
                     /locus_tag="RAHAQ2_RS00585"
                     /old_locus_tag="Rahaq2_0121"
     CDS             125722..126744
                     /gene="dppF"
                     /locus_tag="RAHAQ2_RS00585"
                     /old_locus_tag="Rahaq2_0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573448.1"
                     /note="Part of the ABC transporter complex DppABCDF
                     involved in the transport of dipeptides; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_013573448.1"
                     /db_xref="GI:503338787"
                     /translation="MSPDNTQPQPLLHAIDLKKHYPVKKGIFGQERTVKALDGVSFTL
                     ERGKTLAVVGESGCGKSTLGRLLTMIEVPTGGELYYRGQDLLKPDATAEKLRRQKIQI
                     VFQNPYGSLNPRKKVGQILEEPLLINTKLSREERREKALAMMAKVGLKTEHYDRYPHM
                     FSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLSYVFIS
                     HDLSVVEHIADEVMVMYLGRCVEKGPKDAIFSNPRHPYTQALLSATPRLNPDERRERI
                     KLTGELPSPLNPPAGCAFNARCRRAFGTCKQFQPQLKQYGDQLVACFAVDQDETGTTQ
                     TVAVNQ"
     gene            complement(126808..127416)
                     /locus_tag="RAHAQ2_RS00590"
                     /old_locus_tag="Rahaq2_0122"
     CDS             complement(126808..127416)
                     /locus_tag="RAHAQ2_RS00590"
                     /old_locus_tag="Rahaq2_0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mobile mystery protein B"
                     /protein_id="WP_014333391.1"
                     /db_xref="GI:504099397"
                     /translation="MSETINNGLPEGATELSPDDLAGLIPDYIFTREDLNQFEKTNIQ
                     QALAHLSRQKLSYTEILTVDFCLRLHRNMFNKTWEWAGQLRRREVNIGNTPPHMISMR
                     VRDTLDNAVFWIENETYPPDEICLRLHRDIVWIHPFPNGNGRHSRIFCDVLRRALGRG
                     FFPWGISAGELVSADAHRAEYILALREADNGDYRRLIRFASD"
     gene            complement(127413..127880)
                     /locus_tag="RAHAQ2_RS00595"
                     /old_locus_tag="Rahaq2_0123"
     CDS             complement(127413..127880)
                     /locus_tag="RAHAQ2_RS00595"
                     /old_locus_tag="Rahaq2_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mobile mystery protein A"
                     /protein_id="WP_014333392.1"
                     /db_xref="GI:504099398"
                     /translation="MWDKELKIKQVDNLLNEMKPRRKARRPKKGWIQLLRSALGMSTR
                     SLAERCGLSQSRISLIEKGEIEGSLTLNTLEKIAEGLDCELVYFLQPKQGRTLQELRE
                     QQAGKKAKFLNQYTEIHMSLEQQPTSSAFQKSTQDKLKSDLLQKWPRDFWDEK"
     gene            complement(128074..129087)
                     /locus_tag="RAHAQ2_RS00600"
                     /old_locus_tag="Rahaq2_0124"
     CDS             complement(128074..129087)
                     /locus_tag="RAHAQ2_RS00600"
                     /old_locus_tag="Rahaq2_0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoglucanase"
                     /protein_id="WP_014333393.1"
                     /db_xref="GI:504099399"
                     /translation="MLAFRRYGLVLWFSLIFAFFSSAVMAQDPGWSAYKSRFLMPDGR
                     IIDTANKNVSHTEGQGFSMLLAVFNDDQATFDKLWQWANNTLYRKDIGLYSWRYDPNS
                     TPHVADINNASDGDTLMAWALLLAGDKWNDPRYTKASEKLQAALITYNVIDYAGYKVM
                     LPGVKGFNQTSNVTVNPSYFIFPAWQAFYAHSHLKVWKDLDESSTAMLSKMAFGDFRL
                     PTDWVDMQADGTLKPASRWPTRFSYDAVRIPLYLGWAHPGSPQLAPFILWWQKSPRDA
                     TPAWIDVMTGTKAGYNMSPGLLAVRDFTMANAGAISPNLAPKDDYYSSTLQLLSWWAS
                     HKG"
     gene            complement(129097..129576)
                     /locus_tag="RAHAQ2_RS00605"
                     /old_locus_tag="Rahaq2_0125"
     CDS             complement(129097..129576)
                     /locus_tag="RAHAQ2_RS00605"
                     /old_locus_tag="Rahaq2_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="WP_014333394.1"
                     /db_xref="GI:504099400"
                     /translation="MQEHNYTQVAQEYYRQRHTTPGWQSLVQVLFSGILASADDEDGR
                     RFLTLMGNNLARQHPLPGSATLGELEDNINQLLSRFDWGVVKLEATQQQLALVHIAWP
                     VSPQGQDDELWPIALISLFEGLYAEWLLSQGGQPYVPLRWQESTPEGAFVFRYQNGL"
     gene            complement(129595..133644)
                     /locus_tag="RAHAQ2_RS00610"
                     /old_locus_tag="Rahaq2_0126"
     CDS             complement(129595..133644)
                     /locus_tag="RAHAQ2_RS00610"
                     /old_locus_tag="Rahaq2_0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis factor"
                     /protein_id="WP_014333395.1"
                     /db_xref="GI:504099401"
                     /translation="MKKHKLSLAVIRAIYLVGIAGVASFSAATFAADTDNPAMKALFD
                     QAAYWHERAHDDLAKDALQKVLLVEPDNAQALYLMSLYSLQGGDKTAANQWREKLTAV
                     SPDDPRLASLNSAKAMQAIPPAQLASARQMAAQGNVSGALSAYRTIFNGNQPPDSLAT
                     EYYLTMAGDKSLQPQAIAGLQQRVASRPDDTQARLGLGKVLTYQESTRRDGIKLLSTL
                     AGSSSEADRSLRQALLWMTPQEADRDLYQGYQARHPNDTGVMAYFQKNIGGAAKGQGF
                     TALNSGDVTSAKAKFESVLADNPNDADALAGLGYIAQRSGNFEQASEYLSKAAAQGGP
                     NSVQLSNQAQDSAFYAQLAKAKDAAGSGSYDAALAAVTPLTQVGGEKGQSASLLRADI
                     LRRKGDLAGAEQQYSAMGDNADARAGLYYVLRQQNKTAEANQVLKTLPAGIQAKMNPP
                     TVADVIEPMRRQAAQAVANNDPQRALNILQQARERQPSNVWVKLDMARILQSQGQTAQ
                     AQSIMAPSARPGASSADLYAAALFASETKNWSTANALLSRIPRSSQNQGMRELAQRVS
                     FNAQMADAESYLQQGNTAAASNTLRALAQNPPTAPADVGALAKNLAASGQLPLAVQLV
                     RQNMRQGVNGNAGDYADQVSVLNQAGLSNEAQAFLQSPQIQSGTSPTALASLRNGFVI
                     TQADQLREQGQYAAAYDKLVVALQADPQNRDLMLAMARLYQSGKLNKQAGQVYNYLMS
                     NDTPTQDARVGAINIALGEGDNQRAKTLMEGLRGPRTPDRLLLEARVAEAQGDHQQAL
                     ALLRSAKGKMIGLEGTDSQAQVAGLQISDNPFINRSTRTSASRPATQSSYGTVLPWQV
                     SDQVSTPGNIPVATTEPTAVTQRNATEKQIDDMLDDLQGKTATWAQGDMSIRGRDGES
                     GLSQLTEAKAPMTFAFVPFDTSRLSIGVTPVSLSAGSPSGTGNTRFGQGALSRGYSSA
                     AAAYNAATGASITSKDVQTYLSDPNNPITTTVNGQSVATFDQYRTQLAAQYTDQCSSV
                     SSNSNAADIAACSALNSSLTRLNGVDPTTYPATEAGNQSATGVEINAALTGDSYKADV
                     GSTPLGQDLNSLVGGVQWAPKLTDFTTLRVTAERRAVTDSILSYVGTKDTYSGKEWGQ
                     VTKNGGSVNLSYDDGDAGFYAEAGYYSYLGNNVKSNKSVNANAGLYVRPFRYDDRELK
                     TGINVGYMDFDKNLSYYSFGQGGYFSPQNYVSVSFPVEYTQKYDDWDLKLSGAVGYQS
                     YSQDKSAYFPNNPDLQKQLEELVDAGFGTESYYAGKTENGIGWNAGVGGNYHLNKSMQ
                     IGGQVGYDTFGDYNESKAQVYFRYLMGQN"
     gene            complement(133727..136204)
                     /locus_tag="RAHAQ2_RS00615"
                     /old_locus_tag="Rahaq2_0127"
     CDS             complement(133727..136204)
                     /locus_tag="RAHAQ2_RS00615"
                     /old_locus_tag="Rahaq2_0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase subunit"
                     /protein_id="WP_014333396.1"
                     /db_xref="GI:504099402"
                     /translation="MNRPDNLMIKRRLSAARSASLFRKITTGLLLTFSSLPVSQAEDA
                     PAQAVDPATSLPAAPSWLPPVTPMPGETAPAGDTTPAPAVGAPQTDSTPADNSAAMPE
                     APAASAPVMPLVQPVTSNITVAEMGQPNGLTLSGGQLQSGIMFTLPADEVVTNAHLSL
                     ALKISPALIARDTTLELMLNGQPLGNLPLNQSSNGGDVYDLDIPAAMVVSSNNLSFRV
                     HDSNTMTCEKEQSDKYWVTILPTTSIGLEGQQLNIGRNLGNFPRPFFDGLQMQESKIT
                     MGFSAAMKPGDVSAAAMVSSYLGMLSDYRSIDFPVILNDLPDQNGILFGKPGDKIGSL
                     TLPASHGASVQIIDNPINPVYKLLLVLGNDDNELRQAAYRLISGGMPNNTDHLDVAQQ
                     TIPSSKPYDAPRWIDTSRRVTLGELAGKDQGSLISNGIYHDGIQVAFRAAPDLFMWDG
                     HNIPVRIDYRFPTENWIDEDSSRLNVSINSNFLRSLTVNKVGLVENIWRRLGGDSRQE
                     RYTLQLAPYLIYGDNQLQFYFDIKPKKDAPCSILTSDNIKSRIDPKSFIDLSGSYHFT
                     QLPNLSYFVGASYPYSKLADFSDTLMLLPQAPGADEIHTLLNLASRAGKATGVPVNHV
                     QVAFGLKGDEQNNPLFDRDILAVTTLGDTPFTRQLLAGSPFSINGGSMGVKTPTGMQR
                     VVAWLTGDWYRQPVDADRYLSSTGAWRGFVSYRSRWSADHVVVLATGTDDQQLLKIHH
                     DLKSPKINANVRGDLAIITDENGIRSFSVGQQFPTGQMPWYMMVLWYASNHIVILSLI
                     AILLSLVMGLSLFVVLRRHAAKRLGQK"
     gene            complement(<136291..138300)
                     /locus_tag="RAHAQ2_RS00620"
                     /old_locus_tag="Rahaq2_0128"
     CDS             complement(<136291..138300)
                     /locus_tag="RAHAQ2_RS00620"
                     /old_locus_tag="Rahaq2_0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012699190.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="WP_037040758.1"
                     /db_xref="GI:739176790"
                     /translation="MNKFLFSLLVLLLLPVAAVIIITPMDSQKQYIFGLISIGLLFLL
                     GISKSRRISVVMVIMSVMMSTRYIYWRATETLHFNSTIEAILGVGLFLAELYVWLILL
                     LGYLQTTWPLKRTIEPLPDDTTLWPTVDVYIPSYNESLDVVRDTVLAAQCIDYPKDKI
                     KIYVLDDGKRDEFAVFSADAGVGYITRNDNSHAKAGNLNHAMKLTKGELICVFDCDHV
                     ATRAFLQATVGSFLKDPRLALIQTPHYFYSPDPFERNLSAGRTMPNEGALFYGPVQQG
                     NDNWNATFFCGSCAVIRRVALEEVGGFAVETVTEDAHSALKMQRRGWNTAFLDIPLAA
                     GLATERLGLHVIQRTRWARGMTQIFRVDNPLLGRGLKWQQRLCYLNAMLHFQFGLPRV
                     VFLTAPLAFLLFNLNIISSSASLIFAYALPHLVMSLYINSRMNGRFRYTFWGEIYETV
                     MAFHLILPTLVTMFAPKRGKFNVTDKGGLLDVGFFDFHIVKPHLIVAILMIIGIGYGI
                     VRAVFHDYFAIDPSVVALNIAWGSFSVLILLAAIAVAKETRQVRKTIRIDVAIPAIIH
                     YANGISLRTTTVDMSMGGVQLVTPDVRYLDEEIEEVEIQLSSGAESFPVTQISGDKER
                     LRLQFENLPLSKRRELVRVVLCRADAWIGEEYPPDNPFRSLLSIIR"
     gene            complement(138331..139134)
                     /locus_tag="RAHAQ2_RS00625"
                     /old_locus_tag="Rahaq2_0129"
     CDS             complement(138331..139134)
                     /locus_tag="RAHAQ2_RS00625"
                     /old_locus_tag="Rahaq2_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_013573457.1"
                     /db_xref="GI:503338796"
                     /translation="MPLVCVCSPKGGVGKTTVASNLAYSLARSGSKVLVIDFDVQNAL
                     RLHFGVPIADTRGFVAGSGNESDWSQFILKAGSNTFVLPYGEVTEDQRLEFEHQLASD
                     PHFLQRGLNTVLNYPGLIIIADFPPGPSPALKAVQAIADLHVVVMLADTASLSLLPLM
                     EKNKLIGTPLNNKLGEYYVVNQSDTRRTLSRDVTQFFEQRLNERLLGTIHRDECVPEA
                     NASQRSIIDFSPVSASAFDIELISKKVAAILGIKVGDGELHAAPKSGSY"
     gene            complement(139125..139904)
                     /locus_tag="RAHAQ2_RS00630"
                     /old_locus_tag="Rahaq2_0130"
     CDS             complement(139125..139904)
                     /locus_tag="RAHAQ2_RS00630"
                     /old_locus_tag="Rahaq2_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333398.1"
                     /db_xref="GI:504099404"
                     /translation="MNKYDDIKRFMDKAKLENLDYKELNEKSTGESITGSMNQWTLIK
                     QVSASEEPAGPLDNGRTTQPTPQSISADEFLLSDAQPVAGHQEPHFSAAGPVPPRQAT
                     PMSSQVPPPPAGFGLLDALRETLPPAPAQPVPLSVPPAQHPSVHAAPTLHAQSVVPDS
                     GSGLLDSLRKAMPEVPSKPASAPLHTPQPVQYAAAPVYYPPPGQNPTPVRSPVSASPA
                     SADANQRFKQMFKQRAPQPASAYLHRDTPLQPLLEMIASCR"
     gene            140464..142446
                     /locus_tag="RAHAQ2_RS00635"
                     /old_locus_tag="Rahaq2_0131"
     CDS             140464..142446
                     /locus_tag="RAHAQ2_RS00635"
                     /old_locus_tag="Rahaq2_0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333399.1"
                     /note="HmsP in Yersinia pestis plays a role in invasion of
                     epithelial cells; the EAL-domain portion of HmsP from Y.
                     pestis shows phosphodiesterase activity which is required
                     for the inhibition of biofilm formation; inner membrane
                     protein; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biofilm formation regulator HmsP"
                     /protein_id="WP_014333399.1"
                     /db_xref="GI:504099405"
                     /translation="MRVRRSLTIKQMAAVSSIAAITICIFIVIQLFHFVQQRRDDYAQ
                     QLENIAHSVRVPLSQAVLDVDLEETQDILNTLQPVGILSRADVVMPNQIAALHTHFPP
                     GRPVPQWVTRGFNLPVTISVPLYSAAASPKAPKPLAYLVLQADSYRMYQFIISALSTM
                     LTTYLLLALILTISVSWVINRLIVKPLRAIASDLESLSESDVPGHQLTLPQRHEDDEI
                     GMLVRSYNRNQQQREKPQDKATEALLPSQTLLNNEEQFMQCLQHRLHSAEPEKSFHLL
                     LIGIESLRDDGRVGCPLVSSIMNVLPENCLMARLSYNEFAVLAADIPRPFMAMRLARQ
                     IMERINAPQESHAGNMSLHPTGSIGIVQYTGEFPVSAQQLLVNGRAARVSAYQQGKNQ
                     ILFFEPELTAKIQKRLLQENEILHAMEQNDFTLFIQPQVNMETGAVVGAEALLRRKMA
                     DGSYGLESDFIVLAEEIGVMSQLGYKILELGCQILADWQQRGIALPLSVNLSGAQVQQ
                     RNFLPELRSLLSRYKINPGQLVLEITETARIDDLDRALLLLSELRALGVSIELDDFGL
                     GYSGLEYLNRLRTLPIDVIKIDRSFVSVLPQDEVMVNIVASIARAMNIQLVAEGVETQ
                     AQRQWLLKENIQLGQGYLFSAPLSKTDFERKFCQPS"
     gene            142683..143966
                     /locus_tag="RAHAQ2_RS00640"
                     /old_locus_tag="Rahaq2_0132"
     CDS             142683..143966
                     /locus_tag="RAHAQ2_RS00640"
                     /old_locus_tag="Rahaq2_0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333400.1"
                     /note="involved in the transport of C4-dicarboxylates
                     across the membrane; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_014333400.1"
                     /db_xref="GI:504099406"
                     /translation="MKKSLFKSLYFQVLLAITVGVLLGHFYPEIGAQMKPLGDGFVKL
                     IKMIIAPVIFCTVVTGIAGMESMKAVGRTGAIALLYFEIVSTLALIIGLVIVNIVQPG
                     AGMNVDPAALDAKAVAVYAEQAQSQGIIPFLLDVIPSSVIGAFASGNILQVLLFAVLF
                     GFALHRLGHKGQLIFNVIESFSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQ
                     LGQLILCFYLTCILFVVVVLGLIARFTGFSIFKFVNYIKEELLIVLGTSSSESALPRM
                     LDKMERLGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNTHMDIWHQITLIV
                     VLLLSSKGAAGVTGSGFIVLAATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNG
                     VATIVVAKWCDQLDEGQLKATLNGQKGLTEAEKSA"
     gene            144293..145810
                     /locus_tag="RAHAQ2_RS00645"
                     /old_locus_tag="Rahaq2_0133"
     CDS             144293..145810
                     /locus_tag="RAHAQ2_RS00645"
                     /old_locus_tag="Rahaq2_0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333401.1"
                     /db_xref="GI:504099407"
                     /translation="MQGTKIRLLIGGLLLAAAASHVQAEALQPDPAWQQGKLDNGFTW
                     QLLTTPQRPSDRIELRLVVRTGSLAESAQQTGYAHFLPRLALMHSEGFSTAQLQSLWQ
                     QSINPQRPLPPAVSSYDFTMYNLSLPNNRPELLKDALNWLANTAGKVSVTPALVSAAR
                     QESQDPVGSLPQNTQDAWWRARMAGSTLVGHNPHQLPTKPVNIDALIKFYHQWYTPDA
                     MTLFVVGNVDSRGLSEQINRTFSSLKGSRQTPQTLPTLSAVTTKSMTVMDENLTQDRV
                     SLMWDNAWQPIQDSQALAAYWRSDLAREALFWHLQQQLKSAFETKKDTPAPGPGLGFD
                     CNVQYQRAQCAIRIEAPQAKLTELFKRLSEELLSVRDKGISQAEFDALIAQKNDQLSK
                     LFATYARTDTDVLMSQRLRSQQNGVVDIAPEQYQQLRQQFLSTLTLPVLNQELKQQLS
                     RDPALLVAQPKGEPEMNAGELRAVYDKIMAPAETAPAVDAPAGDVPAASAATSAQ"
     gene            complement(145982..146920)
                     /locus_tag="RAHAQ2_RS00650"
                     /old_locus_tag="Rahaq2_0134"
     CDS             complement(145982..146920)
                     /locus_tag="RAHAQ2_RS00650"
                     /old_locus_tag="Rahaq2_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333402.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-gluconate-6-phosphate from
                     2-dehydro-3-deoxy-D-gluconate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketodeoxygluconokinase"
                     /protein_id="WP_014333402.1"
                     /db_xref="GI:504099408"
                     /translation="MTSKNIAVIGECMIELSQKGDALHRGFGGDTLNTSVYISRQVSP
                     DALNVHYVTALGNDSFSNEMLQAWQQEGVHTDLTQRLENKLPGLYVIETDSTGERTFY
                     YWRNDAAARYWLDSPQSEEICQKLAEFDYLYLSGISLAILSDESRDRLMTLLKACRSR
                     GGKVIFDNNYRPRLWASKEQTQAAYNAMLSCTDIAFLTLDDEDMLWGQKPYDDVIART
                     HALGVSEVVVKRGADSCIVSSAEGEMHDVPAVKLPKEKVIDTTAAGDSFSAGYLAVRL
                     TGGSAVEAAVRGHETASTVIQHRGAIIPMEFMPDRA"
     gene            complement(147115..147318)
                     /locus_tag="RAHAQ2_RS00655"
                     /old_locus_tag="Rahaq2_0135"
     CDS             complement(147115..147318)
                     /locus_tag="RAHAQ2_RS00655"
                     /old_locus_tag="Rahaq2_0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tautomerase"
                     /protein_id="WP_014333403.1"
                     /db_xref="GI:504099409"
                     /translation="MPYVNIKITREGATAKQKKALIAGVTQLLVDTLGKNPATTVVVI
                     DEVDTDNWGVGGRPVTELRQENK"
     gene            147641..148417
                     /locus_tag="RAHAQ2_RS00660"
                     /old_locus_tag="Rahaq2_0136"
     CDS             147641..148417
                     /locus_tag="RAHAQ2_RS00660"
                     /old_locus_tag="Rahaq2_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333404.1"
                     /note="in Escherichia coli this protein is involved in
                     flagellar function; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="c-di-GMP phosphodiesterase"
                     /protein_id="WP_037040744.1"
                     /db_xref="GI:739176774"
                     /translation="MITKMMLGLITPSFTAIERVKAQSYWRQCQRVYRFQPIYRTTGK
                     LLGIELLTGVFHPANPHKFISPEEYFVAIAVGKRLQIVQEQLDLLQRWQHLFTEHELL
                     ASINVDGQVLEMLQSDLALRAQISAMPYVRFELVESAENALSIPLSQIEQSDRLWLDD
                     FGQGIANFSSFTTWHYEYIKIARDLFILLGQSEEGSRLFYTLVTLMNRYSKGVIIEGV
                     ETASEWSMVCNSDALAAQGYYLARPTVFDNLDNLPIHFKG"
     gene            148631..150685
                     /locus_tag="RAHAQ2_RS00665"
                     /old_locus_tag="Rahaq2_0137"
     CDS             148631..150685
                     /locus_tag="RAHAQ2_RS00665"
                     /old_locus_tag="Rahaq2_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333405.1"
                     /db_xref="GI:504099411"
                     /translation="MTRTGKVISWVVGAIIILLIAIVIFIATFNWNRLKPTINQKVST
                     ELNRAFAIRGDLGVDWSRQKDEAGWRAWVPWPHIHAEDIVLGNPSDVQTGEKDAQMVK
                     LARVDASIAPLALLHKEVLIPRIWLKQPDTSLLRLDNGKNNWTFNLANSDTQDPAQPP
                     SAWSFTINDIVFDRGQIDYKDAKLKADFRAVIDPLGKPLPFTEVVGDKKDAPKTKTPP
                     YVFGWKVEGKYNGESLSGSGKIGGMLAMKDPDALFPLQADVRSGNTRVAVEGTLQDPM
                     NLGGLDLRLKFSGQTLSDLYGLTGVLLPQTPPYSTDGHLSATLHDKDGAVYRYQNFNG
                     EIGDSDIHGSLNYQASKPRPELTGEVVSKQLRFADLAPLIGADSNTDKAKRGETTRQP
                     ADKVLPVEKFDTKSWRVMDADVKFSAKRIEHGESLPLSDLSTHLKLNDGVILLDPLRF
                     GVAGGNLNSTIRLEGDKSPMQARADIHARKLKLKQLLPRVQSMERSLGDLNGDATLTG
                     TGNSVAALLGTSDGDMKILINDGVISRGLMELAGLNVGNYVVSKLFGDDEVAINCAAA
                     NVNVRNGVVTPRLFVFDTENAVINITGNTNMATERLDLSVNPESKGVRVLTLRSPLYV
                     RGTYKNPDAGVKPGPLIARGAAAVALGAVVAPAAALLALISPSDNEENHCGPILQQMK
                     QK"
     gene            complement(150755..151522)
                     /locus_tag="RAHAQ2_RS00670"
                     /old_locus_tag="Rahaq2_0138"
     CDS             complement(150755..151522)
                     /locus_tag="RAHAQ2_RS00670"
                     /old_locus_tag="Rahaq2_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol pyrophosphatase"
                     /protein_id="WP_014333406.1"
                     /db_xref="GI:504099412"
                     /translation="MRLRRFILPLLLLLIVIAAAFWYFWPHSSNPNALWNIVSTKCVP
                     NQRSNGKPDPCAQVDEQQGFVVLKDLNGPLQYLLMPTARITGMESPALLEPSTPNFFS
                     QAWNARHFMADKYGKPIDDSNVSLAINSQYGRSQNQLHIHISCLLPQVKTTLSKDGGQ
                     MGYNWQELPDKLLGHTYLARKVTQAELNEKGAFRLLAEGVPDAQKKMGHFGMAMVSLP
                     GGDFLLLASERDLLKLNNASTEEIQDHKCAVLDPLPQ"
     gene            complement(151582..152904)
                     /locus_tag="RAHAQ2_RS00675"
                     /old_locus_tag="Rahaq2_0139"
     CDS             complement(151582..152904)
                     /locus_tag="RAHAQ2_RS00675"
                     /old_locus_tag="Rahaq2_0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009635606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_013573467.1"
                     /db_xref="GI:503338806"
                     /translation="MQATITPELEADAQLVSQNSRSKVIVASLIGTAIEFFDFYIYAT
                     AAVIVFPHIFFPQGDPTAATLQSLATFAIAFVARPIGSALFGHFGDRVGRKVTLVASL
                     LTMGVSTVVIGLLPTYATIGVFAPMLLALARFGQGLGLGGEWGGAALLATENAPAKKR
                     ALYGSFPQLGAPIGFFFANGMFLLLSWLLTDEQFISWGWRVPFLLSAVLVIVGLYVRV
                     SLHETPVFAKIAKAGKQVKVPIGTLFTKYKKATILGTFIMVATYTLFYIMTVYSLGYG
                     TAAKPVGLGIPRNEFLLMLMIGVVGFGVMVPVAGQLADKFGRRKTMICITLLMIVFAL
                     CFPTILGAGSQALVMVFLLCGFMVMGLTFGPMGALLPELFPTEVRYTGASFSYNVSSI
                     LGASVAPYIATWLATHYGLFYVGVYLASMATLTLIALLLSKETAHQSL"
     gene            complement(153192..154316)
                     /locus_tag="RAHAQ2_RS00680"
                     /old_locus_tag="Rahaq2_0141"
     CDS             complement(153192..154316)
                     /locus_tag="RAHAQ2_RS00680"
                     /old_locus_tag="Rahaq2_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333408.1"
                     /db_xref="GI:504099414"
                     /translation="MPIISKQAPATQEKPTPLINIKTGNQTVDKNIGRFSRLVEYVQS
                     WGWVAHLLRATERFNDRLGSQFGAAITYFSFLSLIPILMVSFAAVGFVLASNPDLLAE
                     LINKIVNSISDPNLANTLKSTVNTAIQQRTAVGLSGLLIALYSGVSWMGNLREAIRAQ
                     SRDVWERNPQDQEKIYRRYLRDFISLTGLVLALIITLSLTSIAGAAQKTIVDALGLGG
                     IDWLRPVMTSITLVISIAANYLLFLWIFWMLPRHKPRKKALLRGTLLAAIGFEVIKFV
                     MTMTLPKLATSPSGAAFGSVIGLMAFFYFFARLTLFVAAWIATAKYKDDPRMPDRRQK
                     TAEAQKMATGNDSEYTPDNLIVPDEMHIAEFNSDNERKKQ"
     gene            complement(154401..155300)
                     /locus_tag="RAHAQ2_RS00685"
                     /old_locus_tag="Rahaq2_0142"
     CDS             complement(154401..155300)
                     /locus_tag="RAHAQ2_RS00685"
                     /old_locus_tag="Rahaq2_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_037040750.1"
                     /db_xref="GI:739176780"
                     /translation="MDKIQSMQVFVRVAELNNFTRAAESLGLPKGSVSRLVQQLETRM
                     SARLLHRSTRRVQLTQDGQVFYQRCKELLASMDELESMFQSNPASVSGRLRVDMTTGM
                     ATHLVLPRLAEFLNRYPALEIELSCTDHRVDVVREGFDCVIRSGTLKDSGLIARPLGQ
                     LSMINCASPGYLRRYGTPDHPDQLAQHAMVHYEQILGSHTSAFEYLDGKQLKTVKSGG
                     AVTVNSTETYVSACINGLGIIQVPLIGVRDALAGGQLVSILPQFRAPPMPVTLVYPHR
                     LNLSRRVKVFMDWLTELTQTFIA"
     gene            155427..156185
                     /locus_tag="RAHAQ2_RS00690"
                     /old_locus_tag="Rahaq2_0143"
     CDS             155427..156185
                     /locus_tag="RAHAQ2_RS00690"
                     /old_locus_tag="Rahaq2_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014333410.1"
                     /db_xref="GI:504099416"
                     /translation="MNRKIAIVTGGSRGLGRNAIEKLAKKGVDVILTYHNQAGAAQEV
                     VASVEAQGGKAVALQLNTGESGSFAAFVVQVKAQLQRVWQRDTFDFLVNNAGVGLHQS
                     FAGTTEEQFDLMMNVHLKGPFFLTQKLLPLMADGGRILNISSGLARFALPGSSAYAMM
                     KGAIEVLTRYQAKELGARGITANVLAPGAIETDFSGGMVRDNPDVNKLVASNTALGRA
                     GLPDDIGDMVALMLSDEAGWMTAQRVEASGGMFI"
     gene            complement(156189..156935)
                     /locus_tag="RAHAQ2_RS00695"
                     /old_locus_tag="Rahaq2_0144"
     CDS             complement(156189..156935)
                     /locus_tag="RAHAQ2_RS00695"
                     /old_locus_tag="Rahaq2_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar brake protein YcgR"
                     /protein_id="WP_014333411.1"
                     /db_xref="GI:504099417"
                     /translation="MSEVSKESFAKRNTLAILSVLRDLKKNQTLIMISHSRGQFISKI
                     LDVDADNHQFLFDLGSSDYENTLAAEADTLTFVAEPAGAKVEFSCSKVRQISYEGLPT
                     FTCDLPPVLYFIQRREYFRVNVPRMPDYRCSGILPDTSEFAYRVRDISLGGLGLEIEG
                     ATPPEMTKGSMLKDSLIQLAELGTFTLDLQYLGAMVRKSVSNKGETVTSQRLSFKFPH
                     LSPAQERDLQRAIFELEKQQHIKAKRFQHD"
     gene            157193..157771
                     /locus_tag="RAHAQ2_RS00700"
                     /old_locus_tag="Rahaq2_0145"
     CDS             157193..157771
                     /locus_tag="RAHAQ2_RS00700"
                     /old_locus_tag="Rahaq2_0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_014333412.1"
                     /db_xref="GI:504099418"
                     /translation="MQTSSVVLRNRYDGLTILLHWLTALAVIFLFASAHIWEVLERGT
                     PLRKGLQSVHISVGILLAAIITGRLLWRLFTVSTGRSKQQPVAMPTLMKAAAHLTHLA
                     LYLLLVAQIILGFLFRWSQAEPFYFFGLFPIPDVFNFDSVMTQTFGSLHNNVAWALII
                     IAGVHALAALFHHYVLRDGILRRMLPGSKSRP"
     gene            157803..158345
                     /locus_tag="RAHAQ2_RS00705"
                     /old_locus_tag="Rahaq2_0146"
     CDS             157803..158345
                     /locus_tag="RAHAQ2_RS00705"
                     /old_locus_tag="Rahaq2_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333413.1"
                     /db_xref="GI:504099419"
                     /translation="MKTKKVLQALPVVCLAANLLFFSAAASAMGDDSDAKKTPDCPKG
                     QIYDSKTKSCMVDKGSMISDQDKTQYAYHLAKTGRYQEALTVLDTLKDQNTKEAWNYR
                     GYATRKLGRTDEGIGYYQKSIAIDANYAKVREYLGEAYMIKGRPDLAKAQLATIKGLC
                     GTGCEEYRDLSAAIDGHPES"
     gene            158426..158881
                     /locus_tag="RAHAQ2_RS00710"
                     /old_locus_tag="Rahaq2_0147"
     CDS             158426..158881
                     /locus_tag="RAHAQ2_RS00710"
                     /old_locus_tag="Rahaq2_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma24 factor"
                     /protein_id="WP_014333414.1"
                     /db_xref="GI:504099420"
                     /translation="MVLSRKHDVADDLVQSTCVRALERCAQIKDSTGVDRWLFSILHS
                     IWVNELRAQRVRQGQGFADVGETDTPADTPSFEERHWHTQVMQRVNRLPEAQRNAVFL
                     VYVEGFTYQEAAMTLSVPVGTIMSRLATARLTLAKDAGTATQPQQGEKK"
     gene            158878..159654
                     /locus_tag="RAHAQ2_RS00715"
                     /old_locus_tag="Rahaq2_0148"
     CDS             158878..159654
                     /locus_tag="RAHAQ2_RS00715"
                     /old_locus_tag="Rahaq2_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma factor"
                     /protein_id="WP_014333415.1"
                     /db_xref="GI:504099421"
                     /translation="MTREIPSAPYADDVLVAYLDNQLSESQRAKFDAQLAQDDVLAQR
                     LVQMSRSNLPFHDAFGAMLQEAPVGKLQAALDAIPDARAAGSSGSSRRALLAASLSFL
                     AVGLLAGRYSTLFTSDDNWRARVADYMSLYTAQTLADVYDSASQQKIQLARVQNTLGI
                     ALNPAALAVQGADLKDARMLHYDDYDIAQITYLDAQYGPMALCITRSEHRDNTALQRE
                     IRRGMNVVYWRNAGYNFMLIGHSPAPALTAHAAALQANLA"
     gene            159958..161607
                     /locus_tag="RAHAQ2_RS00720"
                     /old_locus_tag="Rahaq2_0150"
     CDS             159958..161607
                     /locus_tag="RAHAQ2_RS00720"
                     /old_locus_tag="Rahaq2_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate:quinone oxidoreductase"
                     /protein_id="WP_014333417.1"
                     /db_xref="GI:504099423"
                     /translation="MRKILAMILCLNVVAFSQSALAEDEKPVDVLLIGGGIMSATLGT
                     YLQELEPDWSINMVERLDGVALESSNGWNNAGTGHSALAEMNYTPEKADGSIDISKAV
                     EINESFQISRQFWTYQVENGVLHNPRSFINSTPHMSFVWGDDNINFLRKRFAALQQST
                     LFRGMEYSEDPAQIKQWIPLVMEGRDPAQKVAATRIPIGTDVNFGEITRQLVASLQKK
                     PNFSLSLGHEVRDIKRNPDNTWNVTVADLKNGDKESVIKAKFVFIGAGGASLTLLQKS
                     GIPEADNYGGFPVGGEFLVTENPDVVKRHLAKVYGKASVGSPPMSVPHLDTRILDGKQ
                     VLLFGPFATFSSKFLKNGSLWDLFGSVNFSNIMPMTHVGIDNFDLVKYLVSQVMLSDD
                     DRFDALREYFPDAKKEDWRLWEAGQRVQIIKKDEKEGGVLRLGTEVVSSKDGSITALL
                     GASPGASTAAPIMLHLMEKVFKDKVATPEWQAKLKQIIPSYGTELNGNVAATEKELGD
                     TSRVLMLDNPQPKAAEPAPSADNSSAPKPGQEQKQVADVAL"
     gene            161793..>164033
                     /locus_tag="RAHAQ2_RS00725"
                     /old_locus_tag="Rahaq2_0151"
     CDS             161793..>164033
                     /locus_tag="RAHAQ2_RS00725"
                     /old_locus_tag="Rahaq2_0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333418.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
                     /protein_id="WP_041682452.1"
                     /db_xref="GI:754018945"
                     /translation="MDTLSRYSLAIWNSPYALDVLNFRGEEQLSETFSYTVDVTCPAP
                     DIGAAQMLRQFASFTMGTPFQPERAVYGVIRDFQRLSTSADETLYRLELVPRLRLLEN
                     STNSFIFQNQSVPEVVEFILRKHGLEGQDFEFRLSHTYPDRELITQWGETDLQFIKRI
                     LAEVGIWFRFEADTRLTCEKVLFGDGPEQYRFGVTLPYCEPSGMSDAHAESVWGLKIH
                     WNAVTGKIFKRDYNYREATTPLDTSAQVRSAAPVTGESYLYARPYREAGEDMDAAAET
                     GAFYARIRHERQLNHQCRIFARTTGSGLAPGQVLEPQAYPFSDLPDGILITRIVAKGS
                     RTDHFRLNIWGMAYRETIGFRPEPPARPVLSGTIPARVESPAKGDTYAWLDNQGRYRV
                     RIDGDRASADAGYAYLWVRLAKPYGGDGYGWHMPLTDGTDVAIAFDGGDPDRPYIAAA
                     LHDSEHPDHVTERNHTRNVLRTPSNNKLRMEDRRGEEHIKLATEYGKTQLNSGHIVDA
                     QNAPRGEGFELRTDEHGALRGGKGVFLSADAQPQAQGQVPDNLAAMTEIEYLQGQVKA
                     LSQAAAEAKALEADIAAQIAMFSERLKPINQVVLASAPEGMALTSGEHMQLAATQNMI
                     LNAGKNADIGVIKNLTVNTGQEMGIFALKGEMSLKAGEGKVDVQAQNNQLSLAAGKKV
                     SITAVDGDILFSAKKRITLIGGGSYLILQDGKIEYGTAGEYFRKTPHTVLTVANPVRL
                     NMPYLPG"
     gene            164124..164960
                     /locus_tag="RAHAQ2_RS00730"
                     /old_locus_tag="Rahaq2_0152"
     CDS             164124..164960
                     /locus_tag="RAHAQ2_RS00730"
                     /old_locus_tag="Rahaq2_0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020455198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040736.1"
                     /db_xref="GI:739176765"
                     /translation="MESTALAESAVETENGYFYLLLEGGAQETQAFEAFYTVNASEMY
                     SLYLHPQLAEFKNYGPWLLAVKNNNELTQKIKDTPGVVGVIATKSCLSGALAAQLSYA
                     CTVIGPDDTTALIRFYTRQVISLLAQCGEQEWHTFLFRNITRWWAPLEGSWQPVPLLA
                     STAENPRDHAVRLNEEIWQQIMDEPEVGAILTQWQKMPASQHFPPCSQGDMVIKALEK
                     ARLAGMPAGVDSKLYALYYLNGGKKILESEGMQVSLGKVSQGEVSLKEILSNALASKW
                     QS"
     gene            164989..165498
                     /locus_tag="RAHAQ2_RS00735"
                     /old_locus_tag="Rahaq2_0153"
     CDS             164989..165498
                     /locus_tag="RAHAQ2_RS00735"
                     /old_locus_tag="Rahaq2_0153"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333420.1"
                     /db_xref="GI:504099426"
                     /translation="MKEEHQDGEISLTPCVCCTVFRQGKYSRLGGGLIIIALNLMLEI
                     IFKAISLITLPLYGINSLIFEEKIRVVKFLIFCVMDFLIIGFAIYALVFLIRKCERFK
                     RVFKIFIVILISSSFFEVILINMEEIFLYGYIPWTFFFDSASYPIVLACLAYPYLKCS
                     KRVRMTLVH"
     gene            165511..166005
                     /locus_tag="RAHAQ2_RS00740"
                     /old_locus_tag="Rahaq2_0154"
     CDS             165511..166005
                     /locus_tag="RAHAQ2_RS00740"
                     /old_locus_tag="Rahaq2_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007791239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333421.1"
                     /db_xref="GI:504099427"
                     /translation="MNSEQEIKICTCCSEQDRQKLTGIGGWLIVVVLHLSSMLVFNAS
                     LFIEFIYDLNIPITDGSDVKLIPLVLNSFVDVIVFLMAAFSLNALFRKKYQFRKYYRL
                     FILSCLLHPLLFASLCFWYQNITMYSIPWKIIGLMFLYPLGMIFICLPYLDESKRVRL
                     TLVN"
     gene            166049..166579
                     /locus_tag="RAHAQ2_RS00745"
                     /old_locus_tag="Rahaq2_0155"
     CDS             166049..166579
                     /locus_tag="RAHAQ2_RS00745"
                     /old_locus_tag="Rahaq2_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333422.1"
                     /db_xref="GI:504099428"
                     /translation="MDFFRRLEKIDGAVNRGYARWGKWLGAGLLLFILGWGGWLVWAS
                     IWGPPTGPVTLIIHSEIDRPILGFSVNGVAGANSSAHDKENPYASGSGKSTCCGSISG
                     QEADVMWTLDITHEQYLKGMRLEKRRVVMPIPERKWGENYLHVYFLPGDKVRLWWGGG
                     FISPKAEEIPDTVNRK"
     gene            166600..167118
                     /locus_tag="RAHAQ2_RS00750"
                     /old_locus_tag="Rahaq2_0156"
     CDS             166600..167118
                     /locus_tag="RAHAQ2_RS00750"
                     /old_locus_tag="Rahaq2_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333423.1"
                     /db_xref="GI:504099429"
                     /translation="MDFFNRLEKIGGTVNRGYVRWGKWLGAGLLLFILGWGGWLIWAS
                     LWGPPTGPVTLIIHSEIDRPIRGFSVNGVAGPNAFAHGGGKTTCCGSISGKTAEVIWT
                     VDYTLAQYQAGTRTEIHKVIMPLPERKWGEDDLHVHFLPGDKVLLGWSDNVWSPYEKH
                     PDKVDKLSAAGI"
     gene            167156..167674
                     /locus_tag="RAHAQ2_RS00755"
                     /old_locus_tag="Rahaq2_0157"
     CDS             167156..167674
                     /locus_tag="RAHAQ2_RS00755"
                     /old_locus_tag="Rahaq2_0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333424.1"
                     /db_xref="GI:504099430"
                     /translation="MDFFKRLEKIDGAVNRGYARWGKWLGAGLLLFILGWGGWLVWAS
                     LWGPPTGPVTLIIHSEIDRPILGFSVNGVAGSNAFAYGGGGATCCGSISGKTAEVVWT
                     LSTTRAQYNAGLRTENRRIVMPLPERKWGEDDLHVHFLPGDKVLLGWSDNAWSPYEKH
                     PGKDNKLPAAGI"
     gene            167710..168231
                     /locus_tag="RAHAQ2_RS00760"
                     /old_locus_tag="Rahaq2_0158"
     CDS             167710..168231
                     /locus_tag="RAHAQ2_RS00760"
                     /old_locus_tag="Rahaq2_0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333425.1"
                     /db_xref="GI:504099431"
                     /translation="MNFFNRLEKIDGAVNRGYARWGKWLVAGLLVFILGWGGWLVWAS
                     IWGPPTGPVTLIIHSEIDRPIRGFSVNGVAGSNAFAYGGGGATCCGSISGKTAEVVWT
                     VDYTLAQYQAGTRTEIHKVIMPLPERKWGEDDLHVHFLPGDKVLLGWSDNAWSPYEKH
                     PEISPKSVVRGDH"
     gene            168231..170021
                     /locus_tag="RAHAQ2_RS00765"
                     /old_locus_tag="Rahaq2_0159"
     CDS             168231..170021
                     /locus_tag="RAHAQ2_RS00765"
                     /old_locus_tag="Rahaq2_0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333426.1"
                     /db_xref="GI:504099432"
                     /translation="MDIESLVAAANRAQQENDAGIGNCSRALHVGYFFDGIHRNIEQD
                     ATEDRLSNIARLYRAFPDELQNSTKCSYAKFYVSGLGTPFNEDLTTKLHAIMDGAQGS
                     ALDDLKDQPWDIAKEAGIEFFKTGKWWEVLKDVGKKLIKPTEFLKLTGDITKSVVKKV
                     SIEATPWLRDNPVIADMLVTGVDTRITAAKLRFERFFERAVTSSQVPIKLISVSLFGY
                     DLGATLARKFLDTLLDDICQKQGDKYVYQGIPVEIIFAGLFDCARHTPASNNNGVDWF
                     VGAFGGPIRGISILLGDKYVDQDTPLPAAVKSALHLVAAHETRVWRSLYRLGGDKQKY
                     REELLPGCSEDVGGGLKPDEQKPSAELCRVALHRMYREAMLAGVPFPDFQTLHQSNPV
                     IAEYFIMENSVKENSVAQWTALYQQAVPFKNLSVAAQNLHLDSYIDWLGRQFYLYRSQ
                     CIKYAEQRGQVMASAGASAGLLGISPKAQETASDIRNEMDILRKHWGWLDDVHRAALS
                     MQNVMEMPNSHDTRRQLVPDVYIPALRRAKKFLAYGHAAYEGLPPPWPEDSAPSEIYA
                     WFVHDVQKVDKGAGISEDFLVIRSMEMPDS"
     STS             169605..170643
                     /standard_name="D1S3693"
                     /db_xref="UniSTS:474271"
     gene            170394..172046
                     /locus_tag="RAHAQ2_RS00770"
                     /old_locus_tag="Rahaq2_0160"
     CDS             170394..172046
                     /locus_tag="RAHAQ2_RS00770"
                     /old_locus_tag="Rahaq2_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate:quinone oxidoreductase"
                     /protein_id="WP_014333427.1"
                     /db_xref="GI:504099433"
                     /translation="MRKILGMLLNRDSLGASEPAAAEDEKSVDVLLVGGGIMSATLGT
                     YLQELEPDWSVHMIERMDSVAQESSNGWNNAGTGHSALAEMNYTPLMPDGSVDITKAV
                     AINEAFQVSRQFMAYQVQKGVLNNPRSFINSVPHMSFVWGDENIDFLRKRFAALQEST
                     LFRGMEYSEDPEQIRQWIPAVMDGRDPKQKVAATRTTAGTDVNFGEVTRQLVEALQKK
                     SNFTLANGQEVRDIQRNPDKSWRVTITDLKHSHKHRVVNAKFVFIGAGGASLTLLQKS
                     GIPEAREYGGFPVGGEFLVTENQDVVKRHLAKVYGKAAVGAPPMSVPHLDTRIIDGKQ
                     VLLFGPFATFSSKFLKNGSLWDLFGSVNSSNLLPMTHVGMGNFDLVKYLVGQVMLSDE
                     DRHAALKEFFPEAEQKDWKRWVAGQRVQVIKKDGKHGGVLRLGTEVVSAKDGSIAALL
                     GASPGASTAAPIMMKLLETVFKERAASAEWQAKFREIIPSYGTKLNGNIEATEKELLE
                     TSRILQLETPSMITTPVADVVQLRPLDVQAKQEPKHPADIAL"
     gene            complement(172560..173813)
                     /locus_tag="RAHAQ2_RS00775"
                     /old_locus_tag="Rahaq2_0161"
     CDS             complement(172560..173813)
                     /locus_tag="RAHAQ2_RS00775"
                     /old_locus_tag="Rahaq2_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_014333428.1"
                     /db_xref="GI:504099434"
                     /translation="MKDNSIYSPQVSVPEKSRVLGWSDLFSLWFSLGMGLMVLQAGAI
                     LAPGLGLAGSLAAIVLGSAVGVALLALVGVTGGQTGMSSMASLKLSLGKRGVALPVLF
                     NLIQLIGWGAFEIVVMRDAASLLAKRVWGDGSFWANPTLWTFTFGVVATLLAASGPLA
                     FIRLVLRRWGIWLLLASCAWLTGYLFLHAGLSTLWHKAGDGSMPFALACDIVVSMAFS
                     WLPLVSDYTRFGKSARQNFWGTACGYFLGSVWMMSLGVAYTLAFVSTSADANALLLAL
                     SGVALGIPLLLILVEEHENAFADIHSAAVSAGTSLPVSVGKLTLGIGLLCTLIAWAVP
                     LTQYENFLLLIGSVFAPLFGVVLTHHFVLRRQSHENLNIRSVAAWFTGIAVYHLMANL
                     LPDIGATIPSLLVAGLVCWGLGRKA"
     gene            174238..175275
                     /locus_tag="RAHAQ2_RS00780"
                     /old_locus_tag="Rahaq2_0163"
     CDS             174238..175275
                     /locus_tag="RAHAQ2_RS00780"
                     /old_locus_tag="Rahaq2_0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="WP_014333430.1"
                     /db_xref="GI:504099436"
                     /translation="MDEHITPLAPEGEFVLFRTKDGQFQVECRFESETLWLSQAAMSV
                     LYQVTPQAITQHIKAIYAEGELIQSSTCKDYLQVQTEGKREINRQIRHYNLSVILAVG
                     YRVRSARGTQFRQWATQTLQEYVIKGFVMDDPRLKNPPVGQSVVPDYFDEMLERIRDI
                     RASERRIYLRIKDIFAMAADYRPTDKDTARFFQAIQNKLHFACTGLTAAEIIAQRADA
                     SQPDMGLTSFKYDQVRKTDTTIAKNYLREEEIDQLNRIISMWLDYAEDQTKRRQQIFL
                     KSWEDKLEQFLNFNEFDVLQGSGKTSKKEADEKACQQYEKFAEQRRKLKEAEGEKSNI
                     EALCTLAQKKR"
     gene            complement(175294..175950)
                     /locus_tag="RAHAQ2_RS00785"
                     /old_locus_tag="Rahaq2_0164"
     CDS             complement(175294..175950)
                     /locus_tag="RAHAQ2_RS00785"
                     /old_locus_tag="Rahaq2_0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative low-complexity protein"
                     /protein_id="WP_014333431.1"
                     /db_xref="GI:504099437"
                     /translation="MFTNQLFTDQRFSARQFTGETLENCRFYRCRFDSTDLSETAFVD
                     CLFYDDEEQKGCSFQHAKLQDASFKRCDLTMADFKNVQALGCEIRECKATGADFSGAS
                     FMNMITARTWFCSAFMTKNNFSYANFSKVILEKCELWENRWTGANVQGANFSGSDLSG
                     GEFTEFDWNNLNITHCDLTNSDLGELNIRKVDLDGVKIDDWQQSHLLEKLGVIVIHSK
                     "
     gene            176209..177075
                     /locus_tag="RAHAQ2_RS00790"
                     /old_locus_tag="Rahaq2_0165"
     CDS             176209..177075
                     /locus_tag="RAHAQ2_RS00790"
                     /old_locus_tag="Rahaq2_0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000701348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040717.1"
                     /db_xref="GI:739176746"
                     /translation="MRNKWATQVNDIMTAKGIIWDPGKKKIDDYSLHNYHVLRIALGK
                     LTRQEQNFFNVLTQAPFYAVHCTDSFDVVNKGSDLTLYSRKNLISKGIRFNEDNTQPV
                     DISMLGNDGYVFFSLEIGLPLLKTSSRFGSIFYKVAYSHSVFRNSSMVLTDQVALVIP
                     RCHIPELSREAVRILETREFNRHAIIFNGKMFSVLGLAYSIILANRSLPPADQQVILS
                     ARNDTQLSNIVNSFYRPEIRVPKMVSLKSDEYSINMDHYKPRVMSSGESDDGWSGMDS
                     SGSGSDYSDTED"
     gene            177234..179393
                     /locus_tag="RAHAQ2_RS00795"
                     /old_locus_tag="Rahaq2_0166"
     CDS             177234..179393
                     /locus_tag="RAHAQ2_RS00795"
                     /old_locus_tag="Rahaq2_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptidyl carboxypeptidase II"
                     /protein_id="WP_014333433.1"
                     /db_xref="GI:504099439"
                     /translation="MRISPLFLAITLACSQYAVGAEPTSAPALTQEHVMNHAINADNP
                     FLKPSPLEYQAPQFNLYKDSDYEPAILEGIRQKLAEVDKIASDSAPPTFENTYVALEK
                     SGVMLQRVQNVFGAMTGANTNDTLQKIDEDTSPKLAAMDDSIHLNSKLFARLKAVYDQ
                     RSSLKISPESQRLIEVTFKDFELAGANLSDADKDKLRALNQQAATLSTQFTNKLLAAT
                     KAGGLTVKDKAQLAGLSDAELSAAAQAAKDRKLDNAWLLVLQNTTQQPLLQSLDDREA
                     RKALYEASINRAEKGDANDTRELIAKLAKVRAEQARVLGFPSYAAWKLEDQMAKTPKA
                     ALDFMHKIVPAATARAGREAADIQAEIDKQNGGFKVAAWDWQHYAQQVRKEKYDLDDA
                     QIKPYFELNNVLENGVFYAANLLYGITFKERKDLPVYNPDVRVFEVFDKDGKSMALFY
                     ADYYQRDNKGGGAWMSNYVDQSKLLGNKPVIYNVANFQKPAAGQPALLSWDDVITLFH
                     EFGHTLHGLFADQEYPGLSGTATPRDFVEFPSQFNEHWASDPKVFTHFAKHYKTGEVM
                     PQALQDKIEKASKFNKGYDMTELLAAALLDMHWHSLGADAPQQDVDKFEAESLAKDKV
                     NLAYVPPRYRSSYFQHIWGNGYAAGYYAYLWTEMLADDAFAGITEQGGLTRENGQKFR
                     DQILSRGNSEDLEKLYETWRGKAPSIEPMLKNRGLEE"
     gene            179544..180602
                     /locus_tag="RAHAQ2_RS00800"
                     /old_locus_tag="Rahaq2_0167"
     CDS             179544..180602
                     /locus_tag="RAHAQ2_RS00800"
                     /old_locus_tag="Rahaq2_0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-O-methylguanine DNA methyltransferase"
                     /protein_id="WP_014333434.1"
                     /db_xref="GI:504099440"
                     /translation="MLFDLPDDDVLYAALIARDPAYDGFAFVGVKSTGIFCRLTCPAR
                     KPKRENSVFYPSIVSAMEAGFRPCKRCQPLMQGGEKDPLVLKLLAALENEPGRKWSEG
                     DVQAMNVDPSTVRRAFKRQFGITFLEMARLRRIGKGIDALAKGEAVIEAQLDASFESG
                     SGFRAALTRQIGSNPSQVRKHQFLKADWLDTPIGSMLAIASRDALYLLEFIDRPALPN
                     EIERLKLLTSSEIIFGRTPLIDQVEQELTAYFAGEKHTFATPLAEFGSLFTRKVWDAL
                     RAIPAGELRSYSALAADIGQATASRAVARANGANQISILIPCHRVIGADGSLTGYGGG
                     LWRKRWLIEHERRMALSR"
     gene            complement(180772..181986)
                     /locus_tag="RAHAQ2_RS00805"
                     /old_locus_tag="Rahaq2_0169"
     CDS             complement(180772..181986)
                     /locus_tag="RAHAQ2_RS00805"
                     /old_locus_tag="Rahaq2_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014333435.1"
                     /db_xref="GI:504099441"
                     /translation="MKGMPPLILALLASSLVLTIGRGVTLPFITIYLTEHYHLLPKSV
                     GIILGASLAIGILSSLYGGYLVDKFHHRTLITVSISLFGLSFLLLPFLPNVTGVLLVL
                     ALLNASYALLSITLKACIASWLPVEKRVKAFSMNYTLVNVGWAVGSSLGVWLAGFSPL
                     LPFMISGMLALSTVISLTWGLRNIPHQPPQTEQEQKPLPKPNLRQTLSILAHDRRLIY
                     FTLGSTLGSVVFGQFAGYLSQYLILVSNADFAYKIIGAVMITNAVIVIAFQYVLSSRM
                     KQNSLLKWLLLGTIFFIIGLIGFMTAGQSVLFWVIAMAIFSFGELIVIPVEYMFIDFI
                     APENMKGSYYGMQNLSNLGGAINPVMCGFLLSYTAPPVMFIALIAASVGGLVFFWMGH
                     RLAANTTRPPAI"
     gene            complement(182119..182820)
                     /locus_tag="RAHAQ2_RS00810"
                     /old_locus_tag="Rahaq2_0170"
     CDS             complement(182119..182820)
                     /locus_tag="RAHAQ2_RS00810"
                     /old_locus_tag="Rahaq2_0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014333436.1"
                     /db_xref="GI:504099442"
                     /translation="MADRKISDMAGSAQKDQTQATTPARRPGRPHSAKKGADKRELLL
                     DTALKLFAQYGIAETPLSMIAKEAGVTTAMLHYYFRTREHLLDVMIDERFQPVRAGFT
                     DIFQTHADDPLMAITNMAQCMIDAAEKYPWVAPLWVREVISESGMLKKRMEERNGDRN
                     RKIVQECITRWQAEGKLNPDLNPALLFISLFGLTLFPMASMKMRQEGASPISPDMLRK
                     HVALLLFHGVAPQKP"
     gene            182905..184404
                     /locus_tag="RAHAQ2_RS00815"
                     /old_locus_tag="Rahaq2_0171"
     CDS             182905..184404
                     /locus_tag="RAHAQ2_RS00815"
                     /old_locus_tag="Rahaq2_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_014333437.1"
                     /db_xref="GI:504099443"
                     /translation="MTTINSAQSDAAEHKPSIKLLFSALLLVMLLAALDQTIVATALP
                     TIVSELGGLDQLSWVVTSYLLASTIVVPLYGKFGDLLGRKIVLQTAIIVFLLGSVLCG
                     LAQNMTQLILMRALQGLGGGGLMVVSMAAVGDVIPPSERGKYQGLFGGVFGLATVIGP
                     LIGGFLVEHISWRWIFYINLPLGIFALLVIGVALKSQTARIRHEIDFLGAGYLAAALT
                     CIILFTSEGGTVYQWSDPQLWCILAFGLVTLGGFIYEETLAAEPIIPLGLFRDRTFLL
                     SCAISFIIGMSLMGSMTFLPLYLQVVKGSSPSEAGMQLLPLMGALLVSSIISGRLISH
                     FGRYRIFPIIGTLLSFAGMVLLGFLKVSTPVHMLYLYIGVLGLGLGMVMQVLVLAVQN
                     AVSMKQMGVATSGVTLFRSIGGSIGVAMFGAIFTHVLHDQLVVLIPEGTVLPRSLGAQ
                     AVQELPADIRTDYLQAFGSALHSVYLIAACVMLLAFVLSLLQKDAVLKK"
     gene            184507..186360
                     /locus_tag="RAHAQ2_RS00820"
                     /old_locus_tag="Rahaq2_0172"
     CDS             184507..186360
                     /locus_tag="RAHAQ2_RS00820"
                     /old_locus_tag="Rahaq2_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="WP_014333438.1"
                     /db_xref="GI:504099444"
                     /translation="MLFRRFERMIDIFREAPAAEPPDQVLPFYLYYLRQVWPSFAILL
                     VVGLIGALIEVSLFSYLSQIIDLTKDTPPGSFFTDHRGELLWMAAVAMILRPVFIGLH
                     DLLVHQTISPGMTSMIRWQNHKYVLKQSLNFFQSDFAGRIAQRIMQTGSSLRDSAVQA
                     VDAIWHVVIYAASALFLFAEADWRLMIPLIIWIFGYGICLRYFVPRVKQRSVQSSEAR
                     SKLMGCIVDGYTNITTLKLFAHTDLEQKYAREAITEQTEKTQLAGRLVTGMDVSVTTL
                     NGLLIVSTTGLALWLWTQSLISVGAIALATGLVIRIVNMSGWIMWVVNGIFENIGMVQ
                     DGLHTIARPLTVTDIPQAKALKVDQGAIHFDHIDFNYGKENHGKENGGRVIPNLDLAI
                     RPGEKIGLIGPSGAGKSTLVNLLLRLYDIDGGRILIDQQNIAEVTQESLRAQIGMITQ
                     DTSLLHRSIRDNLLYGRPGATEEELQLAIRQARADEFIPQLYDSLGRTGLDAHVGERG
                     VKLSGGQRQRIAIARVLLKNAPVLIMDEATSALDSEVEAAIQESLETLMGGKTVIAIA
                     HRLSTIAKMDRLVVLEKGQIVETGNHAELLAHGGLYARLWQHQTGGFVGMD"
     gene            complement(186370..187497)
                     /locus_tag="RAHAQ2_RS00825"
                     /old_locus_tag="Rahaq2_0173"
     CDS             complement(186370..187497)
                     /locus_tag="RAHAQ2_RS00825"
                     /old_locus_tag="Rahaq2_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333439.1"
                     /db_xref="GI:504099445"
                     /translation="MPVITLNRLADCPAAQWDALVPAQQPFLSYAFLSALEDSGSLGP
                     HSGWRPQHLLWQENGEIRAAIPGYRKRHSYGEYVFDQGWADACQRSGIAYYPKWLGAV
                     PFSPVTGARLLGEESAAIRLLQALPDYLQENGLTGAHINFTDERANRLMGHEAVWQHR
                     QGLQYHWQNRGYRDFQDYLDALTSRKRKQFRKEREQVAAQGIDFVWLEGAQLTEAQWD
                     FVYACYSNTYHIRGQSPYLTRAFFSLLAERMPEAIRVVFAQLNGRDVAMAFSLISGDT
                     FYGRYWGCVAEFDRLHFETCFYQGMAYAIASGLARFDAGAQGEHKLLRGFEPVITDSW
                     HYLRHPGLRDAVEDFLVEERAAVQRWADEARQVLPYRHDVC"
     gene            complement(187681..188316)
                     /locus_tag="RAHAQ2_RS00830"
                     /old_locus_tag="Rahaq2_0174"
     CDS             complement(187681..188316)
                     /locus_tag="RAHAQ2_RS00830"
                     /old_locus_tag="Rahaq2_0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="WP_014333440.1"
                     /db_xref="GI:504099446"
                     /translation="MKDVIEGFLRFQKEAFPQRSKLFKKLALNQNPKTLFISCSDSRL
                     VPELVTQREPGELFVIRNAGNIVPPFGPEPGGVSATVEYAVMALGVKDIVICGHSNCG
                     AMSAIANCTCLDHMPAVAHWLRYSDAAKAINESIEHENPEARVNGMVHQNVVAQLSNL
                     RTHPCVAVALAKGEITLHGWVYDIESGCIEAFDAKSGAFISLSDNPEVRAS"
     gene            188537..189079
                     /locus_tag="RAHAQ2_RS00835"
                     /old_locus_tag="Rahaq2_0175"
     CDS             188537..189079
                     /locus_tag="RAHAQ2_RS00835"
                     /old_locus_tag="Rahaq2_0175"
                     /EC_number="1.8.4.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase A"
                     /protein_id="WP_013573501.1"
                     /db_xref="GI:503338840"
                     /translation="MTIEYAIFGGGCFWCTEAVFKDVIGVESVESVYTGGRRPNPNYE
                     QVCTGTTGHAEAIRVGFDPEKLTYGDLLDIHFVTHDPTQLNRQGNDVGTQYRSAIFPA
                     NEQQKAEAEAAILRAQHDHSDPIVTSIEPLGEVYVAEGYHQNYWDGAGQQNRYCMAVI
                     PPKLQKLRKSFAQRTKSLQQ"
     gene            complement(189150..189332)
                     /locus_tag="RAHAQ2_RS00840"
                     /old_locus_tag="Rahaq2_0176"
     CDS             complement(189150..189332)
                     /locus_tag="RAHAQ2_RS00840"
                     /old_locus_tag="Rahaq2_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-oxalocrotonate tautomerase"
                     /protein_id="WP_013573502.1"
                     /db_xref="GI:503338841"
                     /translation="MPMIRLEMFPGRTPEQKRDFVREVTRLAAETLKCKPESVDVVIT
                     EIPKSHWAKGGVLPEE"
     gene            complement(189452..189757)
                     /locus_tag="RAHAQ2_RS00845"
                     /old_locus_tag="Rahaq2_0177"
     CDS             complement(189452..189757)
                     /locus_tag="RAHAQ2_RS00845"
                     /old_locus_tag="Rahaq2_0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040733.1"
                     /db_xref="GI:739176762"
                     /translation="MDTRIGQILAQQLPPQASAKALNELGKQYQEQQDLDAAIACWEQ
                     SMACYGKPGFAQAQLMKAYNARRRQCSEAGDGKGLEQYSEKIDALMQQSKDAIRYGF"
     gene            complement(189791..191056)
                     /locus_tag="RAHAQ2_RS00850"
                     /old_locus_tag="Rahaq2_0178"
     CDS             complement(189791..191056)
                     /locus_tag="RAHAQ2_RS00850"
                     /old_locus_tag="Rahaq2_0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009635677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS beta-glucoside transporter subunit IIBC"
                     /protein_id="WP_014333442.1"
                     /db_xref="GI:504099448"
                     /translation="MSFLHFIVNDVLGQASILISLIAMIGLIALKKSTGQIITGTLKT
                     LLGFLVLLSGASIIVNALTFLGEIFQKGFHMRGIVTDVGSIAGIAQQTLGRETALIMV
                     LAFIVNILIARLTRFKYIFLTGQASLWMATVCSVIGYMGGLRGTELILTGGIIAGIMA
                     VGMPVLAQPIVRKITGSDDIALGHFCTIGYIVQAGVAKITGDVSKSTEDFELPQSFSF
                     LQDTYLSMMVVMIPIYLIPAIAAGPEVVAPYASNVNYLVYSFLQSIQFVVGVYVLLSG
                     VRLLLAEIVPAFRGIALRIVPNAIPALDCPVLFPYAPNAVIIGFISTTIGSVIGMFLF
                     PSLGLAMILPGMLTNFFAGGTAGIFGNAVGGRRGAIIGGIFHGLFITLLPALLLPLLG
                     KFGFSNVTFSDSDVISVGLVFGHILNFFH"
     gene            complement(191129..191431)
                     /locus_tag="RAHAQ2_RS00855"
                     /old_locus_tag="Rahaq2_0179"
     CDS             complement(191129..191431)
                     /locus_tag="RAHAQ2_RS00855"
                     /old_locus_tag="Rahaq2_0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIB"
                     /protein_id="WP_014333443.1"
                     /db_xref="GI:504099449"
                     /translation="MKKLSILAVCGAGLGSSFACEMSIEAALKDLGVEADLSHCDISS
                     ATSSRADIIMTGENFRSQFQHYSINANIIYLKRLVDKNEIKTKLTPILQEMGHLAT"
     gene            complement(191497..191940)
                     /gene="cmtB"
                     /locus_tag="RAHAQ2_RS00860"
                     /old_locus_tag="Rahaq2_0180"
     CDS             complement(191497..191940)
                     /gene="cmtB"
                     /locus_tag="RAHAQ2_RS00860"
                     /old_locus_tag="Rahaq2_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573506.1"
                     /note="TolM; with CmtA (IIBC), CmtB possibly forms the
                     mannitol-like permease component of the cryptic mannitol
                     phosphotransferase system, which phosphorylates and
                     transports various carbohydrates and polyhydric alcohols
                     in Escherichia coli; cytoplasmic protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIA"
                     /protein_id="WP_014333444.1"
                     /db_xref="GI:504099450"
                     /translation="MLSDWINENNTQIISKTDDWKSAVAFAVQPLIDSGAAESRYLQA
                     IYDMHREIGPYYVLGEGIAMPHARPEEGVNRTALSLVIVSEGVEFGSEGNDPVYVIFA
                     LAAVDSHSHIEMIASLSHLFCDDEAAERLKRSKNKQEALEIIRQF"
     gene            complement(192147..192743)
                     /locus_tag="RAHAQ2_RS00865"
                     /old_locus_tag="Rahaq2_0181"
     CDS             complement(192147..192743)
                     /locus_tag="RAHAQ2_RS00865"
                     /old_locus_tag="Rahaq2_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_014333445.1"
                     /db_xref="GI:504099451"
                     /translation="MSENRSTSRNGFTSKRVILVNGIPASGKSRLAVELSAYSGWLQL
                     SLDGIKNPFLQRLENVDRPFNRVLGLASYQVIWDIIGGAPQGSTFIVDAWFGFQPQEV
                     LQDYLQRAGVTQVVEIWCQIDAELAAERFSSRLGERLPGHVGAEYIPELKILAGNARP
                     ITSGPVYSVDQNVIGQNKPVNIVDIHTWIMNSFNTQIQ"
     gene            complement(192736..193671)
                     /locus_tag="RAHAQ2_RS00870"
                     /old_locus_tag="Rahaq2_0182"
     CDS             complement(192736..193671)
                     /locus_tag="RAHAQ2_RS00870"
                     /old_locus_tag="Rahaq2_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tagatose-bisphosphate aldolase"
                     /protein_id="WP_014333446.1"
                     /db_xref="GI:504099452"
                     /translation="MSKMSTSELRSYQQICGKNGAMMVIACDQRGAMRSLLASDPQQQ
                     SAISEHELGLIKADITQYLASKASCVLVDPVCAVPQLVDNGIIARDTALLIGLDASGW
                     DTSPEGYRLSRLVENVDARRVRELGATGGKIMVYLRSDQEAANRHNMDILRQCIEDFA
                     REDLLLVVEFLTYQLDNETGEEYKEKVPSLIYGGTKICLECGAKVLKLPYPGSKQACA
                     DITKLAGDVPWAVLSAGVDHSTFLKQVADAMSEGASGVIAGRSLWKDCISLDRNATKS
                     RLESLAVPRLNELQAVIEQHFHAPSHNQTQQVEHV"
     gene            193941..194840
                     /locus_tag="RAHAQ2_RS00875"
                     /old_locus_tag="Rahaq2_0183"
     CDS             193941..194840
                     /locus_tag="RAHAQ2_RS00875"
                     /old_locus_tag="Rahaq2_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_037040730.1"
                     /db_xref="GI:739176759"
                     /translation="MVAKLHYESDMSQVEIARKLDVSTATISRLLNKARAAGIVRIEV
                     VGLSSPEDMTADLIKRLGLKHAYVVDAPPGNVLGALATPLASLLQEAGLGAGSVLGIG
                     WGRAVREVTLAGMPRLPGIMTVALNGGMQQSAPHFQITEFVRRAAEQMEGTPYFLHAP
                     YLSSAELRDAFLSDPSVQEIISLWDRLDAAIVGVGLTHTPKPSESTTATPGEQALSDA
                     AGDVLRHYFTGTGELLHWEGEERMIAASVEQLRKTPLTIGVAATPEKAAGIIGAVRSG
                     MINSLVTDVNTAQAILDKLPVVV"
     gene            complement(194935..195765)
                     /locus_tag="RAHAQ2_RS00880"
                     /old_locus_tag="Rahaq2_0184"
     CDS             complement(194935..195765)
                     /locus_tag="RAHAQ2_RS00880"
                     /old_locus_tag="Rahaq2_0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylesterase"
                     /protein_id="WP_014333448.1"
                     /db_xref="GI:504099454"
                     /translation="MSTFNTQDGTQIYYKDWGKGKPVLFSHGWPLDADMWDSQMNFLA
                     DRGYRVIAFDRRGFGRSEQPWEGYNYDTFASDINDLIEHLDLHDVTLVGFSMGGGDVT
                     RYISRYGSERVTSLVLLGAVTPLFIKTDDHPQGVDKSVFDGIRAGLLKDRAQFISDFA
                     TPFYGTHQGMTVSDGVMTQTLNIALMASLKGTVDCVTAFSETDFRPDMAKITVPTLVI
                     HGSADQIVPFEATGKLAAEMIKNAELKIYEGAPHGFAVTHQDQLNDDLLAFLTGIAHA
                     "
     gene            196093..196734
                     /locus_tag="RAHAQ2_RS00885"
                     /old_locus_tag="Rahaq2_0185"
     CDS             196093..196734
                     /locus_tag="RAHAQ2_RS00885"
                     /old_locus_tag="Rahaq2_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014333449.1"
                     /db_xref="GI:504099455"
                     /translation="MSKFDLLDPQNSTLIFIDHQPQMSFGVANIDRQQLKNNTVALAK
                     AGKVFNVPVIYTSVETESFSGYIWPELLAVHPDVKPIERTSMNSWEDAAFVKAVEATG
                     RKKLIISALWTEVCLTFPALMALKEGYEVYVVTDTSGGTSVDAHERSIDRMVQAGAVP
                     VTWQQVLLEYQRDWSRKETYDDVMSLVREHSGAYGMGVDYAYTMVHKAPQRKA"
     gene            196797..197216
                     /locus_tag="RAHAQ2_RS00890"
                     /old_locus_tag="Rahaq2_0186"
     CDS             196797..197216
                     /locus_tag="RAHAQ2_RS00890"
                     /old_locus_tag="Rahaq2_0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333450.1"
                     /db_xref="GI:504099456"
                     /translation="MHHAPVSRLSAPVVPFAVIRWFALLALCAAYLQGGIVKLFDFPG
                     AIAEMQHFGLSPAAPMAAAVIVLELGASALILSGRFRWAGALALALFTFSANFMANAF
                     WQVSGQERAMMMNGFFEHIGLVGAFIYVAWDDIKGRV"
     gene            197213..198799
                     /locus_tag="RAHAQ2_RS00895"
                     /old_locus_tag="Rahaq2_0187"
     CDS             197213..198799
                     /locus_tag="RAHAQ2_RS00895"
                     /old_locus_tag="Rahaq2_0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014333451.1"
                     /db_xref="GI:504099457"
                     /translation="MSQNNVTNGGAFSPLKQGLFATIWVATILGNTGSFMRDVASSWL
                     VTGLSSNPAAVALMQTAATLPIFLLAIPAGVLSDILDRRRLLIFVQLLLASVSATLLL
                     LSHNNLLTVEYLVALTFIGGIGAALMGPAWQAIVPELVPRSDLRNAVALNSLGINIAR
                     AVGPAGGGLLLASLGAGAAYGADVMSYVFVIGALLWWKRPVKAKNELSEHFLGAFRAG
                     LRYVKASQELHRVLLRAAIYFAFASAIWAMLPLIARNMLHGTAGFYGILLGAVGVGAI
                     FGALLLPRLRQKLSADGLVLLSALLSAAVMLLLATSPAKWLAVVLMVILGIGWIIALT
                     SMNGVAQAVLPDWVRGRGLAVYLMVFNGAMAAGSLFWGLIAREIGLVGALLLAGSGLV
                     IAALVCWRLKLPAGEADLQPAGHWDNPVVEGDVQGDRGPVMIQIEYRIAQEDRPAFLT
                     EIRKLSLARRRDGAYAWGITEHSDDPSRLVEWFLVESWHEHLRQHQRVSHADADLQSD
                     VTRYHRGENKPQVHHYLSVR"
     gene            complement(198839..199747)
                     /locus_tag="RAHAQ2_RS00900"
                     /old_locus_tag="Rahaq2_0188"
     CDS             complement(198839..199747)
                     /locus_tag="RAHAQ2_RS00900"
                     /old_locus_tag="Rahaq2_0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcripitonal regulator"
                     /protein_id="WP_014333452.1"
                     /db_xref="GI:504099458"
                     /translation="MRLSLEALLILDALDRHGTFAAAAARLFKTASALSYTVQKMESD
                     LNIKLLDRSGHRATFTPTGRLMLEKGRVLLRAVSELEQQAQYVESGWESKLTISVDAS
                     VPFALLAPLIDRFYAEHQHTQLLFRHDVLAGCWEALSYGEADIVFGAVQEPVTRSGIE
                     YRPIGWLEYVFAVAPHHPLASLPEPLVREQIRQYRAVVVHDTSRHGTGADLRVLDEQK
                     MLSVHDFNAKVHAQIAGLGCGYLPRYLAAPHLASGALVERRLDTETRRDQAFMAWNEN
                     DTGNAAMWWRENLQDFDGIAAVYSHK"
     gene            199887..200195
                     /locus_tag="RAHAQ2_RS00905"
                     /old_locus_tag="Rahaq2_0189"
     CDS             199887..200195
                     /locus_tag="RAHAQ2_RS00905"
                     /old_locus_tag="Rahaq2_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014333453.1"
                     /db_xref="GI:504099459"
                     /translation="MTYPHQPDHITLVITHGVQRDKLTEYEHWLEKLMADAAGFAGYQ
                     SVKILRPVHGETIYTVLVRFDNIDNLYQWIQSGQRESREKALASLLSGQEYIELRTQA
                     "
     gene            200317..201168
                     /locus_tag="RAHAQ2_RS00910"
                     /old_locus_tag="Rahaq2_0190"
     CDS             200317..201168
                     /locus_tag="RAHAQ2_RS00910"
                     /old_locus_tag="Rahaq2_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573518.1"
                     /note="3' incision activity; acts with UvrC; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide excision repair endonuclease"
                     /protein_id="WP_014333454.1"
                     /db_xref="GI:504099460"
                     /translation="MWNPEKELFTGLYQYPEHLRHTLENLPNGSGVYIFYGDDNAFPL
                     YIGKSVNIRSRVMSHFRNPAEAKLLHMTRDIEFIETIGEVGALLLESDLIKTRRPLFN
                     KRLRTARKLCSVRLQGLTASIVFSDDVDFSHSEDLFGLFKTRMSAVEKIREIADQEKL
                     CYGALGLEKLAKNRACFRFSLGKCAGVCCGKESPEAHQARLRDALSTLKIRSWPYPGR
                     IAIAEEANGLTDYHVINHWFYLGTVNTLEAAKAFDTAVPHFDRDSYKILCKPLFEADS
                     PKVILLD"
     gene            complement(201180..>201761)
                     /locus_tag="RAHAQ2_RS00915"
                     /old_locus_tag="Rahaq2_0191"
     CDS             complement(201180..>201761)
                     /locus_tag="RAHAQ2_RS00915"
                     /old_locus_tag="Rahaq2_0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012968198.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040728.1"
                     /db_xref="GI:739176757"
                     /translation="LQEDSESILLTLGDTNSARVTTCEEFIALRRSGETVAGYPDMPD
                     RFMTAARDSLIDCYLTHYALDHRLTEITPAPKTPTLKDVVDHFPATAAIAISDEEVAK
                     VKTQYQGKTISQKDDDLKPDGDNRLVSAKNAEGYRISGMRVFKDKAGNLTQFITLGSF
                     VTEGSWGTTTTYRIIAQDKPVWEIEEITENSPL"
     gene            complement(201997..203349)
                     /locus_tag="RAHAQ2_RS00920"
                     /old_locus_tag="Rahaq2_0192"
     CDS             complement(201997..203349)
                     /locus_tag="RAHAQ2_RS00920"
                     /old_locus_tag="Rahaq2_0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004171266.1"
                     /note="catalyzes the reduction of 2 glutathione to
                     glutathione disulfide; maintains high levels of reduced
                     glutathione in the cytosol; involved in redox regulation
                     and oxidative defense; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione reductase"
                     /protein_id="WP_014333456.1"
                     /db_xref="GI:504099462"
                     /translation="MTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKELGGTCVN
                     VGCVPKKVMWHAAQIAEAIRNYGPDYGFDTTVNSFNWKTLVANRTAYIDRIHTSYDNV
                     LGKNNVDVIKGFARFVDDHTVEVNGEKITADHILIATGGRPSHPDIPGAEYGIDSDGF
                     FDLTEMPKRVAVVGAGYIAVEIAGVMNALGAETHLFVRKHAPLRTFDPLIVETLVEVM
                     ETEGPVLHKESIPKEVVKNADGSLTLKLENGQEFEVDSLVWAIGREPETDNFNLKATG
                     VKTNEKGYIVVDKFQNTSVEGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHL
                     DYSNIATVVFSHPPIGTVGLTEPQAKEQFGEDNVKVYKSAFTAMYTAVTQHRQPCRMK
                     LVCVGKEEKIVGIHGIGYGMDEMLQGFAVALKMGATKKDFDNTVAIHPTGAEEFVTMR
                     "
     gene            complement(203514..204356)
                     /locus_tag="RAHAQ2_RS00925"
                     /old_locus_tag="Rahaq2_0193"
     CDS             complement(203514..204356)
                     /locus_tag="RAHAQ2_RS00925"
                     /old_locus_tag="Rahaq2_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009635663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013573521.1"
                     /db_xref="GI:503338860"
                     /translation="MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKEKPFLYLDTHAG
                     AGRYQLSGEHAERTGEYLEGIARIWQRDDIPEELAAYMSVVNHFNRNENLRYYPGSPL
                     IARQLLREDDKLHLTELHPSDFPLLRSEFQKDDRTRVARADGYQQLKAQLPPPSRRGL
                     ILMDPPYEMKTDYQDVVKGIQEGYKRFATGTYALWYPVVMRQQIKKMLRDLEATGIRR
                     ILQIELGVRPDSDQRGMTASGMIVINPPWKLEQQMNNVLPWLLKVLVPSGTGHTTVNW
                     VVPE"
     gene            204538..206598
                     /locus_tag="RAHAQ2_RS00930"
                     /old_locus_tag="Rahaq2_0194"
     CDS             204538..206598
                     /locus_tag="RAHAQ2_RS00930"
                     /old_locus_tag="Rahaq2_0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="WP_014333457.1"
                     /db_xref="GI:504099463"
                     /translation="MTEQQNASNPLLTPFSLPPFSAIKPEHIVPAMKSAIEESRQTIE
                     RVVAQGAPYTWENLCQPLAESDDRLSRIWSPVGHLNAVKNSPELREAYEQCLPILSEF
                     STWTGQHAGLYQAYRDLKDSEHFSTLSVAQKKAIDNALRDFELSGIGLPMEKQKRYGE
                     ISARLSELGSTYSNNVLDATMGWSKLITDVNDLKGLPESALAAAKALAESKEQEGWLL
                     TLDIPSYLPVITYGENRELREEMYRAFATRASDQGPNAGKWDNSEVMAEELALRHELA
                     QLLGFDSFADMSLATKMAESPKQVIDFLSGLATRARPQGEQELAQLRAFAKEHFGVDE
                     MEAWDLPFYGEKQKQHLFSINDEQLRPYFPEQRALEGLFEVVKRIYGITAKERKDVET
                     WHKDVRFFDLFDETGDLRGSFYLDLYARENKRGGAWMNDCVGSMRKADGELQKPVAYL
                     TCNFNGPVGNKPALFTHNEVTTLFHEFGHGLHHMLTRIDTPGVAGIAGVPWDAVELPS
                     QFMENWCWEPDALAFISGHFETGEPLPKEMLDKMLAAKNYQAALFILRQLEFGLFDFR
                     MHAEYDPAKGAQILQTLAEIKKQVAVVPSPSWGRFPHAFSHIFAGGYAAGYYSYLWAE
                     VLSADAYSRFEEEGIFNRETGQSFLDNILSRGGSEEPMELFKRFRGREPQLDAMLRHY
                     GIKG"
     gene            206608..207354
                     /locus_tag="RAHAQ2_RS00935"
                     /old_locus_tag="Rahaq2_0195"
     CDS             206608..207354
                     /locus_tag="RAHAQ2_RS00935"
                     /old_locus_tag="Rahaq2_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009635665.1"
                     /note="predicted SAM-dependent methyltransferase; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_014333458.1"
                     /db_xref="GI:504099464"
                     /translation="MSVCLLCEEGADEGALSVLAQRWNLTSDPDAVMALVLTPERLEL
                     RKRDEPKLGAIYVDFVGGTMAHRRKFGGGRGEAVAKAVGIKGRYLPDVVDATAGLGRD
                     AFVLASLGCKVRMLERNPVVAALLDDGLARGYRDAEIGPWLRERMTLLHVSSLTALAE
                     LSPKPEVVYLDPMYPHKQKSALVKKEMRVFQGLVGPDEDADGLLEPARRLATKRIVVK
                     RPDYAPPMADIAAQAAVVTKSHRFDIYTPL"
     gene            complement(207433..207795)
                     /locus_tag="RAHAQ2_RS00940"
                     /old_locus_tag="Rahaq2_0196"
     CDS             complement(207433..207795)
                     /locus_tag="RAHAQ2_RS00940"
                     /old_locus_tag="Rahaq2_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012613694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333459.1"
                     /db_xref="GI:504099465"
                     /translation="MTTRHDAQDNADMWDNRDLGASEEHAEAISPSLAAEFDDMMELQ
                     AISIRLQKSLLSNLKTIAAHHQIGYQPMVRDLLTRFAEAEMKKILIDQLNKIDEAQRD
                     REKTVPVTEFIEDLRNQA"
     gene            complement(208075..208515)
                     /locus_tag="RAHAQ2_RS00945"
                     /old_locus_tag="Rahaq2_0197"
     CDS             complement(208075..208515)
                     /locus_tag="RAHAQ2_RS00945"
                     /old_locus_tag="Rahaq2_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333460.1"
                     /note="involved in resistance to DNA-damaging agents;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein A"
                     /protein_id="WP_014333460.1"
                     /db_xref="GI:504099466"
                     /translation="MAYKHILIAVDLSPESKVLVEKAVSMARPYNAKVSLIHVDVNYS
                     DLYTGLIDVNLGDMQKRISEETHHALNELSQNAGYPISETLSGSGDLAQVLVDAINKY
                     GVDLVLCGHHQDFWSKLMSSARQLINTVHIDMLIVPLRDEEEEA"
     gene            208853..209188
                     /locus_tag="RAHAQ2_RS00950"
                     /old_locus_tag="Rahaq2_0198"
     CDS             208853..209188
                     /locus_tag="RAHAQ2_RS00950"
                     /old_locus_tag="Rahaq2_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573525.1"
                     /note="ppGpp-dependent, membrane associated, stress
                     protein produced under conditions of nutrient deprivation,
                     osmotic shock and oxidative stress; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein B"
                     /protein_id="WP_013573525.1"
                     /db_xref="GI:503338864"
                     /translation="MISPVALFWALCFVCVVNMLRYYSSLRALLVVLRGCDPLLYQYV
                     DGGGFFTSHGQPSKQIRLVRYIYAQRYVEHHDPEFIRRCERVRGQFILTTALVGLILI
                     SMLAMLIWY"
     gene            complement(209403..210908)
                     /locus_tag="RAHAQ2_RS00955"
                     /old_locus_tag="Rahaq2_0200"
     CDS             complement(209403..210908)
                     /locus_tag="RAHAQ2_RS00955"
                     /old_locus_tag="Rahaq2_0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333461.1"
                     /note="involved in the transport of inorganic phosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transporter PitA"
                     /protein_id="WP_014333461.1"
                     /db_xref="GI:504099467"
                     /translation="MLHLFAGLDIHTGSLLILALLFVLFYEAINGFHDTANAVATVIY
                     TRAMRSQLAVVMAGVFNFLGVLLGGLSVAYAIVHLLPTDLLLNVGSAHGLAMVFSMLL
                     AAIIWNLGTWYFGLPASSSHTLIGAIIGVGLTNALMTHTSVVEALNIPKMIGIFASLI
                     VSPLVGMMMAGTMIFLLRRYWSGNKKHARIHLTPAEREKKDGKKKPPFWTRIGLILSA
                     IGVSFSHGANDGQKGIGLIMLVLIGVAPAGFVLNMSATGYDITRTRDAVTHLGQYYQQ
                     HADAVPHVVALTPLVPAPDVNIAPTDEPKVFHCDSSHALDAIGRAQTLLTNLQSYNDL
                     APDERSHMRRLLMCVSDTADKVAKLPETSAADKRFLGKLKTDILQTVEYAPIWIIIAV
                     ALALALGTMIGWKRVATTIGEKIGKKGMTYAQGLSAQLTAAVSIGVASYTGMPVSTTH
                     VLSSAVAGTMIVDGGGVQSKTVKNIAMAWILTLPVSIVLSGVLYWIALKLI"
     gene            211220..212443
                     /locus_tag="RAHAQ2_RS00960"
                     /old_locus_tag="Rahaq2_0201"
     CDS             211220..212443
                     /locus_tag="RAHAQ2_RS00960"
                     /old_locus_tag="Rahaq2_0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333462.1"
                     /db_xref="GI:504099468"
                     /translation="MEQVDVVVIGAGAAGMFCAAQAGQGGCRVLLLDNGKKTGRKILM
                     SGGGRCNFTNLYAEPAAYLSENPHFCKSALARYTQWDFIDMVNRYGIAWHEKTLGQLF
                     CDDSAQQIVSMLDKECEQGNVDVRLRSEISDVQKTENGFVIQVNGSTVSTHSLVIASG
                     GLSMPGLGATPFGYRLAEQFGLKVLPTRAGLVPFTLHKPLLDHLQTLSGVSVPAVLTA
                     QDGTVFRESILFTHRGLSGPAVLQLSSYWQPGEFVSVNLLPDVDLAAFLNTQRQEHPN
                     QSLKNTLAMQLPKRLVECLQTLGQLPDVTLKQLNVPQQAELVEQLQNWQVQPNGTEGY
                     RTAEVTLGGVDTKALSSKTMAAAKVPGLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQ
                     DLVMFWNNKNGDLNK"
     gene            <212829..213050
                     /locus_tag="RAHAQ2_RS00965"
     CDS             <212829..213050
                     /locus_tag="RAHAQ2_RS00965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333353.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hcp1 family type VI secretion system effector"
                     /protein_id="WP_037040726.1"
                     /db_xref="GI:739176755"
                     /translation="FKMYQILDAGIEFEYFNIILENVKITSITPNLYQGGQTGTHFET
                     IQMRYEVITWKCCEGNIIFKDSWNNRWVA"
     gene            213320..214570
                     /locus_tag="RAHAQ2_RS00970"
                     /old_locus_tag="Rahaq2_0204"
     CDS             213320..214570
                     /locus_tag="RAHAQ2_RS00970"
                     /old_locus_tag="Rahaq2_0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_037040713.1"
                     /db_xref="GI:739176742"
                     /translation="MKRTTGRFSGLSIMLPLLLTSCGTLSEMQVEENPHEVKQFACSQ
                     NPDDMVDSVAQRYLHKEKSSGMAVGIIRNNGPARTWGYGYTNAVNGYKIDGETLFALG
                     SVSKGVTGEVVAGLVDKGQLKWDDKLTDLLPKNIPLSEDAKNITLLQLATHTSGLPRQ
                     NMTKNMLESFLRYLYTGDNFYHELDSDAVVGDLSSFKRPLLHVPQYSNLGYALLGYIL
                     KLKTGEDIQQLSYAFIFDSLKMGNTSFHASQLKAYPYRAIGHAGDQPKLIRRGEVVPD
                     WHFSNNMVAAASLYSNADDLLKYLRAHIDDSQPGDLNAAIQVTEKIYFQRKIEAANIA
                     WVTDYKDDQVITYQVGYIGGYSSYIGFDKKHKNAVVVLQNSFNWSNYMGHDLLLKMAM
                     ADDYKGTCGKETLFFSPVKWGEAR"
     gene            complement(214572..216278)
                     /locus_tag="RAHAQ2_RS00975"
                     /old_locus_tag="Rahaq2_0205"
     CDS             complement(214572..216278)
                     /locus_tag="RAHAQ2_RS00975"
                     /old_locus_tag="Rahaq2_0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_014333465.1"
                     /db_xref="GI:504099471"
                     /translation="MFSMDTLFQDLDPQQKTPSWQRRLLKILFREKEFHRFADQYPHL
                     KGIDMAEQVLEHFNIRCELTERDREQIPSYGPVVIVANHPIGTLDGLAILHAVASVRP
                     DVKVVANQLLSLVSSLGSLMIPVDNMGNRTRRNQVTQMQEHLENQGVLIVFPAGEVSR
                     MSSKGVRDGKWHTGFIRLAAKARAPVVPVHISGSNSVLFYLSSMIYRPLSTLLLVHEM
                     FGQRGNSLTLKIGARIPYTSWHDGQMQAGDLAARFRKHLYRLGAGKPGLFHTETSIAR
                     AENRAVLKHALEASEVLGKTPDGKMIYLYRRHGEDTVPILRELGRLREIAFRAVGEGS
                     GRRRDLDGYDDDYYHLVLWDPQALEIVGAYRFIPTAEQVASKGLNGIYSQSLFQYGHQ
                     MDPILAQGIELGRSFIQPAYWGKRGLDYLWLGIGAYLAKYPQTRYLFGPVSISGGMPL
                     PARDLLVAFYRLYFSPALPLATSRRPYPASLPDVLAQFCGDDYQEDLQRLKRLLANLG
                     CSIPALYKQYSELCETGGVQFIDFGSDPDFNHCIDGLVLVDLSQLKPAKFERYIAVHQ
                     AE"
     gene            216477..217703
                     /locus_tag="RAHAQ2_RS00980"
                     /old_locus_tag="Rahaq2_0206"
     CDS             216477..217703
                     /locus_tag="RAHAQ2_RS00980"
                     /old_locus_tag="Rahaq2_0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002436578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014333466.1"
                     /db_xref="GI:504099472"
                     /translation="MPEPAAPDLASASPSKTTLRILSILVFNFANYLTIGLPLAILPG
                     YVHEHLGYSAFWAGLVISLQYFATLMSRPYAGRYADKVGPKKVVMFGLSGCLLSGVFY
                     LLALGFDAAPALSLAWLCLGRVMLGVGQSFAGTGSTLWGISVVGSLHIGKVISWSGVV
                     TYGAMAIGAPLGVLIFSVGGLTLLSVCIILVALTSLLTAWRKPPVVTKSPAQIPFRQV
                     LGKILPYGMMLALASTGFGVIATFITLFYAAKGWSGAAFSLTFFSLAFVGMRLLLPDS
                     ISRFGGLRVALACFVVEIAGLIMVFFAPAAWAAMAGAFITGVGFSLVYPALGVVAVKK
                     LPQENQGSALATYSAFLDLSLGITGPLAGVLMAQAGIDAIYLGSALLVLIAMALVVRL
                     LLRQPSSETSASVSAD"
     gene            complement(217700..218209)
                     /locus_tag="RAHAQ2_RS00985"
                     /old_locus_tag="Rahaq2_0207"
     CDS             complement(217700..218209)
                     /locus_tag="RAHAQ2_RS00985"
                     /old_locus_tag="Rahaq2_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase GCN5"
                     /protein_id="WP_014333467.1"
                     /db_xref="GI:504099473"
                     /translation="MSEIVIRHAEAADAEALQHLYAQVPVYSDTLQLPYPPATLWEDR
                     LANASPGRFALVACIDGKLVGNLTLMVEQPWRRRHVATFGIGVATQFQGRGVGSKLMA
                     AALELCDKWLQVIRVELTVYADNDAAIGLYKKFGFSVEGLSPSYAMRDGELVDTLHMG
                     RIRGVRQPV"
     gene            218663..219031
                     /locus_tag="RAHAQ2_RS00990"
                     /old_locus_tag="Rahaq2_0209"
     CDS             218663..219031
                     /locus_tag="RAHAQ2_RS00990"
                     /old_locus_tag="Rahaq2_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333468.1"
                     /db_xref="GI:504099474"
                     /translation="MAWNRETAVSYARTHAGASSQSRCAEYTRRAIEAGGVDIGNTRH
                     AKDYGGNLERAGFRAVPPGSTLIAGDVAVIQPHPGGNQSGHMTIFDGTTWFSDFRQRS
                     MYPGPGYRAAQPSYKIYRKD"
     gene            219031..219516
                     /locus_tag="RAHAQ2_RS00995"
                     /old_locus_tag="Rahaq2_0210"
     CDS             219031..219516
                     /locus_tag="RAHAQ2_RS00995"
                     /old_locus_tag="Rahaq2_0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001258712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333469.1"
                     /db_xref="GI:504099475"
                     /translation="MRIFIILAVSLLAACSANTNQQAGQQVKEFYGFYLTTFAGDTPP
                     PKYDSAVMKKYIAGETLKQLGMIYKIPEQELLGSDYFTYTQDYDAAWIPALKVGEAHD
                     LMGGKVINVWLGGAPEEELLLLEVFVRKEAGTWKIYRVRDVTNNYEAPIFSAGRIQYG
                     W"
     gene            complement(<219945..221423)
                     /locus_tag="RAHAQ2_RS01000"
     CDS             complement(<219945..221423)
                     /locus_tag="RAHAQ2_RS01000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018386056.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C14"
                     /protein_id="WP_037040724.1"
                     /db_xref="GI:739176753"
                     /translation="MGDFRTFGILNADQPADDALDALVNDPAISQIFAFSDLLFQRRH
                     RFSRSDITLDFQNYRVFTAGIASAPVNDPFAAVLFFQGTVTGTPVTFTLTETLQEQTD
                     IFPVTDPSVFQVGDWYAVQVAAVKGAAERELQKLVEIIAIPDSTHIQIGYYNGWELLA
                     GRVISWQKVEPVKFVTIKNMQFFGAGADQITGSHPVAFEYAVYANVAGIHSTGSFWPV
                     VMRRWNTHYLTQQCSLTNPPNTAFGGAGYLTQQIYCLYGHVSDCSVANARHLNDFTAS
                     AYCLVENCHASGQSAEKGPFVTHGQYEHDLTYTGNSGLMTFANSGATWGGSAKRINVR
                     KHVCPWFVARTGVSELTLEDLVVIASDTIPQSGMLWVNADGLQMTGCTADRTLIISQA
                     SQRAARPNLIRQCQFSLQEDGAPVVRSNVTADITFTDTVFNDINGHAFDSTAPLNFVR
                     CTFNATPEFAPLTLKSSTLSVQASQFNQVGFTLSGTEPKQIDI"
     gene            complement(221674..223770)
                     /locus_tag="RAHAQ2_RS01005"
                     /old_locus_tag="Rahaq2_0212"
     CDS             complement(221674..223770)
                     /locus_tag="RAHAQ2_RS01005"
                     /old_locus_tag="Rahaq2_0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333471.1"
                     /db_xref="GI:504099477"
                     /translation="MINRRELIAGITGGVVSAGLFKSVEINPDKMICAGNIMALRNLS
                     APADRTCAVVFGYHFAGDGAPKLVYWDANSEREANQGTVISSLKTAKGRWLQLHNGVM
                     DFRQFGIVNRQNAADAALKAMVSDPLIHRIEAHTSLNFISRHRFNRSNITLDFNGQTV
                     TATGLEILAEPKDNYLSAIFSFRGLAEEQTSVSVLRDPLPLLSEIYPVEDSDLYPVGQ
                     WYCLASDKISGHWERKIQRLVQVTERIDETHIRLNYRSGWALEAQSQLHWRKVTPVNN
                     VCIQNMYYFAEGQLANSSSQPVAFEYAIYCDVLNVHAQGTFWSVIFRRWNTFFRTEQC
                     SLTNPPSVSWGGAGYLTQQIYCQYGAITDCTASNARHLNDFTACSSCVVHNCHSNGDS
                     SGAFVTHGQYEHDLRFTANSGILTLANSGESWGQSAARIVVSQHRCSMLTADTHVTDL
                     TLTDVCIYRNVEQENLGILRLNCDGLTVQNCSLSGELTLVQNSQGSIKMNVFENCGFV
                     LDPRHDSTISNLAPDDPFIVSHPAAEARNSINGRSLLYFSHCQFKGTDKDVSLLIKNK
                     EINFNACRLENVSLILTADHPQKIVINGDSTLAGDEAAGPLLSRTGEHPVTWRLGPLQ
                     SEVTGDNQLHIQITTGINHYHAHHVTFTHGKRLFTDKAFSRPSYFIEQNNIMINTASV
                     VPASTGPHIVVENTEI"
     gene            224009..224704
                     /locus_tag="RAHAQ2_RS01010"
                     /old_locus_tag="Rahaq2_0213"
     CDS             224009..224704
                     /locus_tag="RAHAQ2_RS01010"
                     /old_locus_tag="Rahaq2_0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quercetin 2,3-dioxygenase"
                     /protein_id="WP_014333472.1"
                     /db_xref="GI:504099478"
                     /translation="MIYLRQAQERGHASHGWLESWHTFSFADYYDAQFMGFSALRVIN
                     EDFIDAGQGFGKHPHKDMEILTYVLEGTVEHQDSMGNKEQIQAGEFQIMSAGTGVTHS
                     EYNGNSDRKLHLYQIWIIPNQKGLEPRYEQRMFDAPQGRQLVLSPDARDGSLKVFQDM
                     ELSRWALKKDEQSVYQIQAERRVWIQVVKGTVSINGQKAGPSDALAIWDETALSVHAD
                     EDSEILLFDLPPV"
     gene            complement(224768..>225868)
                     /locus_tag="RAHAQ2_RS01015"
                     /old_locus_tag="Rahaq2_0214"
     CDS             complement(224768..>225868)
                     /locus_tag="RAHAQ2_RS01015"
                     /old_locus_tag="Rahaq2_0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411482.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_037040722.1"
                     /db_xref="GI:739176751"
                     /translation="VSAGAFDYYLYKGGKTSPKDRYLRTYPEPVPLPEPEAVPDLNPA
                     PEPTPQPIPKPVIAYRTDIVGYIAAPFLNRQYGFNSMGSYHERTGASVKHTQDGAWAR
                     VGGTHDNYDIGHFSFDSDIRYVQIGKDLYQDATPRGNDVHAGVMITLGDQKTNTSDSA
                     RGLVGGSADTGDISTDAYGIGGYYTLKTHEGAYLDFVGQYTAYRTDFHSESDASQDGY
                     SVAFSAEGGIPFAITQSWRLEPQTQVIYQYLHMKGFSDGIASVEKTTDSSVQARAGLR
                     LSHLPQIDQPNITPYLNLDAVTTFSDAPAVTIGSTEISPDFTQSAWKAGGGITAPLSR
                     NSSFYTSVNYQRGFDGKQEGYRGNIGINVSFK"
     gene            226426..226749
                     /locus_tag="RAHAQ2_RS01020"
                     /old_locus_tag="Rahaq2_0215"
     CDS             226426..226749
                     /locus_tag="RAHAQ2_RS01020"
                     /old_locus_tag="Rahaq2_0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose transporter subunit IIB"
                     /protein_id="WP_014333474.1"
                     /db_xref="GI:504099480"
                     /translation="MKRIMLCCSAGMSTSLLVRKMKEVAAERGEEVQIDAFGASEFDE
                     KFRDYQVVLLGPQVRYMQADLSARAAEFNIPVETINMMDYGMQRGDNVLDFAFGLIAQ
                     EGSRV"
     gene            226746..228074
                     /locus_tag="RAHAQ2_RS01025"
                     /old_locus_tag="Rahaq2_0216"
     CDS             226746..228074
                     /locus_tag="RAHAQ2_RS01025"
                     /old_locus_tag="Rahaq2_0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmF"
                     /protein_id="WP_014333475.1"
                     /db_xref="GI:504099481"
                     /translation="MSGLYQAMVNVIEKHITPLAGSVGQQRHVIAIRDGFIAALPFMI
                     IGSFMLVFIFPPFSPDTTLGFARGWLDLSLKYREQLMLPWYLSMGVMTFFISVGIGAS
                     LGKHYKLDPIMTGLLAFMAFLLVAAPYHDKQISTQYFSGEGIFTAILTAIYAAEVYAL
                     LKRRNITIRLPKEVPTGVARSFEILIPVVVIVATLHPLNLFIQSTTGMIIPEAIMHLL
                     APLVSASDSLPAILISVFICQVLWFAGIHGALIVTGIMNPFWMTNLALNQTALQAGAP
                     LPHIYLQGFWDHYLLIGGVGSTLPLAILLLCSKAVHLRTIGRMGVVPSFFNINEPILF
                     GTPIIMNPVFFLPFTLVPMLNAIFAYTATKLGWVAQVVSLTPWTTPAPIGASWAANWA
                     FSPVIMCLFCMVLSAVMYYPFLKAYERTLLKQEAEKATAQTAGNAVPANS"
     gene            228121..229503
                     /locus_tag="RAHAQ2_RS01030"
                     /old_locus_tag="Rahaq2_0217"
     CDS             228121..229503
                     /locus_tag="RAHAQ2_RS01030"
                     /old_locus_tag="Rahaq2_0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="WP_014333476.1"
                     /db_xref="GI:504099482"
                     /translation="MKYAFPKEFWWGSASSAPQTEGETLSHGKSATVWDHWYSQQPTR
                     FHNDVGPQDTSTFYKNWREDIALLKQLNHNTFRTSISWARLIPNGRGDVNQEAVTFYN
                     QVIDEMLAQGVQPFINLFHFDMPMAMQEIGGWENREVVQAYAKYADTCFELFGDRVKH
                     WFTFNEPVVPVEGGYLYDFHYPNVVDFKRAATVAYHTMLAHSLAVKAYRARHLSGEIG
                     IILNLTPSYPRSQNPADLKAANIADLMFNRSFLDPALRGEYPQELVELLKKHHQLPAC
                     QQGDKELLQQGVVDLLGINYYQPRRIQCRDSMVNPESPFMPEWFFDNYVMPGRKMNPH
                     RGWEIYEQGIYDILTNLRENYGNPRCFISENGMGVEHELRFEKDGRIEDDYRIEFVSG
                     HLKWLHRALQEGSGCLGYHMWTFIDCWSWMNAYKNRYGFIQLDLETQKRTVKKSGEWF
                     AAVSKNNGFD"
     gene            229517..230434
                     /locus_tag="RAHAQ2_RS01035"
                     /old_locus_tag="Rahaq2_0218"
     CDS             229517..230434
                     /locus_tag="RAHAQ2_RS01035"
                     /old_locus_tag="Rahaq2_0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_014333477.1"
                     /db_xref="GI:504099483"
                     /translation="MANINDVSRLAKVSKATVSRVLSGSRGVKEESRLAVMQAVETLQ
                     YKPSVIAQSLSTQSTGCIGVICATENINQSTGYLHALEKELRLNQKYLLLRFATDAAS
                     LTHSVDEIGRGLCDAMIVIGARFPLPKLPDNVITIDCLDADSERSIHFDRSFAAETAC
                     QYVLKQGRRQIALINPESHETAGQILQGYHLALEKFLLPYDRRLVHSGADALTQLLAQ
                     NVPFNALLVPDDATAQDALRQLMQRGRAVPENVMVFSLDSTLPPGVSAVPAIAYPLET
                     LAQRAMALLTGQFSASVSAPVRGQLSLPS"
     gene            230541..231536
                     /locus_tag="RAHAQ2_RS01040"
                     /old_locus_tag="Rahaq2_0219"
     CDS             230541..231536
                     /locus_tag="RAHAQ2_RS01040"
                     /old_locus_tag="Rahaq2_0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014411484.1"
                     /db_xref="GI:504224382"
                     /translation="MKKKRPVLQDVADKVGVTKMTVSRYLRNPEQVSGALQEKISAAL
                     DELGYIPNRAPDILSNAKSRAIGVLLPSLTNQVFAEVLRGIESVTDIHGYQTMLAHYG
                     YSQEREEQRLTSLLSYNIDGLILSERHHTARTLKMIEVAGIPVVEMMDCVSPCVDLAV
                     GFNNFEAARQMTQQIIARGHRHVVYFGARQDERTIIKQQGYEQAMRESGLEPYSVMTS
                     RSSSYSGGAELLRQAQKDWPQIDSIFCTNDDLAAGAFFECQRQGLKIPSQMAIAGFHG
                     HNMGQAMEPPLASVLTPRERMGQISAERLLARLRGEEVVPRMVDVGFTISAGGSI"
     gene            231691..232197
                     /locus_tag="RAHAQ2_RS01045"
                     /old_locus_tag="Rahaq2_0220"
     CDS             231691..232197
                     /locus_tag="RAHAQ2_RS01045"
                     /old_locus_tag="Rahaq2_0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333478.1"
                     /db_xref="GI:504099484"
                     /translation="MKYDFQIKMIAVRHYLDGHDGFKITARKYQVPASSLRAWTAAYQ
                     FHGEQAFRKATRIYSEQFRAHVVDVTLREHLSMRSAAARFNIADYQTIKRWILAAKNS
                     AFPALKERNNMAQKTQKPEIKPEDMTPAELLEEVRYLRAERAYNEKLDALMKSKTERK
                     KKSTPSGH"
     gene            232185..233024
                     /locus_tag="RAHAQ2_RS01050"
                     /old_locus_tag="Rahaq2_0221"
     CDS             232185..233024
                     /locus_tag="RAHAQ2_RS01050"
                     /old_locus_tag="Rahaq2_0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015696341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041682443.1"
                     /db_xref="GI:754018625"
                     /translation="MRALIGEHRLQDLLKSARLPRSTWYWWQSREQAGDDVTLCDAIG
                     QLAIRHKRCYGYRRVTLELRNQGVRVNHKKVFRLMREMDVQARVRPKKYRSYKDDIGM
                     APAPNLLRRKFNASGPGVKLVTDVTEFNVGGDKLYLSPVMDLYNAEIIAMSIGTRPTF
                     ELTEKMLNDLLTSGYVRKKAILHSDQGWQYRMPSWQKRLKEAGIRQSMSRKGNCYDNA
                     AMESFFAVLKTEMFHGYKFESREKLAESIEAYVAYYNHDRIKMKLGGMSPADYRTQMF
                     PLH"
     gene            complement(233075..233590)
                     /gene="idnK"
                     /locus_tag="RAHAQ2_RS01055"
                     /old_locus_tag="Rahaq2_0222"
     CDS             complement(233075..233590)
                     /gene="idnK"
                     /locus_tag="RAHAQ2_RS01055"
                     /old_locus_tag="Rahaq2_0222"
                     /EC_number="2.7.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-gluconate kinase"
                     /protein_id="WP_013573544.1"
                     /db_xref="GI:503338883"
                     /translation="MAGQSIILMGVSGSGKSTVGAALAREINAKFIDGDDLHPRANIQ
                     KMASGTPLNDDDRAPWLLRLNDAAYSLRHKNETGIIVCSALKRRYRDALRKDNEGMVF
                     IYMKGSFEVIAERLKARAGHFMPTDLLRSQFDALEEPGEDEPDVLRVNIDHKFEGVVD
                     RCIAALKTVQK"
     gene            233836..235152
                     /locus_tag="RAHAQ2_RS01060"
                     /old_locus_tag="Rahaq2_0223"
     CDS             233836..235152
                     /locus_tag="RAHAQ2_RS01060"
                     /old_locus_tag="Rahaq2_0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gnt-II system L-idonate transporter IdnT"
                     /protein_id="WP_014333480.1"
                     /db_xref="GI:504099486"
                     /translation="MPLVIVAVGVALLLLLMIRFKLNGFIALILVALAVGIMQGMPVD
                     KVITSIKNGVGGTLGSLALIMGFGAMLGKMLADCGGAQRIATTLIEKFGREHIQWAIV
                     LTGFIVGFALFYEVGFVLMLPLVFTVAAAARLPLLYVGVPMAAALSVTHGFLPPHPGP
                     TAIATIFHADMGKTLLFGSLLAVPTVILAGPVYARFLKGIDKPVPEGLFNPKTFTEEE
                     MPGFGVSVATSLVPVILMAFRALCEMILPKGHPVLAYAEFFGDPVMATLIAVLIAIFT
                     FGLNRGRKMEDVMATVTDSIKIIAMMLLIIGGGGAFKQVLVDSGIEKYIAALMHGSTL
                     SPILLAWSIAAVLRIALGSATVAAITAGGIAAPLIATTGVSPELMVIAVGSGSVIFSH
                     VNDPGFWLFKEYFNLSIVETFKSWSVLETIISLCGLAGCLLLSMVV"
     gene            complement(235215..235808)
                     /locus_tag="RAHAQ2_RS01065"
                     /old_locus_tag="Rahaq2_0224"
     CDS             complement(235215..235808)
                     /locus_tag="RAHAQ2_RS01065"
                     /old_locus_tag="Rahaq2_0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009635709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013573548.1"
                     /db_xref="GI:503338887"
                     /translation="MTEMISATILLFLIMDPLGNLPIFMSVLKHLDPKRRRVVLIREM
                     LIALILMLIFLFAGEKILSFLNLRTETVSISGGIILFLIAIKMIFPSEEKSSSGLPAG
                     EEPFLVPMAIPLVAGPSILATLMLLSHQYPNQMSHLTLALFIAWGMSMAILLLSNLFL
                     RLLGDKGVSALERLMGLILVMLSTQMFLDGIRAYLKI"
     gene            236019..237122
                     /locus_tag="RAHAQ2_RS01070"
                     /old_locus_tag="Rahaq2_0225"
     CDS             236019..237122
                     /locus_tag="RAHAQ2_RS01070"
                     /old_locus_tag="Rahaq2_0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005186018.1"
                     /note="catalyzes the formation of 4-aspartyl phosphate
                     from aspartate 4-semialdehyde; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="WP_014333481.1"
                     /db_xref="GI:504099487"
                     /translation="MKNVGFVGWRGMVGSVLMQRMIEERDFDAIRPVFFSTSQHGQAA
                     PSFTGQSGTLQDAYDLDALSALDIIITCQGGDYTNEIYPKLREIGWSGYWIDAASSLR
                     MEDDAIIILDPVNSAVIHQGIDKGIKTFVGGNCTVSLMLMSLGGLFAHDLIEWASVAT
                     YQAASGGGARHMRELLTQMGMLHNSVAKELENPASAILDIERKVTALTRSGTLPTDNF
                     GVPLAGGLIPWIDKQLDNGQTKEEWKGQAETNKILGTSSIIPVDGLCVRIGALRCHSQ
                     AFTLKLKQDVSIPEIEQMLASHNDWVRVIPNDRELSMRELTPAAVTGTMSTPVGRLRK
                     LNMGPQYLSAFTVGDQLLWGAAEPLRRMLRILL"
     gene            237534..239717
                     /locus_tag="RAHAQ2_RS01075"
                     /old_locus_tag="Rahaq2_0226"
     CDS             237534..239717
                     /locus_tag="RAHAQ2_RS01075"
                     /old_locus_tag="Rahaq2_0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen branching protein"
                     /protein_id="WP_014333482.1"
                     /db_xref="GI:504099488"
                     /translation="MSVLPDQHVINQIISGHYADPFSLLGMHSVAAGLEVRALLPDAD
                     QVWVIDVEKGKQVAELRRYDDRGFFVGLIPRRKNAFRYKLEVRWGENLQVIDDPYRFG
                     TLLQELDIWLLAEGTHLRPYEKLGAHLQTLDDVEGVSFAVWAPNAMRVSVVGEFNFWD
                     GRRHPMRQRRENGIWELFIPAVREGQLYKFEIIDCRGQISLRADPYAFEAQMRPDTAS
                     CVRKLPDVVPHSESRKKANALNQPVSVYEVHLGSWRRHADDNFWLSYGELAEQLVSYA
                     KWMGFTHIELMPVNEHPFDGSWGYQPLGMYAPTRRFGTPMEFKAFVEAAHHAGLNVIL
                     DWVPGHFPSDTYGLAQFDGTALYEYADPREGYHQDWNTLIYNYGRHEVRNYLAGNGFY
                     WIERFGIDGLRVDAVASMIYRDYSRKAGEWIPNYYGGRENLEAISFLKYTNQTIGREL
                     GGAVTLAEESTDYPGVTMPPDANGLGFHYKWNMGWMHDSLTYMQLDPVHRKYHHNLMT
                     FGVLYAYSENFILPLSHDEVVHGKKSLLDKMPGDVWQKFANLRAYYGFMWAHPGKKLL
                     FMGNEFAQGREWNFDASLDWHLLDDPGGWHSGVQHLVRDLNLTYRANAPLYELDYNPR
                     GFEWLVVDDHENSIFAFARRDENGGEVIVISNFTPVPREHYRIGISRPGCYHEILNTD
                     SHFYRGSNVGNGGDVYSENIGHHQREHSISVTIPPLATVYLRREA"
     gene            239717..241741
                     /locus_tag="RAHAQ2_RS01080"
                     /old_locus_tag="Rahaq2_0227"
     CDS             239717..241741
                     /locus_tag="RAHAQ2_RS01080"
                     /old_locus_tag="Rahaq2_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333483.1"
                     /note="catalyzes the hydrolysis of the
                     alpha-1,6-glucosidic linkages in partially depolymerized
                     glycogen; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen-debranching protein"
                     /protein_id="WP_014333483.1"
                     /db_xref="GI:504099489"
                     /translation="MKQPAPGLPAPFGAHLRDNGVNFCLYSAHAEKVELCLFDETGSE
                     QHLPLTGRTGNLWHGFVPDLKAGQRYGYRIYGPFDPKKGHRFNPKKVLIDPSARAIDG
                     VLLDNARFTGGTDAPDDKDSAVVAPKSVVVAGNFNWGDDKPPATPWGETVIYEAHVRG
                     LTRQHPHIPAAIRGTYAGLAHPVMLEYLQHLGVTAIELLPVQHHADEPRLQRLGLSNY
                     WGYNVLAPCAVEPRYASGSGGVSALNEFKSAVKALHQAGIEVILDVVFNHSAELDIDG
                     PFISFRGIDNASYYWLNEDGSDNNMTGCGNTLRLMDDEVIAWTIDCLHYWVRECHVDG
                     FRFDLATVLGRTPEFSAQSPLFNAIKQDATLSQVKLIAEPWDIGTGGYQLGNFPAPFA
                     EWSDIWRDDMRQFWLHGDTSLGQFAGRFAASADKFNPAQREPCASVNMLTAHDGFTLR
                     DLVSFNQKHNQANGEENRDGHNENFSQNHGEEGLAASAQVLQQRRLSQRALLATLFLS
                     QGTPMLLAGDELGNSQSGNNNAYCQDNPLTWLDWENADDSLTAYTCALIALRRKIPAL
                     TQNRWWQEGGDDVQWLNQQGQPMSPGDWEQGPQQWLQICLSQRWLVIVNASLHEVDLH
                     LPPGNWQPVAPFNSVLFDEEPRRVMEGSQWRAAAKTLCVLQDFTPQSRSL"
     gene            241759..243036
                     /gene="glgC"
                     /locus_tag="RAHAQ2_RS01085"
                     /old_locus_tag="Rahaq2_0228"
     CDS             241759..243036
                     /gene="glgC"
                     /locus_tag="RAHAQ2_RS01085"
                     /old_locus_tag="Rahaq2_0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333484.1"
                     /note="catalyzes the formation of ADP-glucose and
                     diphosphate from ATP and alpha-D-glucose 1-phosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="WP_014333484.1"
                     /db_xref="GI:504099490"
                     /translation="MATLDNRDPVMLARQLPLKSVALILAGGRGSRLKDLTATRAKPA
                     VHFGGKFRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLL
                     PAQQRHSTEHWYKGTADAVYQNLDIIRRYNAEFVVILAGDHIYKMDYSRMLIDHVQKG
                     GECTVACLEVPRAEASEFGVIGVTEDYHITSFVEKPKDPPPMPGNPDMALASMGIYIF
                     NADYLFRMLEEDMASEESSHDFGKDLIPKLTRQGVARAHPFGLSCVTQNDEAPPYWRD
                     VGTLDAYWRANLDLASVTPELDMYDRDWPIRTHMEPLPPAKFVQDRSGSHGMTMNSLV
                     AGGVIVSGSVVVHSVLFPRVRVNSFCNIDSAIILPDVNVGRSCRLRKCVIDRACQIPE
                     GMVIGENADEDSRRFYRSEGGVVLVTRAMLAKL"
     gene            243108..244544
                     /gene="glgA"
                     /locus_tag="RAHAQ2_RS01090"
                     /old_locus_tag="Rahaq2_0229"
     CDS             243108..244544
                     /gene="glgA"
                     /locus_tag="RAHAQ2_RS01090"
                     /old_locus_tag="Rahaq2_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573553.1"
                     /note="catalyzes the formation of alpha-1,4-glucan chains
                     from ADP-glucose; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen synthase"
                     /protein_id="WP_014333485.1"
                     /db_xref="GI:504099491"
                     /translation="MQVLHVCSELFPLLKTGGLADVAGALPAAQIAEGADVRVLIPAF
                     PDVKKGLGETQVIGTLATFAGHVTLSLGYFDGVGIYLIDVPGLYDRPGSPYHDQSSFA
                     YPDNHLRFALLSWMACELALNFDPHWKPDIVHSHDWHAGLCSAYIRARNAPVRTVFTV
                     HNLAFQGLFGAHHLDELYIPREFFQMHGLEFYGQISFLKAGLFYSDHVTTVSPTYAKE
                     ITRPEFGYGMESLLLEREMQGRLTGILNGVDEAIWQPRDDVLLSARYDAEDLRSKAVN
                     KAYLQRAMGLDVDDSRLVFAVVSRLTSQKGLDLVLEALPDLLERGGQLALLGAGDAVL
                     QQAFLAAAADNPGQVGVQLGYHEAFSHRIIGGADVIMVPSRFEPCGLTQLYGLKYGTL
                     PLVRRTGGLADTVVDCALENLADGTASGFVFEEATGKSLGNAIRRAFVLWSRPKHWRH
                     VQQHAMGIDFGWKVAAQEYLTLYNRLLS"
     gene            244582..247029
                     /locus_tag="RAHAQ2_RS01095"
                     /old_locus_tag="Rahaq2_0230"
     CDS             244582..247029
                     /locus_tag="RAHAQ2_RS01095"
                     /old_locus_tag="Rahaq2_0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009635715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen phosphorylase"
                     /protein_id="WP_014333486.1"
                     /db_xref="GI:504099492"
                     /translation="MTSPFNYNSPTVSVEALKHSIAYKLMFIIGKDPSIATQHDWLNA
                     TLFAVRDRMVERWLRSNRAQTSQDVRQVYYLSMEFLIGRTLSNALLAMGIYDDLKSAL
                     DEMGFDLEELIGEENDPGLGNGGLGRLAACFLDSLATLALPGRGYGIRYEYGMFAQSI
                     INGEQKEAPDYWLEYGNPWEFQRYNTRYKVRFGGRVQHEGIKTRWLETEEVIACAYDQ
                     VIPGYDTDATNTLRLWGAQASNEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTY
                     SGRELRLRQEYFLVSATVQDILNRHYTTHHTYDNLADKIAIHLNDTHPVLSIPELMRL
                     LIDEHKFEWQAAWETVCSVFSYTNHTLMSEALETWPVDMIGKILPRHLEIIFQINDHF
                     LKEVAEKIPNDNGLLSRVSIIDEGNGRKVRMAWLAVIASHKVNGVSELHSELMVQSLF
                     ADFARIYPDRFCNKTNGVTPRRWLALANKPLSAVIDDAIGQTWRSDLSQLAELKQNLD
                     YLSFLQAIRKAKLDNKKRLALYIAQKLNIVVDPKSLFDVQIKRIHEYKRQLMNVLHVI
                     TRYNRILDEPEADWVPRTVIFAGKAASAYYAAKQIIRLINDVATVINNDPRMGNKLKI
                     VFIPNYSVSLAQLIIPAADLSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEML
                     EHVGEENIFIFGNTTPQVEELRRKGYNPHTYFEQDAELHQVLTQIATGVFSPGEPKRY
                     TNLFDTLVNLGDHYQVLADYRSYVDTQDKVDELYKLPEEWTRRTLHNIANMGYFSSDR
                     TIQEYADEIWNIKPVKL"
     gene            complement(247263..248774)
                     /gene="glpD"
                     /locus_tag="RAHAQ2_RS01100"
                     /old_locus_tag="Rahaq2_0231"
     CDS             complement(247263..248774)
                     /gene="glpD"
                     /locus_tag="RAHAQ2_RS01100"
                     /old_locus_tag="Rahaq2_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411489.1"
                     /note="in Escherichia coli this homodimeric enzyme is
                     expressed under aerobic conditions; anaerobic expression
                     is repressed by the arcAB system; converts
                     sn-glycerol-3-phosphate and ubiquinone-8 to dihydroxy
                     acetone phosphate and ubiquinol-8; associates with the
                     cytoplasmic membrane; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="WP_014333487.1"
                     /db_xref="GI:504099493"
                     /translation="METKDLIVIGGGINGTGIAVDAAGRGLSVLLLEAQDLACATSSA
                     SSKLIHGGLRYLEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHQPHLRPAWMIR
                     AGLFLYDHLGKRTSLPASKGLKFGSESVLKPELTKGFEYSDCWVDDARLVVVNAQEVE
                     ERGGEVRTRTRVTRAWREDGLWMVEAEDIDTGKTFTWRAKGLVNATGPWVKHFFDDGL
                     KLKSPYGIRLIKGSHIVVPRAHNQPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYH
                     GDPKDVKIDDKEVGYLLKVYNDHFKKQLTTEDIVWTYSGVRPLCDDESDSPQAVTRDY
                     TLDVHDQDGKAPLLSVFGGKLTTYRKLAEHALEKLVKYYPKAGPAWTKTAVLPGGKLN
                     GDRDTYSASLRTRFKWLPESLARRYARTYGSQTELFLNEATSLESLGEDFGHGFYEAE
                     LRYLVEKEWVSQLDDAIWRRTKLGMWLDKAQQQRIAEWLETHKQQKKHLSLAS"
     gene            complement(249048..249806)
                     /locus_tag="RAHAQ2_RS01105"
                     /old_locus_tag="Rahaq2_0232"
     CDS             complement(249048..249806)
                     /locus_tag="RAHAQ2_RS01105"
                     /old_locus_tag="Rahaq2_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004096965.1"
                     /note="represses the glpD, glpFK, glpTQ, and glpACB
                     operons involved in glycerol-3-phosphate metabolism;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013573556.1"
                     /db_xref="GI:503338895"
                     /translation="MKQTQRHDAIIDLVRQQGYVSTEELVEHFAVSPQTIRRDLNDLA
                     EQNKIHRHHGGAALPSSSVNAAYNDRKVMWSEAKARIAERVASQIPDGSTLFIDIGTT
                     PEAVAHALLNHKNLRIVTNNLNVATLLTAKEDFRLFLAGGEVRARDGGIMGEATLDFI
                     SQFRLDYGILGISGIDMDGSLLEFDYHEARTKRAIIENSRCVMLVTDHSKFGRNAMVN
                     LGKMDLIHYLFTDKQPPDSVKQIIDKYDVHLELC"
     gene            complement(249816..250649)
                     /locus_tag="RAHAQ2_RS01110"
                     /old_locus_tag="Rahaq2_0233"
     CDS             complement(249816..250649)
                     /locus_tag="RAHAQ2_RS01110"
                     /old_locus_tag="Rahaq2_0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333488.1"
                     /note="protease responsible for the cleavage between Ser
                     and Asp residues of proteins in regions of high local
                     hydrophilicity; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="intramembrane serine protease GlpG"
                     /protein_id="WP_014333488.1"
                     /db_xref="GI:504099494"
                     /translation="MVRILNLNNPRLAQAFVDYMATQGFTLTMKHESQEVQLWLEDES
                     RLEEAEKQVALFVRDPLHPRYQEASWKTGKAQPHLKMSHTPFLKTLRSRAGPLTIGMI
                     VLSLAVFILQQMVGDELVMSWLAWPDSSRVFQLWRWFTPALMNFSFIALLINLAWWWY
                     LASQIEMHLGSGKLFTVTLISALISGWGQSMVSGSWFGGLSGVVYALMGYAWLTGQLK
                     PESRLYVPGGLLVISLIFMFIGYATGGAAVSNAAHAFGLGLGLVMAFVDTRTPRNKKS
                     K"
     gene            complement(250949..252139)
                     /locus_tag="RAHAQ2_RS01115"
                     /old_locus_tag="Rahaq2_0234"
     CDS             complement(250949..252139)
                     /locus_tag="RAHAQ2_RS01115"
                     /old_locus_tag="Rahaq2_0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333489.1"
                     /note="catalyzes the formation of methanethiol and
                     2-ocobutanoate from L-methionine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine gamma-lyase"
                     /protein_id="WP_014333489.1"
                     /db_xref="GI:504099495"
                     /translation="MKNLNTSRSLGMRTLAVHGGQQPDALTGAIATPITAASAFSYPD
                     FDSGARRFSGEEPGYIYSRFANPTVAVFEQKLAALEGAETAVACASGMAAISATLFAL
                     LVPGDEIIHIGTLYGGTEGVVRNLLPRYGIKPVHVANVNELEAAFTKNTKVVLVETPA
                     NPGLDIADLAEIARLSTAAGAVSVADNTFATPYLTRPLELGIDIVLHSATKYISGHGD
                     ATGGVVAGSAALITPIRTLSLKQFGGNLGPFEASLLIRGLKTLPLRVEASSLSAQAVA
                     EFLDGHSAVDTVFYPGLKQHPGHATASRQMKLFGGIMAIELKGGLNAARTFLDKLSII
                     TQAVSLGDTDSLACHPASTTHSAVAPEVRRQSGITDGLVRISIGIEDTADLIADLQQA
                     LEGL"
     gene            complement(252282..252602)
                     /gene="glpE"
                     /locus_tag="RAHAQ2_RS01120"
                     /old_locus_tag="Rahaq2_0235"
     CDS             complement(252282..252602)
                     /gene="glpE"
                     /locus_tag="RAHAQ2_RS01120"
                     /old_locus_tag="Rahaq2_0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333490.1"
                     /note="belongs to rhodanese family; thiosulfate
                     thiotransferase; in Escherichia coli this enzyme catalyzes
                     the formation of thiocyanate from thiosulfate and cyanide
                     with low efficiency; contains an active site cysteine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase"
                     /protein_id="WP_014333490.1"
                     /db_xref="GI:504099496"
                     /translation="MEQFEAISVEQARNRLTSGEAVMVDIRDPQSFSAAHAPGAWHLS
                     NDSLPAFIQQTDAKTPVLVMCYHGISSRGAAQFLISQGFESVYSVDGGFEAWSQTFPQ
                     DIEA"
     gene            complement(252687..253442)
                     /locus_tag="RAHAQ2_RS01125"
                     /old_locus_tag="Rahaq2_0236"
     CDS             complement(252687..253442)
                     /locus_tag="RAHAQ2_RS01125"
                     /old_locus_tag="Rahaq2_0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014333491.1"
                     /db_xref="GI:504099497"
                     /translation="MTEPQRHNAILDLLQRQGQISVADVIDNFDISPATARRDITKLN
                     ELGKLRKVRNGAEAVNQPRQNWTPLNIHQTHNLNEKMRIAKAAAGLCQPGESVVINCG
                     STAFLLGREMCGKDIQVITNYLPLANYLIEQEHDSVVIMGGQYNKSQSITLAPQDGDA
                     SLYAGHWMFTSGAGLTSDGLYKTDMLTAMAEQKMLNYVGNLAVLVDSSKIGQRAGMLF
                     SRTEQIDVLITGKEANEEIIGQLRQKGVEVILV"
     gene            complement(253671..254735)
                     /locus_tag="RAHAQ2_RS01130"
                     /old_locus_tag="Rahaq2_0237"
     CDS             complement(253671..254735)
                     /locus_tag="RAHAQ2_RS01130"
                     /old_locus_tag="Rahaq2_0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003856017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-ascorbate 6-phosphate lactonase"
                     /protein_id="WP_014333492.1"
                     /db_xref="GI:504099498"
                     /translation="MSKVETISRESWILSTFPEWGTWLNEEIEQEKVAPGTFAMWWLG
                     CTGIWLKSEGGANICVDFWCGVGKQNHSSPLMKTGHQMQRMAGVKKLQPNLRTTPFVL
                     DPFAIREVDAVLSTHDHNDHIDVNVAAAVMQNCAADVPFIGPQTCVDLWMSWGVPASR
                     CIVMTPGKVVRIKDVEIHALDSFDRTVLITLPAGQKAAGVLPDMMDQRAVNYLFKTPG
                     GNLYHSGDSHYSNYYAKHGNEYQIDVALGSYGENPRGVTDKMTSVDMLRMAESLRTKV
                     VIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTYPDDKDNFEYHY
                     PRGFDDCFTTETDLPFKSFL"
     gene            255160..256563
                     /locus_tag="RAHAQ2_RS01135"
                     /old_locus_tag="Rahaq2_0238"
     CDS             255160..256563
                     /locus_tag="RAHAQ2_RS01135"
                     /old_locus_tag="Rahaq2_0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIC"
                     /protein_id="WP_014333493.1"
                     /db_xref="GI:504099499"
                     /translation="MEFLYTIFTVFFNQVMTNAPLLLGIVTMLGYILLRKSATVIIKG
                     TIKTIIGFMLLQAGSGILTGTFKPVVAKLSEVYGINGAISDTYASMMATVERMGEAYS
                     WVGYAVLIALALNILMVVFRRITGIRTIMLTGHIMFQQAGLIAVFFFIMGYPMWTTIW
                     STAILVSLYWGITSNMMYKPTQAVTENSGFSIGHQQQFASWIAYKIAPYLGKKEDSVE
                     DLKLPGWLNIFHDNIVSTAIVMTVFFGIILCSFGLDTLQQMAGKTHWTIYILQTGLMF
                     AVAIFIIIQGVRMFVAELTEAFNGISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGT
                     IGQLIAVGILFGMGSSIMIIPGFIPMFFSNATIGVFANHFGGWRAALKICLAMGMIEI
                     FGCVWAIKLTGLSAWMGMADWSILAPPMMQGFFSIGMAFMGIIAVIALLYMFFAGRAL
                     RAEEDAEKQALNQSVSH"
     gene            256620..256928
                     /locus_tag="RAHAQ2_RS01140"
                     /old_locus_tag="Rahaq2_0239"
     CDS             256620..256928
                     /locus_tag="RAHAQ2_RS01140"
                     /old_locus_tag="Rahaq2_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333494.1"
                     /note="involved in the phosphorylation and transport of
                     sugars across the cell membrane; protein IIA transfers a
                     phosphoryl group to IIB which then transfers the
                     phosphoryl group to the sugar; IIC forms the translocation
                     channel for the sugar uptake; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIB"
                     /protein_id="WP_014333494.1"
                     /db_xref="GI:504099500"
                     /translation="MTVRILAVCGCGQGSSMIMKMKIGQFLTQEGVDHSMNSCAVGEY
                     KSELGGADIIVASTHVADEITVSGNKYVVGVRNMLSAADFGPKVMEVINAHFSADLKK
                     "
     gene            256939..257409
                     /locus_tag="RAHAQ2_RS01145"
                     /old_locus_tag="Rahaq2_0240"
     CDS             256939..257409
                     /locus_tag="RAHAQ2_RS01145"
                     /old_locus_tag="Rahaq2_0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573566.1"
                     /note="involved in the phosphorylation and transport of
                     sugars across the cell membrane; protein IIA transfers a
                     phosphoryl group to IIB which then transfers the
                     phosphoryl group to the sugar; IIC forms the translocation
                     channel for the sugar uptake; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIA"
                     /protein_id="WP_014333495.1"
                     /db_xref="GI:504099501"
                     /translation="MKLRDSLAENNSICLNAEAETWQDAVKIGVDMLVSAGVVEPRYY
                     QAILDGVERFGPYFVIAPGLAMPHGRPEEGVIKTGFALVTLKKPQVFNHEDNDPVDIL
                     ITLAAVDANAHQEVGIMQVVNLFDDEANFDRLRACTTAQQVLDLIDLTSATAVH"
     gene            257433..258089
                     /gene="ulaD"
                     /locus_tag="RAHAQ2_RS01150"
                     /old_locus_tag="Rahaq2_0241"
     CDS             257433..258089
                     /gene="ulaD"
                     /locus_tag="RAHAQ2_RS01150"
                     /old_locus_tag="Rahaq2_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333496.1"
                     /note="catalyzes the formation of L-xylulose-5-phosphate
                     from 3-keto-L-gulonate-6-phosphate in anaerobic
                     L-ascorbate utilization; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-keto-L-gulonate-6-phosphate decarboxylase"
                     /protein_id="WP_014333496.1"
                     /db_xref="GI:504099502"
                     /translation="MSHSLPMLQVALDNQSMDDAYKTTRLIAGEVDIIEVGTILCVAE
                     GVRAVRDLKALYPEKIVLADAKIADAGKILARMCFEANADWVTVICCADINTTKGALE
                     VAKEFNGDVQIELTGYWTWEQAQEWHDAGIGQVVYHRSRDAQAAGVAWSDADISAIKR
                     LSAMGFKVTITGGLALEDLPLFKDIPVHVFIAGRSIRDAKDPVDAARQFKKSIRQLWG
                     "
     gene            258100..258960
                     /locus_tag="RAHAQ2_RS01155"
                     /old_locus_tag="Rahaq2_0242"
     CDS             258100..258960
                     /locus_tag="RAHAQ2_RS01155"
                     /old_locus_tag="Rahaq2_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-xylulose 5-phosphate 3-epimerase"
                     /protein_id="WP_014333497.1"
                     /db_xref="GI:504099503"
                     /translation="MMHKAVPLGIYEKALPAGEDWLMRLTLAKELGFDFVEMSVDETD
                     NRLARLDWSREQRLLVVEAISHTGIRIPSMCLSAHRRFPLGAEDDETRNQGLEIMRKA
                     IVLAQDLGIRVIQLAGYDVYYQQANENTRERFRDGLQVSVEMASRAQVTLAMEIMDYP
                     LMNSISKALGYSHYLNNPWFQLYPDIGNLSAWDNDVQMELASGAGHIVAVHVKDTQPG
                     VFKNVPFGSGVVKFERCFETLQKSGYRGPYLIEMWSETAADPMQEVRNARAWVIDKMQ
                     KAGLNMEETR"
     gene            258957..259646
                     /gene="araD"
                     /locus_tag="RAHAQ2_RS01160"
                     /old_locus_tag="Rahaq2_0243"
     CDS             258957..259646
                     /gene="araD"
                     /locus_tag="RAHAQ2_RS01160"
                     /old_locus_tag="Rahaq2_0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333498.1"
                     /note="catalyzes the isomerization of L-ribulose
                     5-phosphate to D-xylulose 5-phosphate in the anaerobic
                     catabolism of L-ascorbate; links the arabinose metabolic
                     pathway to the pentose phosphate pathway and allows the
                     bacteria to use arabinose as an energy source; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 4-epimerase"
                     /protein_id="WP_014333498.1"
                     /db_xref="GI:504099504"
                     /translation="MTDALKQRVFDANMALPAFGLVTFTWGNVSGIDRERGIVVIKPS
                     GVEYGKMQASDMVVLNLQGEVVEGRYKPSSDTATHLELYARFPQLGGIVHTHSTCATS
                     WAQAGIAIPPLGTTHADYFAGAIPCTRPLSRQEVSGDYELETGKVIATALTNIDPLHM
                     PGILVAQHGPFCWGTTPEQAVHNAVVLEEVAKMAWITGSIRRDQTPMDDYLLHKHFSR
                     KHGPDAYYGQK"
     gene            259831..262245
                     /locus_tag="RAHAQ2_RS01165"
                     /old_locus_tag="Rahaq2_0244"
     CDS             259831..262245
                     /locus_tag="RAHAQ2_RS01165"
                     /old_locus_tag="Rahaq2_0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen phosphorylase"
                     /protein_id="WP_014333499.1"
                     /db_xref="GI:504099505"
                     /translation="MSKITFKQDVFLAALTRQWQAFGLTSASDMTRHQWWHAVSAAVA
                     EQLPAQSESVSSKSKKITRHVNYISMEFLVGRLTGNNLINLGWYEKIAAALEPFDINL
                     TDLLEEEIDPALGNGGLGRLAACYLDAMASVGQPGIGYGLNYQYGLFRQRFVDGKQKE
                     SPDDWHRSEYPWFRHNSALAVSVGVGGKMVKNEQGVSRWEPEFILRGEAWDLPVMGYR
                     NGITQPLRLWEATHPHPFDLEKFNDGEFLKAEQQGIDAAKLTKVLYPNDNHQAGKRLR
                     LMQQYFQCACSVADILRRHHFHGRKISELPDYEVIQLNDTHPTIAIPEMLRVLIDEHQ
                     LSWNDAWHITSRTFAYTNHTLMPEALETWDERLVRSLLPRHFQIIKQINANFKKQVSK
                     EWPGDEAVWAKLAVHHDKQVRMANLCVVAGFAVNGVAALHSDLVVKDLFPEYYQLWPE
                     KFHNVTNGITPRRWLKQCNPALSALIDERLKTDTWVNNLDLLKGLEDGVKDKKFCKQY
                     RKIKHDNKVRLAEYVWQRMGIRLNPDAIFDVQIKRLHEYKRQHLNLLHILSLYRQIRD
                     NPKLDIVPRVFLFGAKAAPGYYLAKNIIYAINQVAEKINNDPIVADRLKVVFIPDYSV
                     SVAELMIPAADVSEQISTAGKEASGTGNMKLALNGALTIGTLDGANVEIAEQVGEDNI
                     FIFGLTVDEVKAQLKKGYKPKALVKKDKHLKAILDELASGFYASGDKKAFDLMLNSLL
                     DGGDPYLVLADFASYCEAQKQVDALYRNADEWTRRTLLNTARVGMFSADRSIRDYQQR
                     IWQAKR"
     gene            262254..>264320
                     /gene="malQ"
                     /locus_tag="RAHAQ2_RS01170"
                     /old_locus_tag="Rahaq2_0245"
     CDS             262254..>264320
                     /gene="malQ"
                     /locus_tag="RAHAQ2_RS01170"
                     /old_locus_tag="Rahaq2_0245"
                     /EC_number="2.4.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333500.1"
                     /exception="unextendable partial coding region"
                     /note="amylomaltase; acts to release glucose from
                     maltodextrins; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-glucanotransferase"
                     /protein_id="WP_041682453.1"
                     /db_xref="GI:754018948"
                     /translation="MEDKQLAEAARRAGIVDSFINMTDDVETVSDDTRVALLAAMGRD
                     PADVPEITPVPPVNVFTQGKKVLLTPEVSGAFSWQLTQENGSQTQGEIPAGTVLNLGA
                     ALPTGYHQLTLSQNGNVWPCRIIVVPPRCYEPEALLTGEKLWGATLQLYTLRSENNWG
                     VGDFGDLKKMVEEIGLRGGAFVGLNPIHALYPANPQSASPYSPSSRRWLNLTYIDVNA
                     VEEFTASSEAQRWWHSHETREALLQARSTEFVDYPQVIELKLTALKLAWQLFCSLPES
                     RPRKQDFRQFVELGGESLRQQALFDALHVHLRDLDLGQWGWPVWPEAYRDAKSADVRE
                     FSERYASEVAFYQWLQWLAQTQFSACYQRSVELKMPIGVYRDLAVGVAQGGAETWSDP
                     ALYCLNATVGAPPDILGPQGQNWGLPPIDPHEMKARAYQPFIDLLRANMAECGALRID
                     HVMGLLRLWWIPADQEAGSGAYVRYPLEDLLGVLALESQRHQCMVIGEDLGTVPKEIL
                     ASLRDCGVYSYKVLYFEHDKNFLYRPPQDYVSQAMATVTTHDLPTLRGYWEGADLTLG
                     ASLGVYPDPLVLEKLRGERERSKQGLLDALHRTGCVPKSISRSAENMPMMPLLNRGLQ
                     RYLAGSASALLGLQPEDWLDMSTPVNVPGTNTEYPNWRRKLTRTLEEMFADEYIDALL
                     SDLNQRR"
     gene            complement(264553..265128)
                     /locus_tag="RAHAQ2_RS01175"
                     /old_locus_tag="Rahaq2_0246"
     CDS             complement(264553..265128)
                     /locus_tag="RAHAQ2_RS01175"
                     /old_locus_tag="Rahaq2_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333501.1"
                     /note="cytoplasmic protein that may be involved in the
                     utilization of double-stranded DNA as a carbon source;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe/S biogenesis protein NfuA"
                     /protein_id="WP_014333501.1"
                     /db_xref="GI:504099507"
                     /translation="MILITDAAQEHFAKLLANQEEGTQIRVFVINPGTPTAECGVSYC
                     PPDAVEATDTELKFEKLSAFIDELSAPYLQDAVIDFVTDQLGSQLTLKAPNAKMRKVS
                     DDAPLMERVEYQLQSQINPQLASHGGRVSLMEITDDGIAVLQFGGGCNGCSMIDVTLK
                     DGIEKELLQNFPELKGVRDLTEHQRGEHSFY"
     gene            complement(265226..265915)
                     /locus_tag="RAHAQ2_RS01180"
                     /old_locus_tag="Rahaq2_0247"
     CDS             complement(265226..265915)
                     /locus_tag="RAHAQ2_RS01180"
                     /old_locus_tag="Rahaq2_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="WP_014333502.1"
                     /db_xref="GI:504099508"
                     /translation="MLTIASRCWLCQCPLHLPVQGICSLCMKYLPAAPPCCLRCGLPS
                     SGGNTDCGRCLLKPPPWDAMIFASPYEMPVSGLVLRFKFSGKPELDTTLARLLLLRWQ
                     ERYRMNNLPRPDVLLSVPLHQKRYFSRGYNQSELLAKPLARWLHCEYLPDALSRDRRT
                     PPQQSLTEQQRKWNLRKAFTCHASLRDKHVMLLDDVVTTGSTVREISKILRNHGVASL
                     QIACICRTLQA"
     gene            265962..266732
                     /locus_tag="RAHAQ2_RS01185"
                     /old_locus_tag="Rahaq2_0248"
     CDS             265962..266732
                     /locus_tag="RAHAQ2_RS01185"
                     /old_locus_tag="Rahaq2_0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333503.1"
                     /note="Shows carboxylesterase activity with a preference
                     for short chain fatty acid esters; involved in
                     pimeloyl-CoA synthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase BioH"
                     /protein_id="WP_014333503.1"
                     /db_xref="GI:504099509"
                     /translation="MNTLYRETIGEGNRHLVLLHGWGLNAEVWRYTAERLAPHFCLHL
                     IDLPGYGRSEGFGAMTLEDMAETVLAAMPEKASLLGWSLGGLVASQIALSAPQRVEKL
                     ITVASSPCFVAHEDWPGIRPDVLQGFQHQLSEDFQRTVERFLALQTLGSDSARQDARL
                     LKSIVLNLPMPPVAVLNSGLEILRNVDLRQPMTQLTLPILRIYGALDGLVPRKMVPLL
                     DAILPGSRSEIVEKAAHAPFISHPDMFCELVGQFLITD"
     gene            266965..267234
                     /locus_tag="RAHAQ2_RS01190"
                     /old_locus_tag="Rahaq2_0249"
     CDS             266965..267234
                     /locus_tag="RAHAQ2_RS01190"
                     /old_locus_tag="Rahaq2_0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333504.1"
                     /db_xref="GI:504099510"
                     /translation="MKSNKIIVAAILTGLFSLNAMAAEMISKEEAKDKGYTSLGVVTT
                     SNEYTAPMDAKEELSKLADEKGGKYYVVIAAQEKKKITATAEVFK"
     gene            267543..269204
                     /locus_tag="RAHAQ2_RS01195"
                     /old_locus_tag="Rahaq2_0250"
     CDS             267543..269204
                     /locus_tag="RAHAQ2_RS01195"
                     /old_locus_tag="Rahaq2_0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit alpha"
                     /protein_id="WP_014333505.1"
                     /db_xref="GI:504099511"
                     /translation="MPQHPQTTKVWDTRRKEKQRRIDSVRSVAEGKVLPTDKIIPILE
                     TLIASGDRVVMEGNNQKQADFLSRSLAKVDPEKLHDLHMIMPSVSRAEHLDLFERGIA
                     RKLDFAFSGPQSLRIAQLLEDGQMEIGAIHTYIELYSRLYVDLVPNIALIAGFKADRK
                     GNLYTGASTEDTPALVEAAAFKNGIVIAQVNELVDEETDLPRVDIPGDWIDFVVVADK
                     PFFIEPLFTRDPRLIKPVHVLMAMMAIKGIYAKHNVQSLNHGIGFNTAAIELLLPTYG
                     EQLGLRGKICKHWTLNPHPTLIPAIESGWVETVHCFGGELGMEEYIRARPDVFFTGSD
                     GSMRSNRAFCQLAGQYAVDMFIGSTLQVDGLANSSTVTRGRLAGFGGAPNMGHDPHGR
                     RHSTPAWLDMIEEPDPMARGKKLVVQMVETFQAGGKPTFVEKLEAVDVGKESGMPLAP
                     VMIYGDDVTHVLTEEGIAYLYRARSLEERRAMVAAVAGITDIGLGVDAKRVADLRRQE
                     LVVFPEDMGIRRTDATRSLLAAGSVSELVDWSGGLYNPPAKFRSW"
     gene            269210..270067
                     /locus_tag="RAHAQ2_RS01200"
                     /old_locus_tag="Rahaq2_0251"
     CDS             269210..270067
                     /locus_tag="RAHAQ2_RS01200"
                     /old_locus_tag="Rahaq2_0251"
                     /EC_number="2.4.2.52"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333506.1"
                     /note="catalyzes the reversible formation of
                     2'-(5''-triphosphoribosyl)-3'dephospho-CoA from
                     3-dephospho-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triphosphoribosyl-dephospho-CoA synthase"
                     /protein_id="WP_037040700.1"
                     /db_xref="GI:739176728"
                     /translation="MPQTLTIGAVLTAEELAERLAETATQALIDEARLSPKPGLVDSR
                     SAGAHQDLSLDLMVRSARSLTTTFYLLALHSWQRPADIALRQEVGRLGRAGEAQMMAE
                     TGGVNTHRGAIWAMGLLVSAVAMQPERLLPLHIAQRAAKIAVLPDAFSPKKFSKGSHA
                     VQRYQVPGAREEAQSGFPHIIGCALPQLHHSRARGASESEAQVDALLAVMSTLADTCV
                     LSRGGLPALEAMHQGAQAVLEAGGTSTMAGKQRLRHLEQRMLADNVSPGGAADLLAAT
                     LFLDRVSVA"
     gene            270108..270410
                     /locus_tag="RAHAQ2_RS01205"
                     /old_locus_tag="Rahaq2_0252"
     CDS             270108..270410
                     /locus_tag="RAHAQ2_RS01205"
                     /old_locus_tag="Rahaq2_0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333507.1"
                     /note="acyl carrier protein of malonate decarboxylase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase acyl carrier protein"
                     /protein_id="WP_014333507.1"
                     /db_xref="GI:504099513"
                     /translation="MERFEFSYPAAKPLADHAQAGVVGSGDLEALYEPQTTSALKITV
                     TTSVDGSHSLWQHFFDRLNALRELPAGRLDINDFGATPGVARLRIEQVFEEAEHAN"
     gene            270400..271251
                     /locus_tag="RAHAQ2_RS01210"
                     /old_locus_tag="Rahaq2_0253"
     CDS             270400..271251
                     /locus_tag="RAHAQ2_RS01210"
                     /old_locus_tag="Rahaq2_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333508.1"
                     /note="The beta subunit catalyzes the decarboxylation of
                     the malonyl moiety on coenzyme A; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit beta"
                     /protein_id="WP_014333508.1"
                     /db_xref="GI:504099514"
                     /translation="MPTDTSVQDQSFIELNARQRARKLLDAGTFRELLGPFERIMSPW
                     LEPQGIVPQADDGMVVAKGQINGQPAVVVAIEGSFQGGSMGEVSGAKMAAALEMAAED
                     NRNGIPTQAVLLLETGGVRLQEANLGLAAIADIHAAIVDLRRYTPVIGVVAGTVGCFG
                     GMSIAAALCSYLIVTREARLGLNGPQVIEQEAGIDEYDSRDRPFIWSMTGGEVRYHSG
                     FVDALVKDSLAEVKDSMLGFMKKGVPVTHRSDNYEYYLPKLTGFDTAQQASREVTEVL
                     FNREDRA"
     gene            271248..272063
                     /locus_tag="RAHAQ2_RS01215"
                     /old_locus_tag="Rahaq2_0254"
     CDS             271248..272063
                     /locus_tag="RAHAQ2_RS01215"
                     /old_locus_tag="Rahaq2_0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit gamma"
                     /protein_id="WP_014333509.1"
                     /db_xref="GI:504099515"
                     /translation="MSNVNNNAVSRGDYWFAELTKDATPVAGLCPSVKAADGKMNDQP
                     VRFIAVVPDKNNQYPRAAGGEVGLLEGWNLAKVVSDVIDADANASTKRAIVAVIDVPS
                     QAYGRREEAFGIHQALAGAAGAYAKARLAGHPVIGLIVGKAMSGAFLAHGYQANKLIA
                     FKNNGVMIHAMGKESAARITLRSVDALEKLAATIPPMAYDIENYATLGLLSQLLDIAD
                     PDNATPDDISSVENAVWQNIQDARKEGVSLSNRLGAENRASSQRVRQQMRQEW"
     gene            272254..273216
                     /locus_tag="RAHAQ2_RS01220"
                     /old_locus_tag="Rahaq2_0255"
     CDS             272254..273216
                     /locus_tag="RAHAQ2_RS01220"
                     /old_locus_tag="Rahaq2_0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014333510.1"
                     /db_xref="GI:504099516"
                     /translation="MTYVILHALAPIFVIMILGFYAGKAKMVDNQNVSLLNIFVMDFA
                     LPAALFAATVQTPWTGIVEQSPLILVLVLAMWITYAAIYFICTKVFKKSPQDAAVLTL
                     TVALPNYAALGLPILSSVLGDAPSTSLSVAVSIACGSVLMTPFCLLILEREKARLSGE
                     NQGSSLALLPVLMWRSVKKPIVWAPLLGVILSAIGIKMPEIFLASIKPLGLSATASAL
                     FLTGVILSARKLKINGPVLLSCVAKNLVQPFIAWGLVLAFGLSGQVAVTAILMIALSA
                     GFFGIVFGNRFGVQSPDAEASLLISSVLCIVTLPLFISLTAALH"
     gene            273234..273860
                     /locus_tag="RAHAQ2_RS01225"
                     /old_locus_tag="Rahaq2_0256"
     CDS             273234..273860
                     /locus_tag="RAHAQ2_RS01225"
                     /old_locus_tag="Rahaq2_0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333511.1"
                     /note="Catalyzes the transfer of
                     2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A to the
                     apo-acyl carrier protein of malonate dehydrogenase to form
                     holo-acyl carrier protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-dephospho-CoA transferase"
                     /protein_id="WP_014333511.1"
                     /db_xref="GI:504099517"
                     /translation="MCDPRAHDFVWIRDRSALESDDVLPEWVNTGWRTALPLVVRRDK
                     RADGAIPVGIRGLTRIQRAAAWIDPAAVERVVTPESLVSDVNALLHSPFVSQQPVQAL
                     ITLCSLKLPFPWGVTGSCAFALVSDLPVMHADSDLDLLVRCDTPVDSSLFSDFYDQLQ
                     RLPCRADVQITTPQGGFALSEWLRGGDIMLKTASGPLLVRDPWQPPAD"
     gene            273888..274823
                     /locus_tag="RAHAQ2_RS01230"
                     /old_locus_tag="Rahaq2_0257"
     CDS             273888..274823
                     /locus_tag="RAHAQ2_RS01230"
                     /old_locus_tag="Rahaq2_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit epsilon"
                     /protein_id="WP_014333512.1"
                     /db_xref="GI:504099518"
                     /translation="MKILFTFPGQGPQVPHMLHRLPDNPLTDSLIAQASLALGEDVLL
                     LDTADALRSTRAVQLCLLIAGVVWAKQCQAEGIEADFCSGLSIGAFPAAVMAGALDFD
                     DAIRLVALRGELMQQAYPQGFGLSAITGLRQMQVEDLVAQVNSPTSPVYLANINAEDQ
                     LVIAGSDAAMAQVMQLAKARGAQKTHQLAVSVPSHCALLDQPAAKLVEAFKNIQISRP
                     ACGYLSGTTGRVYWQPEKIADDLAMNMARTVNWRDAMVAAYQREVRLAIEMPPGAVLT
                     GLTRRAMEQGEALSLCQSGMQVAARLATRLRENER"
     gene            275147..275413
                     /locus_tag="RAHAQ2_RS01235"
                     /old_locus_tag="Rahaq2_0259"
     CDS             275147..275413
                     /locus_tag="RAHAQ2_RS01235"
                     /old_locus_tag="Rahaq2_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333514.1"
                     /db_xref="GI:504099520"
                     /translation="MNISPKSVRFDESTMWVTLEDGQILTVPLAQFPALLNATPAQRQ
                     DCETSAYGLHWDALDEDISIEGLIVGKPIAKPATHTNASALSAR"
     gene            complement(275393..276313)
                     /locus_tag="RAHAQ2_RS01240"
                     /old_locus_tag="Rahaq2_0260"
     CDS             complement(275393..276313)
                     /locus_tag="RAHAQ2_RS01240"
                     /old_locus_tag="Rahaq2_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014333515.1"
                     /db_xref="GI:504099521"
                     /translation="MIDSEITFRKLEIFLAYMEKQNITRAAEQLGLSSVSVHRALHSL
                     EEGLRCPLFIHRGRNLLPLPAAEALLEHATQVIEQMEHGILATRRAAGFGDKRLKVGT
                     LYSLTLETIPRLIMGLKLRRPELELELVMGSNNDLLHKLEDGQLDAILISTSDSSVDA
                     QRYDQLPLFQDDIFLAAPASAELASEGTADLRDYKQKKFVSLAEGFATYHGFQEAFQV
                     AGFEPDIVTRVNDIFSMLSLVQAGVGYTLIPGRMKGVYENTVKLLPLAEAYQMRQTIS
                     LVFPHSREHDPNLLALAAESRMYALASRKR"
     gene            complement(276383..276622)
                     /locus_tag="RAHAQ2_RS01245"
                     /old_locus_tag="Rahaq2_0261"
     CDS             complement(276383..276622)
                     /locus_tag="RAHAQ2_RS01245"
                     /old_locus_tag="Rahaq2_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333516.1"
                     /note="regulatory protein that controls transcription of
                     feoABC genes; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoC"
                     /protein_id="WP_014333516.1"
                     /db_xref="GI:504099522"
                     /translation="MTSLIQVRDSLALVGRADARQLSHQLNAPQPLVQAMLERLVAMR
                     KAEVVEADDSCLSGSCKSCADGKNCLTVSYQLIQH"
     gene            complement(276631..278949)
                     /gene="feoB"
                     /locus_tag="RAHAQ2_RS01250"
                     /old_locus_tag="Rahaq2_0262"
     CDS             complement(276631..278949)
                     /gene="feoB"
                     /locus_tag="RAHAQ2_RS01250"
                     /old_locus_tag="Rahaq2_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573589.1"
                     /note="cytoplasmic membrane ferrous uptake system
                     permease; mutations disrupt the ability of Escherichia
                     coli to take up ferrous iron; GTP-binding protein which
                     requires GTP for efficient iron(II) uptake; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_014333517.1"
                     /db_xref="GI:504099523"
                     /translation="MKPLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQ
                     FTTAEHQITLVDLPGTYSLTTISEQTSLDEQIACHYILSGDADLMINVVDASNLERNL
                     YLTLQLLELGVPCIVALNMLDIAKIQNININIPALSARLGCPVVALVSTRASGIKELK
                     AAIDELPQVAALERVQYHPVLQQEVDVLAAGMPQDMALQQRRWLALQILEGDIYSQTH
                     AGNAQALLPQVKARLAEHKLEDPALLIADARYQSIAALCAEISNSHLTAPNKLTQVLD
                     RVILNRFLGVPIFLLVMYLMFVLAINIGGALQPIFDIGSAAIFIQGMQWIGFTLHFPQ
                     WLTIFLAQGLGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQSLGLPG
                     KSFVPLIVGFGCNVPSIMGARTLDAPRERLITVMMAPFMSCGARLAIFAVFSAAFFGQ
                     DGASVVFSLYLLGIVVAILTGLLLKYTIMRGEASPFVMELPVYHVPHLKSLLLQTWQR
                     LKGFVLRAGKVIVIASIFIGALNSFSFSGKAVDNINDSALASVSKVLTPVLSPMGVQP
                     DNWQATVGLVTGAMAKEVVVGTLNTLYTAEHITNETFDAASFNLFDELGGAVKETWQG
                     LKDTFSISVLSNPIEASKGDGEMGVSSMGVMSTKFGSAISAYSYLIFVLLYVPCVSVM
                     GAIARETSRNWMTFSIFWGLNVAYSLATVFYQAATFSRHPAHSAGIILVVLIFNAIVL
                     TALRKARSRVSVHLQPRNVAACCKPATGSDCH"
     gene            complement(279037..279261)
                     /locus_tag="RAHAQ2_RS01255"
                     /old_locus_tag="Rahaq2_0263"
     CDS             complement(279037..279261)
                     /locus_tag="RAHAQ2_RS01255"
                     /old_locus_tag="Rahaq2_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_014333518.1"
                     /db_xref="GI:504099524"
                     /translation="MQLQSKRAYKITGFSHEISPAYRQKLLSLGMLPGSFFNIIRVAP
                     MGDPVQIETRRTSLVVRRKDLDLLQLEMLA"
     gene            279289..279486
                     /locus_tag="RAHAQ2_RS01260"
                     /old_locus_tag="Rahaq2_0264"
     CDS             279289..279486
                     /locus_tag="RAHAQ2_RS01260"
                     /old_locus_tag="Rahaq2_0264"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333519.1"
                     /db_xref="GI:504099525"
                     /translation="MDDGVLVILRRASLPGDVADQRFMWLTIFVAKDSAQKLSLVRNY
                     QPLADGALNTQRSTNENSYHN"
     gene            complement(279694..282024)
                     /locus_tag="RAHAQ2_RS01265"
                     /old_locus_tag="Rahaq2_0265"
     CDS             complement(279694..282024)
                     /locus_tag="RAHAQ2_RS01265"
                     /old_locus_tag="Rahaq2_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription accessory protein"
                     /protein_id="WP_014333520.1"
                     /db_xref="GI:504099526"
                     /translation="MNDQLSRIIASELQVRPEQVASVVRLLDEGNTVPFIARYRKEVT
                     GGLDDTQLRQLDTRLGYLRELEDRRQTILKSIEEQGKLSDDLAKAINTTLSKTELEDL
                     YLPFKPKRRTRGQIAIEAGLEPLAELLWNAPQNEPDAAAAQFVDAEKGVADTKAALDG
                     ARYILMERFAEDASLLAKVRDYLWKNAHLTSRMVEGKEQEGAKFRDYFDHHEPISQVP
                     SHRALAMFRGRNEGVLQLALNADPQHDEPPKESYAEQLIIDHLGLRLNNAPADVWRRA
                     VVNWTWRIKVLLHLETELMGTVRERAEDEAINVFARNMHDLLMAAPAGMRATMGLDPG
                     LRTGVKVAVVDNTGKLVDIDTVYPHTGQAAKAAQQVAALCIKHNVELVAIGNGTASRE
                     TERFFLELQKQFPAVKAQKVIVSEAGASVYSASELAALEFPDLDVSIRGAVSIARRLQ
                     DPLAELVKIDPKSIGVGQYQHDVSQSQLAKKLDTVVEDCVNAVGVDLNTASVPLLTRV
                     AGLTRMMAQNIVNWRDENGQFRNREQLLKVSRLGPKAFEQCAGFLRINHGDNPLDAST
                     VHPETYPVVERILAATQMALKELMGDSNVLRGLKASEFTDEQFGVPTVTDIIKELEKP
                     GHDPRPEFKTATFADGVETMNDLMPGMILEGSVTNVTNFGAFVDIGVHQDGLVHISSL
                     ANKFVEDPHTVVKAGDIVKVKVMEVDLQRKRIALTMRLDEQPGEAPARRSSAPAADTR
                     DNQKRHSPNKPAGRNTVPAGNNAMADALAAALGKKR"
     gene            complement(282136..282609)
                     /gene="greB"
                     /locus_tag="RAHAQ2_RS01270"
                     /old_locus_tag="Rahaq2_0266"
     CDS             complement(282136..282609)
                     /gene="greB"
                     /locus_tag="RAHAQ2_RS01270"
                     /old_locus_tag="Rahaq2_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333521.1"
                     /note="necessary for efficient RNA polymerase
                     transcription elongation past template-encoded arresting
                     sites; arresting sites in DNA have the property of
                     trapping a certain fraction of elongating RNA polymerases
                     that pass through, resulting in locked ternary complexes.
                     Cleavage of the nascent transcript by cleavage factors
                     such as GreA or GreB allows the resumption of elongation
                     from the new 3'terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreB"
                     /protein_id="WP_014333521.1"
                     /db_xref="GI:504099527"
                     /translation="MKTKLITREGYDKLKTELDYLWREERPEVTKKVTWAASLGDRSE
                     NADYQYNKKRLREIDRRVRYLTKCLEQLRIVDYSPQQDGKVFFGAWVEVENDDGDIKR
                     FRIVGYDEIFGRKDYISIDSPMARALLKKEVGDSLVVTTPVGDATWYVNQIEYIK"
     gene            282840..288857
                     /locus_tag="RAHAQ2_RS01275"
                     /old_locus_tag="Rahaq2_0267"
     CDS             282840..288857
                     /locus_tag="RAHAQ2_RS01275"
                     /old_locus_tag="Rahaq2_0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333522.1"
                     /db_xref="GI:504099528"
                     /translation="MDLLKFLLRLPFTLIKGLFRVLAFILSLLGRVFKPLVGNIDWRA
                     PAWWTATSGWLKRSFTRMEKGVDNSPKAISLAILLLLCVAGAGVYGWHWWLNRPQPIE
                     PAPMVYQDTSLRVSGPESVNYAAQKSAPQQVIFTFRNSAAPVTDVGKVVEKGISLKPA
                     TEGEWKWVSGYTLVFTPKNPLPMGSKYEVNFSPDVLLAPQSKLAKTRYEFSAPAFGYQ
                     LGQAEYYQDPQDPQKRSAIFNVKFNAPVDVASFEKQISLGLTEGKAKTESKLNYSVVY
                     DQKKLNAWVHSEPLKSLDHGGSVRVTIGEGVKSSVPSNATAQAKNGVVSVPTLYSLTV
                     NEASAQVVDAEGAKGQRALIVGFSDAVKDKDIRQAVKAWLLPQHNPNDQDEAKGADDY
                     ASWAVDSVENNVLAQSTPLNIRLNDAESDYQPQFSFRFDAPAHRAMLVEIDNILTSSG
                     GYKMPEKVYRIVQVPDYPKSLQFMSQGSLLSVSGDKQISVAARNVPGLRLDIKRVIPS
                     QLQHIVSFKSREYSSAEFNRLNDEYFTEHFKYQTAVNNDKPGEVNYQGVDLSRYLSTD
                     PASHRGVFLLTLSEWDPKKKEDKPETDDDGNVYQDEQQNEDEAPVGDSRFVVVTDLGI
                     IAKRSQDKTRDVFVQSIHSGTPVANATVSVIAKNGVTLLTQTTGADGHVRFPALDVYT
                     SERQPVMFLVEKEGDVSFLPADRNNDRGLDFSRFDVDGEITPNDPRTLSSYLFSDRGV
                     YRPGDTFNIGLITRAADWSNGLAGVPVRAEIHDPRDKLMSTIPLTLGASGFNELSYTT
                     DDNSPTGEWNVYLYLIGKDNESSTFLGHTAVNVKEFEPDQLKVKLQLTPERKQGWVKP
                     SELQANIDVQNLFGTPAQDRRVTSRLTLRPMYPSFDKFPDYAFYENRQNSDGFETELE
                     DRTTDEKGAANIPLDLKSYADATYQLQLLSEAFVAGGGRSVAATARVLVSPYDYLIGV
                     KADGDLGYINRDAARHLNIIAVDPSLKQIALPDLKVALIEQKYISVLTKQDSGVYKYQ
                     SKMKEVQLSEQPLSLTAQGNDLTLATDKPGDFVLVVEDAKGNVLNRIGYTVAGNANLS
                     RSLDRNAELKLKLNQAEYLPGEEIEVSVNAPYTGSGLITIEKDKVYSWQWFHTDTTSS
                     VQKIRVPAAMEGNGYINVQFVRDVNSNEIFMSPLSYGVMPFKISTMARQNTLEITAPE
                     VIKPGENLVMTVKTDGPQQVALFAVDEGILQVARYRLKDPLEYFFRKRELGVESSQIL
                     DLILPEFSKLMQLAAAPGGDAGEGLDLNVNPFKRKRDKPVAYWSGITEVNGEKQFDYP
                     VPDYFNGKIRVMAISVTPDKIGKAQTSATVRDNFIMTPNVPSMVAPGDEFDVSVGVSN
                     NLEGLNGKSIPVAIHLTVPPQLEVVGNADQNLSLAEKREGVINFRLRANAVPGDAPLV
                     FEATYGDKTSRRTISTSVRPAMPFRTQSVMGRMSGSSQNVDNLRQMFDAYAVRKAAVS
                     NSPLVLTRGLSQYLADYPYYCSEQIVSRSVPLILEMVHPEMRGNLSPAESSKQLKDMM
                     AVLRSRQNDSGAIGLWRSSPQTDPFVTPYVVQYLLEAKAAGVALPAGMLEEASSALRE
                     LAANQNDDLYSLRLRAWAVYLLTRQGEITTSLLASVQDTLQQRYPDTWKTDLSAMYLA
                     SSYRLLKMDDEADTLLQPTWKELSKAYDQAWWTQSYFDPLVQDATRLYLITRHFPEKV
                     SAIPPQVLENMVKALKEERYTTYSSAMSILALESYSAQVAAQATAPDALKITQISKTK
                     NVEPRLISEVQGLFAKANFTADAQALRIENGNDAPAWYVVTQAGYDLAAPEKAISRGL
                     EITRDYTDEKGNAVTQVTLGQKINVHLKIRANSQEGQDNLAIVDLLPGGFEVVQQTPP
                     EPESDSNDENSDAEASASWQSPLAASGSTWTPDYSDIREDRVVIYGSASTDVQEFVYQ
                     IKATNTGSFVIPPAYGEAMYNRDVQALSVSDKKLLVVPADDAAVAKK"
     gene            288914..291283
                     /locus_tag="RAHAQ2_RS01280"
                     /old_locus_tag="Rahaq2_0268"
     CDS             288914..291283
                     /locus_tag="RAHAQ2_RS01280"
                     /old_locus_tag="Rahaq2_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1C"
                     /protein_id="WP_014333523.1"
                     /db_xref="GI:504099529"
                     /translation="MITFPAFSKTAKRLLQNMAMAVFLLALIAVACRLWPHPPLSQGQ
                     PFSTVYYDRQGTLMRITLANDDRYRLWTPLEQVSPLAVKSLLLHEDRWFYSNPGFNPF
                     SLLRGFWRSYVAGGKMQGGSTITMQLARMHWHLNTRTPSGKLIQLLRAVQLELSYSKH
                     DILEAYLNTAPYGRNIESIGAASLIYFNKAPKDLTLPEALTLAVLPQSPSYRIDSKTG
                     VVGAALTQARNRLFQRWQAHYETDSSQLSLFRLPLALRQPEQMPYIAPHFIEQLRQQN
                     HQVIRTDTRVDSTLDAGLQRLAERQVNAFITRNESRGIHNAAVVLVDTRDMGVRALVG
                     SADYYNRTIQGQVNGTNAKRSPGSALKPFIYALGMEQGVLHPMTILKDVPSAFGAYAP
                     ENFDRRFLGPVTATDALNFSRNIPAVYVASQLHQPTFYQFLRLSGIANMSSENHYGLS
                     LVLGGGEVTMQELAKLYALLANRGVLQPLRMQKSDPRQAMTVRLLSEEASFMTLDMLR
                     QHRRPGDTLAQAPSSLPVYWKTGTSWGFRDAWSVGIFGPYVLVVWEGNFDSKGNNVFV
                     GADAAAPLFFNIIDSITASYPDLQEPERPFPKQLKRVDICLASGDLPTPWCQQKGKTW
                     FIPGKSPIKVDTVYRPVRLDKLTGEVACPPFDEDETRTEVFEFWPSDLANVFAQAGLP
                     KRKPPANHCKDEGVDVSGNPPRITSPLKNTTYTLRQSQQGRDRISFNAVTDADSKTVY
                     WFVDDIYLGSSASKSAIDWRPINNGQYRIRAVDDHGRADSRLVSIEIVN"
     gene            complement(291298..292413)
                     /locus_tag="RAHAQ2_RS01285"
                     /old_locus_tag="Rahaq2_0269"
     CDS             complement(291298..292413)
                     /locus_tag="RAHAQ2_RS01285"
                     /old_locus_tag="Rahaq2_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_014333524.1"
                     /db_xref="GI:504099530"
                     /translation="MNTKKQVLHNLASLIKLTLLGIAINSFSSLAQAGSAICSPENGA
                     GMSYENFLQEDIPASDNERGKKYEKSMNGGMQNYTIACNCTDNDASSSNGVLLMYTVK
                     TALPKGTELGYYKINDHIDVKASLDLPPATNVPVPTTKTLGDATHHTDANNNGVCVQQ
                     NTRASLNIGSQGSLTFYITTPFIGELDIPRTEIAEIYLSSGTAIVTAPPLGPPVARVY
                     VSGKLTVPQSCEINKGETITVNFGAIATNKFTTLNQPPKGFIPVTFNITYDCTVNGLP
                     QIPAGTQLAMLLKGDDLTDQYTLVARRRPSDNKADIGIRVENASGTAIPFESGNLPMN
                     QNGMGNISMTAYPINLIGGGLDTGEFSGMATLKIDIR"
     gene            complement(292423..294966)
                     /locus_tag="RAHAQ2_RS01290"
                     /old_locus_tag="Rahaq2_0270"
     CDS             complement(292423..294966)
                     /locus_tag="RAHAQ2_RS01290"
                     /old_locus_tag="Rahaq2_0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333525.1"
                     /db_xref="GI:504099531"
                     /translation="MLTDEKFLQKSLSGDIKKTSAPLVLKLGSLLASTALGLLAAHPA
                     RSENVYFDPQFIERQAGDVGDVDLSLFQSNDQAQLPGNYDTALYVNKKLKIRYSISYL
                     PRPDGTLEPQITPDILRLLGVNVDAFPALKNHQPDAPLGALAQYIPAADVKFDFYLMQ
                     LNFSIPQAAILQKAEDYIDPEKWDDGAPVLFSNYSYSGGQRSYRNGSDDSSQYLNLQN
                     GFNVGPWRLRNYTTYSDSGDEKRWDTISTYAERDIKTLKSKFQIGENSTSGEILSSVP
                     FSGVQLFSDDNMLPNSQRGFAPTIRGIANSNAEVTIRQNDHIIYQSFVPPGAFEINDL
                     YPSSYSGNLEITVKEADGTERRFNQPFSAIPIMQRPGRLKYSATAGTYRATDNNEKEP
                     TFAQGTAIYGLSNTITSYGGSVVSEDYLSGLIGIGYNLQWLGGISADVTHARSTLDNN
                     QTTSGQSYRVQYSKNIEMTDTDLSLASYRYSSAGYYDFDESTQYLNGDNAPELDYHKR
                     SKIQFNINQTLWQGASLYLSGYKQDYWNNTGKEKNISLGLNNSLFGISYNLSYSYSQL
                     QDQDNDQQISLNVRIPLSRWLPQSWGTYNVSHQKGEGTRHQVGLSGTALDDRRLSYSV
                     QQSYTDQNSENGSNLYSSYRSSFGNINAGYNYSRDSQQLSYGIAGGIVAHSRGATLSQ
                     PLGDSFALIDTNGASGARLQNLPGVRTDWRGFAVVPYLTAYNENRIAMDTTTLPDDVD
                     IESTSVIVIPNSGAMVTAHFEAHVGARVLVTLVRPNGATVPFGAVAATDKQSNIVDEG
                     GVVYLSGIPLEKLVLLQVKWGNDASQQCQAQLNLSASTSQVNSLTAQCI"
     gene            complement(295039..295725)
                     /locus_tag="RAHAQ2_RS01295"
                     /old_locus_tag="Rahaq2_0271"
     CDS             complement(295039..295725)
                     /locus_tag="RAHAQ2_RS01295"
                     /old_locus_tag="Rahaq2_0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="WP_014333526.1"
                     /db_xref="GI:504099532"
                     /translation="MGKSKKLTLLFIIISVFTSQITYAGGIIVGRTRVIYDADKREAT
                     LSVKNNADNNPFLIQSWVDAGGEKTRGPFIITPPLFRLNAQQESNLRISYNGSALPTD
                     RESVFYINVKAIPSTPKNTKNELKLVVNTRIKLFYRPTKLPGKSFEAPKALTFSKNNG
                     HLVIKNQSPYHVVFSSLSIGSTFLKEVAMIAPLSELDVILPAKISGNSVKWEAINDYG
                     GTTERYEQPL"
     gene            complement(295831..296379)
                     /locus_tag="RAHAQ2_RS01300"
                     /old_locus_tag="Rahaq2_0272"
     CDS             complement(295831..296379)
                     /locus_tag="RAHAQ2_RS01300"
                     /old_locus_tag="Rahaq2_0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_014333527.1"
                     /db_xref="GI:504099533"
                     /translation="MKTKFKLLAGGIFMAIAVNSYAIDGAINFTGAIVEEACEINGGE
                     ELNIPLGTYSAAQFQEIGDLSPKIPFTLPLDNCPVVSASNPTPHFRIWLESDTVADTT
                     DLIALGNDYGDAMADGVGIRIEDAETNEVMKINGLPDIIYPIPGKVMNVNLLAYYESF
                     KLPGDITAGAADARVKVTLDYR"
     gene            complement(296688..296894)
                     /locus_tag="RAHAQ2_RS01305"
     CDS             complement(296688..296894)
                     /locus_tag="RAHAQ2_RS01305"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040693.1"
                     /db_xref="GI:739176721"
                     /translation="MVYILVEIVTMIMDFLIYQQYQRSLPQAKVGLLRFVPPVKIVCP
                     ILLHIPRRLLAKISTHDHVRYGMK"
     gene            296967..297686
                     /gene="ompR"
                     /locus_tag="RAHAQ2_RS01310"
                     /old_locus_tag="Rahaq2_0273"
     CDS             296967..297686
                     /gene="ompR"
                     /locus_tag="RAHAQ2_RS01310"
                     /old_locus_tag="Rahaq2_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208914.1"
                     /note="part of two-component system EnvZ/OmpR; regulates
                     transcription of outer membrane porin genes ompC/F; under
                     high osmolarity EnvZ functions as
                     kinase/phosphotransferase and phosphorylates OmpR; the
                     result is increased expression of ompC and repression of
                     ompF; also functions in regulation of other genes; forms
                     dimers upon phosphorylation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_009635740.1"
                     /db_xref="GI:497321527"
                     /translation="MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLL
                     TRESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDY
                     IPKPFNPRELLARIRAVLRRQANELPGAPSQEEAVISFGKFKLNLGTREMFREDEPMP
                     LTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAH
                     PRYIQTVWGLGYVFVPDGSKA"
     gene            297683..299044
                     /gene="envZ"
                     /locus_tag="RAHAQ2_RS01315"
                     /old_locus_tag="Rahaq2_0274"
                     /gene_synonym="ompB"
     CDS             297683..299044
                     /gene="envZ"
                     /locus_tag="RAHAQ2_RS01315"
                     /old_locus_tag="Rahaq2_0274"
                     /gene_synonym="ompB"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333528.1"
                     /note="membrane-localized osmosensor; histidine kinase; in
                     high osmolarity EnvZ autophosphorylates itself and
                     transfers phosphoryl group to OmpR; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="osmolarity sensor protein"
                     /protein_id="WP_014333528.1"
                     /db_xref="GI:504099534"
                     /translation="MKRIRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQ
                     QFNKVLAYEVRMLMTDRLQLEDGTLLAVPPAFRREIYRELGISLYTNSAAEESGLRWA
                     QHYEFLSQQMAQQLGGPTDVRVEVNKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPL
                     FRYTLAIMLLAIGGAWLFIRIQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTR
                     AFNQMAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMMGDDDSYLAESINKDIEE
                     CNAIIEQFIDYLRTGQEMPTEITDLNGILGEVIATESGYEREIDSDLADGELLVNAHP
                     LSIKRAVVNMVVNAARYGDGWIKVSSGRELQRAWFQVEDDGPGIAPDQLKHLFQPFVR
                     GESARTTSGTGLGLAIVQRIIDAHSGTLDIGKSDRGGLRIRAYLPLPVEMLKAVAVQQ
                     KPV"
     gene            complement(299395..301017)
                     /locus_tag="RAHAQ2_RS01320"
                     /old_locus_tag="Rahaq2_0276"
     CDS             complement(299395..301017)
                     /locus_tag="RAHAQ2_RS01320"
                     /old_locus_tag="Rahaq2_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573603.1"
                     /note="PEP carboxykinase; PEP carboxylase; PEPCK;
                     catalyzes the phosphorylation and decarboxylation of
                     oxaloacetate to form phosphoenolpyruvate using ATP;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="WP_014333529.1"
                     /db_xref="GI:504099535"
                     /translation="MPTTIGITAETLSQYGIHQNSEIIYNPDYETLFAEETAPGLEGY
                     ERGQVTELGAVNVDTGIFTGRSPKDKYIVRDDTTRDTLWWADQGKGKNDNKPLSQATW
                     TSLKALVSKQLSGKRLFIIDAFCGANADSRLKVRFITEVAWQAHFVKNMFIRPDDSEL
                     ENFEPDFIVMNGAKCTNPDWQKQGLNSENFIAFNLTERIQLIGGSWYGGEMKKGMFAV
                     MNYLLPLQGIASMHCSANVGEKGDVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDD
                     GVFNFEGGCYAKTIKLSKDAEPEIFGAIKRDALLENVMVSADGKIDFNDGSKTENTRV
                     SYPIYHIQNIVKPVSKAGHASKVIFLTADAFGVLPPVSRLTAAQTQYHFLSGFTAKLA
                     GTERGVTEPTPTFSACFGAAFLMLHPTQYSEVLVKRMEAAGAQAYLVNTGWNGTGKRI
                     SLKNTRAIIDAILNGTIDDAETFTLPLFNLAVPVELPGVDTHILDPRNTYASREQWQE
                     KAEHLAQLFIDNFDKYTDTPAGAALVSAGPKR"
     gene            complement(301245..302129)
                     /gene="hslO"
                     /locus_tag="RAHAQ2_RS01325"
                     /old_locus_tag="Rahaq2_0277"
     CDS             complement(301245..302129)
                     /gene="hslO"
                     /locus_tag="RAHAQ2_RS01325"
                     /old_locus_tag="Rahaq2_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411506.1"
                     /note="becomes active under oxidative stress; four
                     conserved cysteines bind a zinc atom when they are in the
                     reduced state and the enzyme is inactive; oxidative stress
                     results in oxidized cysteines, release of zinc, and
                     binding of Hsp33 to aggregation-prone proteins; forms
                     dimers and higher order oligomers; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp33 chaperonin"
                     /protein_id="WP_014333530.1"
                     /db_xref="GI:504099536"
                     /translation="MSNHDQLHRYLFSHHAVRGELVSLKETFQQVVAGHDYPAEVRNL
                     LGEMLVATSLLTATLKFDGDITVQLQGDGPLKLAVINGNNKQELRGVARLQGDITEGS
                     SLKEMIGNGYMVITISPTVGERYQGVVGLEGENLAECLENYFMQSEQLPTRIFIRTGE
                     VEGQPAAGAMLLQVLPAQDTDPEEFSHLAQLTTTIKAEELLTLPANEVLYRLYHQEEV
                     TLYEPQDVCFRCTCSRERCAAALLTLPDEDIHEMLEADGKIEMHCDYCGADYEFDGMD
                     MATLKAGGDVHSGDDHVH"
     gene            complement(302188..302592)
                     /locus_tag="RAHAQ2_RS01330"
                     /old_locus_tag="Rahaq2_0278"
     CDS             complement(302188..302592)
                     /locus_tag="RAHAQ2_RS01330"
                     /old_locus_tag="Rahaq2_0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated heat shock protein Hsp15"
                     /protein_id="WP_014333531.1"
                     /db_xref="GI:504099537"
                     /translation="MKGKTEDDDNAVRLDKWLWAARFYKTRALAREMIDGGKVHYNGQ
                     RGKPSKLMELNAELTLRQGNDTKTIIVLGLTTQRRSAEEAQKLYQETEASIASREKIA
                     EARKMNAMPHPDRRPDKKERRNLIKFKYGDSE"
     gene            complement(302617..303306)
                     /locus_tag="RAHAQ2_RS01335"
                     /old_locus_tag="Rahaq2_0279"
     CDS             complement(302617..303306)
                     /locus_tag="RAHAQ2_RS01335"
                     /old_locus_tag="Rahaq2_0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidase"
                     /protein_id="WP_014333532.1"
                     /db_xref="GI:504099538"
                     /translation="MPSDFDWQCIDTVLLDMDGTLLDLAFDSQFWLQDVPLALSQQRA
                     IPLENARQLIHDEYLAVQHTMNWYCFDYWSERLSLDIYQMTTNIGKNARLRDDTLPFL
                     AHLRESGRQTILLTNAHPHSLSVKIEHTGLDQHLDLLLSTHTFGYPKEDQRLWSAVQR
                     QTGFNPDRTLFVDDGEPILNAAKTFGIRYCLGIENPDSTMANKSFEGHPSINDYRSLL
                     PAIHPVTGPAK"
     gene            complement(303419..305551)
                     /locus_tag="RAHAQ2_RS01340"
                     /old_locus_tag="Rahaq2_0280"
     CDS             complement(303419..305551)
                     /locus_tag="RAHAQ2_RS01340"
                     /old_locus_tag="Rahaq2_0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Intracellular growth attenuator protein igaA"
                     /protein_id="WP_014333533.1"
                     /db_xref="GI:504099539"
                     /translation="MTLVLLCIAIIATASYFWLVLRRRQRDESVVRFSTPSQRKLSQK
                     ERDAVERYLRQNEGLGQTPITHRNNLIILRDKLTLTTKSENVYSLTRAITRYGVASED
                     PNKWRYFLDSTEIHLPPFWEQYIAQENQVELIKTQTLPLVISLNGHTLTEHVYEGPAP
                     VSAVMPSQPQNASIRHEESEHIELVKVRRETREEHALTRSNGVKEALAVSAILLVLFI
                     TLQSPVIFLPWLLLISAGLAAWVIWRLVSERLGKNRKEIHCLRGLPKRWGLFGESKQG
                     DISNISLGAVDLIYPPHWQPYIGRDLGQPTDVEVYMNSHVVRQGSYLTLHDEVKKFPL
                     QLWGRNLVLATSAFLLLLALLVYVPLGLPLKLSVAWLQGAQSSQVNSVQELEKAALRV
                     GDTLKVQGTGMCYVPPAASRSASGFMPFDCSAIYWNTATPLPVPQSEIIDAATALQTT
                     VNNQLHPGQNQMPEQNINPQLATAIEKSGMILLDDFADIVLKTETLCGNSNDCVRLKN
                     ALVNLGNSSNWNSLVKRAKAGTLQGINVLLRPVSAQSLSELVNNATSSFFVQETRRAA
                     DSLNSPPPGGFLISNDEGRQLIEMPAPPVGVFANPPQEQWKQLQQLSTLLLHTPFSAQ
                     GVITSISIDANGTRHISLHSEPDISTLWRYLGTSLLLLLLIGVLAVNTVLFIRRFIKD
                     KRRIDDIQQYYNSCFHPTLMPMPVQKLG"
     gene            306009..306566
                     /gene="nudE"
                     /locus_tag="RAHAQ2_RS01345"
                     /old_locus_tag="Rahaq2_0281"
     CDS             306009..306566
                     /gene="nudE"
                     /locus_tag="RAHAQ2_RS01345"
                     /old_locus_tag="Rahaq2_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573609.1"
                     /note="ADP-sugar pyrophosphatase; catalyzes the formation
                     of D-ribose 5-phosphate from ADP-ribose; can also act on
                     ADP-mannose and ADP-glucose; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose diphosphatase"
                     /protein_id="WP_014333534.1"
                     /db_xref="GI:504099540"
                     /translation="MTQHLQKPKITKVETVARSRLFTIESVDLTFSNGAERVYERMRP
                     SDREAVMIVPIIDNELLLIQEYAVGIESYELGFPKGLIDPGEGVLEAANRELMEEVGY
                     GARHFDVLAKLTMAPSYFSSRMNIVIAKDLYMKSLEGDEPEPLPQTRWPVSRMMELLQ
                     HPDFCEARNVSALFLAHDFLMRNAR"
     gene            complement(306640..309195)
                     /gene="mrcA"
                     /locus_tag="RAHAQ2_RS01350"
                     /old_locus_tag="Rahaq2_0282"
     CDS             complement(306640..309195)
                     /gene="mrcA"
                     /locus_tag="RAHAQ2_RS01350"
                     /old_locus_tag="Rahaq2_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333535.1"
                     /note="bifunctional murein transglycosylase/murein
                     transpeptidase; penicillin-binding protein 1A; involved in
                     the synthesis of cross-linked peptidoglycan from the lipid
                     intermediates in cell wall formation;
                     penicillin-insensitive transglycosylase catalyzes the
                     formation of linear glycan strands and the
                     penicillin-sensitive transpeptidase catalyzes the
                     cross-linking of the peptide subunits; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1a"
                     /protein_id="WP_014333535.1"
                     /db_xref="GI:504099541"
                     /translation="MKFVKYLLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDVRL
                     QTPMQVFSAEGDLIAQYGEKRRIPLKLDQIPPELVHAFIATEDSRFYEHHGVDPIGIF
                     RAASVALVSGHASQGASTITQQLARNFFLSPERTLTRKIKEAFLAIRIEQMMSKDEIL
                     ELYLNKIYLGYRAYGVGAAAQVYFGKNVSQLTLSEMAVIAGLPKAPSTFNPLYSHDRS
                     LARRNTVLARMLDEKYITQAQYDQARAEPLVANYHAPHIEFSAPYLTEMVRQEMVKRY
                     GDNAYNDGYMVYTTITKKTQLAAQEALRTNVLNYDMRHGYRGPSNQLWKVGEPAWDQD
                     KIVQSLKTLPVYGPLFPAVITATDDAQATATMSNRAVISLPFSGMRWARPYRNDNAQG
                     PTPKKVTDVVRPGQQVWVRKVGDDWWLAQVPDVNSAIVSLNPNDGAIEALVGGFDFNQ
                     SKFNRANQAVRQLGSNIKPFLYTAAMDKGLTLATILNDMPITRWDAGAGTDWRPKNSP
                     PTYYGPIRLRQGLGESKNVVMVRAMRAMGVDYAAEYLQRFGFPAANIVHSESLALGSA
                     SFTPLQVVRGYATLTNGGYLVDPYFITKIVDESGQVQFEAKPKIACRTCNIPVIYGDT
                     QKSAVLSDDNVENVATSAINNNTSVPTPQLEQVPPNSPQVDAAQQYAPHVISTPLSFL
                     ISDALNSNIFGEPGWMGTGWRAGRDLKRHDIGGKTGTTNSSKDAWFSGYGPDVVTSVW
                     IGFDDHRRDLGRSTASGVIPDQISGAEGGAKSAQPAWDDYMKAVLEGVPEQPQTPPPG
                     IVTVTIDKGTGKLSDGGGNSRPEYFIDGTQPTEHAVHEVGTTIMDNGQEHELF"
     gene            309317..310168
                     /locus_tag="RAHAQ2_RS01355"
                     /old_locus_tag="Rahaq2_0283"
     CDS             309317..310168
                     /locus_tag="RAHAQ2_RS01355"
                     /old_locus_tag="Rahaq2_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Competence protein A"
                     /protein_id="WP_014333536.1"
                     /db_xref="GI:504099542"
                     /translation="MRLQAWQVGLDIQAGFARAIAVQRRRHGWQLRHWWQHPLPPFTL
                     REGILHETAPLIAILSCWRKTLPTAFSLRISLPAQRIMQQRMVAPDTRLGEPQRSAFI
                     FANAAKQFPLGMEHLVMDYRADPHGDNQLVVTAARQQEIEQWVQCMAQARLFPDAIEL
                     APCALQMAACAAGVPGDALLIHPLDDAFLWASPHSLPFQFGLLDHAEVVTETAVSQKI
                     RTQYRAAALCHAEDYFSGEFSGESSFAAMQCWSPLSAIVQLSAPLPANPGAFAPAVGL
                     AIRQADN"
     gene            310168..310731
                     /locus_tag="RAHAQ2_RS01360"
                     /old_locus_tag="Rahaq2_0284"
     CDS             310168..310731
                     /locus_tag="RAHAQ2_RS01360"
                     /old_locus_tag="Rahaq2_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial assembly protein"
                     /protein_id="WP_014333537.1"
                     /db_xref="GI:504099543"
                     /translation="MLQVNLLPWRKLRRQKRMRNWLKIFVSVPLSVVVCAWLLAAFIV
                     QERTLLQVKLSALNSGIQKIMLQQRRVDVASAQVKVLAETRLLSHQRVLQSRDYLQLL
                     ELLALKMPEELWLTELTEHQGMLTLKGEGRLYHDILALSEILSAGELLSKVSLSAVQQ
                     QPNHNLSFVMKTQFRSERALPAPGVSQ"
     gene            310728..311588
                     /locus_tag="RAHAQ2_RS01365"
                     /old_locus_tag="Rahaq2_0285"
     CDS             310728..311588
                     /locus_tag="RAHAQ2_RS01365"
                     /old_locus_tag="Rahaq2_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tfp pilus assembly protein PilO"
                     /protein_id="WP_014333538.1"
                     /db_xref="GI:504099544"
                     /translation="MTGFLSEHIDPLMEKPGWQRVFILTACLLVLVLTLYQCVLRGLW
                     QQQETLKREIDTARQTLSRDQMALMRMIPLERLEQELAGNAILRRESLPLEQEFAGPL
                     QDAQAVLIRWQPVSPPKQEPQGELQLQVTFTGLMHFLYALLQRPEQPAFSELNLHTTG
                     DAGMKASVVLTQTVQAGVFVNGAVAAKAVRDPFRAPQTPACADVSPLSEWLLSGISDA
                     GGQRYGWLLSPQGRWNKVETGSRFGAPQWTVEALSSSQVELSLSDARCGAQRQIISLG
                     KGNDSPGKGK"
     gene            311588..312850
                     /gene="hofQ"
                     /locus_tag="RAHAQ2_RS01370"
                     /old_locus_tag="Rahaq2_0286"
     CDS             311588..312850
                     /gene="hofQ"
                     /locus_tag="RAHAQ2_RS01370"
                     /old_locus_tag="Rahaq2_0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004875153.1"
                     /note="outer membrane porin probably involved in uptake of
                     extracellular double-stranded DNA; similar to outer
                     membrane competence protein ComE from Haemophilus
                     influenzae and outer membrane protein PilQ involved in
                     type IV pilus production from Pseudomonas aeruginosa;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_014333539.1"
                     /db_xref="GI:504099545"
                     /translation="MKYVNKQIVLFLLCLCLSPVKADAPPLISLEFQSSPVGLVLQAL
                     ADSRQLNLVTAPGLEGLMSVKLKEVPWQQALDIILQMNHLTSQLQGNVLLVSPEEDPQ
                     IVQQRMKDAADQQALQSPLISLTVPLQYADAKETALSLNAQKGSLLSQKGNASADTRT
                     NTLLLRDTQVALDVVAPWVKEMDLPLQQVQLAAHIVTMNSESLRELGVRWGFTGEEPI
                     TKAVRMNNFSMGMPVENPIFTAGFNLAHISGRILDLELTALEQEDKVDIIASPRLLTA
                     HMQTASIKQGTEIPYQVSSGASGSTSIEFKEAVLGMEVTPKIQRNGHIQLALQISQNM
                     PGRSIKQSEGEALAIDKQEIKTQVTVKDGETIVLGGIFQRKTQKTDTKVPVLGDIPGV
                     GSLFKHQYTNEQRRELVIFITPTLILTR"
     gene            313199..313720
                     /gene="aroK"
                     /locus_tag="RAHAQ2_RS01375"
                     /old_locus_tag="Rahaq2_0287"
     CDS             313199..313720
                     /gene="aroK"
                     /locus_tag="RAHAQ2_RS01375"
                     /old_locus_tag="Rahaq2_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009635755.1"
                     /note="type I enzyme similar to type II but differentially
                     regulated; major shikimate kinase in fully repressed
                     cells; catalyzes the formation of shikimate 3-phosphate
                     from shikimate in aromatic amino acid biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="WP_014333540.1"
                     /db_xref="GI:504099546"
                     /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDHEIERRTG
                     ADVGWVFDLEGEDGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVY
                     LETTIEKQLARTQRDKKRPLLQVSAPPREVLEALARERNPLYEEIADVTIRTDDQSAK
                     VVANQIINMLESN"
     gene            313778..314860
                     /gene="aroB"
                     /locus_tag="RAHAQ2_RS01380"
                     /old_locus_tag="Rahaq2_0288"
     CDS             313778..314860
                     /gene="aroB"
                     /locus_tag="RAHAQ2_RS01380"
                     /old_locus_tag="Rahaq2_0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333541.1"
                     /note="catalyzes the formation of 3-dehydroquinate from
                     3-deoxy-arabino-heptulonate 7-phosphate; functions in
                     aromatic amino acid biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="WP_014333541.1"
                     /db_xref="GI:504099547"
                     /translation="MERITVTLGERSYPITIAAGLFHDPASFMPVKAGDQVMIVTNET
                     LAPLYLDAIRSVLEQAGVRVDQVILPDGEQYKSLTVLNDVFSALLEKPHGRDTTLIAL
                     GGGVVGDLTGFAAASYQRGVRFVQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQP
                     ASVVVDLDCLRTLPAREMSSGLAEVIKYGIILDADFFMWLEDNMDALLALDMNALAYC
                     IRRCCELKAEVVAADERENGLRALLNLGHTYGHAIEAEMGYGNWLHGEAVAAGMVMAC
                     YTAHRLGQFSLGDIARVKALLTRAGLPVTGPEVMAAQSYLPHMMRDKKVLAGELRLVL
                     PKAIGQSEVRSGVSHEMVLASIEDCR"
     gene            314988..316037
                     /locus_tag="RAHAQ2_RS01385"
                     /old_locus_tag="Rahaq2_0289"
     CDS             314988..316037
                     /locus_tag="RAHAQ2_RS01385"
                     /old_locus_tag="Rahaq2_0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333542.1"
                     /db_xref="GI:504099548"
                     /translation="MDDLTPEDDLKPDTSDRRPPRARKPSPSIPKVAVSRQYVMIGIG
                     IVVLVLLIVGIGSAMKSPSSSQTVQQTNGPKDISLAGNDAAAPAQPSAQAQANTAQAV
                     DGQQPADSQQPKSIGLPPVSPTPTEAQPVPDNGQAKERVDLPGDMSDALSSQQNQVDG
                     VAQGSMAPAAQSLTSLPTAPATVNGSARTQAPAGSQPSATHTRPAQSSRNVQPAHTSK
                     PAEHKTSATASHTAKTPATKSSASSAPVASAPATASGSTSAIKSAPGTHFTLQLSGAS
                     QSNTLNAFAKQQGLKNYLVYQTARDGKPWFVLVSGNYASSAEAKRAISSLPAEVQAKK
                     PWVKPVHQVQQDLKK"
     gene            316118..316933
                     /locus_tag="RAHAQ2_RS01390"
                     /old_locus_tag="Rahaq2_0290"
     CDS             316118..316933
                     /locus_tag="RAHAQ2_RS01390"
                     /old_locus_tag="Rahaq2_0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA adenine methylase"
                     /protein_id="WP_014333543.1"
                     /db_xref="GI:504099549"
                     /translation="MKKNRAFLKWAGGKYPLIDDIRRHLPVGDCLIEPFVGAGSVFLN
                     TEYDAYILADINSDLINLYNIVKTRTEEFVRDARVLFTPEFNESDRFYVLRAEFNASS
                     DTYRRSVLFLYLNRHCYNGLCRYNLSGAFNVPFGRYKKPYFPEEELYWFAEKAKHAVF
                     VCEHYQDTLLKAQSGSVVYCDPPYAPLSATANFTAYHTNSFSMDDQRNLARLAYQLSN
                     ENDVPVLISNHETPLTLEWYAQAKQLHRVSARRTISSKVAQRSMVNELLALYR"
     gene            316984..317661
                     /locus_tag="RAHAQ2_RS01395"
                     /old_locus_tag="Rahaq2_0291"
     CDS             316984..317661
                     /locus_tag="RAHAQ2_RS01395"
                     /old_locus_tag="Rahaq2_0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_014333544.1"
                     /db_xref="GI:504099550"
                     /translation="MKQFLIAPSILSADFARLGEDTAKALEAGGDVVHFDVMDNHYVP
                     NLTMGPAILKSLRNYGITAPIDVHLMVKPVDRLIPDFAEAGASYITFHPEASEHVDRS
                     LQLIKSHGCKAGLVFNPATSLSYLEYVMDKLDVILLMSVNPGFGGQSFIPGTLDKLRQ
                     VRKIIDASGYDIRLEVDGGVKAENIGEIAAAGADMFVAGSAIFNQPDYRTVIDHMRSE
                     LAKVSHD"
     gene            317654..318352
                     /locus_tag="RAHAQ2_RS01400"
                     /old_locus_tag="Rahaq2_0292"
     CDS             317654..318352
                     /locus_tag="RAHAQ2_RS01400"
                     /old_locus_tag="Rahaq2_0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333545.1"
                     /note="catalyzes the dephosphorylation of
                     2-phosphoglycolate to form glycolate and phosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="WP_014333545.1"
                     /db_xref="GI:504099551"
                     /translation="MTDILAARGLGFDLDGTLVDSAPGLSEAMDLALQDFGLPAAGVE
                     RLSTWIGNGADVMVERAVRWAEGDLSPEFLQSVRDKFDHYYADTAAGGSRLYPQVKET
                     LAALAAAGLPMGLVTNKPTPFIAPLLQSLGIDSYFTVVIGGDDVVAKKPHPAPVYMTL
                     ALLGLRASEMVFVGDSRNDIHAAQAAGCPCVGMTYGYNYGETIALTKPDRVLDNFADL
                     LPTLGLLSLKDQEA"
     gene            318354..319370
                     /locus_tag="RAHAQ2_RS01405"
                     /old_locus_tag="Rahaq2_0293"
     CDS             318354..319370
                     /locus_tag="RAHAQ2_RS01405"
                     /old_locus_tag="Rahaq2_0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="WP_014333546.1"
                     /db_xref="GI:504099552"
                     /translation="MSKPIVFSGAQPSGELTIGNYMGALRQWVKMQDDYECIYCIVDL
                     HAITVRQDAEKLRKATLDTLALYLAVGIDPKKSTIFVQSHVPEHSQLSWALNCYTYFG
                     ELGRMTQFKDKSARYETSNSESITAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLEL
                     SRDIASRFNALYGDVFTVPEPFIPKSGARVMSLQEPTKKMSKSDDNRKNVIGLLEDPK
                     AVTKKIKSAMTDSEEPPVIRYDIKNKPGVSNLLDILSGVTGKAIPELEAEFEGQMYGH
                     LKGAVAEAVSGMLTEVQERFNRFRSDEAYLQEVMKEGAEKARARASVTLKKAYEAIGF
                     VTLP"
     gene            complement(319459..320844)
                     /gene="cysG"
                     /locus_tag="RAHAQ2_RS01410"
                     /old_locus_tag="Rahaq2_0294"
     CDS             complement(319459..320844)
                     /gene="cysG"
                     /locus_tag="RAHAQ2_RS01410"
                     /old_locus_tag="Rahaq2_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333547.1"
                     /note="multifunction enzyme consisting of uroporphyrin-III
                     C-methyltransferase, precorrin-2 dehydrogenase and
                     sirohydrochlorin ferrochelatase; catalyzes the methylation
                     of uroporphyrinogen III to form precorrin-2, then
                     catalyzes formation of sirohydrochlorin from precorrin-2
                     and finally catalyzed the formation of siroheme from
                     sirohydrochlorin; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siroheme synthase"
                     /protein_id="WP_014333547.1"
                     /db_xref="GI:504099553"
                     /translation="MDYLPLFCQLKNRACLLVGAGDVAERKARLLLEAGAKLTVNALT
                     FTPQFQIWAEEGKVRLLRGEFSPLLVDEKWLVIAATDSDLVNQEVSEAADHRRVFCNV
                     VDAPESASVIMPSIIDRSPLMIAVSSGGNAPVLARLLRERLESILPQHLGKLAQIAGG
                     LRARVKTHFPDASERRRWWEKLFNHHRLAQSLANNDDAQSQEYLEELFREPVDKQGEV
                     ILVGAGPGDAGLLTLKGLQQMQLADVVVYDRLVSDGVLNLVRRDAERIFVGKRAGHHC
                     VPQERINEILLEQAQMGKRVVRLKGGDPFIFGRGGEELEALKAAGIPFSVVPGITAAS
                     GCSAYSGIPLTHRDHAQSVRLITGHAKQDGILDWACMAQPQQTLVFYMGLTQAGEIQR
                     NLLENGLTAETPVALVENGTSQQQRVVTGKLTELESLAKKVQSPSLIIVGSVVSLRQQ
                     LNWFASETLTV"
     gene            complement(320905..321255)
                     /gene="nirD"
                     /locus_tag="RAHAQ2_RS01415"
                     /old_locus_tag="Rahaq2_0295"
     CDS             complement(320905..321255)
                     /gene="nirD"
                     /locus_tag="RAHAQ2_RS01415"
                     /old_locus_tag="Rahaq2_0295"
                     /EC_number="1.7.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333548.1"
                     /note="involved in reducing nitrite to ammonium to
                     detoxify nitrite accumulation in anaerobic
                     nitrate-respiring cells and regenerate NAD+; bounds to
                     NirB, the cytoplasmic subunit, whose expression is induced
                     at high nitrate concentrations; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite reductase"
                     /protein_id="WP_037040691.1"
                     /db_xref="GI:739176719"
                     /translation="MSQWLTLCSVDQILPACGVCALAGDQQIALFRPYADEQIFALSN
                     IDPFAQASVLSRGIIAEHQGELWVASPLKKQHFRLTDGVCMEDEQYSVPAYEVRVQDG
                     NVQINTASLRAEIS"
     gene            complement(321255..323804)
                     /locus_tag="RAHAQ2_RS01420"
                     /old_locus_tag="Rahaq2_0296"
     CDS             complement(321255..323804)
                     /locus_tag="RAHAQ2_RS01420"
                     /old_locus_tag="Rahaq2_0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite reductase subunit NirD"
                     /protein_id="WP_014333549.1"
                     /db_xref="GI:504099555"
                     /translation="MSKVRLAIIGNGMVGHRFIEDLLDKAEPGQFDITVFCEEPRVAY
                     DRVHLSSYFSHHTAEELSLVREGFYEKHHVNVLTGERAITLNRKEKVIHSSSGRTVYY
                     DKLIIATGSYPWVPPITGSDGQDCFVYRTIEDLHAIESCARRSKRGAVVGGGLLGLEA
                     AGALKNLGVETHVVEFAPGLMAEQLDTQGGSQLRQKIESMGVRVHTAKNTKQIIQGGT
                     SARKTMEFADGTFLEVDFIVFSTGIRPQDKLARQCDLEIAPRGGIVINDQCQTSDPDV
                     YAIGECASWNQRTFGLVAPGYKMAQVTADHLLGRDNAFTGADMSAKLKLLGVDVAGIG
                     DAHARTPGARSYVYLDETKALYKRLVVSEDNKTLLGAVLVGDTSDYGNLLQLVLNSIP
                     LPENPDALILPAHSGSGTAVIGTDALPESAQICSCFDVTKGDIIKAVQGGCHTVAALK
                     SATKAGTGCGGCIPLVTQVLNAELSKQGIEVNHHLCEHFAYSRQELYHLIRVEGIRSF
                     DDLLNKYGKGYGCEVCKPTVGSLLASCWNDYVLKPQHTPLQDTNDVFLANMQKDGTYS
                     VIPRSPGGEITPQGLQAIGEIAAEYNLYTKITGSQRIGMFGAQKDDLPAIWQKLINAG
                     FETGQAYAKALRMAKTCVGSTWCRYGVGDSLGFGISLENRYKGIRTPHKMKFGVSGCT
                     RECSEAQGKDVGIIATENGWNLYVCGNGGMKPRHGDLLAADLDNDTLLRYLDRFMMFY
                     IRTADKLQRTSVWMDNLEGGIGYLRNVIIDNKLGLNDQLEAELTRLRESAVCEWQETL
                     NDPAAQTRFSHFINSSQRDPNVQFVGERQQHRPARPDERIPVTLVTDGEEV"
     gene            324028..325311
                     /locus_tag="RAHAQ2_RS01425"
                     /old_locus_tag="Rahaq2_0297"
     CDS             324028..325311
                     /locus_tag="RAHAQ2_RS01425"
                     /old_locus_tag="Rahaq2_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573625.1"
                     /note="Catalyzes the deamination of cytosine to uracil and
                     ammonia; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine deaminase"
                     /protein_id="WP_014333550.1"
                     /db_xref="GI:504099556"
                     /translation="MTKTLLRTVKNVRLPDREGLWQIDIEDGVIRQIVPQLDNADYGK
                     HILDAEGGLAIPPFIEPHIHLDTTQTAGQPAWNQSGTLFEGIERWAERKALLSHEDVK
                     QRAWQTLKWQIANGIQHVRTHVDVSDPTLTALKAMLEVKAEVAPWITLQIVAFPQEGI
                     MSYPNGEALLEEALRLGADVVGAIPHFEFTREYGVESLHKTFGLAKKYNALIDVHCDE
                     IDDEQSRFVETVAALALRENMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVAN
                     PLVNIHLQGRFDTYPKRRGITRVKEMLEAGINVCFGHDDVFDPWYPLGTANMLQVLHM
                     GLHVCQLMGYQQIDDGLKLITTYSARTMNLQGYGLESGHAASLIILPAQSGFDAVRRQ
                     TPVQYSLREGVLIAQTQLAKTIIHLDKDHLVDFNS"
     gene            325457..326023
                     /locus_tag="RAHAQ2_RS01430"
                     /old_locus_tag="Rahaq2_0298"
     CDS             325457..326023
                     /locus_tag="RAHAQ2_RS01430"
                     /old_locus_tag="Rahaq2_0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_014333551.1"
                     /db_xref="GI:504099557"
                     /translation="MFKRTLVALTALLSLTAMAPVLAAAQTHVMLTTSAGNIELELDS
                     AKAPVSVKNFVDYAQSGYYNNTIFHRVIPGFMVQGGGFTTDMQQKATKEPIKNEADNG
                     LRNLRGTVAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVIKGMDVVDKM
                     SQVKTDNVGPYQNVPTTPIVILSAKVLP"
     gene            326562..327767
                     /locus_tag="RAHAQ2_RS01435"
                     /old_locus_tag="Rahaq2_0299"
     CDS             326562..327767
                     /locus_tag="RAHAQ2_RS01435"
                     /old_locus_tag="Rahaq2_0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333552.1"
                     /db_xref="GI:504099558"
                     /translation="MKKLLVTGIVLGLFSWQATAQTIVLTDAEAGTELGNWKTDNKKL
                     NIAGTDFSIEQKVLHGGKQEGSKVITITSKGLTIALSPTRGMDLLHVTGDNIRLGWDS
                     PVQEVVNPAYINLESRNGVGWLEGFNEMMVRCGFEWTGHPVTADGMIYTLHGRAGNTP
                     ASKVVVDIADKAPHEITVRGLLKEDTFKKAKLETWTELRYVPGSHSWTIHDTLTNQSD
                     YPHDYQIIYHSNFGQPILEQGARFIAPLKSISPFNDYAKKGLADWQTYAGPTKGFDEM
                     VFNMVPLADAQGKTIAGVVNKAGNKGASIEFDTHQLPLLTLWKNTDTLKQGYVTGIEP
                     GTNYAYPVTIERKQGRVKQLQPGQSTVFELKYSLLPDAQAVKQLEDRVKTLQADHKTD
                     VNETPIAVE"
     gene            328025..328627
                     /locus_tag="RAHAQ2_RS01440"
                     /old_locus_tag="Rahaq2_0301"
     CDS             328025..328627
                     /locus_tag="RAHAQ2_RS01440"
                     /old_locus_tag="Rahaq2_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell filamentation protein Fic"
                     /protein_id="WP_014333554.1"
                     /db_xref="GI:504099560"
                     /translation="MNDKLVAGADPYYYPGINVLKNRLEIREEHRLLQAELAFTALRA
                     SVMPLGPSVMGLPHLCAVHLSLFQDIYPWAGEFREIDIYKDDTQFCHFEYIEKEGNAL
                     MQELEEEEFLVGLPLDNLAERLAHYYTGLNLLHPFRHGNGRALRIFIEQLVIHAGYDI
                     DWSKVDRERWLAANKTAVFGDETELVAIFNTVVSEIPQEH"
     gene            328704..329279
                     /locus_tag="RAHAQ2_RS01445"
                     /old_locus_tag="Rahaq2_0302"
     CDS             328704..329279
                     /locus_tag="RAHAQ2_RS01445"
                     /old_locus_tag="Rahaq2_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573631.1"
                     /note="TrpG; with TrpE catalyzes the formation of
                     anthranilate and glutamate from chorismate and glutamine;
                     TrpG provides the glutamine amidotransferase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit II"
                     /protein_id="WP_014333555.1"
                     /db_xref="GI:504099561"
                     /translation="MLLLIDNYDSFTYNLYQYFCELGAEVKVMRNDQLTLTGIEQLSP
                     SHLVISPGPCTPDEAGISLQAITYFSDRLPILGVCLGHQAMAQAFGANIVRARQAIHG
                     KTSPVRHTGRSVFTGLNNPLTVTRYHSLVVAPQTLPDCFEVTAWTERDGGRDDIMGIM
                     HKTLPLHGVQFHPESILSEQGHQLLDNFLKI"
     gene            329403..330620
                     /gene="argD"
                     /locus_tag="RAHAQ2_RS01450"
                     /old_locus_tag="Rahaq2_0303"
     CDS             329403..330620
                     /gene="argD"
                     /locus_tag="RAHAQ2_RS01450"
                     /old_locus_tag="Rahaq2_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411516.1"
                     /note="DapATase; bifunctional enzyme that functions in
                     arginine and lysine biosynthetic pathways; catalyzes the
                     formation of N-acetyl-L-glutamate 5-semialdehyde from
                     2-oxoglutarate and N(2)-acetyl-L-ornithine or
                     N-succinyl-2-L-amino-6-oxoheptanedioate from
                     2-oxoglutarate and N-succinyl-L-2,6-diaminoheptanedioate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate aminotransferase"
                     /protein_id="WP_014333556.1"
                     /db_xref="GI:504099562"
                     /translation="MAEKSAVDRGTFDKVILPVYSPAKFIPVKGKGSRVWDQQGNEYV
                     DFAGGIAVTALGHCHPALVKALHEQGETLWHVSNVFTNEPALRLAQKLIDATFADRVF
                     FANSGAEANEAAFKLARYYASHRHSPYKSKIIAFHNAFHGRTLFTVSVGGQPKYSDGF
                     GPKPADIVHVPFNDLDAVKAVIDDHTCAIVVEPVQGEGGVTPATKEFLQGLRELCNKH
                     QALLVLDEVQSGMGRSGKLFSYMHYGVTPDILTTAKALGGGFPVSAMLATEEVASVME
                     PGKHGTTYGGNPLACAVAEAALDIINTPDVLAGINERREKFISALEAINQKYHIFSEF
                     RGQGLLIGAELADAYKNRAGEFHAAAAEFGLMMLVAGPNVMRFAPSLVIDFADIEEGM
                     ARFEKAVGKVCGG"
     gene            complement(330900..331217)
                     /locus_tag="RAHAQ2_RS01455"
     CDS             complement(330900..331217)
                     /locus_tag="RAHAQ2_RS01455"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040689.1"
                     /db_xref="GI:739176717"
                     /translation="MPRTDGLKRIEKVSVSQVRGSLNAQRRNRPKWESAFPLLDFPSL
                     FQHALRSLAMFQQPQRQAGNLAALRFPLSVLKPWVFRPLRSARFLNRPQDLKFNGRLS
                     FIF"
     gene            complement(331290..333365)
                     /locus_tag="RAHAQ2_RS01460"
                     /old_locus_tag="Rahaq2_0304"
     CDS             complement(331290..333365)
                     /locus_tag="RAHAQ2_RS01460"
                     /old_locus_tag="Rahaq2_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333557.1"
                     /db_xref="GI:504099563"
                     /translation="MTLWRRLFYHPEVNYALRQTLVLCLPVSICWLFGNLQMGLLFSL
                     CPACCNIAGLDTPHKRFFKRLLVGGSLFAVSSILLQLMLENWHVPLPLIMLSLALLLG
                     VTGEISPLHARLLPGALVATIFTLSMVGVRPMWQAPVLFAAGTAWYGLFNWAWFRISK
                     EQPMRETLSQLYLQLADYFEAKYSLLTQHTDPETALPPLLTRQQQVIDLIALLYQQLH
                     MLPQHGHHHHHKRLFQRFQVALDLQEHITVSLHQPEEVQKLVEESHAEAVIRRNAQVI
                     SARLRVIADDILYHRLSERFTMANELTALEKIAARNPDNPVGQFCYYHFSRIARLLRT
                     QRPLYRRDLMNTQPRLPFWPALKSYLSFKSVALRNAARLGIILAIGSSLGLFFNLPKP
                     YWILLTIMLVSQNGYNATRVRIQHRALGTLAGLLIASGLLKLELPEGTTLLYMLLITL
                     LSYTVLRKNYGLAMVGMTVTAVYTLQLLAMNGVHFLVPRLVDTLIGCALAFGGTIWLW
                     PQWQSGLLRQNAHQALETYQNAIRLLLEENPDTARLAYTRMQVNQAHNKLFTSLNQAM
                     QEPGFNSHYLADMRLWVTHSQFVVEHINAMTILAREHYMLPEKLATEYLQTCEIALQS
                     CQQRLLYDGPGSENNLFNAPELHPDMPLTEMERHLRRVISHLSVMHTISSLAWKQRPH
                     HGIWLTRRA"
     gene            complement(333427..334059)
                     /locus_tag="RAHAQ2_RS01465"
                     /old_locus_tag="Rahaq2_0305"
     CDS             complement(333427..334059)
                     /locus_tag="RAHAQ2_RS01465"
                     /old_locus_tag="Rahaq2_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005159757.1"
                     /note="cAMP receptor protein; complexes with cyclic AMP
                     and binds to specific DNA sites near the promoter to
                     regulate the transcription of several catabolite-sensitive
                     operons; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013573634.1"
                     /db_xref="GI:503338973"
                     /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIV
                     KGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKK
                     FRQLIQVNPDILMRLSAQMANRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTH
                     PDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQSLISAHGKTIVVYGTR"
     gene            334423..334830
                     /locus_tag="RAHAQ2_RS01470"
                     /old_locus_tag="Rahaq2_0306"
     CDS             334423..334830
                     /locus_tag="RAHAQ2_RS01470"
                     /old_locus_tag="Rahaq2_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013573635.1"
                     /db_xref="GI:503338974"
                     /translation="MHARVKWVEGLTFLGESASGHQISMDGNAGDKAPSPMEMLLMSA
                     GGCSAIDVVSILQKGRNDVRDCEVKLTSQRREEAPRLFTHINLHFIVTGKDLTDKIVE
                     RAVSLSAEKYCSVSLMLGKAATITHSFEVIAAE"
     gene            complement(334834..335703)
                     /locus_tag="RAHAQ2_RS01475"
                     /old_locus_tag="Rahaq2_0307"
     CDS             complement(334834..335703)
                     /locus_tag="RAHAQ2_RS01475"
                     /old_locus_tag="Rahaq2_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015962172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribulokinase"
                     /protein_id="WP_014333558.1"
                     /db_xref="GI:504099564"
                     /translation="MSAKHPVIAVTGSSGAGTTTTSVAFRKIFQQLGLRAAELEGDSF
                     HHFTRPEMDAAIRKARDLGRHISYFGPEANDFGLLEKSFIEYGETGTGRSRKYLHTYD
                     EAVPYNQVPGTFTPWQALPEPTDILFYEGLHGGVVADKIDVAAQVDLLVGVVPIVNLE
                     WIQKLVRDTGERGHSREAVMDSVVRSMDDYISYITPQFSRTHINFQRVPTIDTSNPFA
                     AKAIPSLDESFVVIHFQGLDDIDFPYLLAMLQGSFISHIKTLVVPGGKMGLAMELIMA
                     PLVQRLMEGKKIE"
     gene            complement(335839..336753)
                     /locus_tag="RAHAQ2_RS01480"
                     /old_locus_tag="Rahaq2_0308"
     CDS             complement(335839..336753)
                     /locus_tag="RAHAQ2_RS01480"
                     /old_locus_tag="Rahaq2_0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573637.1"
                     /note="activator of the allDC-ylbA operon involved in
                     allantoin utilization; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014333559.1"
                     /db_xref="GI:504099565"
                     /translation="MLDEESIKTFMHVAQTGSFSRAAEMLHKTPATISYRIKMLEDST
                     GTLLLNRTTRTVSLTPAGQHLLERCRQWLTWLEGVPAELQQINDGIERQLNVVVNNLM
                     YCPEALAALLSSLTQRYPFTQFTFTRQIYMGVWDTLLYEDFQLAIGVTGTESLSNAVN
                     LLPLGEVDWVFVHAPFHPLQHITGMLEEAVLRQYIAINVEDTSRHLNKRVAWLLTGQR
                     QIIVADVATKLACHLKGMGIGFLPRHLCQPYLDSGELIARQIRYPRAPSPLSLAWKKE
                     YTGKALHDIVSLFHQKDPLIQPLLAGLE"
     gene            336968..337474
                     /locus_tag="RAHAQ2_RS01485"
     CDS             336968..337474
                     /locus_tag="RAHAQ2_RS01485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate hydrolase"
                     /protein_id="WP_037033635.1"
                     /db_xref="GI:739169449"
                     /translation="MELPVYPLTQAAFAAYGDVIETTGRDFFHINDGKVERYHDLTNV
                     EILGQDRPLVSINRAQPAPLPIVVTQLEKHPLGSQAFVPMQGERFIVIVAAGGETPDI
                     STLKAFITNGLQGVNYHRNVWHHPLFAFETVTNFLTVDRGGADNCDISQLPQGYQLIL
                     PVAAGLKS"
     gene            337561..338370
                     /locus_tag="RAHAQ2_RS01490"
                     /old_locus_tag="Rahaq2_0310"
     CDS             337561..338370
                     /locus_tag="RAHAQ2_RS01490"
                     /old_locus_tag="Rahaq2_0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573639.1"
                     /note="regulates operons involved in the utilization of
                     allantoin; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013573639.1"
                     /db_xref="GI:503338978"
                     /translation="MAEVKKRGRPSQPGSGSQKGAQALERGIAVLNYLAQSGGSSSVS
                     NIAENLSLPLSTTFRLLKVLEEADFVYQDAQLSWWHIGLQAFTVGSSYIHNRDVLSVA
                     APYMQRLMLLSGETANLAIRNGFEAVLIGQRECQSMVRMCAPLGSRLPLHASGAGKAL
                     LYSLDDEALMSLMMQAGLKNFTTHTLDNLNALKKDLQHARQQGFAQDSEEHVTGLNCL
                     ASAIFDSNNNAVAAISISGPSSRLTTERFTDLGELVRDTARDISLALGQRH"
     gene            338485..340266
                     /locus_tag="RAHAQ2_RS01495"
                     /old_locus_tag="Rahaq2_0311"
     CDS             338485..340266
                     /locus_tag="RAHAQ2_RS01495"
                     /old_locus_tag="Rahaq2_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411519.1"
                     /note="catalyzes the formation of
                     2-hydroxy-3-oxopropanoate (tartronate semialdehyde) from
                     two molecules of glyoxylate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxylate carboligase"
                     /protein_id="WP_014333561.1"
                     /db_xref="GI:504099567"
                     /translation="MARMTAAQAAMYVLEKEGITTAFGVPGAAINPFYNAMRLHGKIR
                     HVLARHVEGASHMAEGYTRAKAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITG
                     QAPRARLHKEDFQAVDIQAIAGPVSKMAVTVLEPALVPRVLQQAFHLMRSGRPGPVLV
                     DLPYDVQTAEIEFDPETYESLPAYKPIATVAQAVKAMEMLNACERPLIVAGGGVINAD
                     AAVLLQRFAELTQVPVIPTLMGWGVIPDDHRLMAGMVGLQTAHRYGNTSLLASDLVFG
                     IGNRFANRHTGSVEKYTAGRKIIHVDIEPTQIGRVLCPDLGIVSDAGEALKLLIEVAE
                     EQRKAGKLPCRESWIQECEERKRTMLRKTHFNDVPVKPQRVYEEMSKAFGRNVNYVTT
                     IGLSQIAAAQMLHVFEPRHWINCGQAGPLGWTIPAALGVCIAAPERQVVGISGDYDFQ
                     FMIEELAVGAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSEDVKGYG
                     VDHVKVVEGLGCKAIRVFRPEDIAPAFAEAKRLMKQHQVPVVVEIMLERVTNISMGGE
                     IDSVNEFEPVADNADDAPTHVSFMKYE"
     gene            340281..341057
                     /locus_tag="RAHAQ2_RS01500"
                     /old_locus_tag="Rahaq2_0312"
     CDS             340281..341057
                     /locus_tag="RAHAQ2_RS01500"
                     /old_locus_tag="Rahaq2_0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate isomerase"
                     /protein_id="WP_014333562.1"
                     /db_xref="GI:504099568"
                     /translation="MLKFSANLSMLFLEVDFLQRFKAAAEGGFTAVEFMFPYDYPAGT
                     LKALLAENHLQHTLHNLPAGNWAEGERGIACLAGREAEFREGVAQAIAYAKALGNRKI
                     NCLTGKIPAGSDAASVTPLVVENLRYAAQALAKEGLMLLIEPINHFDIPGFYLTGTQQ
                     ALDLIDLVGSDNMFIQYDIYHMQRMEGELANTMTRHAEKIGHLQVADNPHRNEPGTGE
                     INYDFIFNLIKQSDYDGWVGCEYKPRARTEDGLGWLNAYR"
     gene            341149..342027
                     /locus_tag="RAHAQ2_RS01505"
                     /old_locus_tag="Rahaq2_0313"
     CDS             341149..342027
                     /locus_tag="RAHAQ2_RS01505"
                     /old_locus_tag="Rahaq2_0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333563.1"
                     /note="NADH-dependent; catalyzed the reversible formation
                     of glycerate from tartronate semialdehyde; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tartronate semialdehyde reductase"
                     /protein_id="WP_014333563.1"
                     /db_xref="GI:504099569"
                     /translation="MKIGFIGLGIMGAPMAQHLVDAGHSLHFSTLGNVPASLTDAGAK
                     ACATPAEVASYADVIIIMVPDTPDVATVLFGDNGCASVPLKGKTIVDMSSISPIDTKT
                     FAQRVQQLGGEYLDAPVSGGEIGAQQGTLTIMVGGKEAVFNDIKPLFELMGKNITLVG
                     DCGAGQTCKVANQIIVALNIEAVSEALLFASRAGADPARVRQALMGGFASSRILEVHG
                     ERMIKRTFAPGFKVALHQKDLNLALQSAKALSISLPNTATCQELFNVCAANGGSQLDH
                     SSLIQSLEMMSNHKIG"
     gene            342103..343557
                     /locus_tag="RAHAQ2_RS01510"
                     /old_locus_tag="Rahaq2_0314"
     CDS             342103..343557
                     /locus_tag="RAHAQ2_RS01510"
                     /old_locus_tag="Rahaq2_0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoin permease"
                     /protein_id="WP_014333564.1"
                     /db_xref="GI:504099570"
                     /translation="MNESECTQQERYCERGYSNDLLPKLKEKRNWKGFNYFTLWMGSV
                     HNVPNYIAVGGFLILGLSTFSVMMAIIISALFIAAVMVLNGAAGSKYGVPFAMILRGS
                     YGIRGALFPGILRGCIAAIMWFGLQCYAGSLAFLILIGKIWPEFLTLGGDFNLLGISM
                     PGLIAFLIFWAINVMIGFGGGGVLNKFTAILNPCIYVVFGGMAVWAISLAGLENILNY
                     VPANAEQSGNPLFLFLVVINAVVAVWAAPAVSASDFTQNASSFKQQAWGQTLGLIVAY
                     VLFAVASVCILAGASIHYGVDTWNVLDIVQKWDSLFASVFAVLVILMTTISTNATGNI
                     IPAGFQIAAIAPKKLTYKKGVLIASLISVVICPWKLMENQESIYLFLDIIGGMLGPVI
                     GVMMAHYFIVVRSELDLDTLYTAPGNYNYYHRGFNTVAFAVTLIAVVLSLGGKFIPVL
                     EPLSRVSWFVGVIVAFVLYSIFMKREPSLQPQNV"
     gene            343640..345001
                     /locus_tag="RAHAQ2_RS01515"
                     /old_locus_tag="Rahaq2_0315"
     CDS             343640..345001
                     /locus_tag="RAHAQ2_RS01515"
                     /old_locus_tag="Rahaq2_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333565.1"
                     /note="Plays a crucial role on both purine and pyrimidine
                     metabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoinase"
                     /protein_id="WP_014333565.1"
                     /db_xref="GI:504099571"
                     /translation="MSYDLIIKKGTVVLESEAVITDIAVKNGKIVAIGDDLTGAEKIL
                     SAEGVIVAPGMVDAHTHISEPGRSHWEGYATGTRAAAKGGITTMIEMPLNQLPATVDR
                     ASLHMKFDAAEGKLTIDAAQFGGLVSYNLDRLHELDEEGVVAYKCFVATCGDRSVSND
                     FRDVNDWEYFKGLQILAKRDQLVAVHAENALICDELGREAKDAGRVTAHDYVASRPVF
                     TEVEAIRRVLYLAKVADCRLHVCHISSPEGLAEVLRARHEGQRVTCESCPHYFVLDTA
                     QFEEIGTLAKCSPPIRDKKNQEGMWEHLLKGDFDCLVSDHSPCPPDMKAGNVMQAWGG
                     IAGLQNCVDVMFDEAVQKRGMSLPMFSKLMSSNAADIFGLKHKGRISIGKDADFVFIK
                     PNSSYVLKASDLEYRHKVSPYVGRTINAQVVKTILRGETIYDIQDGFQDKCIGKFVLK
                     HLQ"
     gene            345064..346368
                     /locus_tag="RAHAQ2_RS01520"
                     /old_locus_tag="Rahaq2_0316"
     CDS             345064..346368
                     /locus_tag="RAHAQ2_RS01520"
                     /old_locus_tag="Rahaq2_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine permease"
                     /protein_id="WP_014333566.1"
                     /db_xref="GI:504099572"
                     /translation="MMLFPRVQFLPGIQWFFFIFCNTVVIPPTLQSAFQLSDAATLCL
                     MQYSFIATGLACVAQAALGHGRAIMEGPTGLWWGVILTVTLAEAAHGTPLPVIGGSLA
                     VGIALSGVITVLIGLSGLGHRIAVLFRPAVMMVFMFLLGAQLLSLFIRGMLGLPFGVP
                     QGPVNIDFPAFLLALAVAALVVGIVVWLPSPWNKYGLLAGTLTGWAAYRIIFPQAVSP
                     GTGTDWQWFPLGAPQGLRGGIILTATLTGLLNISNTFGALRGTQTFYPQQTPQYRRSF
                     VVSGLFTLGSAVLGIVPFSPFVSSIGLLTQTNDNRKAPFILGALVVVAIGLFTPLTAF
                     FARIPLSISSAVLLVSYLPLLSSSLSFLPHIRLSSRNVYRLAIPLFSGIFLMGLPAGY
                     LQEVPLWLRPLLSNGLLTGVMLAIVLENLLPWDRVHANNAPH"
     gene            complement(346419..347210)
                     /locus_tag="RAHAQ2_RS01525"
                     /old_locus_tag="Rahaq2_0317"
     CDS             complement(346419..347210)
                     /locus_tag="RAHAQ2_RS01525"
                     /old_locus_tag="Rahaq2_0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333567.1"
                     /db_xref="GI:504099573"
                     /translation="MGYINHNTGYIKDLLSNRSIIKRGNYALIEPDGLVKNTLPGFER
                     CEITILATPKLGATFVDYLINMLEGGKNLAGFGGDAHIETFVYVIDGNITANAEGQDY
                     RLESGGYLYCPPGVSMTLENANGSRNSRLFLYKKRYTPVTGFQPHVVCNNVHQLEKIH
                     YEGMSDVIVQDLLPANLGFDMNIHILTFAPGACHGYVETHVQEHGALILSGEGMYNLD
                     NHWIPVKKNDYIFMGAYCPQACYAVGRDEPLSYIYSKDCNRDVEL"
     gene            complement(347233..348459)
                     /locus_tag="RAHAQ2_RS01530"
                     /old_locus_tag="Rahaq2_0318"
     CDS             complement(347233..348459)
                     /locus_tag="RAHAQ2_RS01530"
                     /old_locus_tag="Rahaq2_0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoate amidohydrolase"
                     /protein_id="WP_014333568.1"
                     /db_xref="GI:504099574"
                     /translation="MSPFYQEVESQLDWLSVFGADPEGGISRLLYSPEWLETQNQLKQ
                     RMEQAGFATRFDAVGNVYGRIEGSDRKDEVILSGSHIDTVVSGGHLDGQFGVLAAFIA
                     MRYLKDTFGTPRRTLEVVSLAEEEGSRFPYVFWGSKNIVGQADPADVRDITDAQGVKF
                     TDAMQQCGFTLSGSPLPARRDIKAFVELHIEQGSVLERNQQQLGVVNAIVGQRRYTVT
                     LTGTANHAGTTPMSYRKDTLLAFSQICVAATDSAEAHGDPLVLTFGKVVPVPGTVNVV
                     PGKTVFSIDCRHTDQQALLAFTTELEATMRRICQERGIGIDIDLWMDEAPVPMDKQLV
                     AQLDALCREQNSRYRVMHSGAGHDAQIFAACVPTCLLFVPSIAGISHNPAENTAIADL
                     AAGVETLAKMLHQLAY"
     gene            complement(348481..349530)
                     /locus_tag="RAHAQ2_RS01535"
                     /old_locus_tag="Rahaq2_0319"
     CDS             complement(348481..349530)
                     /locus_tag="RAHAQ2_RS01535"
                     /old_locus_tag="Rahaq2_0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333569.1"
                     /note="catalyzes the formation of oxalurate from
                     ureidoglycolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate dehydrogenase"
                     /protein_id="WP_014333569.1"
                     /db_xref="GI:504099575"
                     /translation="MKVSREELHQLIARKLTTAGLTPEHAAVVADVLSYADARGIHSH
                     GAVRVEYYAERIARGGTNTSPALQWEETGPCSGILHADNGPGHVAANLAMEHAIDMAK
                     IKGIAVVGVRQMGHCGALSYFVHRAAQAGMLAVSVCQSDPMVVPFGSADIYYGTNPIA
                     FAAPGEGEQIITFDMATTVQAWGKILDARARNEKIPDTWAVDGAGNPTTDPFAVEALL
                     PMSGPKGYGLMMMVDVLSGILLGLPFGRSVSSMYEDLTAGRDLGQLHIVINPAFFTSS
                     QIFRKNISQMLAELVALSPAPGFEKVLYPGQNLDIYEEETKKNGIELVDDIYRYLISD
                     ELYTRTYETQSPFAH"
     gene            349828..351495
                     /locus_tag="RAHAQ2_RS01540"
                     /old_locus_tag="Rahaq2_0320"
     CDS             349828..351495
                     /locus_tag="RAHAQ2_RS01540"
                     /old_locus_tag="Rahaq2_0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411527.1"
                     /note="multicopy suppressor of dominant negative ftsH
                     mutations; putative  acyl-CoA synthetase; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333570.1"
                     /db_xref="GI:504099576"
                     /translation="MIHACIKKGSFQDSVSLMIISRQLSESPDVDDVSVMMGTPANKA
                     LLDATGFWHACFEQATPNDICVAVRSESRDESIISAITGRLEEALKAMSAGQRGGRSL
                     PVARRFASAEQRLPEANLMLISIAGEYAAGLAHQALDSGRNVMIFSDNVTLEDEILLK
                     QKARDKGLLVMGPDCGTAIIAGAPLAFANVLPQGMIGVIGASGTGIQELTSQIALNGQ
                     GISQAIGLGGRDLSAQVGGISALTSLKMLAEDPQSQVLAFVSKPPADAVRLKVMAAMK
                     AIDKPVVALFLGAPVSQARDGNVWLASTLDEAARIACLLARVVQVAASQPDVAGKKIA
                     GLFTGGTLAAEAAMVLAGLLDVEADHAHEHGTMLDHNGHRIIDLGDDFYTVGKPHPMI
                     DPTSREQLILGLAGKSETGVLLLDVVIGYGAQRDPAGSVATAVRHLMTQRARHAPLVV
                     IAMVTGSEQDPQCRSQQIALLREVGILVVQTLPEATLLAHTLCTQTAVTPAASTCLLL
                     SQVAVINAGLLGFALDLQSASVPVVHYPWSPVAGGNLRLASLLKQLG"
     gene            351530..352798
                     /locus_tag="RAHAQ2_RS01545"
                     /old_locus_tag="Rahaq2_0321"
     CDS             351530..352798
                     /locus_tag="RAHAQ2_RS01545"
                     /old_locus_tag="Rahaq2_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333571.1"
                     /db_xref="GI:504099577"
                     /translation="MKNILEQANTAVIERIRQARPHWLDVQPARQAIPVLNQGKTLLH
                     AGPPIRWEDMTGPVRGACIGACLFEGWAQDEQRALQLLNSGEIRFVPCHHVSAVGPMG
                     GITSANMPVLVIGNLTDGNRAFCNMNEGIGKVMRFGAYGPDVQMRLRWMRDVLAPALS
                     GALRRLERGIDLTAMMAQGITMGDEFHQRNIATSALLMRSLAPQLAAGNLDKTTLTDV
                     LHFLSTTDQFFLNLAMAYCKAAMDAGAAVGKGSIVTAMTRNGKEFGIRVSGLGDRWFT
                     APVNMPQGLFFSGYSQQDANPDMGDSAITETFGVGGAAMIAAPGVTRFVGAGGMDAAI
                     TVSEEMAEIFLERNMMLQIPGWDFQGACLGLDVRRVVETGITPLINTGIAHREPGIGQ
                     IGAGTVRAPLACFEQALEALAEHLGVHPQV"
     gene            352795..353556
                     /locus_tag="RAHAQ2_RS01550"
                     /old_locus_tag="Rahaq2_0322"
     CDS             352795..353556
                     /locus_tag="RAHAQ2_RS01550"
                     /old_locus_tag="Rahaq2_0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333572.1"
                     /db_xref="GI:504099578"
                     /translation="MNIPAPLAVSAHAPVCSGDWLVVGLFSRAINLVNERGEWLTLHR
                     YGKGLSPMGWLLRARDFEGLLSRLTLGDMMREGAENQPTRRLDLHVTQGSRQLYDYVH
                     GFLTGCPQLTGLFGELGQVVLEPPGGELAHIQHQLLRQLQGHRVDWQNVVGKGAGLTP
                     SHDDTLTGMLLVCAAHGLPVGDFFDHTPDLRTLTSSVSCAYLHHAVRRQFSTPLLHLI
                     RARRAEQVLALGHTSGADTLLGVWLALTLFREHFL"
     gene            353566..354465
                     /locus_tag="RAHAQ2_RS01555"
                     /old_locus_tag="Rahaq2_0323"
     CDS             353566..354465
                     /locus_tag="RAHAQ2_RS01555"
                     /old_locus_tag="Rahaq2_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573653.1"
                     /note="reversible synthesis of carbamate and ATP from
                     carbamoyl phosphate and ADP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamate kinase"
                     /protein_id="WP_014333573.1"
                     /db_xref="GI:504099579"
                     /translation="METLVVALGGNALLQRGECLSAENQYRNIATVAGALARLATRYR
                     LAIVHGNGPQVGLLSLQNQAYTEVPAYPLDILVAETQGMIGFMLAQMLGQQTGMPEVS
                     TVLTRIEVDSRDPAFASPEKFIGPVYPPESQQELETLHGWKMKADGRFLRRVVASPVP
                     KRIVDIDAIQQLLARGHVVICNGGGGIPVFEDGNGAKAVIDKDLSAALLARQLKAQKL
                     VILTDADAVYEHWGTSQQRAIRRATPAQLAPFAQNDGSMGPKVAAVSAFVNYSGYPAY
                     IGALDQIEAVLAGDAGTCISATA"
     gene            complement(354497..354742)
                     /locus_tag="RAHAQ2_RS01560"
                     /old_locus_tag="Rahaq2_0324"
     CDS             complement(354497..354742)
                     /locus_tag="RAHAQ2_RS01560"
                     /old_locus_tag="Rahaq2_0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004930376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333574.1"
                     /db_xref="GI:504099580"
                     /translation="MIIPWQELDAELLTSVVESFVLREGTDYGEQERSLEQKVDDVKR
                     QLKSGEVVLVWSELHETLNIMPRGQFRAGQEETPQDG"
     gene            complement(354739..355734)
                     /locus_tag="RAHAQ2_RS01565"
                     /old_locus_tag="Rahaq2_0325"
     CDS             complement(354739..355734)
                     /locus_tag="RAHAQ2_RS01565"
                     /old_locus_tag="Rahaq2_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014333575.1"
                     /db_xref="GI:504099581"
                     /translation="MVESFRPLRGASNPHIQTLLPRLVRRHAKLKPHWQRLDTPDGDF
                     LDLAWSEDPEQARHKPRMILFHGLEGSFYSPYAHGLLQAWKDKGWLGVVMHFRGCSGE
                     PNKLLRIYHSGETEDARFFIRWLNETHGEVPTGAVGVSLGGNMLACYLGQEGEKCTLS
                     AAVVVSAPLMLEPCAYRLERGSSRIYQHYLLGQLKGNALRKLAKYPGTLPVTLAQLKA
                     MRRLREFDDAITSKAHGFTDALDYYRRCSALPLLAQIRTPLLIIHAKDDPFMTPEVIP
                     KAEDLPDCVEYQLTEHGGHVGFVSGSLRNPQMWLEQRIPAWIAPFLENKTKETTE"
     gene            355835..356437
                     /locus_tag="RAHAQ2_RS01570"
                     /old_locus_tag="Rahaq2_0326"
     CDS             355835..356437
                     /locus_tag="RAHAQ2_RS01570"
                     /old_locus_tag="Rahaq2_0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_014333576.1"
                     /db_xref="GI:504099582"
                     /translation="MEPGLFLSMLGFLWVAAITPGPNNMLLTTSGANFGFFRSLWLMV
                     GIMLGMQSILLLVAFGVGGLITIYPALHLFLKIAGSLYLLWLAWKIATSVYEKLETGA
                     PPPKPIRLYQGWLLQFLNPKAWLMGLGAVASFSLAGAAYNHSIAGISLGMFLVNLVSG
                     IIWLGFGTVIGRLLRSKRAWYTFNIAMGMLTAACVLLIWH"
     gene            complement(356492..358411)
                     /locus_tag="RAHAQ2_RS01575"
                     /old_locus_tag="Rahaq2_0327"
     CDS             complement(356492..358411)
                     /locus_tag="RAHAQ2_RS01575"
                     /old_locus_tag="Rahaq2_0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione ABC transporter ATP-binding protein"
                     /protein_id="WP_014333577.1"
                     /db_xref="GI:504099583"
                     /translation="MIVFSSLQIRRGTNVLLDNASATINPGQKVGLVGKNGCGKSTLI
                     SLLKGEMSADAGNLTFPSNWALAWVNQETPALDEPAIEYVIDGDREFRQLEAQLQHAN
                     ERDDGHAIATLHGKLDAINAWTIPARAASLLSGLGFTQNQLQQPVKSFSGGWRMRLNL
                     AQALICRSDLLLLDEPTNHLDLDAVIWLEKWLKSYTGTLVLISHDRDFLDPIVDKILH
                     IEQQMLNEYTGNYSSFERQRATKLSQQQALFESQQEKVAHLQSYIDRFRAQATKAKQA
                     QSRIKMLERMELIAPAHVDNPFHFSFRSPESLPDPLLRMEKVSAGYGDTTILESIKLN
                     LVPGSRIGLLGRNGAGKSTLIKLLAGTMPPLQGDIGLAKGVKLGYFAQHQLEFLRAED
                     SPLQHLVRLANKETEQQLRDYLGGFGFHGDKVTDPTGRFSGGEKARLVLALIVWQRPN
                     LLLLDEPTNHLDLDMRQALTEALIDFEGAMVVVSHDRHLLRSTTDDLYLVHGGKVEQF
                     DGDLEDYQQWLVDIQRQESQQDAPAKDGGVNSAQSRKDQKRREADFRNQTQPLRKQIT
                     QLEAQMEKLSTELAAIEARLADSAIYDISRKADLTDCLQQQTKVKGALEETEMTWLDA
                     QEQLEEMSKAFDIEN"
     gene            358541..359095
                     /locus_tag="RAHAQ2_RS01580"
                     /old_locus_tag="Rahaq2_0328"
     CDS             358541..359095
                     /locus_tag="RAHAQ2_RS01580"
                     /old_locus_tag="Rahaq2_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573658.1"
                     /note="required for KefB activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_014333578.1"
                     /db_xref="GI:504099584"
                     /translation="MSQPPKVLLLYAHPESPDSVANRVLLQQAQQLEHVTVHDLYAHY
                     PDFFIDIHREQQLLREHKVIVFQHPLYTYSCPALLKEWMDRVLARGFASGAGGNALNG
                     KYWRSVVTTGEPEGAYRAGGYNRYPMSDIMRPFELTSAMCHMHWMTPIVIYWARRQKP
                     DVLQSHAEAYGEWLRSPLPHGGIV"
     gene            359095..360903
                     /locus_tag="RAHAQ2_RS01585"
                     /old_locus_tag="Rahaq2_0329"
     CDS             359095..360903
                     /locus_tag="RAHAQ2_RS01585"
                     /old_locus_tag="Rahaq2_0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333579.1"
                     /note="involved in potassium efflux; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_014333579.1"
                     /db_xref="GI:504099585"
                     /translation="MDVSSIPTAILLFLFAAVVAVPLAQRLGIGAVLGYLLAGIAIGP
                     WGLGFIRDVDEILHFSELGVVFLMFIIGLELNPGKLWALRRQIFGVGAGQVILTALVL
                     GGLLYLTKFSWQAAVIGGIGLAMSSTAMALQLMRDKGMTRNEGGQLGFAVLLFQDIAV
                     IPALALIPILAGGSEGSNNWEMIGLKVLAFGGMLIGGRYLLRPIFRLIVASGVREVFT
                     AAALLVVLGSALFMDTLGFSMALGTFIAGILLAESEYQHELEIAIEPFKGLLLGLFFI
                     SVGMALNLGVLYTHILLVLAGVIILVAVKSALLYGLSRVFGLRTSVRLQFSAVLSQGG
                     EFAFVLFSAAGAQKVISSSQLSLLLVVVTLSMMTTPLLMQWVDRILVRRYNDGEESDE
                     KHFVQDDEPQVIIVGFGRFGQVIGRLLMANKMRITVLERDISAVGLMRTYGYKVYYGD
                     ATELELLRASGAEKAKSIVITSNEPEDTMAIVHLCQQHFPHLNILARARGRVEAHELL
                     QAGVVNFSRETFSSALELGKKALVTLGMHPHSAYRAQQHFRRLDMRMLRELVPQNRGD
                     VAQISRVKEARRELEDIFQSEMHNERRQLDGWDDDE"
     gene            360982..361185
                     /locus_tag="RAHAQ2_RS01590"
                     /old_locus_tag="Rahaq2_0330"
     CDS             360982..361185
                     /locus_tag="RAHAQ2_RS01590"
                     /old_locus_tag="Rahaq2_0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013573660.1"
                     /db_xref="GI:503338999"
                     /translation="MATTRKRFIAGAVCPKCKAMDTLALWQEDQVEVVECVKCGHHQR
                     QTDAQVSKKLRPEEQVIGIFDPK"
     gene            361384..361971
                     /locus_tag="RAHAQ2_RS01595"
                     /old_locus_tag="Rahaq2_0331"
     CDS             361384..361971
                     /locus_tag="RAHAQ2_RS01595"
                     /old_locus_tag="Rahaq2_0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333580.1"
                     /note="rotamase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_014333580.1"
                     /db_xref="GI:504099586"
                     /translation="MKVAKDLVVSVAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISG
                     LETALDGHAVGDRFDVHVGANDAYGNYDENLVQRVPKDVFMGVEELEVGMRFLADTDQ
                     GPVPVEITEVDGDHVVVDGNHMLAGQNLNFHVEVVAIREATEEELAHGHVHGEHGHDH
                     GHDHEHGDGCCGGHDHDHDHGKKGGCGGNGGCGCH"
     gene            complement(362036..362254)
                     /locus_tag="RAHAQ2_RS01600"
                     /old_locus_tag="Rahaq2_0332"
     CDS             complement(362036..362254)
                     /locus_tag="RAHAQ2_RS01600"
                     /old_locus_tag="Rahaq2_0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333581.1"
                     /note="required for phi X174 lysis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysis protein"
                     /protein_id="WP_014333581.1"
                     /db_xref="GI:504099587"
                     /translation="MNSNTVEQRLEMLENKLAFQEITIEELNMIVTQHQLEMSRLHDH
                     LRLLTDKLRASQPSMIADPSEETPPPHY"
     gene            362548..363408
                     /locus_tag="RAHAQ2_RS01605"
                     /old_locus_tag="Rahaq2_0333"
     CDS             362548..363408
                     /locus_tag="RAHAQ2_RS01605"
                     /old_locus_tag="Rahaq2_0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333582.1"
                     /note="rotamase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_014333582.1"
                     /db_xref="GI:504099588"
                     /translation="MKSLFKVTLLATTMAIALNATQVMAAEATAPAAAATAPAAAPAA
                     AAPAATDTAKFKSDDEQAAYALGASLGRYMDNSLKEQEKLGIKLDKDQLIAGVQDAFA
                     NKSKLSDQEIEQTLQTFEGRVKASAQAKMEQDAKANADKGDKFRADFAKEKGVKKTES
                     GLLYQVEKPGAGAAPKDSDTVVVNYKGTLTDGTEFDNSYTRGEPLSFRLDGVIPGWTE
                     GLKHIKKGGKIKLVIPPALAYGKTGVPGIPANSTLVFDVELLDVKAAPKADPKAAEKP
                     AEAEAAPKAN"
     gene            363672..364394
                     /locus_tag="RAHAQ2_RS01610"
                     /old_locus_tag="Rahaq2_0334"
     CDS             363672..364394
                     /locus_tag="RAHAQ2_RS01610"
                     /old_locus_tag="Rahaq2_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013573664.1"
                     /db_xref="GI:503339003"
                     /translation="MSNSLITGETGELDLLDQRPFSQVDHEILSSYEAVVDGLAMLIG
                     EHCEIVLHSLEDLKCSAVRIANGEHTGRKIGSPITDLALRMLHDMTGADSNVSKAYFT
                     RAKSGVLMKSVTIAIRNREQRVIGLLCINMNLDVPFSQIIQTFMPPETQEVASSVNFA
                     SSVDDLVAQTLEFTIEEVNADRNVSNNAKNRQVVLNLYEKGIFDIKDAINQVADRLNI
                     SKHTVYLYIRQFKSGDLVGNER"
     gene            364391..364783
                     /locus_tag="RAHAQ2_RS01615"
                     /old_locus_tag="Rahaq2_0335"
     CDS             364391..364783
                     /locus_tag="RAHAQ2_RS01615"
                     /old_locus_tag="Rahaq2_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411535.1"
                     /note="in Escherichai coli the heterohexameric TusBCD
                     complex is involved in sulfur related that results in
                     thiouridation to U34 position in some tRNAs; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur transfer complex subunit TusD"
                     /protein_id="WP_014333583.1"
                     /db_xref="GI:504099589"
                     /translation="MKLRYCLLVTGPAYGTQQASAAYQFALALISSGHHLDSVFFYRE
                     GVLNGNLLSAPASDEFDLVRSWQRMAADYQVALNVCVAAALRRGVIDETEAHNQGHGQ
                     TNLQPGFTLTGLGSLAEASLTCDRLVQF"
     gene            364806..365165
                     /locus_tag="RAHAQ2_RS01620"
                     /old_locus_tag="Rahaq2_0336"
     CDS             364806..365165
                     /locus_tag="RAHAQ2_RS01620"
                     /old_locus_tag="Rahaq2_0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur relay protein TusC"
                     /protein_id="WP_014333584.1"
                     /db_xref="GI:504099590"
                     /translation="MKKIAFVFTQGPHGTSAGREGLDALLATSALTEDIGVFFMSDGV
                     FQLMPAQQPEKILARNYIATFGVLSLYDVDQCFVCEESLKTRGLSAGHEWVLDVEPLP
                     VAEIRQRLADYDVVMTF"
     gene            365179..365466
                     /locus_tag="RAHAQ2_RS01625"
                     /old_locus_tag="Rahaq2_0337"
     CDS             365179..365466
                     /locus_tag="RAHAQ2_RS01625"
                     /old_locus_tag="Rahaq2_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur transfer complex subunit TusB"
                     /protein_id="WP_014333585.1"
                     /db_xref="GI:504099591"
                     /translation="MLFTLASSPQQCDFSLLINMITQDDALLLMQDGVLAAVDGSEAC
                     NLMSQHVQSVYVLSEDLAARGLVGQISHKITLIDYTGFVALTEKHAQQTAW"
     gene            365610..365984
                     /locus_tag="RAHAQ2_RS01630"
                     /old_locus_tag="Rahaq2_0338"
     CDS             365610..365984
                     /locus_tag="RAHAQ2_RS01630"
                     /old_locus_tag="Rahaq2_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009638963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_013573668.1"
                     /db_xref="GI:503339007"
                     /translation="MATINQLVRKPRSTKVAKSNVPALEACPQKRGVCTRVYTTTPKK
                     PNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGAL
                     DCSGVKDRKQSRSKYGVKKPKS"
     gene            366081..366551
                     /locus_tag="RAHAQ2_RS01635"
                     /old_locus_tag="Rahaq2_0339"
     CDS             366081..366551
                     /locus_tag="RAHAQ2_RS01635"
                     /old_locus_tag="Rahaq2_0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001742319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_005969574.1"
                     /db_xref="GI:492805484"
                     /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVY
                     TALETLAQRSGKGHLEAFEVALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
                     WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFAHYRW"
     gene            366648..368762
                     /gene="fusA"
                     /locus_tag="RAHAQ2_RS01640"
                     /old_locus_tag="Rahaq2_0340"
     CDS             366648..368762
                     /gene="fusA"
                     /locus_tag="RAHAQ2_RS01640"
                     /old_locus_tag="Rahaq2_0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020455498.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_014333586.1"
                     /db_xref="GI:504099592"
                     /translation="MARKTPIERYRNIGISAHIDAGKTTTTERVLFYTGVNHKIGEVH
                     DGAATMDWMEQEQERGITITSAATTCFWSGMAKQFEPHHINIIDTPGHVDFTIEVERS
                     MRVLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVDQIEK
                     RLGATPVPLQLAIGAEEKFTGVVDLVKMKAINWNEADQGVTFEYEEIPANMQELAEEW
                     RQKLVESAAEGSDELMEKFFGGEELTEEEIKASLRKRVLNNEIILVTCGSAFKNKGVQ
                     AMLDAVVEYLPAPTDVEAINGLLDDGKDTPAVRHSDDSEPFSALAFKIATDPFVGNLT
                     FFRVYSGLVNSGDTVFNPVKSQRERLGRIVQMHANKREEIKEVRAGDIAAAIGLKDVT
                     TGDTLCDPDNVIILERMEFPEPVISVAVEPKTKADQEKMGLALGRLAKEDPSFRVWTD
                     EESGQTIIAGMGELHLDILVDRMRREFNVEANVGKPQVAYREAIRAKVTDVEGKHAKQ
                     SGGRGQYGHVVIDMYPLEPGTNPKGYEFVNEIKGGVIPGEFIGAIDKGIQEQLKSGPL
                     AGYPVVDLGVRLHFGSYHDVDSSELAFKLAASIAFKDGFKKAKPVLLEPIMKVEVETP
                     EENTGDVIGDLSRRRGMLKGQESNATGVVIHAEVPLSEMFGYATQLRSLTKGRASYSM
                     EFLKYDDAPNNVALAVIEARGK"
     gene            368834..370018
                     /gene="tuf"
                     /locus_tag="RAHAQ2_RS01645"
                     /old_locus_tag="Rahaq2_0341"
     CDS             368834..370018
                     /gene="tuf"
                     /locus_tag="RAHAQ2_RS01645"
                     /old_locus_tag="Rahaq2_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A8GKK1.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_013573670.1"
                     /db_xref="GI:503339009"
                     /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYMIVFMNKCDMVDDEELLELVEMEVRELLSA
                     YEFPGDDIPVIKGSALKALEGDATWEAKIIELAEALDSYIPLPERAIDKPFLLPIEDV
                     FSISGRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVG
                     VLLRGIKREDIERGQVLAKPGSIKPHTKFDSEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNVNMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IA"
     gene            370304..>371884
                     /locus_tag="RAHAQ2_RS01650"
     CDS             370304..>371884
                     /locus_tag="RAHAQ2_RS01650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333587.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide degrading enzyme"
                     /protein_id="WP_037040669.1"
                     /db_xref="GI:739176695"
                     /translation="MKLKYIASLIALSLISTSAMAKLKANDDTNQMEGTNGETMMRSN
                     DNGKTWFHFETTKDGESYGLNNNFPGTQTVIVANEMYPVMNTPAWDASQTYSKPDNKV
                     RYDGYFWTNQWWAGPEQVPGVDDVWKKGEPTNLQSNILGTFYFTPWTGEKAEQFQAES
                     KAQVASQRKIIGYFPEWGVYDAHNNFTPDKINMSNLTHVNYGFAVIKNGIVEMHDAEK
                     APQLIPELVGRTSTQGRRLMISFGGWDNSQEGAFEAATATSAGSEKLAQSMVDYMLKW
                     HFDGIDVDWEYPDNEQEKAQFTQLIQLLRSKLDSVGLQNDKYFQLSAAVTTSYKNMEF
                     INPTVTTPLLDSVNVMAYDIHGAFDPITGHNAPLFANSKDTDTKLNDAYAMKEYNQTY
                     GVPKSKLMMGLAFYGRAWGEVEPTIIVPGLPGLFVPGNATVKGAWDDVGQTTGTNPYY
                     LLKDWAKNPAFTRYYDTEARVPYLYNAQTKEFFTYDDEQSIREKVDYIQSEGFGGAII
                     WDLSGDTPDYDLGNIAKDI"
     gene            372959..373438
                     /locus_tag="RAHAQ2_RS01655"
                     /old_locus_tag="Rahaq2_0344"
     CDS             372959..373438
                     /locus_tag="RAHAQ2_RS01655"
                     /old_locus_tag="Rahaq2_0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333589.1"
                     /note="iron storage protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="WP_014333589.1"
                     /db_xref="GI:504099595"
                     /translation="MKGDKKVIAHLNKLLGNELVAINQYFLHARMFKNWGLMRLNGIE
                     YHESIDEMKHADIYIERILFLEGLPNLQDLGKLNIGEDVEEMLKSDLLLELEGAKDLR
                     EGIAYADSVHDYVSRDLMITILADEEHHIDWLETELELIGRIGIQNYIQSQLKEESQ"
     gene            complement(373450..374262)
                     /locus_tag="RAHAQ2_RS01660"
                     /old_locus_tag="Rahaq2_0345"
     CDS             complement(373450..374262)
                     /locus_tag="RAHAQ2_RS01660"
                     /old_locus_tag="Rahaq2_0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_037040667.1"
                     /db_xref="GI:739176693"
                     /translation="MAYITSLPGGFYHTCITLLGLLMGSFLNVAVYRLPLMIRNDERK
                     AENSFNLSFPASHCPTCKHPLQYWQNIPVLSWLLLRGKCHYCETTISKRYPLTEAGCA
                     VMFLGLSFLFTTPLSLFSALLLFWFLLALSLIDLATYLLPDRLTLPLLWAGLLIHSLY
                     GNVTLQDALYGAVAGYLVLWFLYQAVKFVSGKEGMGYGDFKLLAALGAWVGWQMLPYL
                     CIFAALTGIVFTLARVGLYKMSEQTPFGPCLALAGALIYISQESKIIWLMLS"
     gene            complement(374301..374759)
                     /locus_tag="RAHAQ2_RS01665"
                     /old_locus_tag="Rahaq2_0346"
     CDS             complement(374301..374759)
                     /locus_tag="RAHAQ2_RS01665"
                     /old_locus_tag="Rahaq2_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein M"
                     /protein_id="WP_014333591.1"
                     /db_xref="GI:504099597"
                     /translation="MKQWLMLKNERERWLILIAAFLLAVTCLWYGILTPLNNRIAQSR
                     ARINTQHHQLEWMVQQTQRLGTPSGWRTQKDKLTEAINTSATRLSLQLPQLLADDRGI
                     TLSYEQISYPELLRWLEVLNKEYGIQVVAITIVAGTGEKGSVKVSQLILR"
     gene            complement(374756..375931)
                     /locus_tag="RAHAQ2_RS01670"
                     /old_locus_tag="Rahaq2_0347"
     CDS             complement(374756..375931)
                     /locus_tag="RAHAQ2_RS01670"
                     /old_locus_tag="Rahaq2_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein L"
                     /protein_id="WP_014333592.1"
                     /db_xref="GI:504099598"
                     /translation="MEQLHPANRLFIRAGTTPERSLYWFTDKAECDEDIHCLQDTEHL
                     SELATQPAAQNICLFIPASEVIFRQIALPQRASKITRQMIGYLTEESIASDVDTLHWV
                     ELYREEQTLFVAGIESDYLRNWLQRFSDAGLTIKHVYIDALLLPRHEKGWTIMKLDEQ
                     WLLRQSEYSGSQIEQVLLDTLLKIAMPETLHYYGDEKEIPPDWVRADLPFHPLIMMKN
                     NCPSAVNLLQGEFAVRQEEPAWGRHMQRVATSMAILTVIVIIGAKLFTWWHVSQQESL
                     LKNEMLVLHQTWFPQDKHTRNLKFYFEQNMKKAPTAFLPALAKLTAYQGEIPQIAIDK
                     LDFQQETKQFILQITTDDQAAIDDFVERTDSDFHFAISNLATSPTGITATLTQRSKS"
     gene            complement(375932..376918)
                     /locus_tag="RAHAQ2_RS01675"
                     /old_locus_tag="Rahaq2_0348"
     CDS             complement(375932..376918)
                     /locus_tag="RAHAQ2_RS01675"
                     /old_locus_tag="Rahaq2_0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein"
                     /protein_id="WP_014333593.1"
                     /db_xref="GI:504099599"
                     /translation="MNKQQGVALLIVLMILAIMAALAAKMTLQFQVSQQRQSWLLNQQ
                     QLRWLTFAAEEIALPRLKKALTENPDQNNLDQFAVQEGHFTGQDGFSVDYIINDGQNC
                     FNLNSLRNNEPDSATEGEPYNTQVLKQLLLNAQATSVETERFADTLSDYLDADNETRT
                     AGAESEYYETLIVPRSAANQRLFSLNELALLPELPLLPLKQIRHQLCTLPEEFQQINV
                     NTLTEEQASLLSALFLGGINQEDATKLISARPRRGWVSVDAFLKEAKKQRFTLEIQSS
                     ELKPLLTVRSQYFVLYTLGRFEEQQNAMTSFVQFNPKDSKIKIYQRRYRVIE"
     gene            complement(376911..377594)
                     /locus_tag="RAHAQ2_RS01680"
                     /old_locus_tag="Rahaq2_0349"
     CDS             complement(376911..377594)
                     /locus_tag="RAHAQ2_RS01680"
                     /old_locus_tag="Rahaq2_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein J"
                     /protein_id="WP_014333594.1"
                     /db_xref="GI:504099600"
                     /translation="MNSQQAAKQQGFTLIEVMIAMAIFALLSLLAYQILSASLKNSEM
                     AQEHTARLTEIQTAFSLLERDLTQILPRQTDEEEAFLSASETSLSFTTISSDSASAPL
                     SASDLTRATWTFTDHTLTRSAQALPSPPLTDLSPLIPFTLLTGVKSLHWRFYSSDWTN
                     SWSKPDTFPKVIELVVTLEDMGEIRRLFLLPQTIEETKAESVDNPSEQTGSEAAAPIP
                     LNGESAINE"
     gene            complement(377591..377980)
                     /locus_tag="RAHAQ2_RS01685"
                     /old_locus_tag="Rahaq2_0350"
     CDS             complement(377591..377980)
                     /locus_tag="RAHAQ2_RS01685"
                     /old_locus_tag="Rahaq2_0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein I"
                     /protein_id="WP_014333595.1"
                     /db_xref="GI:504099601"
                     /translation="MRISSTRSAKNQQGMTLIEVIIALGIFATAALALLNSMSSQMSA
                     VDHFRTSLFASWVAENTLIEAQIKLGKKEKEHVTLAGQQWFVEQQYALDRENKIRQNQ
                     VRVLQAEDARLPILSVSSWTQIMAEKP"
     gene            complement(377980..378501)
                     /locus_tag="RAHAQ2_RS01690"
                     /old_locus_tag="Rahaq2_0351"
     CDS             complement(377980..378501)
                     /locus_tag="RAHAQ2_RS01690"
                     /old_locus_tag="Rahaq2_0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein H"
                     /protein_id="WP_014333596.1"
                     /db_xref="GI:504099602"
                     /translation="MSAAKQSGFTLLEILMVLAIFAIAAGVVIMVLPSDNSQIQRAEQ
                     MKTVMEYASERAVLEGKPLGLSLTASAYRFVVLGGTLPLIPQTREPQWEEIKSSRMPV
                     SGKLSENEILSLSPLALNKSINLPPQIVFMPDGTLSVFELSFSSSASEPACCSIISEG
                     RQPLIFNVRRSEK"
     gene            complement(378504..378959)
                     /locus_tag="RAHAQ2_RS01695"
                     /old_locus_tag="Rahaq2_0352"
     CDS             complement(378504..378959)
                     /locus_tag="RAHAQ2_RS01695"
                     /old_locus_tag="Rahaq2_0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein G"
                     /protein_id="WP_014333597.1"
                     /db_xref="GI:504099603"
                     /translation="MLNIQKYHHVTSKKQQGFTLIELMVVIVILGVLAALVVPNVMGN
                     KERADTQKAISDIVALENALDMYKLDNHRYPTTEQTLEALVTLPTLNPLPANYRNDGY
                     IKRLPADPWGNEYMLVSPGEHGTIDVFSAGPDSEPNTADDIKNWVEKDH"
     gene            complement(378972..380189)
                     /locus_tag="RAHAQ2_RS01700"
                     /old_locus_tag="Rahaq2_0353"
     CDS             complement(378972..380189)
                     /locus_tag="RAHAQ2_RS01700"
                     /old_locus_tag="Rahaq2_0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein F"
                     /protein_id="WP_014333598.1"
                     /db_xref="GI:504099604"
                     /translation="MSRFSFHAISPTGKAQRGVIDADSLRLARQMVRERGLTLLEIKQ
                     VGNSLTAINNKNKGLKTRVPSHAVSLFSRQLATLTHAALPVEAALAVIARQTEHAGLT
                     QVLTAVRNKVVEGHTLADALSDFPRIFDPMFRTLVTAGERTGQLGTVLEKMADYYEIR
                     QQIKSKLSQAMIYPAMLTFVAILVIVILLVAVVPQIIEQFVHMKHTLPITTRILIGVS
                     GFLGRAWWLIAIVLIAVIGIFRLALRRKHNLMRFHTALLGVAVLGPLIRAINSARYAR
                     TLSILQSSGVPLLDAMKISTEGITNLRIHYLLTQAAEHVRQGSSLFAVLEQTRLFPPM
                     MLYMIASGEQSGRLGELMAHAADNQDKLMQHRLSMVLALFEPLLIVTMASIVLFIIMS
                     ILQPILQLNNLVS"
     gene            complement(380186..381712)
                     /locus_tag="RAHAQ2_RS01705"
                     /old_locus_tag="Rahaq2_0354"
     CDS             complement(380186..381712)
                     /locus_tag="RAHAQ2_RS01705"
                     /old_locus_tag="Rahaq2_0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system protein E"
                     /protein_id="WP_014333599.1"
                     /db_xref="GI:504099605"
                     /translation="MNRDNELLNRPVVEHAAPVLPYTYAKQKGVTLLDNVLFCRQDIS
                     VETLLEARRVMGEIMAVEIVETTLFDEKLSATYQRSSGQSQQIIDDIDNEVDLLSLSE
                     ELPDNEDLLASDENSPIIRLINAVLSEAVKEGASDIHIETFERTLSIRFRIDGVLRQI
                     LQPARKLAPFLVSRIKVMAKLDIAEKRLPQDGRISLRIGHRAIDIRVSTIPAQYGERV
                     VMRLLDKNNLCLDIPQLGLSPQDEQQLSALIHKPHGIILVTGPTGSGKSTTLYAVLSA
                     LNNNERNILTVEDPIEYELEGVGQTQVNPRVEMTFALGLRAILRQDPDVVMVGEIRDN
                     ETAQIAVQASLTGHLVMSTLHTNSAVGAITRLRDMGLEPFLLASSLLGVVAQRLVRRL
                     CPHCSQQSPLDASHIPLFHFLPEPPPFVFKASGCSQCHFTGYKGRAAIHECMVVDNAI
                     RQAIHENQDEFSIENIHRKTARSLRENGLLKAISGETTLEEVIRVTAEQEIAAGGTTS
                     "
     gene            complement(381716..383701)
                     /locus_tag="RAHAQ2_RS01710"
                     /old_locus_tag="Rahaq2_0355"
     CDS             complement(381716..383701)
                     /locus_tag="RAHAQ2_RS01710"
                     /old_locus_tag="Rahaq2_0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein D"
                     /protein_id="WP_014333600.1"
                     /db_xref="GI:504099606"
                     /translation="MKKFINPLLVKACILCATLPWIVHAEEFTASFKGTDIKEFIDTI
                     SKNLNKTILIDPSVQGTISVRSYDVLNEEQYYQFFLSVLDVYGFAVIPMDNGLLKVVR
                     SANAKMSGVPVADKNRPGKGDEIVTRVVTLLNVPVRELAPLLRQMNDSTGVGSVVHYE
                     PSNVLLLTGRASVVNRLINLVERVDSMGDQQRQTIKLKYASAPEMAEMMNNLIREESK
                     GQSSSILQAKIVADERTNTLIVSGPENVRSRAAKLVNQLDKDQSSQGNTRVFYLKYAK
                     AEKIVPVLTGITQEMKEGKTAQPSTASNNPMSITADEQTNSIVITAQQDVMQSLEQVI
                     TKLDIRRAQVLVEAIIVEVQDGNGLNLGIQWSNNQVGGTQFTGTGAPLSTVAAGVRQY
                     KKEGVISSDNPLSSTLQTFNGMTAGFFSGDWNVLLTALSTSNKNDILATPSIVTLDNK
                     EASFNVGQEVPSLSGSQTTSGDNIYSSVVYKTVGTKLKVTPQINEGDSVLMEIEQEVS
                     SVDTSTNSSLGPTFNTRTISNAVLVRTGETVVLGGLLDDSTKETKSKVPLLGDIPWIG
                     NLFRYTSTESAKRNLMVFIRPTIIRDDEVYSSISNKKYSHFQKLQKTRQDEDHQDLLT
                     PNTRAVLPDYPAPENSSPKTSLSTMPDNDKPRNPFSG"
     gene            complement(383685..384518)
                     /locus_tag="RAHAQ2_RS01715"
                     /old_locus_tag="Rahaq2_0356"
     CDS             complement(383685..384518)
                     /locus_tag="RAHAQ2_RS01715"
                     /old_locus_tag="Rahaq2_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein C"
                     /protein_id="WP_014333601.1"
                     /db_xref="GI:504099607"
                     /translation="MYAAWNKWHWPNISLKIGMLIVITFMCTIICCSTIAITVLNSWE
                     KSVITPKASGNTKMLINIHGTLFDKRRKAVIKETTQSPVTSVKLPLILKGVLTSTETR
                     RSLAILQGPSGQHSYREGEKLADVENAFLQSVKPDEVLIRTPGGTAILYLNDKPRDDK
                     RPEPQKEKVSREHAKYLMHYLVANPIYKDEKLTGYRFNPRTSSNIYLRAGLIPDEFVV
                     KINGQSLDDAVTADKYIEQLANLRDVQLTVLRENQVQNIYINLATIETSLDTESHEEV
                     H"
     gene            384719..386239
                     /locus_tag="RAHAQ2_RS01720"
                     /old_locus_tag="Rahaq2_0357"
     CDS             384719..386239
                     /locus_tag="RAHAQ2_RS01720"
                     /old_locus_tag="Rahaq2_0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein"
                     /protein_id="WP_014333602.1"
                     /db_xref="GI:504099608"
                     /translation="MYCDHFNFVTFPFLEGNYFNNIRLLAAQDFILQKLNQGGIAIIG
                     GNKGVGKTRLAHEVARQSQRRVLNLSAAPLNGADGENLGQLLACCFHLKKWRTLPASI
                     LPLRIAETFDQNEYSTQPWLVVVDNAENLSVESYEFLRTFKSYPQSSCVSFLLVEERK
                     GDSGDRKRCRRLFPHTDYHLLPMSFAETSDYLSQRLQSSGGEAAVIPGPVAKLLHNAS
                     GGRIQLINALAADSLNSAYAEKTSSVTYRQMKICTEAWGLTPGRKKCITLLIACYMLF
                     GGMLGWTYYNYAKSYLPLPLTFSEKLHEIPAAAKTLSDVGSNERNGMRQLFQVWGYDV
                     PTDDAFCDQAIRAQLTCKKGKATLETLLQEGIPWLSPITADKRTVYVTVVKVTDETLD
                     VLIKDETWTVQRSWFNEVWGGEYIQLFPQTPSGKNVINNTSPEADTAWLDMTLSKILN
                     LPFSKTGQWDNDLIGKIKLFQQREDLIVDGRVGKGTLMQIAKRTGNMPVLLTKEEL"
     gene            386247..386732
                     /locus_tag="RAHAQ2_RS01725"
                     /old_locus_tag="Rahaq2_0358"
     CDS             386247..386732
                     /locus_tag="RAHAQ2_RS01725"
                     /old_locus_tag="Rahaq2_0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333603.1"
                     /db_xref="GI:504099609"
                     /translation="MQNIHLSAYVSHLNKQKVKVAAHHQLRKSLYCVVLSGLCLFAGA
                     LAGSYLHIIYLNWQGYRIEISEESHLPYQQSALHYIYKNKELPAVSQTAYIDDNENAE
                     GELPEDTSPMENETLEEAPADESDESQIIKLDEGSPDMPLQEWLKKAMLEQQQEEKSA
                     K"
     gene            386967..387278
                     /gene="rpsJ"
                     /locus_tag="RAHAQ2_RS01730"
                     /old_locus_tag="Rahaq2_0359"
                     /gene_synonym="nusE"
     CDS             386967..387278
                     /gene="rpsJ"
                     /locus_tag="RAHAQ2_RS01730"
                     /old_locus_tag="Rahaq2_0359"
                     /gene_synonym="nusE"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014268624.1"
                     /note="NusE; involved in assembly of the 30S subunit; in
                     the ribosome, this protein is involved in the binding of
                     tRNA; in Escherichia coli this protein was also found to
                     be involved in transcription antitermination; NusB/S10
                     heterodimers bind boxA sequences in the leader RNA of rrn
                     operons which is required for antitermination; binding of
                     NusB/S10 to boxA nucleates assembly of the antitermination
                     complex; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_009639175.1"
                     /db_xref="GI:497324962"
                     /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPT
                     RKERFTILISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL
                     G"
     gene            387312..387941
                     /locus_tag="RAHAQ2_RS01735"
                     /old_locus_tag="Rahaq2_0360"
     CDS             387312..387941
                     /locus_tag="RAHAQ2_RS01735"
                     /old_locus_tag="Rahaq2_0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3YWT9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_013573687.1"
                     /db_xref="GI:503339026"
                     /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKDLDNDG
                     YRAVQVTTGSKKANRVTKPEAGHFAKAGVEAGRGLWEFRLAEGEEFTAGQNISVEIFA
                     DVKKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKK
                     MAGQLGNERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA"
     gene            387958..388563
                     /gene="rplD"
                     /locus_tag="RAHAQ2_RS01740"
                     /old_locus_tag="Rahaq2_0361"
     CDS             387958..388563
                     /gene="rplD"
                     /locus_tag="RAHAQ2_RS01740"
                     /old_locus_tag="Rahaq2_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010304939.1"
                     /note="L4 is important during the early stages of 50S
                     assembly; it initially binds near the 5' end of the 23S
                     rRNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_013573688.1"
                     /db_xref="GI:503339027"
                     /translation="MELVVKDAQSALTVSETTFGRDFNEALVHQVVVAYAAGARQGTR
                     AQKTRAEVTGSGKKPWRQKGTGRARSGSVKSPIWRSGGVTFAAKPQDHSQKVNKKMYR
                     GALKSILSELVRQDRLIVVETFSVEAPKTKLLAQKLKDMALEDVLIVTGEVDENLFLA
                     ARNLYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
     gene            388560..388862
                     /gene="rplW"
                     /locus_tag="RAHAQ2_RS01745"
                     /old_locus_tag="Rahaq2_0362"
     CDS             388560..388862
                     /gene="rplW"
                     /locus_tag="RAHAQ2_RS01745"
                     /old_locus_tag="Rahaq2_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006709774.1"
                     /note="binds third domain of 23S rRNA and protein L29;
                     part of exit tunnel; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_013573689.1"
                     /db_xref="GI:503339028"
                     /translation="MIREERLLKVLRAPHVSEKASTAMEKNNTIVLKVAKDATKAEIK
                     AAVSKLFEVEVEDVNTLLVKGKVKRHGQRVGRRSDWKKAYVTLKEGQNLDFISGAE"
     gene            388881..389705
                     /locus_tag="RAHAQ2_RS01750"
                     /old_locus_tag="Rahaq2_0363"
     CDS             388881..389705
                     /locus_tag="RAHAQ2_RS01750"
                     /old_locus_tag="Rahaq2_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P60436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_013573690.1"
                     /db_xref="GI:503339029"
                     /translation="MAIVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKLSKSGGRN
                     NNGRITTRHIGGGHKQHYRLVDFKRNKDGIAAVVERLEYDPNRSANIALVLYKDGERR
                     YILAPKGLKVGDQIQSGVDAAIKTGNTLPMRNIPVGSTVHNVEMKPGKGGQMARSAGA
                     YVQIVARDGSYVTLRLRSGEMRKVQVDCRATLGEVGNSEHMLRVLGKAGAARWRGIRP
                     TVRGTAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSKK"
     gene            389720..389998
                     /locus_tag="RAHAQ2_RS01755"
                     /old_locus_tag="Rahaq2_0364"
     CDS             389720..389998
                     /locus_tag="RAHAQ2_RS01755"
                     /old_locus_tag="Rahaq2_0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MYF5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_004929772.1"
                     /db_xref="GI:491068142"
                     /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNM
                     IGLTIAVHNGRQHVPVFVSDEMVGHKLGEFAPTRTYRGHAADKKAKKR"
     gene            390013..390345
                     /locus_tag="RAHAQ2_RS01760"
                     /old_locus_tag="Rahaq2_0365"
     CDS             390013..390345
                     /locus_tag="RAHAQ2_RS01760"
                     /old_locus_tag="Rahaq2_0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000447526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_004391423.1"
                     /db_xref="GI:490526113"
                     /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLAYTNKKAA
                     GLVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSH
                     ITVVVSDR"
     gene            390363..391061
                     /locus_tag="RAHAQ2_RS01765"
                     /old_locus_tag="Rahaq2_0366"
     CDS             390363..391061
                     /locus_tag="RAHAQ2_RS01765"
                     /old_locus_tag="Rahaq2_0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001742302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_013573691.1"
                     /db_xref="GI:503339030"
                     /translation="MGQKVHPNGIRLGIVKPWNSTWYANTKDFADNLDGDFKVRQFLT
                     KELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQIN
                     IAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGA
                     EIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPE
                     PAAQPKKQQRKGRK"
     gene            391074..391484
                     /locus_tag="RAHAQ2_RS01770"
                     /old_locus_tag="Rahaq2_0367"
     CDS             391074..391484
                     /locus_tag="RAHAQ2_RS01770"
                     /old_locus_tag="Rahaq2_0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017805229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_009639183.1"
                     /db_xref="GI:497324970"
                     /translation="MLQPKRTKFRKVHKGRNRGLAQGTDVSFGTYGLKAVGRGRLTAR
                     QIEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVL
                     YEMDGVPEELAREAFQLAAAKLPIKTTFVTKTVM"
     gene            391484..391675
                     /locus_tag="RAHAQ2_RS01775"
                     /old_locus_tag="Rahaq2_0368"
     CDS             391484..391675
                     /locus_tag="RAHAQ2_RS01775"
                     /old_locus_tag="Rahaq2_0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003850146.1"
                     /note="one of the stabilizing components for the large
                     ribosomal subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_013573692.1"
                     /db_xref="GI:503339031"
                     /translation="MKAQELREKSVEELNTELLNLLREQFNLRMQTASGQLQQTHLLK
                     QVRRDVARVKTLLTEKAGA"
     gene            391675..391929
                     /locus_tag="RAHAQ2_RS01780"
                     /old_locus_tag="Rahaq2_0369"
     CDS             391675..391929
                     /locus_tag="RAHAQ2_RS01780"
                     /old_locus_tag="Rahaq2_0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006817275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_014333604.1"
                     /db_xref="GI:504099610"
                     /translation="MTDKIRTLQGRVISDKMEKSIVVAIERVVKHPIYGKFIKRTTKL
                     HVHDENNECGIGDVVEISECRPLSKTKSWTLVRVVEKAIL"
     gene            392100..392471
                     /locus_tag="RAHAQ2_RS01785"
                     /old_locus_tag="Rahaq2_0370"
     CDS             392100..392471
                     /locus_tag="RAHAQ2_RS01785"
                     /old_locus_tag="Rahaq2_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006328460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_008457164.1"
                     /db_xref="GI:495732585"
                     /translation="MIQEQTMLTVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIK
                     EAIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNSEQPIGTRIFGP
                     VTRELRNEKFMKIISLAPEVL"
     gene            392482..392796
                     /gene="rplX"
                     /locus_tag="RAHAQ2_RS01790"
                     /old_locus_tag="Rahaq2_0371"
     CDS             392482..392796
                     /gene="rplX"
                     /locus_tag="RAHAQ2_RS01790"
                     /old_locus_tag="Rahaq2_0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013204127.1"
                     /note="assembly initiator protein; binds to 5' end of 23S
                     rRNA and nucleates assembly of the 50S; surrounds
                     polypeptide exit tunnel; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_013573694.1"
                     /db_xref="GI:503339033"
                     /translation="MAAKIRRDDEVILLTGKDKGKRGKVKNVLSSGKVIVEGINLVKK
                     HQKPVPALNQPGGIVEKEAAIPVSNVALFNTATGKADRVGFRFEDGKKVRFFKSNSVT
                     IK"
     gene            392811..393350
                     /locus_tag="RAHAQ2_RS01795"
                     /old_locus_tag="Rahaq2_0372"
     CDS             392811..393350
                     /locus_tag="RAHAQ2_RS01795"
                     /old_locus_tag="Rahaq2_0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P46178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_013573695.1"
                     /db_xref="GI:503339034"
                     /translation="MAKLHDYYKDDVVKKLMAEFGYNSVMQVPRVEKITLNMGVGEAI
                     ADKKLLDNAAADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFER
                     LVSIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
                     KSDDEGRALLTAFNFPFRK"
     gene            393364..393669
                     /gene="rpsN"
                     /locus_tag="RAHAQ2_RS01800"
                     /old_locus_tag="Rahaq2_0373"
     CDS             393364..393669
                     /gene="rpsN"
                     /locus_tag="RAHAQ2_RS01800"
                     /old_locus_tag="Rahaq2_0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004160578.1"
                     /note="located in the peptidyl transferase center and
                     involved in assembly of 30S ribosome subunit; similar to
                     what is observed with proteins L31 and L33, some proteins
                     in this family contain CXXC motifs that are involved in
                     zinc binding; if two copies are present in a genome, then
                     the duplicated copy appears to have lost the zinc-binding
                     motif and is instead regulated by zinc; the proteins in
                     this group do not appear to have the zinc-binding motif;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="WP_013573696.1"
                     /db_xref="GI:503339035"
                     /translation="MAKQSMKAREVVRVKLADKYRAKREELKAIISGVNSSDEDRWDA
                     VLKLQSLPRDSSPSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW"
     gene            393703..394095
                     /locus_tag="RAHAQ2_RS01805"
                     /old_locus_tag="Rahaq2_0374"
     CDS             393703..394095
                     /locus_tag="RAHAQ2_RS01805"
                     /old_locus_tag="Rahaq2_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MYG5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_013573697.1"
                     /db_xref="GI:503339036"
                     /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEG
                     YIEEFKIEGDAKPELELVLKYFQGKAVVESIQRISRPGLRIYKKKDELPKVMAGMGIA
                     VISTSKGVMTDRAARQAGLGGEIICYVA"
     gene            394109..394642
                     /locus_tag="RAHAQ2_RS01810"
                     /old_locus_tag="Rahaq2_0375"
     CDS             394109..394642
                     /locus_tag="RAHAQ2_RS01810"
                     /old_locus_tag="Rahaq2_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004926436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_013573698.1"
                     /db_xref="GI:503339037"
                     /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELSRTIHDAVVVK
                     QEENTLTFAPREGAVDGWAQAGTTRALLNSMVVGVTDGFTKKLQLVGVGYRAAVKGNV
                     VNLALGFSHPVDHQLPEGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGK
                     GVRYADEVVRTKEAKKK"
     gene            394652..395005
                     /locus_tag="RAHAQ2_RS01815"
                     /old_locus_tag="Rahaq2_0376"
     CDS             394652..395005
                     /locus_tag="RAHAQ2_RS01815"
                     /old_locus_tag="Rahaq2_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6CZY6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_013573699.1"
                     /db_xref="GI:503339038"
                     /translation="MDKKSARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNG
                     SEVIVAASTVEKTITEQLKYTGNKDAATAVGKAIAERALEKGITKVSFDRSGFQYHGR
                     VQALADAAREAGLQF"
     gene            395020..395520
                     /locus_tag="RAHAQ2_RS01820"
                     /old_locus_tag="Rahaq2_0377"
     CDS             395020..395520
                     /locus_tag="RAHAQ2_RS01820"
                     /old_locus_tag="Rahaq2_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005290366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_013573700.1"
                     /db_xref="GI:503339039"
                     /translation="MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNG
                     RVGFGYGKAREVPAAIQKAMEKARRNMMNVALNSGTLQHPVKGAHTGSRVFMQPASEG
                     TGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDALANMKSPQMVAAKRGKS
                     VEEILG"
     gene            395527..395706
                     /gene="rpmD"
                     /locus_tag="RAHAQ2_RS01825"
                     /old_locus_tag="Rahaq2_0378"
     CDS             395527..395706
                     /gene="rpmD"
                     /locus_tag="RAHAQ2_RS01825"
                     /old_locus_tag="Rahaq2_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A8GKH9.1"
                     /note="L30 binds domain II of the 23S rRNA and the 5S
                     rRNA; similar to eukaryotic protein L7; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_013573701.1"
                     /db_xref="GI:503339040"
                     /translation="MAKTIKVTQTRSSIGRLPKHKATLLGLGLRRIGHTVEREDTPAV
                     RGMINLVSYMVKVEE"
     gene            395710..396144
                     /locus_tag="RAHAQ2_RS01830"
                     /old_locus_tag="Rahaq2_0379"
     CDS             395710..396144
                     /locus_tag="RAHAQ2_RS01830"
                     /old_locus_tag="Rahaq2_0379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014462226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_013573702.1"
                     /db_xref="GI:503339041"
                     /translation="MRLNTLSPADGAKQAPRRVGRGIGSGLGKTGGRGHKGQNSRSGG
                     GVRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNALKAANVVG
                     IQIEFAKVILSGEVGRAVTLRGLRVTKGARVAIEAAGGKIEE"
     gene            396152..397483
                     /gene="secY"
                     /locus_tag="RAHAQ2_RS01835"
                     /old_locus_tag="Rahaq2_0380"
     CDS             396152..397483
                     /gene="secY"
                     /locus_tag="RAHAQ2_RS01835"
                     /old_locus_tag="Rahaq2_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004956156.1"
                     /note="forms heterotrimeric complex in the membrane; in
                     bacteria the complex consists of SecY which forms the
                     channel pore and SecE and SecG; the SecG subunit is not
                     essential; in bacteria translocation is driven via the
                     SecA ATPase; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_014333605.1"
                     /db_xref="GI:504099611"
                     /translation="MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGI
                     DAAVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPAL
                     AEIKKEGEAGRRKISQYTRYGTLVLAVFQSIGIATGLPNMPGMQGLVLNPGFAFYFTA
                     VVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFL
                     LLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIP
                     AIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYATAIIFFCFFYTA
                     LVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLIGAMYITFICLIPEFMR
                     DAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYNR"
     gene            397782..398138
                     /locus_tag="RAHAQ2_RS01840"
                     /old_locus_tag="Rahaq2_0383"
     CDS             397782..398138
                     /locus_tag="RAHAQ2_RS01840"
                     /old_locus_tag="Rahaq2_0383"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014268647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_013573704.1"
                     /db_xref="GI:503339043"
                     /translation="MARIAGINIPDQKHTVIALTSIYGIGKTRSQSICAASGIAENVK
                     ISELSEEQIEKLRDEVAKFIVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRT
                     KTNARTRKGPRKPIKK"
     gene            398156..398545
                     /locus_tag="RAHAQ2_RS01845"
                     /old_locus_tag="Rahaq2_0384"
     CDS             398156..398545
                     /locus_tag="RAHAQ2_RS01845"
                     /old_locus_tag="Rahaq2_0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O54296.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_004929731.1"
                     /db_xref="GI:491068101"
                     /translation="MAKAPVRTRKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGW
                     ATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNA
                     AGFRITNITDVTPIPHNGCRPPKKRRV"
     gene            398576..399196
                     /locus_tag="RAHAQ2_RS01850"
                     /old_locus_tag="Rahaq2_0385"
     CDS             398576..399196
                     /locus_tag="RAHAQ2_RS01850"
                     /old_locus_tag="Rahaq2_0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005134071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_014333606.1"
                     /db_xref="GI:504099612"
                     /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGAR
                     KPRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGENLLQLLEGRLDNVV
                     YRMGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALE
                     LAEQREKPTWLEVDAAKMEGVFKRMPERTDLSSDINEHLIVELYSK"
     gene            399222..400211
                     /locus_tag="RAHAQ2_RS01855"
                     /old_locus_tag="Rahaq2_0386"
     CDS             399222..400211
                     /locus_tag="RAHAQ2_RS01855"
                     /old_locus_tag="Rahaq2_0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001747117.1"
                     /note="catalyzes the transcription of DNA into RNA using
                     the four ribonucleoside triphosphates as substrates.
                     Dimerization of the alpha subunit is the first step in the
                     sequential assembly of subunits to form the holoenzyme;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_002919219.1"
                     /db_xref="GI:489008656"
                     /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALR
                     RILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTL
                     NKSGIGPVTAADITHDGDVEIVKPQHVICHLTDENAAISMRIKVQRGRGYVPASARIH
                     SEEDERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIR
                     RAATILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIH
                     YIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
     gene            400252..400641
                     /gene="rplQ"
                     /locus_tag="RAHAQ2_RS01860"
                     /old_locus_tag="Rahaq2_0387"
     CDS             400252..400641
                     /gene="rplQ"
                     /locus_tag="RAHAQ2_RS01860"
                     /old_locus_tag="Rahaq2_0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573706.1"
                     /note="is a component of the macrolide binding site in the
                     peptidyl transferase center; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_013573706.1"
                     /db_xref="GI:503339045"
                     /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKEL
                     RRVVEPLITLAKTDNVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGF
                     RAGDNAPMAYIELVDRAESKAEVATAE"
     gene            400817..401185
                     /locus_tag="RAHAQ2_RS01865"
     CDS             400817..401185
                     /locus_tag="RAHAQ2_RS01865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040664.1"
                     /db_xref="GI:739176690"
                     /translation="MFLIDQWVEKHINDAQEKGEFENLRGSGRPLILDDDSAVPDELR
                     TSYRILKNAGYLPPELQDRKEAIELDHLLNTLDSDDPKFLPAEKRLKVLQMRLQQAGM
                     NTGFLHGHYENALKDKFRGK"
     gene            401188..401604
                     /gene="zntR"
                     /locus_tag="RAHAQ2_RS01870"
                     /old_locus_tag="Rahaq2_0389"
     CDS             401188..401604
                     /gene="zntR"
                     /locus_tag="RAHAQ2_RS01870"
                     /old_locus_tag="Rahaq2_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333608.1"
                     /note="mediates expression of the zinc export protein ZntA
                     in response to high levels of zinc; member of MerR family
                     of transcriptional regulators; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn(II)-responsive transcriptional regulator"
                     /protein_id="WP_014333608.1"
                     /db_xref="GI:504099614"
                     /translation="MYKIGELARLANVSTDTVRYYEKQGMMSTGARNLSGYRQYDESD
                     VQRLRFIRYAKSTGFTLDAIKELLSIRIDPLHHTCQESKSIVDERLAEVEHKLQELNQ
                     MRESLQRLSAACCGSAHTSVSCSILEALEDGAGKVT"
     gene            401711..401911
                     /locus_tag="RAHAQ2_RS01875"
                     /old_locus_tag="Rahaq2_0390"
     CDS             401711..401911
                     /locus_tag="RAHAQ2_RS01875"
                     /old_locus_tag="Rahaq2_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333609.1"
                     /db_xref="GI:504099615"
                     /translation="MSHYKHQKGVIQDNALQALLHDPLFKQRVEKNEKGKGSYRRKEK
                     NGKRSYLEGSVECLFEYSTLPF"
     gene            complement(401936..402352)
                     /gene="mscL"
                     /locus_tag="RAHAQ2_RS01880"
                     /old_locus_tag="Rahaq2_0391"
     CDS             complement(401936..402352)
                     /gene="mscL"
                     /locus_tag="RAHAQ2_RS01880"
                     /old_locus_tag="Rahaq2_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333610.1"
                     /note="forms homopentamer; channel that opens in response
                     to pressure or hypoosmotic shock; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="large-conductance mechanosensitive channel"
                     /protein_id="WP_014333610.1"
                     /db_xref="GI:504099616"
                     /translation="MSFMKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSFVADIIMPP
                     LGLLIGGVDFKQFAFVLREAQGAAPAVVMHYGVFIQNVFDFIIVALAIFCAITLMNKM
                     RRKQEDKPAAPPKPTAEETLLAEIRDLLKEQQTPKL"
     gene            complement(402465..403841)
                     /gene="trkA"
                     /locus_tag="RAHAQ2_RS01885"
                     /old_locus_tag="Rahaq2_0392"
                     /gene_synonym="sapG"
     CDS             complement(402465..403841)
                     /gene="trkA"
                     /locus_tag="RAHAQ2_RS01885"
                     /old_locus_tag="Rahaq2_0392"
                     /gene_synonym="sapG"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095496.1"
                     /note="involved in potassium uptake; found to be
                     peripherally associated with the inner membrane in
                     Escherichia coli; contains an NAD-binding domain; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter peripheral membrane
                     protein"
                     /protein_id="WP_014333611.1"
                     /db_xref="GI:504099617"
                     /translation="MKIIILGAGQVGGTLAENLVGENNDITVVDTNTVRLRQLQDKFD
                     LRVVQGHGSHPRVLREAGAEDADMLVAVTNSDETNMVACQIAYSLFNTPNRIARIRST
                     EYIRESEKLFHPEAVPIDHLISPEQLVTDYIYKLIEYPGALQVVNFAEGKVSIAAVKA
                     YYGGPLVGNALSSMREHMPHIETRVAAIFRQDRPIRPQGSTIIEAGDEVFFVAASQHI
                     RAVMSELQRLEKPYKRIMIVGGGNVGAGLAQRLEKNYSVKLIERDQQRAAELAEILQD
                     TIVFYGDASDQELLAEEHIEQVDVFIAITNDDEANIMSAMLAKRMGAKKAMVLIQRSA
                     YVDLVQGSVIDIAISPQQATISALLGHVRKADIVSVSSLRRGVAEAIEAIAHGDETTS
                     KVVGRTVEEIKLPPGTTIGAIVRGNEVIIANGTSRIQQGDHVVMFITDKKFVRDVERL
                     FQPSPFFL"
     gene            complement(403902..405191)
                     /locus_tag="RAHAQ2_RS01890"
                     /old_locus_tag="Rahaq2_0393"
     CDS             complement(403902..405191)
                     /locus_tag="RAHAQ2_RS01890"
                     /old_locus_tag="Rahaq2_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333612.1"
                     /note="catalyzes the methylation of cytosine at position
                     967 (m5C967) of 16S rRNA; SAM-dependent methyltransferase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_014333612.1"
                     /db_xref="GI:504099618"
                     /translation="MKTAYNLRSIAAQAISQVLDKGLSLSTVLPGLQKNVSEKDRGLL
                     QELCFGTLRVLPQLEWCLQQLMAKPLTGKQRTLHYLLMVGLYQLIHTRIPAHAVLAET
                     VNGAVALKRPQLKGLINGVLRQFQRQQEELLQRMLNNDSRHLHPSWLFNRLKKAYPDD
                     WENIVDANNQRPPMWLRVNRLHHTRDEYLHLLNESQIEAVPHPEYGDAIRLITPCQVS
                     LLPGFTEGWITVQDASAQGSVDLLDPQNGELILDLCCAPGGKTTHILEAAPKAHVLAV
                     DVDEQRLKRVHENLQRLKLNAEVKQGDGREPQVWAGDRIFDRILLDAPCSATGVIRRH
                     PDIKWLRRDSDIAELASLQKEILHAVWPRLKSKGVMVYATCSILPDENCQQIASFLES
                     HQDATLVETGTMEKPGRQNLPHAEDGDGFYYAKLIKS"
     gene            complement(405267..406202)
                     /gene="fmt"
                     /locus_tag="RAHAQ2_RS01895"
                     /old_locus_tag="Rahaq2_0394"
     CDS             complement(405267..406202)
                     /gene="fmt"
                     /locus_tag="RAHAQ2_RS01895"
                     /old_locus_tag="Rahaq2_0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333613.1"
                     /note="modifies the free amino group of the aminoacyl
                     moiety of methionyl-tRNA(fMet) which is important in
                     translation initiation; inactivation of this gene in
                     Escherichia coli severely impairs growth; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_014333613.1"
                     /db_xref="GI:504099619"
                     /translation="MRIIFAGTPDFAARHLDALLSSEHQVVGVFTQPDRPAGRGNKLT
                     ASPVKVLAQTHDIPVFQPKSLRPEENQSLVSALQADVMVVVAYGLILPKAVLGMPKLG
                     CINVHGSLLPRWRGAAPIQRSLWAGDAKTGITIMQMDVGLDTGNMLHKVECDISPADT
                     SASLYDKLAELGPQGLLETLKQLANGTVKPEVQSEEDVTYAEKLSKEEARLDWNLSAE
                     QLERCIRAFNPWPVSFFMIEEQPVKVWQAECLPGKNSAAPGTIVAADKKGIQIATSDG
                     ILNITQLQPSGKKAMSAQDLLNSRREWFIEGTRLV"
     gene            complement(406228..406740)
                     /locus_tag="RAHAQ2_RS01900"
                     /old_locus_tag="Rahaq2_0395"
     CDS             complement(406228..406740)
                     /locus_tag="RAHAQ2_RS01900"
                     /old_locus_tag="Rahaq2_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_014333614.1"
                     /db_xref="GI:504099620"
                     /translation="MSVLQILHFPDERLRITAKPVKEVNAEIQQIVDDMFETMYAEEG
                     IGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPDQRALVP
                     RAAKVKVRALDRDGKTFELEADDLLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKME
                     KMAKLNARAD"
     gene            406869..408038
                     /locus_tag="RAHAQ2_RS01905"
                     /old_locus_tag="Rahaq2_0396"
     CDS             406869..408038
                     /locus_tag="RAHAQ2_RS01905"
                     /old_locus_tag="Rahaq2_0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA processing protein DprA"
                     /protein_id="WP_014333615.1"
                     /db_xref="GI:504099621"
                     /translation="MTLQEAWIRLSVVKRLDPQRAMGIIQTLFYRGAYSSSELANSEL
                     SPEQIADFQHINQHWLSATLKWLEGENCHLITFSSEFYSPLLAQISSPPLILFAKGAA
                     ELLLSPQIAMVGSRDYTHYGEQYAQVFAGGLVSSGFTVTSGLAMGIDGISHKATLDAQ
                     GKTIAVLGSGLMKCYPSCHLKLAARILEEGGALVSEHLVTAPPLAANFPRRNRVISGL
                     SAGVLVIEATLRSGSLITARYALEQGREVFALPGPLGSATSEGTHWLIQQGAYLVTEP
                     NDIADHIGSGLTWFPNIKAAESLKRPQDSRSTASEAIICASDSEVELPFADVLANVEY
                     EVTSVDVVAERAGQPVPEVVGKLLELELAGWIAAVPGGYVRIKRASHVRRTNVLI"
     gene            408010..408483
                     /locus_tag="RAHAQ2_RS01910"
                     /old_locus_tag="Rahaq2_0397"
     CDS             408010..408483
                     /locus_tag="RAHAQ2_RS01910"
                     /old_locus_tag="Rahaq2_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333616.1"
                     /db_xref="GI:504099622"
                     /translation="MFDVLMYLFETYIHNEAEMNVDEDRLTDDLTEAGFHRADIHNAL
                     NWLEKLADMQEGGTPSYMLDSDPSALRVYTDEETSRLDSSCRGFLLFLEQIKVLNFDT
                     REMVIDRVMALDAEEFDLEDLKWVVLMVLFNIPGYETAYQQMEELLFEVNEGYLH"
     gene            408508..409068
                     /locus_tag="RAHAQ2_RS01915"
                     /old_locus_tag="Rahaq2_0398"
     CDS             408508..409068
                     /locus_tag="RAHAQ2_RS01915"
                     /old_locus_tag="Rahaq2_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333617.1"
                     /db_xref="GI:504099623"
                     /translation="MTKAALFADKQNGSCPECGADLVIRSGRHGPFLSCSSYPQCQYI
                     RPLKSQADGHVVKVLEGQACPKCDSTLVLRQGRYGMFIGCSQYPECDHIEAIDKPEET
                     TMGCPQCGKGHLLQRKSRFGKVFHACDRYPDCQFAINNKPVAGECEHCHYPLLMEKKT
                     AQGMKLFCASKLCGKAVEIKDNEQDE"
     gene            409061..409630
                     /locus_tag="RAHAQ2_RS01920"
                     /old_locus_tag="Rahaq2_0399"
     CDS             409061..409630
                     /locus_tag="RAHAQ2_RS01920"
                     /old_locus_tag="Rahaq2_0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573718.1"
                     /note="involved in the biosynthesis of the
                     threonylcarbamoyladenosine (t6A) residue at position 37 of
                     ANN-decoding tRNAs; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(ANN) t(6)A37 threonylcarbamoyladenosine
                     modification protein"
                     /protein_id="WP_014333618.1"
                     /db_xref="GI:504099624"
                     /translation="MNKETEKSLNTVLEALRGQHVIAYPTEAVFGLGCDPDSEQAVEA
                     LLALKKRPKDKGLILIADNYQQLLPYIDDSSLTEQQLAHVVSFWPGPVTWVMPAKSST
                     PDWLTGRFTSLAVRVTDHPLVKELCQKFGKPLVSTSANLNGQSPCRLSEEVRLQFGKD
                     FPVLDGDVGGRDNPSEIRDALTGNLIRQG"
     gene            409634..410461
                     /locus_tag="RAHAQ2_RS01925"
                     /old_locus_tag="Rahaq2_0400"
     CDS             409634..410461
                     /locus_tag="RAHAQ2_RS01925"
                     /old_locus_tag="Rahaq2_0400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="WP_014333619.1"
                     /db_xref="GI:504099625"
                     /translation="MKVTPSFAVFGNPIGHSKSPRIHALFARQTGIDHTYGTVLAPQE
                     EFEETLRSFFDNGALGANITVPFKERAFAESDELTERAAMSGAVNTLKKFEDGRLLGD
                     NTDGIGMLSDLERLALLKPGDRVLLIGAGGAARGVILPLLSYGCPVVVTNRTFERALH
                     LSHIFEKKGDIRSIALADLADESFDLIINATASGIKGEIPMLPESVLTRQTRVYDMYY
                     QAGLTPFISWAKNNGVIHYADGLGMLVGQAAHAFYLWHGVMPQIEPVLEQLKKDLLV"
     gene            complement(410513..411055)
                     /locus_tag="RAHAQ2_RS01930"
                     /old_locus_tag="Rahaq2_0401"
     CDS             complement(410513..411055)
                     /locus_tag="RAHAQ2_RS01930"
                     /old_locus_tag="Rahaq2_0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008457228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333620.1"
                     /db_xref="GI:504099626"
                     /translation="MSQALRSYQELIPTLGERVMVDPSSVVIGDVDLADDVSIWPLVV
                     IRGDVNNVVIGCRTNVQDGSVLHVTHQSRQNPEGHPLIIGEDVTVGHKAMLHGCTIGN
                     RVLVGMGSILLDGAIVEDDVMIGAGSLVPPGKTLESGYLYLGSPVKQVRELTSDELAG
                     LTYSSNNYVTWKDLYLSQEQ"
     gene            411576..413126
                     /locus_tag="RAHAQ2_RS01935"
                     /old_locus_tag="Rahaq2_0402"
     rRNA            411576..413126
                     /locus_tag="RAHAQ2_RS01935"
                     /old_locus_tag="Rahaq2_0402"
                     /product="16S ribosomal RNA"
     gene            413192..413268
                     /locus_tag="RAHAQ2_RS01940"
                     /old_locus_tag="Rahaq2_0403"
     tRNA            413192..413268
                     /locus_tag="RAHAQ2_RS01940"
                     /old_locus_tag="Rahaq2_0403"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:413226..413228,aa:Ile,seq:gat)
     gene            413402..413477
                     /locus_tag="RAHAQ2_RS01945"
                     /old_locus_tag="Rahaq2_0404"
     tRNA            413402..413477
                     /locus_tag="RAHAQ2_RS01945"
                     /old_locus_tag="Rahaq2_0404"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:413435..413437,aa:Ala,seq:tgc)
     gene            413678..416613
                     /locus_tag="RAHAQ2_RS01950"
                     /old_locus_tag="Rahaq2_0405"
     rRNA            413678..416613
                     /locus_tag="RAHAQ2_RS01950"
                     /old_locus_tag="Rahaq2_0405"
                     /product="23S ribosomal RNA"
     gene            416733..416848
                     /locus_tag="RAHAQ2_RS01955"
                     /old_locus_tag="Rahaq2_0406"
     rRNA            416733..416848
                     /locus_tag="RAHAQ2_RS01955"
                     /old_locus_tag="Rahaq2_0406"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            416899..416974
                     /locus_tag="RAHAQ2_RS01960"
                     /old_locus_tag="Rahaq2_0407"
     tRNA            416899..416974
                     /locus_tag="RAHAQ2_RS01960"
                     /old_locus_tag="Rahaq2_0407"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:416932..416934,aa:Thr,seq:ggt)
     gene            417011..417126
                     /locus_tag="RAHAQ2_RS01965"
                     /old_locus_tag="Rahaq2_0408"
     rRNA            417011..417126
                     /locus_tag="RAHAQ2_RS01965"
                     /old_locus_tag="Rahaq2_0408"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(417264..418931)
                     /gene="actP"
                     /locus_tag="RAHAQ2_RS01970"
                     /old_locus_tag="Rahaq2_0409"
     CDS             complement(417264..418931)
                     /gene="actP"
                     /locus_tag="RAHAQ2_RS01970"
                     /old_locus_tag="Rahaq2_0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333621.1"
                     /note="member of the sodium:solute symporter family;
                     cotranscribed with the acs gene which encodes acetyl
                     coenzyme A synthase; mutations affect acetate uptake;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="actetate permease"
                     /protein_id="WP_014333621.1"
                     /db_xref="GI:504099627"
                     /translation="MIARRGSLSLLMLSLAFPFSLFAAEGIAGEVNRQPLNIEAIVMF
                     VLFVGATLYITYWAAKRTRSRQDYYTAGGRITGLQNGLAIAGDFMSAASFLGISALVY
                     TSGYDGLIYSIGFLIGWPIILFLIAERLRNLGKYTFADVASYRLKQKPIRLLSACGSL
                     VVVALYLIAQMVGAGKLIQLLFGLNYHVAVILVGILMVLYVLFGGMLATTWVQIIKAI
                     LLLAGATFMAIMVMRSVGFNFNTLFTQAVAVHSKGIAIMSPGGLVSDPISALSLGLAL
                     MFGTAGLPHILMRFFTVNDAKEARKSVFYATGFIGYFYILTFIIGFGAIVLVSSNPAF
                     KDASGILLGGNNMAAVHLADAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDL
                     YASVIKDGKATERDELRVSKITVILLGIVAIALGILFEKQNIAFMVGLAFSIAASCNF
                     PIILLSMYWSKLTTRGAMVGGWLGLLTAVILMILGPTIWVQILGHAKPIYPYEYPALF
                     SMIVAFVGTWFFSITDNSLEGQKERERFYPQFVRSQTGIGISQSSNH"
     gene            complement(418928..419239)
                     /locus_tag="RAHAQ2_RS01975"
                     /old_locus_tag="Rahaq2_0410"
     CDS             complement(418928..419239)
                     /locus_tag="RAHAQ2_RS01975"
                     /old_locus_tag="Rahaq2_0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017493021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333622.1"
                     /db_xref="GI:504099628"
                     /translation="MNDLIYQRVVSNPRFRELVQKRSRFAWLLSGITLVLYVAFILLI
                     AFVPQWLGTPLYDGATITRGIPVGVGLIVISFVLTGIYVVRANGEFDRLTADIIREVK
                     P"
     gene            complement(419295..421256)
                     /locus_tag="RAHAQ2_RS01980"
                     /old_locus_tag="Rahaq2_0411"
     CDS             complement(419295..421256)
                     /locus_tag="RAHAQ2_RS01980"
                     /old_locus_tag="Rahaq2_0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333623.1"
                     /note="Acs; catalyzes the conversion of acetate and CoA to
                     acetyl-CoA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase"
                     /protein_id="WP_014333623.1"
                     /db_xref="GI:504099629"
                     /translation="MSHVYKHPIPASVAERTLITPEKYQQYYQQSVEDPDAFWGEQAK
                     VLDWIKPFTKVKNTSFAPGNVDIRWFEDGTLNLAANCLDRHLTDKGDQTALVWEGDDP
                     KAENKYVTYKQLHHDVCQFANVLKGLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVH
                     SVIFAGFSPEAVAGRIVDSNAKLVITADEGLRAGRTIPLKQNVDDALKNPAVTSITHS
                     IIFKRTGKQGEWKEGRDIWWHDAIEGVSADCPPEEMKAEDPLFILYTSGSTGKPKGVL
                     HTTGGYLVYAALTFKYTFDYHDGDIYWCTADVGWVTGHSYLLYGPLACGAISLMFEGV
                     PNYPTPARMAQVIDKHKVNILYTAPTAIRALMAEGDKAIEGTSRASLRIMGSVGEPIN
                     PEAWEWYYKTIGNSQCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALV
                     DNEGVPQEGACEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDED
                     GYYWITGRVDDVLNISGHRLGTAEIESALVSHPKIAEAAVVGIPHNIKGQAIYAYITL
                     NHGEEPSPELYTEVRNWVRKEIGSIATPDILHWTDSLPKTRSGKIMRRILRKIAAGDT
                     SNLGDTSTLADPGVVDKLLEEKQSMKVPS"
     gene            421763..422341
                     /locus_tag="RAHAQ2_RS01985"
                     /old_locus_tag="Rahaq2_0412"
     CDS             421763..422341
                     /locus_tag="RAHAQ2_RS01985"
                     /old_locus_tag="Rahaq2_0412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_014333624.1"
                     /db_xref="GI:504099630"
                     /translation="MFNAKKKTLIIALSAFISASAFADDTTPPTGADQGSGRIHFTGT
                     VINAPCSIAAGDEDINVNMGQVANKVLESGNKYSQNVNYTIHLQDCDLTAQTAGTVEY
                     PAMSKVAVSFAGTPDSSAAELLANTGSAKGAGIRLIDANGDLLKVGDTSKDINLVTGN
                     NELVFAARVEANSQPVSTGTIVSQATYALNYK"
     gene            422443..424944
                     /locus_tag="RAHAQ2_RS01990"
                     /old_locus_tag="Rahaq2_0413"
     CDS             422443..424944
                     /locus_tag="RAHAQ2_RS01990"
                     /old_locus_tag="Rahaq2_0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylbenzoate--CoA ligase"
                     /protein_id="WP_014333625.1"
                     /db_xref="GI:504099631"
                     /translation="MSLAMNRTSAEIKNALWFIFLLSGCFISVRSFAVEFNVNFIDSA
                     DRNNVDLSRFQVADYIAPGEYLLDVVLNGRTLGEQSVIHYIPTADKKNSRLCLPPALV
                     DKFDLTKDAREKLTLWHHGECTSLDQQQEVTARYDQAKQTLNISIPQAWLIFHDQNWV
                     PPSQWDDGVNGALLDYNLLGSKYMPQSGDSTTSFSSYGTTGFNVGAWRARADYQYSSS
                     RTSGMPASDKFTWTQTYLYRALPSVGARLTGGQTYFSSDIFDSFRFLGVSLNSDQRML
                     PPSLRGYAPQVTGIAKTNAKVSISQNGRVIYQTNVSPGPFVVQDLTEAVQGALDVKIE
                     EENGSVTTYQVTTATIPFLTRKGQVRFKTAMGKPTTGSSNHVLQPGFYSGEMSWGALN
                     DFSLYGGLITTTGNYQAQAIGVGQNLQKLGAVSFDVTRSSATVPVAGKQTGLSYRANY
                     SKRFDSTGSQITFAGYRFSEKTFMSFSQYLDKVNGDGYSRDDKQTYTVTANQYLPWPA
                     ITLYLSATHKVYWNESASNNYSVSVSKIFDIGRFTGISATFSASKLNYRDTDENQMFL
                     SLSLPLSSGQQISYDAQQDSQSGFSQTASYYNSQDPNNSWRVGAGGSSPDLQKGNGVF
                     RANYQHMSPYGQLGANGSVKNNDYRSVNANWYGSFTATAAGAALHQSSAGSEPRMMVS
                     TGVKGIPISDGASVTNDYGIAVVNGVSSYQTSDIRVDVNNLPDDVEVYSSVVSKTLTE
                     GAIGFRKIRAIKGERLMAVIRLADGSHPPLGAAVTDNSSGFEAGLIGDGGLAYLAGVS
                     GEKSLTVRWGDGQQCQIQVPPQPVTYSGQVLLPCT"
     gene            424992..425729
                     /locus_tag="RAHAQ2_RS01995"
                     /old_locus_tag="Rahaq2_0414"
     CDS             424992..425729
                     /locus_tag="RAHAQ2_RS01995"
                     /old_locus_tag="Rahaq2_0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial chaperone protein StdC"
                     /protein_id="WP_014333626.1"
                     /db_xref="GI:504099632"
                     /translation="MNMHLLRFLAALLLMTGAAYPACAAVNLDRTRIIYNASDKSVSV
                     MLENQSKDLPYLAQVWLENAKGEKITSPLVALPPMQRIDAGQKSQIRILQLPETAGLP
                     KDRESLFYFNVREVPPKSDMANVMQVAIQSRVKLFFRPAEIRSLVKGNWQEQLQVIRL
                     SDGLKLTNPTPFYITVGYLGKDNKGNIPGFDSVMLAPFATENLSGRQYVSQQYSLGYM
                     DDYGGLQVNEYHCQTQQCQRISKDAKR"
     gene            425739..426710
                     /locus_tag="RAHAQ2_RS02000"
                     /old_locus_tag="Rahaq2_0415"
     CDS             425739..426710
                     /locus_tag="RAHAQ2_RS02000"
                     /old_locus_tag="Rahaq2_0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333627.1"
                     /db_xref="GI:504099633"
                     /translation="MAGIHRFQAGRMAFLLLLLFFCRSALALDCVEKGTGIVDKPAIP
                     VGQLAIPANVPAGTKVWESNDINVTAYCDNVLGSIIDVVHFYFNPKSQSIGEGLLLGV
                     SYNGQDLEQNEQRLSTNSTPIKKGQNVTVNVTFRLYIKVSGNAPSSGHYQGTDQFTVF
                     QLDGSRGINKTPGAKNLKYNLSGLQGIRFLACGSDLKVYPESQIVDFGAIQSTTLSRS
                     SGISLPFAIKAVKQGCLDNFSLQAEFSTASPLLDDTAIDLSNGAKLMLYNDQNKAITF
                     NRYDDFAELNNVNEVTKNFTAKLSAIPGKTLSLGRFDASVIVKINYY"
     gene            426738..427010
                     /locus_tag="RAHAQ2_RS02005"
                     /old_locus_tag="Rahaq2_0416"
     CDS             426738..427010
                     /locus_tag="RAHAQ2_RS02005"
                     /old_locus_tag="Rahaq2_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014333628.1"
                     /db_xref="GI:504099634"
                     /translation="MLRTAKLRAQALEEPVYKAQAPELIAETHIHALLQTLREDAGLS
                     KTELARRLGVTPPAITRLEKRPAQASFCTLSRYAQACGFRLYLCYK"
     gene            complement(427036..427593)
                     /locus_tag="RAHAQ2_RS02010"
                     /old_locus_tag="Rahaq2_0417"
     CDS             complement(427036..427593)
                     /locus_tag="RAHAQ2_RS02010"
                     /old_locus_tag="Rahaq2_0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333629.1"
                     /db_xref="GI:504099635"
                     /translation="MISDRKRIFQGWKIIVLPLIPTVFILLFILHGFSVKKDRAVFPV
                     NIPCRGNMIVEARYDNQSAKLVSTLYFSFLDNHKILVSLSGTGYLYDEKGNITQRKTL
                     LRNIYYDYIHESTHSSTYSLTSSQINIDSVDNMDWQISSLLLLNSFFLTGHTDTLALK
                     KYDDNTLLIESNQSPVALCVFKKIF"
     gene            complement(427583..428464)
                     /locus_tag="RAHAQ2_RS02015"
                     /old_locus_tag="Rahaq2_0418"
     CDS             complement(427583..428464)
                     /locus_tag="RAHAQ2_RS02015"
                     /old_locus_tag="Rahaq2_0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CadC family transcriptional regulator"
                     /protein_id="WP_014333630.1"
                     /db_xref="GI:504099636"
                     /translation="MHMNYLIENQILFNPEDNTISLPGDSENKIAISNPARRILLLLI
                     EKKGIVVEREIFFKKVWDDYGLTASNNNLNHCISKLRKVMVTLGYPNEFIVTVPKVGF
                     TIRKHIIIEPYFTHEISEKKIQIHNVQVSKTPENRLTETEQKEETIRPTVIPVQLKTQ
                     SENRTNRFRHGFMISLLVTMALTIWAFFIVYHDLQDPKTQLKIARLGACDLYSTAPVV
                     LSRQRDFIELAETFLQKNNITCKPGDIFIFQSERFTSPVNTGSVRDFMAQCLTDDNDK
                     ANICISYYTNDRTTHDQ"
     gene            complement(428713..429738)
                     /locus_tag="RAHAQ2_RS02020"
                     /old_locus_tag="Rahaq2_0419"
     CDS             complement(428713..429738)
                     /locus_tag="RAHAQ2_RS02020"
                     /old_locus_tag="Rahaq2_0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S66"
                     /protein_id="WP_014333631.1"
                     /db_xref="GI:504099637"
                     /translation="MPSSELPLFPPALKTGDTIGFFSASSPVTATAPNRYLRGKKFLE
                     DKGFVLKAGTMTGQYDHYRSGSIQARAEELNQLFRDPQVRCVMSTIGGNNTNSLLPYL
                     DYDALRADPKIIIGYSDTTALLAGIYAKTGLITFYGPALVASFGEFPPLVDETYASFA
                     DILMTRHSEPYRYALPQHWTDEKLNWNDVTPVRAKALYANTCRFLGRGRIEGRVIGGN
                     LNTLSGIWGSPYMPEIRQGDILFIEDSLKDIATVERSFSMLKLNGIFDRVSAILLGKH
                     ELFDDAGSGRQPADVLLEVLNGQDIPLVDGFDCCHTHPMLTLPLGTRIAVDFSQQHID
                     IPGPYLR"
     gene            complement(429829..431145)
                     /locus_tag="RAHAQ2_RS02025"
                     /old_locus_tag="Rahaq2_0420"
     CDS             complement(429829..431145)
                     /locus_tag="RAHAQ2_RS02025"
                     /old_locus_tag="Rahaq2_0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hexuronate transporter"
                     /protein_id="WP_014333632.1"
                     /db_xref="GI:504099638"
                     /translation="MYKSNYRVVIALLLFFAGILNYLDRAALSVMAPLIKSDLHINDA
                     QMGILFSAFFIGYCLFCFIGGWSADKFGPRKVFAFAAAFWSVFCGATALVSGFAHLLV
                     VRVMFGIGEGPMGTTTNKSISNWFPRKEVGRAVGFTNAGQPLGAAIAAPVVGLVGLHF
                     GWRIAFVVIAALGFVWLAAWMTFFRDKPEQHPRVSEEEKRLIASDRPATPVTNGVREK
                     DAHSLWYYVFSKPVLGVAAAFFCFNYIQYFFLSWLPSYLTDFQHLDIKSMSIIGILPW
                     LGATAGFIGGGIVADILYRRSGNFLFSRKAVIFAGLIVAAGCVLMTAYTQNTAGAVTL
                     ITVASIFAYMTPQACWSLLQDIVPAHRIGTAGGFVHLLANLAGILSPSITGFLIQYGG
                     GYQSAFILSSGLAIVGVIAMAILVRQNKVNELFGKKAPPEEIATGH"
     gene            complement(431138..432298)
                     /locus_tag="RAHAQ2_RS02030"
                     /old_locus_tag="Rahaq2_0421"
     CDS             complement(431138..432298)
                     /locus_tag="RAHAQ2_RS02030"
                     /old_locus_tag="Rahaq2_0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase"
                     /protein_id="WP_014333633.1"
                     /db_xref="GI:504099639"
                     /translation="MKITKIEVLRVAIPFSSGRGKTPETQTDAYNAASPELTRMETLL
                     VKISTDTGLHGWGEGFGHLCNPMTETALNGLVGRFFLGQRCPQSPQEIAALMQQAEVN
                     FHAFGRTGPVMFALSAVDIALWDLLAKARKQPLWQMLGAKRQKIGVYASLVSYGNHPQ
                     RVAAKVLSTYQAGFRAIKLHETDYSAIAAAREILPADAELMVDVNCPWNVEEAAKQAQ
                     ALLSLNLGWLEEPVWPPDDLAGLAEVRKQGTRIAAGENAAGVQGFAEHFEHRAIDIAQ
                     PSVSKVGGITAMLKVFTLAKQYHIRVVPHCFYYGAGLMATAQLVAMLDDSVSLEVPYI
                     QWQETLYSQLNFKPHMLLPDMPGLGFEPSLSTLQKYLISSNTLSLNAETAHV"
     gene            complement(432689..432764)
                     /locus_tag="RAHAQ2_RS02035"
                     /old_locus_tag="Rahaq2_0422"
     tRNA            complement(432689..432764)
                     /locus_tag="RAHAQ2_RS02035"
                     /old_locus_tag="Rahaq2_0422"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(432729..432731),aa:Phe,seq:gaa)
     gene            complement(432894..433469)
                     /locus_tag="RAHAQ2_RS02040"
                     /old_locus_tag="Rahaq2_0423"
     CDS             complement(432894..433469)
                     /locus_tag="RAHAQ2_RS02040"
                     /old_locus_tag="Rahaq2_0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014333634.1"
                     /db_xref="GI:504099640"
                     /translation="MLREQVLDKTLNFLEQRGLATLSLETVAELVDVPLSELRRFWPD
                     AEALLYDSLRYHGEQIDIWRRQLMLDESLSAPQKLLARYKVLDEQVRQQRYPGCLFIA
                     ACTFFPDSDTPIHQLAQQQKRASYDYTLSLLQEMGSDDPEMVAQQMELILEGCLSKLL
                     VKRQLNDVEVARRLAEDVLNIARCREHGALS"
     gene            complement(433513..435243)
                     /gene="dipZ"
                     /locus_tag="RAHAQ2_RS02045"
                     /old_locus_tag="Rahaq2_0424"
     CDS             complement(433513..435243)
                     /gene="dipZ"
                     /locus_tag="RAHAQ2_RS02045"
                     /old_locus_tag="Rahaq2_0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333635.1"
                     /note="two electrons are transferred from cytoplasmic
                     NADPH to thioredoxin and then to the inner membrane
                     protein DsbD which keeps the disulfide isomerase DsbC in a
                     reduced state in the oxidizing periplasm; DsbC in turns
                     rearranges incorrectly made disulfide bonds in the
                     periplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_014333635.1"
                     /db_xref="GI:504099641"
                     /translation="MDHRIFRLFFLLCSLCLLPFQANASLFGKPAVAQFVPVDQAFSF
                     DFRQQGHDLKLNWQIRDGYYLYRSKIELEPKNARLAAFLMPKGRDHHDEFFGDSEVYE
                     NALSLTVPLRQAGADATVRVTYQGCAAAGFCYPPETREVPLSAVTELSPLSTPATDTA
                     PVIATPEKQSTPLPFSPLWALLIGIGIAFTPCVLPMYPLISGIILGRQRPHSMKRIFM
                     LSLFYVQGMALTYTLLGMVVAAAGLQFQAALQSPWVLIVLSVMFIALALSMLGAFSLQ
                     LPSSVQTRLALWSNGQKGGSLPGVFIMGALAGLICSPCTTAPLSAILLYIAQSGNLLA
                     GAGTLYLYALGMGIPLIIVTMFGNKLLPRSGPWMQYVKEGFGFVILALPVFLLERVTG
                     DIWGLRLWSLLGVAFFGWALLLSLKSQHGMVRILQIAFLAAVLIVSRPLQDWAFAPAG
                     NTMAQTHALNFQKIHNVAELDTALQGAQGKRIMLDLYADWCVACKEFEKYTFSASEVQ
                     NELSDTVLLQADVTQNSPEQKALLARLNVLGLPTIIFFGPDGHELPQSRVTGFMDAAE
                     FSAHLQKVHP"
     gene            complement(435416..436717)
                     /locus_tag="RAHAQ2_RS02050"
                     /old_locus_tag="Rahaq2_0425"
     CDS             complement(435416..436717)
                     /locus_tag="RAHAQ2_RS02050"
                     /old_locus_tag="Rahaq2_0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573736.1"
                     /note="functions in anaerobic transport of
                     C4-dicarboxylate compounds such as fumarate; similar to
                     dcuB; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_014333636.1"
                     /db_xref="GI:504099642"
                     /translation="MLIIEFIIVLAAIFLGARLGGIGIGFAGGLGVLVLALIGVKPGT
                     IPFDVISIIMAVIAAISTMQVAGGMDYLVQQTEKLLRRNPKHITLLAPIVTYFLTIMA
                     GTGNISLSALPVIAEVAKEQGIKPCRPLSTAVVAAQIAITASPISAAVVYMASTMEGH
                     GVSYLHLLMVMIPATLAAVILMSLIVSWCFDSKLSNDPVYLKRYEEGLIQLRGDKVPE
                     IKRGAKLSVLLFLLGVLTVVAYAVINSPSLGWVAQPVMTTNSAILIIMLSVATLITLL
                     CSIDTDAILTSSTFKSGMSACICILGVAWLGDTFVQANLGWIKETAGGLIQAHPWLLA
                     VIFFFSSALLYSQAATTKALLPMALALSVSPLTAVGSFAAVSGLFILPTYPTLVAAVQ
                     MDDTGTTRIGRFVFNHPFFIPGTIGVFLAVLFGFGFGSIIL"
     gene            complement(436853..438289)
                     /gene="aspA"
                     /locus_tag="RAHAQ2_RS02055"
                     /old_locus_tag="Rahaq2_0426"
     CDS             complement(436853..438289)
                     /gene="aspA"
                     /locus_tag="RAHAQ2_RS02055"
                     /old_locus_tag="Rahaq2_0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005175569.1"
                     /note="catalyzes the formation of fumarate from aspartate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_014333637.1"
                     /db_xref="GI:504099643"
                     /translation="MSNTIRIEEDLLGTREVPAEAYYGIHTLRAIENFYISNTKISDV
                     PEFVRGMVMVKKAAALANKELRTIPRHIADIIIQACDEVLDKGKCMDQFPIDVYQGGA
                     GTSVNMNTNEVLANIGLELMGHQKGDYQFLNPNDHLNKCQSTNDAYPTGFRIAVYASL
                     LKLVDAISQLGDGFERKAKEFENIIKMGRTQLQDAVPMTLGQEFHAFNVLLKEETRNL
                     MRTGELLLEVNLGATAIGTRLNTPEGYQQLAVEKLAEVSNLACVPAEDLIEATSDCGA
                     YVMVHSSLKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVIPE
                     VVNQVCFKVIGNDVCVTMAAEAGQLQLNVMEPVIGQAMFESVHILTNACYNLLEKCIN
                     GITANKEVCEFYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTE
                     AELDDIFSIENLKHPAYKAKRYTDENEQ"
     gene            438662..439153
                     /gene="fxsA"
                     /locus_tag="RAHAQ2_RS02060"
                     /old_locus_tag="Rahaq2_0428"
     CDS             438662..439153
                     /gene="fxsA"
                     /locus_tag="RAHAQ2_RS02060"
                     /old_locus_tag="Rahaq2_0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333639.1"
                     /note="F exclusion of bacteriophage T7; overproduction of
                     this protein in Escherichia coli inhibits the F
                     plasmid-mediated exclusion of bacteriophage T7; interacts
                     with the F plasmid-encoded PifA protein; inner membrane
                     protein; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exclusion suppressor FxsA"
                     /protein_id="WP_014333639.1"
                     /db_xref="GI:504099645"
                     /translation="MRWLPLLLLFLLAYIEITLFIKVAAVVGVATTLLLVVFTSCVGV
                     SLVKNQGMKTFMQLQQKLAVGESPAAEMVKSVSLVIAGFLLLVPGFFTDFLGLLLLLP
                     PIQKRLTLKLMPHLNIVRSGGNWGSSAPTGNTFDGEFQRTDETQERLVSPKKDDDTEH
                     RDR"
     gene            439369..439662
                     /gene="groES"
                     /locus_tag="RAHAQ2_RS02065"
                     /old_locus_tag="Rahaq2_0429"
     CDS             439369..439662
                     /gene="groES"
                     /locus_tag="RAHAQ2_RS02065"
                     /old_locus_tag="Rahaq2_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006658991.1"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin GroES"
                     /protein_id="WP_009636718.1"
                     /db_xref="GI:497322505"
                     /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEILAVG
                     HGRILENGEVKALDVKVGDIVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
     gene            439716..441362
                     /gene="groEL"
                     /locus_tag="RAHAQ2_RS02070"
                     /old_locus_tag="Rahaq2_0430"
     CDS             439716..441362
                     /gene="groEL"
                     /locus_tag="RAHAQ2_RS02070"
                     /old_locus_tag="Rahaq2_0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017493786.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_014333640.1"
                     /db_xref="GI:504099646"
                     /translation="MAAKEVKFGNDARVKMLRGVNILADAVKVTLGPKGRNVVLDKSF
                     GAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITE
                     GLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGK
                     LIAEAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP
                     FILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAV
                     KAPGFGDRRKAMLQDIATLTGGTVISEEIGLELEKATLEDMGQAKRVVINKDTTIIID
                     GVGEEATIQGRVSQIRQQIEEATSDYDREKLQERVAKLAGGVAVLKVGAATEVEMKEK
                     KARVEDALHATRAAVEEGVVAGGGVALVRVAHTLANLTGDNDDQNVGIRVALRAMESP
                     LRQIVVNAGEEASVIANKVKAGEGSFGYNAYTEEYGDMIAMGILDPTKVTRSALQYAS
                     SVAGLMITTECMITDLPKDDKVDMGGAGGMGGMGGMGGMM"
     gene            441659..442003
                     /locus_tag="RAHAQ2_RS02075"
                     /old_locus_tag="Rahaq2_0431"
     CDS             441659..442003
                     /locus_tag="RAHAQ2_RS02075"
                     /old_locus_tag="Rahaq2_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333641.1"
                     /db_xref="GI:504099647"
                     /translation="MRIKMLLGLSAIALLAGCSTTHQLDAAGQQVKFTDDKPGANCQL
                     LGEVTGAQSNWFSGTGGDGSSMRGAANDLRNKAAAMGGNTIYGANSPSQNFLSSFAPV
                     DSKMVGQVYKCP"
     gene            complement(442192..443220)
                     /locus_tag="RAHAQ2_RS02080"
                     /old_locus_tag="Rahaq2_0432"
     CDS             complement(442192..443220)
                     /locus_tag="RAHAQ2_RS02080"
                     /old_locus_tag="Rahaq2_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine 2,3-aminomutase"
                     /protein_id="WP_014333642.1"
                     /db_xref="GI:504099648"
                     /translation="MANIVTLNAPFREDWLYQLGDVITDPDELLTLLALNDNAELQNG
                     REARRLFPLRVPRAFVARMQPGDPQDPLLLQVLTAREEFIAAPGFTTDPLDEQRSVVP
                     GLLHKYSNRALLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWVQALDYIRTRPELDEI
                     IFSGGDPLMAKDHELDWLIGELEGIAHIKRLRIHTRLPVVIPARITDNLCQRLEKSRL
                     QVLMVTHINHANEIDNALRASMAKLKHHGVTLLNQSVLLRGVNDSADVLAALSNALFE
                     AGILPYYIHVLDKVQGAAHFMVNDDEARVIMKGLMSKVSGYMVPKLTREIGGEPSKTL
                     LDLRLKQS"
     gene            443259..443825
                     /locus_tag="RAHAQ2_RS02085"
                     /old_locus_tag="Rahaq2_0433"
     CDS             443259..443825
                     /locus_tag="RAHAQ2_RS02085"
                     /old_locus_tag="Rahaq2_0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004956037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="WP_013573742.1"
                     /db_xref="GI:503339081"
                     /translation="MATYSSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMR
                     RLLTGSRVEKTFKSTDSCEGADVVDTNMNYLYNDGEFYHFMHPETFEQHQVEEKTVSD
                     ASKWLQDNAECIVTLWDGRPIAVQPPNFIEAEVVDTDPGLKGDTAGTGGKPATLSTGA
                     VVKVPLFVQIGEIVRCDTRSGEYVSRVK"
     gene            443921..444049
                     /locus_tag="RAHAQ2_RS02090"
                     /old_locus_tag="Rahaq2_0434"
     CDS             443921..444049
                     /locus_tag="RAHAQ2_RS02090"
                     /old_locus_tag="Rahaq2_0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="entericidin"
                     /protein_id="WP_013573743.1"
                     /db_xref="GI:503339082"
                     /translation="MLKKMMFIVVSVMLLASLSGCNTVHGFGEDIQHLGGAISKAG"
     gene            444168..444302
                     /locus_tag="RAHAQ2_RS02095"
                     /old_locus_tag="Rahaq2_0435"
     CDS             444168..444302
                     /locus_tag="RAHAQ2_RS02095"
                     /old_locus_tag="Rahaq2_0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013200472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative small secreted protein"
                     /protein_id="WP_014333643.1"
                     /db_xref="GI:504099649"
                     /translation="MLKKSILAILSVLVLSSALTACNTTRGVGEDVSAGGQAIQKSAQ
                     "
     gene            complement(444392..444916)
                     /locus_tag="RAHAQ2_RS02100"
                     /old_locus_tag="Rahaq2_0436"
     CDS             complement(444392..444916)
                     /locus_tag="RAHAQ2_RS02100"
                     /old_locus_tag="Rahaq2_0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333644.1"
                     /note="lipocalin; globomycin-sensitive outer membrane
                     lipoprotein; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein Blc"
                     /protein_id="WP_014333644.1"
                     /db_xref="GI:504099650"
                     /translation="MRIWSKLSVIITALLSVACSVTPPADVKVVNNFELTRYLGTWYE
                     VARLDHSFESGLERVTANYSLRDDGGVKVINRGFNPQKNKWQESEGKGYFTGSPARAA
                     LKVSFFGPFYGGYNVIELDKDYRYALVCGPDKSYLWILSRTPTLDDSVKQQLLQTAQQ
                     YGFDTSKLVWVKQP"
     gene            complement(445041..445400)
                     /locus_tag="RAHAQ2_RS02105"
                     /old_locus_tag="Rahaq2_0437"
     CDS             complement(445041..445400)
                     /locus_tag="RAHAQ2_RS02105"
                     /old_locus_tag="Rahaq2_0437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit D"
                     /protein_id="WP_014333645.1"
                     /db_xref="GI:504099651"
                     /translation="MKNTLPKRSDEPVFWGLFGAGGMWSAIFAPVMILLVCFLLPLGF
                     FPGDALSYPRVLAFAQSGIGRLFLLLMIVLPLWCGLHRIHHCMHDLKIHVPAGKWVFY
                     GLATILSIVTLIVLIRL"
     gene            complement(445410..445820)
                     /locus_tag="RAHAQ2_RS02110"
                     /old_locus_tag="Rahaq2_0438"
     CDS             complement(445410..445820)
                     /locus_tag="RAHAQ2_RS02110"
                     /old_locus_tag="Rahaq2_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573747.1"
                     /note="part of four member fumarate reductase enzyme
                     complex FrdABCD which catalyzes the reduction of fumarate
                     to succinate during anaerobic respiration; FrdAB are the
                     catalytic subcomplex consisting of a flavoprotein subunit
                     and an iron-sulfur subunit, respectively; FrdCD are the
                     membrane components which interact with quinone and are
                     involved in electron transfer; the catalytic subunits are
                     similar to succinate dehydrogenase SdhAB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit C"
                     /protein_id="WP_014333646.1"
                     /db_xref="GI:504099652"
                     /translation="MTTQSTGSKRKPYVHEMKASWWKSLPFYRFYMLREGTAVPAVWF
                     SLLLLAGVCSLRNGPESWAGFVNFLQNPVVLLINLIALLAALLHTKTWFELAPKASIV
                     VVKGKKMGPEPVIAGFWGVTIVVTLVVLVIALFL"
     gene            complement(445832..446557)
                     /locus_tag="RAHAQ2_RS02115"
                     /old_locus_tag="Rahaq2_0439"
     CDS             complement(445832..446557)
                     /locus_tag="RAHAQ2_RS02115"
                     /old_locus_tag="Rahaq2_0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573748.1"
                     /note="part of four member fumarate reductase enzyme
                     complex FrdABCD which catalyzes the reduction of fumarate
                     to succinate during anaerobic respiration; FrdAB are the
                     catalytic subcomplex consisting of a flavoprotein subunit
                     and an iron-sulfur subunit, respectively; FrdCD are the
                     membrane components which interact with quinone and are
                     involved in electron transfer; the catalytic subunits are
                     similar to succinate dehydrogenase SdhAB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase"
                     /protein_id="WP_041682444.1"
                     /db_xref="GI:754018640"
                     /translation="MRSLKVEIMRYNPETDSAPHPVVYDVPFDETTSLLDALGYIKDH
                     LAADLSYRWSCRMAICGSCGMMINKVPKLACKTFLREYPEGMQVEALANFPVERDLVV
                     DMTHFIESLEAIKPYIIGNTRTVGEGPGKQTPAQMEKYHQFSGCINCGLCYAACPQFG
                     LNPEFIGPAAITLAHRYNLDNRDHGKAQRMPQLNGQNGVWSCTFVGYCSEVCPKHVDP
                     AAAIQQGKVESAKDFMIARLRPQ"
     gene            complement(446559..448358)
                     /locus_tag="RAHAQ2_RS02120"
                     /old_locus_tag="Rahaq2_0440"
     CDS             complement(446559..448358)
                     /locus_tag="RAHAQ2_RS02120"
                     /old_locus_tag="Rahaq2_0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411553.1"
                     /note="part of four member fumarate reductase enzyme
                     complex FrdABCD which catalyzes the reduction of fumarate
                     to succinate during anaerobic respiration; FrdAB are the
                     catalytic subcomplex consisting of a flavoprotein subunit
                     and an iron-sulfur subunit, respectively; FrdCD are the
                     membrane components which interact with quinone and are
                     involved in electron transfer; the catalytic subunits are
                     similar to succinate dehydrogenase SdhAB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="WP_014333648.1"
                     /db_xref="GI:504099654"
                     /translation="MQTFNADIAIIGAGGAGLRAAIAAAEANPNLNIALISKVYPMRS
                     HTVAAEGGSAAVTQDHDSFDFHFQDTVSGGDWLCEQDVVDHFVHQCPTEMAQLELWGC
                     PWSRKDDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIKRFDEHFVLD
                     ILVDEGQVRGVVAINMMEGTRVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMAF
                     RHGIPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLG
                     EPKNKYMELGPRDKVSQAFWHEWRAGRTIETPRGDVVYLDLRHLGEKKLRERLPFICE
                     LAKAYVGVDPITDPIPVRPTAHYTMGGIETDAQCETRIKGLFAVGECSSVGLHGANRL
                     GSNSLAELVVFGRMAGEKAAERAVQAKDTGNNDALEAQVRDIESRVAALMAQEGDESW
                     AAIRDEMGLAMEEGCGIYRTTELMQKTIDKLAELKERFKRVKIQDTSSVFNTDLLYTI
                     ELGHGLEVAECMAHSALHRRESRGAHQRLDEGCTERDDVNFLKHTLAFYQPDSAPRLE
                     YGDVKITTLPPAKRVYGGESETHDKKDKEQSRG"
     gene            448642..449619
                     /locus_tag="RAHAQ2_RS02125"
                     /old_locus_tag="Rahaq2_0441"
     CDS             448642..449619
                     /locus_tag="RAHAQ2_RS02125"
                     /old_locus_tag="Rahaq2_0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573750.1"
                     /note="poxA; regulates pyruvate oxidase poxB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="WP_014333649.1"
                     /db_xref="GI:504099655"
                     /translation="MSETASWQPSAPVANLLKRAAILAEIRRFFADRGVLEVETPAMS
                     QATVTDIHLVPFETRFVGPGAAEGMTLYLMTSPEYHMKRLLAAGSGPIYQMGRSFRNE
                     EAGRHHNPEFTMLEWYRPRYDMYRLMNEVDDLLQQVLDCDSAETLSYQQAFTRHLGVD
                     PLSADKTELREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGRDKPTFIYHFPAT
                     QASLAEISTEDHRVAERFEVYYKGIELANGFRELTDGREQRQRFEQDNRKRAARGLPQ
                     HPIDNNLLDALEHGMPECSGVALGVDRLIMIALGAASLSDVLAFPVTRA"
     gene            complement(449730..453101)
                     /locus_tag="RAHAQ2_RS02130"
                     /old_locus_tag="Rahaq2_0442"
     CDS             complement(449730..453101)
                     /locus_tag="RAHAQ2_RS02130"
                     /old_locus_tag="Rahaq2_0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive channel protein"
                     /protein_id="WP_014333650.1"
                     /db_xref="GI:504099656"
                     /translation="MRLIPALLMSLLLSLPLMAGAAPTEDQLKQELKQAEANKEMANQ
                     TQVVEALQSALNWLNEASVSAGRTAEYQKVIDDFPKLTQALRQELQNQPDKPPALNNS
                     ISTAQLEQQILQVSSQQLEETRQLRQEQDRSRDISDSLSLIPQQQSEARNALSDIDQR
                     IQAATAAATSSSPLAQAQLSALQAESAARKAKVDELELAQLSANNRQELSRMRTDLYK
                     KRADFLDQQLQTLRNTLNNQRQQEAEQALEKTELLAEQSGELPHSISQQLQSNRELSL
                     ALNQQAQRMDLISSQQRQAAAQTQQVRQAINTIREQAQWLGASNLLGETLRAQVARLP
                     EMPKPQQLDRDMGQLRVQRLHYEDLLDKQAIYRQARQDDGKPLTADQQKILDAQLRTQ
                     RELLNSLLSGCDTQILELTKLKVANSQLVEALNDVHDAAHRYLFWVADVSAIGISYPV
                     QVAHDLKRLVSLDSLSQLGGASMMMVTSKETLLPLFGALILVIISISSRKHYYAFLER
                     ASSKVGKVTQDHFSLTLRTVFWSILVAMPLPVLWAALGFGLQSAWPYPIAVAIGDGVT
                     ATLPILWAFMVSAALAHPQGLFVAHFGWPQRAVSRALRYYALSIWVLVPLIMALITFD
                     NLNDREFSNTLGRLCFVLLCIVVALVTNSLKRAGIPLYHDKKGNSENVINKTLWWMLL
                     GAPIMAAMASLMGYLATSQALLARLETSVAIWFVLLVIYHIIRRWMLIQRRRIAFERA
                     KQRRAEILNQRARGEDDAHQVSTSNEGTVEIEEPVVDLDAISAQSLRLVRSLLTLIAL
                     ISVIFLWSEIHSAFSFLENIHLWQVASTVQGVESMQPITLGSVLIAILVLIITTQLVR
                     NLPALLELALLQHLDLTPGTGYAVLTVTKYVLLLIGGLTGFSLIGIEWAKLQWLVAAL
                     GVGLGFGLQEIFANFISGLIILFEKPIRIGDTVTIRNLTGSITRINTRATTIADWDRK
                     EIIVPNKAFITEQFINWSLSDSVTRVVLTVPAPSEANSEEVTEILLSAAHRCSLVLDM
                     PAPEAYLVDLQQGIQIFELRMHAAEMAHRMPLRHEIHQLILAGFREHGITLPFPPFQV
                     RMETLHRAQNGNNATFTSSSGSGRSGNSSRSPGDL"
     gene            complement(453148..454092)
                     /locus_tag="RAHAQ2_RS02135"
                     /old_locus_tag="Rahaq2_0443"
     CDS             complement(453148..454092)
                     /locus_tag="RAHAQ2_RS02135"
                     /old_locus_tag="Rahaq2_0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="WP_014333651.1"
                     /db_xref="GI:504099657"
                     /translation="MLDSIKIKLQYLLPKQGLTRLAGWGADKRAATLTHWVIKGFARF
                     YNVDMKEAQNPDLKSYATFNEFFVRPLRDGARPVVSGLDMLCLPADGAVSQLGAITDD
                     KLFQAKGHFYSLEALLAGNYLLAEQFKDGQFATIYLAPRDYHRVHMPCDGVLREMIYV
                     PGDLFSVNPLTAANVPNLFARNERVICVFDTEFGPMVQILVGATIVGSIETVWAGCVT
                     PPREGIIKRWTYPAAGEEGAITLEKGQEMGRFKLGSTVINLFAAHQIRFMPNLSNGTV
                     TRMGEPFAEALRAAATPEPEPEAPAGVATAEPQVPKDF"
     gene            complement(454275..455312)
                     /locus_tag="RAHAQ2_RS02140"
                     /old_locus_tag="Rahaq2_0444"
     CDS             complement(454275..455312)
                     /locus_tag="RAHAQ2_RS02140"
                     /old_locus_tag="Rahaq2_0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573755.1"
                     /note="EngC; RsgA; CpgA; circularly permuted GTPase;
                     ribosome small subunit-dependent GTPase A; has the pattern
                     G4-G1-G3 as opposed to other GTPases; interacts strongly
                     with 30S ribosome which stimulates GTPase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase RsgA"
                     /protein_id="WP_014333652.1"
                     /db_xref="GI:504099658"
                     /translation="MTKSKLSKGQQRRVQTNHQRRLTQTDKRKELDDSLHGEPQDGVV
                     ISRFGMHADVEAADGSQHRCNIRRTIRSLVTGDRVVWRAGENTSVKGIVEAVHERTSV
                     LTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETVEVEPLIVLNKIDL
                     LDDEGRKFVQGMMDIYRNINYRVLEVSSQTGEGMPAFEKALTDRISIFAGQSGVGKSS
                     LLNALLPPDEKQIVVNEVSDNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLA
                     PEQITQGFVEFRPFLGYCKFRDCKHGSDPGCAIRDAVDRGEIAEERFDNYHRILESME
                     DVKTRKNFDTL"
     gene            455439..455984
                     /locus_tag="RAHAQ2_RS02145"
                     /old_locus_tag="Rahaq2_0445"
     CDS             455439..455984
                     /locus_tag="RAHAQ2_RS02145"
                     /old_locus_tag="Rahaq2_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333653.1"
                     /note="3'-5' exoribonuclease specific for small
                     oligoribonuclotides; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoribonuclease"
                     /protein_id="WP_014333653.1"
                     /db_xref="GI:504099659"
                     /translation="MAANDSNLIWIDLEMTGLDPERDRIIEIATLVTDAHLNILAEGP
                     VMAVHQSDAQLALMDDWNVRTHTGSGLVDRVKASPFDDNAAQQKTIEFLREWVPAGKS
                     PICGNSVGQDRRFLFKYMPELEEYFHYRYLDVSTLKELARRWKPEVLAGFKKQNTHQA
                     LDDIRESVAELAYYREHFINL"
     gene            456302..456377
                     /locus_tag="RAHAQ2_RS02150"
                     /old_locus_tag="Rahaq2_0446"
     tRNA            456302..456377
                     /locus_tag="RAHAQ2_RS02150"
                     /old_locus_tag="Rahaq2_0446"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:456335..456337,aa:Gly,seq:gcc)
     gene            456437..456512
                     /locus_tag="RAHAQ2_RS02155"
                     /old_locus_tag="Rahaq2_0447"
     tRNA            456437..456512
                     /locus_tag="RAHAQ2_RS02155"
                     /old_locus_tag="Rahaq2_0447"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:456470..456472,aa:Gly,seq:gcc)
     gene            456573..456648
                     /locus_tag="RAHAQ2_RS02160"
                     /old_locus_tag="Rahaq2_0448"
     tRNA            456573..456648
                     /locus_tag="RAHAQ2_RS02160"
                     /old_locus_tag="Rahaq2_0448"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:456606..456608,aa:Gly,seq:gcc)
     gene            complement(456963..458117)
                     /locus_tag="RAHAQ2_RS02165"
                     /old_locus_tag="Rahaq2_0449"
     CDS             complement(456963..458117)
                     /locus_tag="RAHAQ2_RS02165"
                     /old_locus_tag="Rahaq2_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster binding protein"
                     /protein_id="WP_014333654.1"
                     /db_xref="GI:504099660"
                     /translation="MTLPLDLVQLAQHIKQWGQSLGFQQVGICDTDLSAEEPKLQDWL
                     DKQYHGEMEWMARHGMLRARPHELLPGTLRVISVRMNYLPAKAAFAKTLNNPQLGYVS
                     RYALGRDYHKVLRQRLKKLGDMIQTHCTEHADQTITFRPFVDSAPLMERPLAAKAGLG
                     WVGKHSLILNRESGSWFFLGELLIDLPLPVDQPQEEKCGKCVACITTCPTGAIVAPYT
                     VDARRCISYLTIELEGAIPEEFRPLMGNRIYGCDDCQLICPWNRYSQLTDEEDFSPRA
                     ALHAPELIELFGWTEEKFLRITEGSPIRRIGHLRWLRNIAVALGNAPYSEEVLNTLQS
                     REGENALLDEHISWAIAQQVARRNEHRVEVQSSQQKRLIRAVEKGLPRDA"
     gene            458116..459630
                     /locus_tag="RAHAQ2_RS02170"
                     /old_locus_tag="Rahaq2_0450"
     CDS             458116..459630
                     /locus_tag="RAHAQ2_RS02170"
                     /old_locus_tag="Rahaq2_0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_014333655.1"
                     /db_xref="GI:504099661"
                     /translation="MTNQREKRNEASLPHSVFSADWLRQAERQAAQETGISLFTLMQR
                     AAKAAFSLAQREFPQMRHWLILCGHGNNGGDGFEVARLAKNAGIRVTLLAVAGSKPLP
                     EEAEAAREGWLKSGGTVNPADSAWPQDADLIIDGLLGTGLSSAPRAPYDGLIDAINSA
                     SLPVISLDIPSGLDAQTGQTAGKAVHATHTLSFIALKPGLLTGQARDYTGKLHCDALG
                     LESWLGGHLAPLQRLDATQLGQWLHPRRPCSHKGEHGRLLVIGGDTGFAGAIRMASEA
                     ALRSGAGLVRVLTHKEHAGPLLTARPELMVQELTAESLDESLEWADVLVIGPGLGQKE
                     WGKQAIERVAKWDKPALWDADALNLLAINPRKRQNRVLTPHPGEAARLLGCSVKDIES
                     DRLLSARNLTQRYGGVVVLKGAGTLIASERGEMAVADVGNAGMASGGMGDVLSGIIGG
                     LLAQKLNIYDAACAGSVVHGAAADEIAHRQGTRGMLATDLLAVIAPLVNPDLKK"
     gene            459641..460108
                     /locus_tag="RAHAQ2_RS02175"
                     /old_locus_tag="Rahaq2_0451"
     CDS             459641..460108
                     /locus_tag="RAHAQ2_RS02175"
                     /old_locus_tag="Rahaq2_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333656.1"
                     /note="needed for nucleoid integrity; possibly involved in
                     cell wall synthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-binding protein"
                     /protein_id="WP_014333656.1"
                     /db_xref="GI:504099662"
                     /translation="MNQLNISLPDEAATLLLGASLAKACEGSAVIHLYGDLGAGKTTF
                     SRGFLQALGHQGTVKSPTYTLVEPYQLEKIAVYHFDLYRLADPEELEFMGIRDYFAQD
                     AICLVEWPQQGAGVLPEPDIELTLDYSGTGRTAKLVAVSESGIKLLHRVQQQG"
     gene            460116..461882
                     /locus_tag="RAHAQ2_RS02180"
                     /old_locus_tag="Rahaq2_0452"
     CDS             460116..461882
                     /locus_tag="RAHAQ2_RS02180"
                     /old_locus_tag="Rahaq2_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_014333657.1"
                     /db_xref="GI:504099663"
                     /translation="MNSRFTSLYLSAAMLLSTLMLFAVLAPPVFAAGMKNINVSNGPT
                     QSTVTITFDGSPDYSFFPLHNPERVVMDIRQDGVMKGLPLNFNGQNLVTRVRASTPPN
                     AQSQRLVFELNQKVRTNATKQKDGSQYTVVLTMNASAPARRSAPVAVGTNTPSPNAGR
                     MVTPSAKSNPFTNDQTKVVATTVAPDNSRSSTVSTSDSRIIVAIDAGHGGQDPGAIGA
                     GGLKEKNVTISIARKLQAILNADPMFQPVLTRDGDYFISVMGRSDVARKKNANVLVSI
                     HADAAPSRSARGASVWVLSNRRANSEMGNWLEQHEKQSELLGGAGDVLANTASDPYLS
                     QAVLDLQFGHSQRVGYDVATRVLRELRSVGSLHKAKPEHASLGVLRSPDIPSLLVETG
                     FISNSTEERLLGSSAYQDKIARAIHIGLRNYFQSHPIQNGPKVENRPLLASSAAAADS
                     SATASTAANQPGPIEVTAGAAGATQIHKVTRGETLTGIANSYGTTNAALRDLNKLKKD
                     GVWVGQRLKVPAGTRTSSTTAAPASTAKTSQKPAKHKVKRGDTLSAIASKYGVSMNDI
                     KTANHMKSGEVQLGQTLTIPQS"
     gene            461914..463830
                     /locus_tag="RAHAQ2_RS02185"
                     /old_locus_tag="Rahaq2_0453"
     CDS             461914..463830
                     /locus_tag="RAHAQ2_RS02185"
                     /old_locus_tag="Rahaq2_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein"
                     /protein_id="WP_014333658.1"
                     /db_xref="GI:504099664"
                     /translation="MPIKVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDI
                     DIDRGGAKLIRIRDNGCGIGKDDLALALARHATSKITCLDDLEAILSLGFRGEALASI
                     SSVSRLILTSRTAEQNEAWQAYAEGRDMTVTVKPAAHPQGSTVEVLDLFYNTPARRKF
                     MRTEKTEFTHIDEVVRRIALARFDVSVNLSHNGKLIRQYRAVKDPSQFSRRLASICSP
                     TFVEHALEVEWSHGDLAIRGWVADPAGSRSLTEMQYCYVNNRMMKDRLINHAIRQAYQ
                     DQLKDDQQPAYVLYLDVDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQAVMSVLQQAGA
                     PVLDEPQLQEDTPRWQQENRQAAGGNHFSQPAERKVPASRENSSPRDNVFPETARASQ
                     PRDPAFRSNEPAYNPSESKAYGRLLQPAPESFSLQEPTPAVAQPAKPAGSAARTLEPA
                     LESHSQSFGRVLTVYSAEYALLERGNQLVLLALPVADRWLKWAQLTPPEEGLRPQPLL
                     IPLKLTMKKEETVVLARHQALLQHFGLEMLSESQRVTVRAVPLPLRQQNLQKLIPDLL
                     GYLAVQQEVTSDAVAMWFARHCGCEHEVWTISQAIQLLTDVERLCPQLVKSPPSGLLQ
                     PLDLRPALAAFKHD"
     gene            463823..464764
                     /gene="miaA"
                     /locus_tag="RAHAQ2_RS02190"
                     /old_locus_tag="Rahaq2_0454"
     CDS             463823..464764
                     /gene="miaA"
                     /locus_tag="RAHAQ2_RS02190"
                     /old_locus_tag="Rahaq2_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017492186.1"
                     /note="IPP transferase; isopentenyltransferase; involved
                     in tRNA modification; in Escherichia coli this enzyme
                     catalyzes the addition of a delta2-isopentenyl group from
                     dimethylallyl diphosphate to the N6-nitrogen of adenosine
                     adjacent to the anticodon of tRNA species that read codons
                     starting with uracil; further tRNA modifications may
                     occur; mutations in miaA result in defects in translation
                     efficiency and fidelity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA delta(2)-isopentenylpyrophosphate
                     transferase"
                     /protein_id="WP_014333659.1"
                     /db_xref="GI:504099665"
                     /translation="MTDSEKHAVPPAIFIMGPTASGKTALAMSLMKHLPVELISVDSA
                     LIYRGMDIGTAKPTAEELADAPHRLIDILDPTVAYSAADFRKDALREMAEITSRNKIP
                     LLVGGTMLYFKALLEGLSPLPPADPAVRERIEKQAAEQGWEALHDQLREIDPVAAMRI
                     HPNDPQRLSRALEVFFISGKTLTELTKISGETLPYRVHQFAIAPTRRELLHARIEERF
                     SQMLSNGFEDEVRTLIARGDLHTDLPSIRCVGYRQMWSYLSGEFDYDEMVYRGVCATR
                     QLAKRQMTWLRGWESVEWLDSEKPEEALNRVIQVVSA"
     gene            464879..465187
                     /gene="hfq"
                     /locus_tag="RAHAQ2_RS02195"
                     /old_locus_tag="Rahaq2_0455"
     CDS             464879..465187
                     /gene="hfq"
                     /locus_tag="RAHAQ2_RS02195"
                     /old_locus_tag="Rahaq2_0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573763.1"
                     /note="HF-I, host factor for RNA phage Q beta replication;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein Hfq"
                     /protein_id="WP_013573763.1"
                     /db_xref="GI:503339102"
                     /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVI
                     LLKNTVSQMVYKHAISTVVPSRPVSHHSNNPGSGSTNNYHQGSTPSAQQPQQENDDAE
                     "
     gene            465286..466590
                     /locus_tag="RAHAQ2_RS02200"
                     /old_locus_tag="Rahaq2_0456"
     CDS             465286..466590
                     /locus_tag="RAHAQ2_RS02200"
                     /old_locus_tag="Rahaq2_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333660.1"
                     /note="involved in modulation of proteins HflK and HflC;
                     part of the hflA locus (high frequency of lysogenization)
                     which governs the lysis-lysogeny decision of bacteriophage
                     lambda by controlling stability of the phage cII protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase HflX"
                     /protein_id="WP_014333660.1"
                     /db_xref="GI:504099666"
                     /translation="MFDRYEAGEQAVLVHIYFSQDKDTEDLSEFESLVSSAGVEALQV
                     VTGSRKAPHPKYFVGEGKAQEIADAVKATGASVILFDHALSPGQERNLEALCECRVVD
                     RTGLILDIFAQRARTHEGKLQVELAQLRHIATRLVRGWTHLERQGGGIGARGPGETQL
                     ETDRRLLRDRITLILSRLEKVAKQREQGRRSRVRADIPTVSLVGYTNAGKSTLFNRIT
                     QADVYVANQLFATLDPTLRRIMVADVGETVLADTVGFIRHLPHDLVAAFKATLQETRQ
                     ASLLLHVIDAADIRVQENIDAVNTVLAEIEADEIPALLVMNKIDMLDDFVPRIDRNEE
                     NLPVRVWLSAVTGEGIPLLFQALTERLSGEIAQHELCLPPEAGRLRSRFYQLQAIEKE
                     WIEEDGSIGLMVRMPIVDWRRLCKQEQELESYVRNQSLSDLA"
     gene            466624..467922
                     /locus_tag="RAHAQ2_RS02205"
                     /old_locus_tag="Rahaq2_0457"
     CDS             466624..467922
                     /locus_tag="RAHAQ2_RS02205"
                     /old_locus_tag="Rahaq2_0457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333661.1"
                     /note="with HflC inhibits proteolysis of lambda cII
                     protein by FtsH; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_014333661.1"
                     /db_xref="GI:504099667"
                     /translation="MAWNQPGNNGQDRDPWGSSNNNSGNSGGNSGGNNDNKGGRNQGP
                     PDLDDIFRKLSKKLGGFGGKGSGNNNNSNNGAPTGSGHGMSGSRIAGIAVAAVVVIWA
                     ATGFYTIKEAERGVVTRFGKFSHLVEPGLNWKPTFIDQVRAVNVEAVRELAASGVMLT
                     SDENVVRVEMNVQYRVTDPEAYLFSVANPDDSLSQATDSALRGVIGKYTMDKILTEGR
                     TTVRSDTQRVLEETIRPYKMGITIQDVNFQTARPPEEVKASFDNAIAAREREQQSIRE
                     AEAYANQIQPLANGEAQRLLEDAKAYKDRTVLEAQGEVARFSKLLPEYKAAPEITRER
                     LYIETMEKVLSHTRKVLVSDKGNNLMVLPLDQMLRGNNAAANDTSKNDDTGLLPSVPG
                     LTSSNSKSSADNSSSRSSGSVMDQRRANAQRDDTLRVGRE"
     gene            467925..468923
                     /locus_tag="RAHAQ2_RS02210"
                     /old_locus_tag="Rahaq2_0458"
     CDS             467925..468923
                     /locus_tag="RAHAQ2_RS02210"
                     /old_locus_tag="Rahaq2_0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573766.1"
                     /note="with HflK inhibits proteolysis of lambda cII
                     protein by FtsH; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_013573766.1"
                     /db_xref="GI:503339105"
                     /translation="MRKSFLLIVVVVLVALYASLFVVQEGQRGIVLRFGKVLRDSDNK
                     PLVYAPGLHFKVPFVESIKMLDARIQTMDNQADRFVTSEKKDLIVDSYLKWRISDFSR
                     YYLATGGGDVSQAEILLKRKFSDRLRSEIGRLDVKDIVTDSRGRLTLDVRDALNTGSV
                     GDEPEATTEADDAIASAAKRVEQETKGKQPAVNPNSMAALGIEVVDVRLKQINLPEEV
                     SSAIYDRMRAERNAVALRHISQGKEEATKIQAAADYERTRTVAEAERTARITRGEGDA
                     EAAKLFADAFSQDPDFYAFIRSLRAYEASFKSGNDVMVLSPDSDFFRFMKSPEKNK"
     gene            469018..469218
                     /locus_tag="RAHAQ2_RS02215"
                     /old_locus_tag="Rahaq2_0459"
     CDS             469018..469218
                     /locus_tag="RAHAQ2_RS02215"
                     /old_locus_tag="Rahaq2_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013573767.1"
                     /db_xref="GI:503339106"
                     /translation="MNATIWLALALVLVLEGLGPMLYPKTWRKMILSLANLPDTVLRR
                     FGGGLVVAGFVIYYMLRSRLGG"
     gene            469363..470661
                     /locus_tag="RAHAQ2_RS02220"
                     /old_locus_tag="Rahaq2_0460"
     CDS             469363..470661
                     /locus_tag="RAHAQ2_RS02220"
                     /old_locus_tag="Rahaq2_0460"
                     /EC_number="6.3.4.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004707016.1"
                     /note="catalyzes the formation of
                     N6-(1,2,-dicarboxyethyl)-AMP from L-aspartate, inosine
                     monophosphate and GTP in AMP biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthetase"
                     /protein_id="WP_013573768.1"
                     /db_xref="GI:503339107"
                     /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTL
                     VINGEKTVLHLIPSGILRENVTSIIGNGVVLAPDALMKEMGELEARGIPVRERLLLSE
                     ACPLILPYHVALDMAREKARGDKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAI
                     KLKEIIEYHNFQLVNYYKVEAVDFQKTLDDVMAIADILTAMVVDVSELLDGARKRGDL
                     IMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGA
                     GPFPTELFDETGEFLRKQGNEFGATTGRSRRCGWLDIVAVRRSVQINSLSGFCLTKLD
                     VLDGLKEVKLCVGYRMPDGREMTTTPLAAEGWEGIEPIYEIMPGWTETTFGVKEVENL
                     PQAALNYIKRIEELTEVPVDIISTGPDRSETMILRDPFDA"
     gene            470889..471314
                     /locus_tag="RAHAQ2_RS02225"
                     /old_locus_tag="Rahaq2_0461"
     CDS             470889..471314
                     /locus_tag="RAHAQ2_RS02225"
                     /old_locus_tag="Rahaq2_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017492193.1"
                     /note="negatively regulates the transcription of genes
                     upregulated by nitrosative stress; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013573769.1"
                     /db_xref="GI:503339108"
                     /translation="MQLTSFTDYGLRALIYMASLPDDQMTNISQVTEVYGVSRNHMVK
                     IINQLSRAGLVTAVRGKNGGIKLGKPAETIRIGDVVRELEPLSLVNCASDFCHITPAC
                     RLKQVLHTAVEHFLDELNQYTLADMVKDNSTLYKLLLVE"
     gene            471356..473854
                     /locus_tag="RAHAQ2_RS02230"
                     /old_locus_tag="Rahaq2_0462"
     CDS             471356..473854
                     /locus_tag="RAHAQ2_RS02230"
                     /old_locus_tag="Rahaq2_0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333662.1"
                     /note="3'-5'exoribonuclease that acts nonspecifically on
                     poly(A), poly(U) and ribosomal RNAs; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exoribonuclease R"
                     /protein_id="WP_014333662.1"
                     /db_xref="GI:504099668"
                     /translation="MSQDPFLEREAEKYESPIPSREFILEHLAKRETPASREEIGNEL
                     NLSGEEALEALRRRLRAMERDGQLVFTRRQCYALPERLDLLKGTVIGHRDGYGFLRLE
                     GVKKDDVYLSAEQMKMCIHGDVVLAQPVGTDRKGRREARIVRVLVPKTSQIVGRYFTD
                     AGAGFVVPDDSRLSFDILIPADAINGARMGYMVVVELTQRPTRRTKAVGKIVEVLGDK
                     MGTSMAVDIALRTHEIPHVWPPQVLKQVEDLSEQVPEEAKKGRVDLRSLPLVTIDGED
                     ARDFDDAVYCEKKRGGGWRLWVAIADVSYYVRHGTALDDEARSRATSVYFPSQVVPML
                     PEVLSNGLCSLNPQVDRLCMVCEMTISAQGKLTSSKFYEAVMSSHARLTYNKVWRIIE
                     GDPELREQYSPLVKHLLELHTMYKVLDQARAERGGIAFETEEAKFIFNAERRIERVEP
                     TVRNDAHKLIEECMIMANIAAARFVEKHNEPALFRVHDRPSDDHISALKSVLGELGLV
                     MGGGMKPEPKDYAQIMDELADRPDREMLQTMLLRSMKQAIYDPENRGHFGLALPSYGH
                     FTSPIRRYPDLALHRAIKYLLAKEHGTLKDRWTPTGGWHSDYEDMLQLGEHCSMAERR
                     ADEATRNVADWLKCDFMQDHVGETFTGIIASVTGFGFFVRLNDLFIDGLVHVSSLDND
                     YYRYDNIGQRLVGESSGAVYRLGDTVEIRVEAVHMDERKIDFALVSSTRKARGEGKTA
                     RDRAKKGGERTMRSAAPANAGRRRTAKKNVNFEPDSAFRKDDAKTAKPKKEKAASAVG
                     KDGKPKKVKKPSDKTAKIAAATRAKRAKKKQPDS"
     gene            473947..474690
                     /locus_tag="RAHAQ2_RS02235"
                     /old_locus_tag="Rahaq2_0463"
     CDS             473947..474690
                     /locus_tag="RAHAQ2_RS02235"
                     /old_locus_tag="Rahaq2_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411562.1"
                     /note="Specifically methylates the ribose of guanosine
                     2251 in 23S rRNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (guanosine-2'-O-)-methyltransferase"
                     /protein_id="WP_014411562.1"
                     /db_xref="GI:504224460"
                     /translation="MSEIIYGIHSVKALLDNDPQRFLEVFILKGRDDKRLKPLIDELE
                     ASGIVIQVASRQWLDEKSEGAVHQGIIARVREGRQYQENDLPALLESLDCPFLLVLDG
                     VTDPHNLGACLRTADAAGVHAVIVPRDRSAKLNATAKKVASGAAENVPLINVTNLART
                     LRVLQEHNVWIVGTAGEADHDLFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPM
                     AGSVSSLNVSVATGVCLFEAVRQRGLKKS"
     gene            474843..476474
                     /locus_tag="RAHAQ2_RS02240"
                     /old_locus_tag="Rahaq2_0464"
     CDS             474843..476474
                     /locus_tag="RAHAQ2_RS02240"
                     /old_locus_tag="Rahaq2_0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333663.1"
                     /note="catalyzes the formation of 3-methylcrotonyl-CoA
                     from isovaleryl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl CoA dehydrogenase"
                     /protein_id="WP_014333663.1"
                     /db_xref="GI:504099669"
                     /translation="MDWETHRVFNQPKPLSNSNLFLSDTPLREAVSRQQAGWDADVLA
                     SLGQQLGSAESLELGRLANTNPPDLLRYDTTGERLDDVRFHPAWHLLMQGLIANRVHN
                     LPWQEDARIGSVVARAARFILHGQVEAGTLCPVTMTFGAIPLLQKYLPPEFSGWMKPL
                     LSDRYDPHLQSGDQKKGVLIGMGMTEKQGGSDVLSNTTRATALEGRGSGKPYHLVGHK
                     WFFSVPQSDAHLVLAQADGGLSCFFLPRVLPDGTRNAIRIERLKDKLGNRSNASSEVE
                     FQNATAWLLGEEGEGVRHILKMGGHTRFDCALGSHAMMRRALSVALYHAFQRQVFGKP
                     LTEQPMMRQTLSRMALHLEGQTMLLMRLAAACGARDNPAEQLLCRLLTPAAKFEVCRQ
                     GMPFVAEAMEVLGGIGYCEDSELPRLYREMPVNSIWEGSGNVMCLDVLRTLKKLPASA
                     DMVQQILHQARGQNRVFDRASRQFLQRLRTPEEAQGRWLTGQLCHLLTAAQMLEFASP
                     PVADAWCRMVLDPRGETLLPERLCQLLLNRAIGAE"
     gene            complement(476475..476786)
                     /locus_tag="RAHAQ2_RS02245"
                     /old_locus_tag="Rahaq2_0465"
     CDS             complement(476475..476786)
                     /locus_tag="RAHAQ2_RS02245"
                     /old_locus_tag="Rahaq2_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005175485.1"
                     /note="in Escherichia coli, mutation of this gene affects
                     biofilm maturation, stress response, and motility; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014333664.1"
                     /db_xref="GI:504099670"
                     /translation="MKSLRIPALLLVLAALSGCSNLMQTTPVAPPAATDKAQEITRAQ
                     TSTLTKIGSITVDVIGSPMDAEAEIQRRADAAGAHYYVIMFNSETIIPGRWYSQATLY
                     R"
     gene            complement(476882..478831)
                     /locus_tag="RAHAQ2_RS02250"
                     /old_locus_tag="Rahaq2_0466"
     CDS             complement(476882..478831)
                     /locus_tag="RAHAQ2_RS02250"
                     /old_locus_tag="Rahaq2_0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_014333665.1"
                     /db_xref="GI:504099671"
                     /translation="MKKASKRAFRRWSIGAKLASIASLLVGTLFIIFTLSLTHSAGKQ
                     VSELTVNAISEQVTGVVDMIEMYNASLNAEVDSYTRLFSHFLPSDFELDPASPVMVGD
                     QSAPVIKAGGTPLNLDSKIPDDFLARTGAISTVFARRGDDFIRVTTSLKKQDGSRAIG
                     TLLDNTSPAYAQIMAGQSFSGLATLFGKQYITKYQPVRDAQGNVIGILFVGVDITAEY
                     ADMRQKILSKRIGEKGYFFVLNSAPGKDQGKYLVHPTGEGKTPAWPDGELQQVMSQPK
                     GQREYTDAASQHQQFMVYANVPAWHWVVVGSTDKNSLMEQVNSTRNQFLLISLLALAC
                     FAALFIGLTRKLVSRPLSEVVRIAQQYASGDLRARAETQRIDEIGALMHAIDGIGHGL
                     EKIVDEVRQVSSEIMMSTQGLAHDSEQITQQIGTQASSLEETSASMEQITATVQNTAD
                     NATQATQLVQQTDKAATVGAEAVNQSVMSMEAIKHASTRIADITTVIEGIAFQTNILA
                     LNAAVEAARAGEHGRGFAVVASEVRALAQRSSNAVKEIENLVADSLGKVEDGHQSAAK
                     TQANMSHILQGINQVKVLMSDIDVASHEQSSGISQVNIAIMQIGKATQENATLVENSQ
                     QTVAALSEQGRHLSQLVSVFKISER"
     gene            479111..479860
                     /locus_tag="RAHAQ2_RS02255"
                     /old_locus_tag="Rahaq2_0467"
     CDS             479111..479860
                     /locus_tag="RAHAQ2_RS02255"
                     /old_locus_tag="Rahaq2_0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333666.1"
                     /note="YjfP; esterase activity towards palmitoyl-CoA and
                     pNP-butyrate in vitro; unknown function and substrate in
                     vivo; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl oligopeptidase family protein"
                     /protein_id="WP_014333666.1"
                     /db_xref="GI:504099672"
                     /translation="MIEMYEEDVDGIQIIHAVPAGQYQQQLPTIFFYHGFLSSKEIYS
                     YFGYTLAKTGFRVILPDALMHGARAEHSEERCLANFWHILQNNIDDLALLKEAFVGRG
                     LADPQRLGVGGVSMGGMTTMAALVKFPWIKAAANLMGSGYFAHLSHHLFPAYNAGGMV
                     QRDVFEREIAPLLSLDISGKAALIADIPLFVWHGEEDDVVPFGESQRLRQELAESGAD
                     ANLTFISEAGARHKVSVHALAEATAFFAAKL"
     gene            480011..480403
                     /gene="rpsF"
                     /locus_tag="RAHAQ2_RS02260"
                     /old_locus_tag="Rahaq2_0468"
     CDS             480011..480403
                     /gene="rpsF"
                     /locus_tag="RAHAQ2_RS02260"
                     /old_locus_tag="Rahaq2_0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411563.1"
                     /note="binds cooperatively with S18 to the S15-16S
                     complex, allowing platform assembly to continue with S11
                     and S21; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="WP_013573776.1"
                     /db_xref="GI:503339115"
                     /translation="MRHYEIVFMVHPDQSEQVPGMIERYSAVITNAAGQIHRLEDWGR
                     RQLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRTKHAVTEASPM
                     VKAKDERRDRREDFAEANDDAEAGDSEE"
     gene            480731..480958
                     /gene="rpsR"
                     /locus_tag="RAHAQ2_RS02265"
                     /old_locus_tag="Rahaq2_0470"
     CDS             480731..480958
                     /gene="rpsR"
                     /locus_tag="RAHAQ2_RS02265"
                     /old_locus_tag="Rahaq2_0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012986941.1"
                     /note="binds as a heterodimer with protein S6 to the
                     central domain of the 16S rRNA; helps stabilize the
                     platform of the 30S subunit; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="WP_002210155.1"
                     /db_xref="GI:488138947"
                     /translation="MARYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRI
                     TGTRAKYQRQLARCIKRARYLSLLPYTDRHQ"
     gene            480998..481450
                     /gene="rplI"
                     /locus_tag="RAHAQ2_RS02270"
                     /old_locus_tag="Rahaq2_0471"
     CDS             480998..481450
                     /gene="rplI"
                     /locus_tag="RAHAQ2_RS02270"
                     /old_locus_tag="Rahaq2_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004707026.1"
                     /note="in Escherichia coli this protein is wrapped around
                     the base of the L1 stalk; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_014333667.1"
                     /db_xref="GI:504099673"
                     /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNV
                     EFFEARRAELEAKLADVLNAAEARATKINELGSVTIASKSGDEGKLFGSIGTRDIADA
                     VTAAGVEVAKSEVRLPNGVLRTTGDHEVEFQVHSDVFAKLNVIVVAEA"
     gene            complement(481548..482258)
                     /locus_tag="RAHAQ2_RS02275"
                     /old_locus_tag="Rahaq2_0472"
     CDS             complement(481548..482258)
                     /locus_tag="RAHAQ2_RS02275"
                     /old_locus_tag="Rahaq2_0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope opacity-associated protein A"
                     /protein_id="WP_014333668.1"
                     /db_xref="GI:504099674"
                     /translation="MGRIPPRRRKAIRIYQPMLRSWIAIMKRPMRDTTAPQSESESEI
                     TSAETETGTSAATRGKTLLSKIWHMSDDFHWMSPLPYAHRRGMILAALVILLALLWPY
                     TPENTYAPSQPQQPASIPMQADLRNDQGRTTQMAQPEPVQPQSNDNSGTWRSYQVQSG
                     QTLAQLFRDNNMAVNDVFSMARVEGADKPLSTLKTGQEVKIQRDAQGAVMALQVTTDQ
                     NVTVTFTRQPDGSFQRGN"
     gene            482514..483134
                     /locus_tag="RAHAQ2_RS02280"
                     /old_locus_tag="Rahaq2_0473"
     CDS             482514..483134
                     /locus_tag="RAHAQ2_RS02280"
                     /old_locus_tag="Rahaq2_0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014701238.1"
                     /note="FKBP-type; rotamase; catalyzes the cis-trans
                     isomerization of proline imidic peptide bonds in
                     oligopeptides; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_014333669.1"
                     /db_xref="GI:504099675"
                     /translation="MTTPSFDSVEAQASYGIGLQVGQQLQESGLQGLEPDALLAGLRD
                     ALEGNTPAVPVDVVHRALREVHERADAVRRERQEALAVQGQEFLTANAQREGVSSTES
                     GLQFSVITQGEGSIPGRQDRVRVHYTGKLIDGTVFDSSVQRGEPAEFPVNGVIAGWIE
                     ALTLMPVGSKWELYIPHNLAYGERGAGASIPPYSALIFEVELLEIL"
     gene            complement(483200..483865)
                     /locus_tag="RAHAQ2_RS02285"
                     /old_locus_tag="Rahaq2_0474"
     CDS             complement(483200..483865)
                     /locus_tag="RAHAQ2_RS02285"
                     /old_locus_tag="Rahaq2_0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573781.1"
                     /note="Involved in anaerobic NO protection and iron
                     metabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster repair di-iron protein"
                     /protein_id="WP_014333670.1"
                     /db_xref="GI:504099676"
                     /translation="MDYRDQPLGALAVAIPRATRLFRQYDLDFCCGGKQTLLRAVTKK
                     ELDIDLIEQQIAEIARQPDTSTDWKSAPLAQIIDFIIPRYHDRHRQELPELVLMAEKV
                     ERVHGDKLPCPHGLAVQLQLILEELTSHMMKEEQILFPMIRGGMGRQAAGPISVMERE
                     HDDAGQILEEIKRLTHNVTPPEGACVTWRALYAGINEFITDLMEHIHLENNLLFPRAL
                     RGE"
     gene            complement(483990..485939)
                     /gene="cpdB"
                     /locus_tag="RAHAQ2_RS02290"
                     /old_locus_tag="Rahaq2_0475"
     CDS             complement(483990..485939)
                     /gene="cpdB"
                     /locus_tag="RAHAQ2_RS02290"
                     /old_locus_tag="Rahaq2_0475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573782.1"
                     /note="periplasmic enzyme; functions during ribonucleic
                     acid degradation; 2',3'-cyclic nucleotides are first
                     converted to 3'-nucleotide and then cleaved to yield a
                     ribonucleotide and a phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-nucleotidase"
                     /protein_id="WP_014333671.1"
                     /db_xref="GI:504099677"
                     /translation="MNKRHLTLSLLATLTATSVQASQVDLRIMETTDLHSNMMDFDYY
                     KDKPTDKFGLVRTASLIHAARNEVTNSVLVDNGDIIQGSPLGDYMAAKGLKQGDVHPV
                     YLAMNTLNYAVGNLGNHEFNYGLDYLKKALAGAKFPYVNANVIDDKTGKPLFTPFLIT
                     DNAVKDREGKTHNLRIGYIGFVPPQIMVWDKANLQGKVTVADITETAKKWIPEMRKQG
                     ADIIVAIPHSGLSGDPYKTLAENSVYYLSQVKGIDAIMFGHAHAVFPSEEFASIKGAD
                     IRQGTLNGVPAVMPGMWGDHLGVVDMVLNNDSGSWKVETAKAEARPIYDKEQKKSLAA
                     EDQSLVKVLAPSHDATRKFVSKPIGKSTDNMYSYLALVQDDPTVQIVNNAQKAYTEHF
                     IQGDPDLADLPVLSAAAPFKVGGRKNDPASFVEVEKGELTFRNAADLYLYPNTLVVMK
                     VTGQEVKDWLECSAGQFNQIDIHNTKPQSLINWDGFRTYNFDVIDGVKYEVDVSQPAK
                     FDGECTLINKEAERIKNLTYNGKPIDLKASFLVATNNYRAYGGKFAGTGDKHIAFASP
                     DENRSVVAAYISAETKKAGAVTPTADNNWKLAKITATQPLDIRFETSPGDKAAAFIQS
                     HAQYPMTAKGTDAIGFEIYQVDLQK"
     gene            486138..486884
                     /locus_tag="RAHAQ2_RS02295"
                     /old_locus_tag="Rahaq2_0476"
     CDS             486138..486884
                     /locus_tag="RAHAQ2_RS02295"
                     /old_locus_tag="Rahaq2_0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333672.1"
                     /note="catalyzes the formation of AMP from
                     adenosine-3',5'-bisphosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5'-bisphosphate nucleotidase"
                     /protein_id="WP_014333672.1"
                     /db_xref="GI:504099678"
                     /translation="MLEQICQLARDAGDAIMAVYDGEQPLDARHKKDDSPVTAADIAA
                     HNVIKAGLQTLDPQTPMLSEEDPQSWGERQNWTRYWLVDPLDGTKEFLKRNGEFTVNI
                     ALIEDGIPVLGVVYVPVTKVMYSAAEGKAWKEEQGVRQQIAVKEAHPPLVVVSRSHFS
                     NDPELQDYLAQLGEHQTVAIGSSLKFCLVAEGTAQLYPRFGPTNIWDTGAGHAVALAA
                     GAQVHDWKGQTLDYVPRESFLNPGFRVSLF"
     gene            complement(486921..487478)
                     /locus_tag="RAHAQ2_RS02300"
                     /old_locus_tag="Rahaq2_0477"
     CDS             complement(486921..487478)
                     /locus_tag="RAHAQ2_RS02300"
                     /old_locus_tag="Rahaq2_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333673.1"
                     /db_xref="GI:504099679"
                     /translation="MLLRSLFVIIFMTFSFFASAHNFTVGQRLAPVGVDDKGELNDIK
                     DVFSYSKWNSAKLPGKVRIVQHMAGRSSAKALNEPLITAIRAANLPHDRYQTTTIVNT
                     DDAIIGTGLFVRKSIESGKREFPWSQVIVDSHGAVKKAWELQPESSAVVVLDKNGVIK
                     LAKDGQLSPQEVQQVITLVDHLVKE"
     gene            487788..487994
                     /locus_tag="RAHAQ2_RS02305"
                     /old_locus_tag="Rahaq2_0478"
     CDS             487788..487994
                     /locus_tag="RAHAQ2_RS02305"
                     /old_locus_tag="Rahaq2_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333674.1"
                     /db_xref="GI:504099680"
                     /translation="MRIFQRYNPMKVAKYVKTLFRGRLYIKDVGAFEFDHGKILLPKV
                     RDKRHFSVMSEVNRQVTHLQTEMG"
     gene            complement(488108..489457)
                     /locus_tag="RAHAQ2_RS02310"
                     /old_locus_tag="Rahaq2_0479"
     CDS             complement(488108..489457)
                     /locus_tag="RAHAQ2_RS02310"
                     /old_locus_tag="Rahaq2_0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333675.1"
                     /db_xref="GI:504099681"
                     /translation="MLNSILLILLLIAISAFFSLSEISLAASRKIKLKQLADEGNVNA
                     SRVMKLQETPGLFFTVVQIGLNAVAILGGIVGDAAFSPAFQTFFIRFMSPEMADQISF
                     IFSFVLVTSLFILFADLTPKRIGMISPESVAVRIVNPMRFCLMICRPMVWFFNGMANT
                     IFRLFKLPMVRNDDITSDDIYAVFEAGALAGVLRKQEHELIENVFELESRTVPSSMTS
                     RESVIYFDLRESEESIKEKIATHPHSKFLVCDGHIDQVVGYVDSKDLLNRVLGNQSLM
                     LSSGVQIRNALIVPDTLTLSEALESFKAAGEDFAVILNEYALVVGIITLNDVMTTLMG
                     DLVGQGMEEQIVARDEHSWLIEGGTPIEDVMRVLHIEEFPQSGNYETIGGFMMFMLRK
                     IPKRTDFVKFSGFKFEVVDIDSYKIDQLLVTRIVDQPVTPLLPKTPQEIKDEKKAQG"
     gene            complement(489686..490324)
                     /locus_tag="RAHAQ2_RS02315"
                     /old_locus_tag="Rahaq2_0480"
     CDS             complement(489686..490324)
                     /locus_tag="RAHAQ2_RS02315"
                     /old_locus_tag="Rahaq2_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333676.1"
                     /note="this stereospecific enzymes reduces the S isomer of
                     methionine sulfoxide while MsrB reduces the R form;
                     provides protection against oxidative stress; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase A"
                     /protein_id="WP_014333676.1"
                     /db_xref="GI:504099682"
                     /translation="MVQLSDKTQSVTQAEALPGRTTPMPVATLHAVNGHSMTYVPENM
                     EVAIFAMGCFWGVERLFWQQEGVYSTAAGYSGGFTPNPTYREVCTGQTGHAEVVRVVF
                     DPAVISYAKLLQIFWENHDPAQGMRQGGDIGTQYRSALYVLSAEQQDQALASLASFQQ
                     AMDEANDKRTITTEITEALPFYYAEDEHQQYLFKNPEGYCGLGGIGVCLPPL"
     gene            490594..492330
                     /locus_tag="RAHAQ2_RS02320"
                     /old_locus_tag="Rahaq2_0481"
     CDS             490594..492330
                     /locus_tag="RAHAQ2_RS02320"
                     /old_locus_tag="Rahaq2_0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333677.1"
                     /db_xref="GI:504099683"
                     /translation="MPRYRELGLLFVLLAPSLSMAAKVRLQLEGLDGDLERNVRVRLS
                     SIQSDEVGANGRFRARVSAAIEQGLRPLGYYSPTIDFDYRETPPPGRPVLIAKVTPGI
                     PVKIAGTSVVIEGQADKDNEFEQLKQRDVPAVGTILNHGTYDNFKSSLTGIALRKGYF
                     DATMRKSQLGVIEDEHKAFWDIQFDSGERYRFGEVHYQGSQIRDEYLQNLVPFHQGDY
                     YTTAQLAELNRRLSATGWFNSVVVSPDFTDAKTTKTLPLNAVVSPRTENTIETGIGYS
                     TDIGPRVTANWKKPWVNDRGQSFETSTTLSGPEQSLDLSYKIPLLKSPLEQYYLVQGG
                     FKREDLNDTNSDSTTVNLARYWDLSSGWQHAVNLRWSLDHFTQGSVTNTTMLIYPGVS
                     LNRTRQRGGLMPTWGDSQRYSLDVSNTTWGSDVDFAVVQAQNVWIRTLADKHRFVFRG
                     NLGWIETNDFDRVPPSLRFFAGGDRSIRGYKYKSISPRDDEGKLTGASYLGTGSVEYQ
                     YNVTGKWWGAVFVDSGEAVNDITQNDFKTGAGVGVRWASPIGPVKLDVAAPVGDKDEH
                     GLQFYIGLGPEL"
     gene            492327..496142
                     /locus_tag="RAHAQ2_RS02325"
                     /old_locus_tag="Rahaq2_0482"
     CDS             492327..496142
                     /locus_tag="RAHAQ2_RS02325"
                     /old_locus_tag="Rahaq2_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333678.1"
                     /db_xref="GI:504099684"
                     /translation="MSLFKKICLGFLIFLVLLISLVAFLVGTQTGLHLMINGANRFVP
                     GLNIASTEGGWRDLTLKGVHYEMPGVDVKAGEFHLSLDFSCLKNSALCVNALRVKDVN
                     VVVNTKEMTPAAAQPEPENNEPLTNLSTPYPITLRLLTLDNINITLDDRAISLASFRT
                     GAHWEGRAIQLMPTRIGGLLIALPKTPVSPLPEVVQAAQDKAIEKATGKPAEPPVVVP
                     EKPLGETLQALFAKPLLPELPDFRLPVDLNIQQILAENLRLTGDTDVLITRFELKAST
                     QNQSVKLDKLMVRSPQGSVDGVGQATLNQNWPVDMTVNTAVNIDPLKGEKIKLKVTGG
                     LRDKLDVGLNLSGPLRAQLALQTQLAETGLPLDLQLTSDALQWPLTGTPQYQVKGFNL
                     NLSGKATGYALSLRSDFKGDQIPPATLTLDGKGNVEQFRLTLLRLAALEGNTDLTGVV
                     DWSKAISWNSELKLSGINTARQYPDWPAKLQGKITTRGSLYGGTWQMQIPVLDLTGNV
                     KQNAVKAQGNVRGNSYGQWDIPQLHLELGRNNLDVKGTLGDTWDLDAKVDAPHLDGAL
                     PGLGGVVKGMLQLRGDLKAPKLLADLTATGLKWQALTVRRVDIKGDVSSTDQIQGNLA
                     VRVQQLKQDALDITDINLDAKGNEKKHELTLKVDGKPVSGRLALSGSFDRATEEWKGS
                     ITNTLFDTPVGQWRLNRSIALDYFNKEQRITVGPHCWQNPNADLCVPKTIDAGASGQA
                     SVVLNRFDLAMIKPFLTDDTQLSGVFSGKADVSWKAEGGLPQASVSLVGKGVKVQQRV
                     QGSPLPVAFDTLNLNAGLNNGRANLDWLIKITHNGQLDGSIQIADPQGKRNLSGNVNI
                     ARISMALLQPALMDGEKASGILNANLRLGGNAQKPLVFGKLALTDVDFDAQFMPFDIT
                     DANIGINFNGMSSIMEGVIKTAQGQLELNGNADWSELNAWRARIAARGNKVRVSVPPM
                     VRLDVSPDLVFDATPQLFSLNGTVDIPWARITVQELPESAVGVSSDEVMLNDQRQPIA
                     PASASIPINSNLMVNIGKDVRLDAFGLKARLEGALKVAQDSRGLGLNGQINIPSGRFH
                     AYGQDLIVRKGQLLFSGPADQPLLNLEAIRNPDATENDVVAGLRVTGEADAPKLEIFS
                     DPAMSQQEALSYLLRGQGLDNSGGDSGAMTSALIGLGVAQSGKLVGKIGEAFGVSNLA
                     LDTQGVGDSSQVVVSGYVLPGLQVKYGVGIFDSLATLTLRYRLMPKLYLQAVSGIDQA
                     LDLLYQFEF"
     gene            496174..496527
                     /locus_tag="RAHAQ2_RS02330"
                     /old_locus_tag="Rahaq2_0483"
     CDS             496174..496527
                     /locus_tag="RAHAQ2_RS02330"
                     /old_locus_tag="Rahaq2_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamylcyclotransferase"
                     /protein_id="WP_013573790.1"
                     /db_xref="GI:503339129"
                     /translation="MRIIVYGSLRRKQGNSHWMTNAQWLGDHELEGYALYNLGHYPAV
                     IPGEGKVYCEVYRINSSIMAELDELKSNTKDYRRELISTPYGSAWIYLYIRSLDGVPR
                     IEGGDWVKRNEAVSE"
     gene            complement(496644..497174)
                     /locus_tag="RAHAQ2_RS02335"
                     /old_locus_tag="Rahaq2_0484"
     CDS             complement(496644..497174)
                     /locus_tag="RAHAQ2_RS02335"
                     /old_locus_tag="Rahaq2_0484"
                     /EC_number="3.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017492211.1"
                     /note="catalyzes the hydrolysis of pyrophosphate to
                     phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="WP_013573791.1"
                     /db_xref="GI:503339130"
                     /translation="MSLLNVPAGKELPEDIYVVIEIPANADPIKYEVDKDTGALFVDR
                     FMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGMLKMTDEAGE
                     DAKLVAVPHTKLSKEYDHIKDVNDLPELLRGQITHFFEQYKALEKGKWVKVDGWADAA
                     AAKAEIVTSFERAKNK"
     gene            497491..499062
                     /locus_tag="RAHAQ2_RS02340"
                     /old_locus_tag="Rahaq2_0486"
     CDS             497491..499062
                     /locus_tag="RAHAQ2_RS02340"
                     /old_locus_tag="Rahaq2_0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_014333680.1"
                     /db_xref="GI:504099686"
                     /translation="MLNKLSVKAGLIGLLVFMTLILLLVSVLGANAIRQSAVSLQQIN
                     QLQGDELGSLADSYSFSLRTRVASGVAVRQLEIGMMDDAKNTADRIGGYIKQADTDLA
                     KFVSIQDDTQQGRDLSDAVKKTYDAYKAHGLMPLLAAIQAQSADGYYDVLENKITPYS
                     NAYDKALADFRAYAVDNTNKRIEQARANARIQLTIIAISFIITLIIAVLAWFALQKII
                     MHPLRFSIAQLEYIAQGDLTHEIDDSRNNEMGRLLKAMKQMQDSLALSVGRVRDAGNQ
                     IDVGSRELAAGNVHLAQRTEESAASLEETAASMEQLTSTVRMNAANSDQANQLAQSVS
                     VIANKGSEVVHQVMDKMQGITESSKRIGDIITVIDGIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRSLAQRSAQSAKEIKELIVDSENRVSEGSDMVKSAADTMLEISSEVT
                     RVTSLMREITIATTEQTHGIEQVNVAITQMDQVAQQNAALVEQATAATRSLEEQAQLL
                     AKSMAVFKLNRADQF"
     gene            complement(499190..500194)
                     /locus_tag="RAHAQ2_RS02345"
                     /old_locus_tag="Rahaq2_0487"
     CDS             complement(499190..500194)
                     /locus_tag="RAHAQ2_RS02345"
                     /old_locus_tag="Rahaq2_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004955940.1"
                     /note="catalyzes the formation of D-fructose 6-phosphate
                     from fructose-1,6-bisphosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="WP_014333681.1"
                     /db_xref="GI:504099687"
                     /translation="MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAG
                     LVDILGTSGAENVQGEVQMKLDLYANEKLKAAMKARGEIAGIASEEEDEIVIFEGERA
                     ENAKYVILMDPLDGSSNIDVNVSVGTIFSIYRRTTPLGQPVTEADFLQPGNRQVAAGY
                     VVYGSSTMLVYTTGAGVHAFTYDPSLGVFCLSHEKVCFPEKGNMYSINEGNYIKFPLG
                     VKKYIKYCQEQDEATQRPYTSRYIGSLVADFHRNLLKGGIYIYPSTASHPNGKLRLLY
                     ECNPMAFLAEQAGGKASDGKNRILDIIPQKLHERAPFFVGNSSMVEDAERFIAQFPDE
                     "
     gene            500362..501747
                     /locus_tag="RAHAQ2_RS02350"
                     /old_locus_tag="Rahaq2_0488"
     CDS             500362..501747
                     /locus_tag="RAHAQ2_RS02350"
                     /old_locus_tag="Rahaq2_0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333682.1"
                     /note="ligates
                     L-alanyl-gamma-D-glutamyl-meso-diaminopimelate to
                     UDP-N-acetylmuramic acid for reincorporation into
                     peptidoglycan; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="WP_014333682.1"
                     /db_xref="GI:504099688"
                     /translation="MRIHILGICGTFMGGLAMLARAQGHQVTGSDDNVYPPMSTLLEN
                     QGIDLIQGYDPAQLDPQPDLVIIGNAMTRGNPCVEAVLELGIPYVSGPQWLHDHVLPE
                     RWVIAVAGTHGKTTTAGMVTWILEACGYEPGYVIGGVPGNFEVSARLGNSPFMVLEAD
                     EYDCAFFDKRSKFVHYSPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRLVPGKGKII
                     LPEHDTPLKQVMAMGCWSEQEFVGDAENCVWDAKKLTPDSSTFEVYLRGEVVGQVNWS
                     LVGEHNMHNGLMAIAAARHVGVKPEDACKALGDFINARRRLELRGVENDVSVYDDFAH
                     HPTAILATLSALRSKVGGTARILAVLEPRSNTMKMGMSKNELAPSLGRADEVFLLQPQ
                     HIPWQVAEVAEHCIQPAHWSADVDSLVDMVIKASQPGDHILVMSNGGFGGIHGKLLTA
                     LAAKAQAVPEL"
     gene            complement(502067..502330)
                     /locus_tag="RAHAQ2_RS02355"
                     /old_locus_tag="Rahaq2_0489"
     CDS             complement(502067..502330)
                     /locus_tag="RAHAQ2_RS02355"
                     /old_locus_tag="Rahaq2_0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333683.1"
                     /db_xref="GI:504099689"
                     /translation="MKIITAIAAFSLLSAVSFGASAAQLVTNQQAENLQPMGTISVSG
                     VDGVPTDIRQQLSDKADNKGAKSFRVIEAHNDGAYHATAEIYQ"
     gene            complement(502534..502797)
                     /locus_tag="RAHAQ2_RS02360"
                     /old_locus_tag="Rahaq2_0490"
     CDS             complement(502534..502797)
                     /locus_tag="RAHAQ2_RS02360"
                     /old_locus_tag="Rahaq2_0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333684.1"
                     /db_xref="GI:504099690"
                     /translation="MKVKTTIATLSILSALSFGVFAAQPVTQEQASAMQPAGMISVSG
                     VAGAPSDIRQALSDKADAKGAKAFRVIEAREEGNYHATAEIYQ"
     gene            complement(503249..503719)
                     /locus_tag="RAHAQ2_RS02365"
                     /old_locus_tag="Rahaq2_0491"
     CDS             complement(503249..503719)
                     /locus_tag="RAHAQ2_RS02365"
                     /old_locus_tag="Rahaq2_0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004723011.1"
                     /note="regulates arginine biosynthesis when complexed with
                     arginine by binding at site that overlap the promotors of
                     the arginine biosynthesis genes; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine repressor"
                     /protein_id="WP_014333685.1"
                     /db_xref="GI:504099691"
                     /translation="MRNPAKQEDLIKAFKALLKEEKFSSQGEIVVALQDDGFENINQS
                     KVSRMLTKFGAVRTRNAKMEMVYCLPAEIGVPTTTSPLKNLVLDIDYNDAIVVIRTSP
                     GAAQLIARLLDSLGKSEGILGTIAGDDTIFITPARRFSVKQLHDAILSLFEQEL"
     gene            504184..505122
                     /locus_tag="RAHAQ2_RS02370"
                     /old_locus_tag="Rahaq2_0492"
     CDS             504184..505122
                     /locus_tag="RAHAQ2_RS02370"
                     /old_locus_tag="Rahaq2_0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004699887.1"
                     /note="oxidizes malate to oxaloacetate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_014333686.1"
                     /db_xref="GI:504099692"
                     /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAV
                     DLSHIPTAVKIKGFCGEDAKPALEGADIVLISAGVARKPGMDRSDLFNVNAGIVRNLI
                     QQVASTCPKASIGIITNPVNTTVAIAAEVLKNAGVYDKNKLFGVTTLDTIRSNTFVAE
                     LKGKQPEEIEVPVIGGHSGVTILPLLSQISDVSFTESEIAALTQRIQNAGTEVVEAKA
                     GGGSATLSMGQAAARFGLSLVRAMQGERNVVECAYVEGKGDYARFFAQPVLLGQNGIA
                     ELIDIGQLSAFEQQSLDSMLDILRKDIELGEQFINK"
     gene            506101..506460
                     /locus_tag="RAHAQ2_RS02375"
                     /old_locus_tag="Rahaq2_0494"
     CDS             506101..506460
                     /locus_tag="RAHAQ2_RS02375"
                     /old_locus_tag="Rahaq2_0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014333688.1"
                     /db_xref="GI:504099694"
                     /translation="MKKEWFAAKELTGKEGLPTSTQGIHGMARRLCWIKRRRLGVQGR
                     AVEYHIDSLPGNAAASLSMNERSAEYVYTSHQDPLAIWIESYKQLKEPERETMISFIV
                     REGISELLSRLREPEKN"
     gene            complement(506513..507484)
                     /locus_tag="RAHAQ2_RS02380"
                     /old_locus_tag="Rahaq2_0495"
     CDS             complement(506513..507484)
                     /locus_tag="RAHAQ2_RS02380"
                     /old_locus_tag="Rahaq2_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017492901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl diphosphate synthase"
                     /protein_id="WP_014333689.1"
                     /db_xref="GI:504099695"
                     /translation="MNLEQIIDLTQDDMAAVNASILEQLNSEVSLINQLGYYIISGGG
                     KRIRPMIAVLAAKALSYEGDKHIKVAALIEFIHTATLLHDDVVDESDMRRGKATANAA
                     FGNAASVLVGDFIYTRAFQMMTDLESLPVLALMAKAVNVIAEGEVQQLINCNDPDITE
                     TSYMQVIYSKTARLFEAAAQASAMLADGNSQQIKALQDYGRYLGTAFQLIDDLLDYDA
                     DGETLGKNTGDDLDEGKPTLPLLHAMQHGDAEQSAMIRKAIEEGNGRHLLEPVLAAMH
                     QWGSLAYTRQRAEEEADKAIQALQVLPASEYRSALEGLAHMSVKRDF"
     gene            507744..508055
                     /gene="rplU"
                     /locus_tag="RAHAQ2_RS02385"
                     /old_locus_tag="Rahaq2_0496"
     CDS             507744..508055
                     /gene="rplU"
                     /locus_tag="RAHAQ2_RS02385"
                     /old_locus_tag="Rahaq2_0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4WEZ9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="WP_013573804.1"
                     /db_xref="GI:503339143"
                     /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDVATGEAIEFDQVLMIANG
                     EEINIGLPLVAGGVIKAEVVAHGRGEKVKIVKFRRRKHYRKQQGHRQWFTDVKITGIS
                     A"
     gene            508074..508331
                     /gene="rpmA"
                     /locus_tag="RAHAQ2_RS02390"
                     /old_locus_tag="Rahaq2_0497"
     CDS             508074..508331
                     /gene="rpmA"
                     /locus_tag="RAHAQ2_RS02390"
                     /old_locus_tag="Rahaq2_0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A8G8Z2.1"
                     /note="involved in the peptidyltransferase reaction during
                     translation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="WP_013573805.1"
                     /db_xref="GI:503339144"
                     /translation="MAHKKAGGSTRNGRDSEAKRLGVKRFGGEAVLAGSIIVRQRGTK
                     FHAGINVGCGKDHTLFALADGKVKFEVKGPKNRKYISIEAE"
     gene            508417..509374
                     /locus_tag="RAHAQ2_RS02395"
                     /old_locus_tag="Rahaq2_0498"
                     /note="membrane protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            509408..510580
                     /gene="obgE"
                     /locus_tag="RAHAQ2_RS02400"
                     /old_locus_tag="Rahaq2_0499"
                     /gene_synonym="cgtA; obg; yhbZ"
     CDS             509408..510580
                     /gene="obgE"
                     /locus_tag="RAHAQ2_RS02400"
                     /old_locus_tag="Rahaq2_0499"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573807.1"
                     /note="ObgE; essential GTPase; exhibits high exchange rate
                     for GTP/GDP; associates with 50S ribosomal subunit;
                     involved in regulation of chromosomal replication; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase CgtA"
                     /protein_id="WP_014333691.1"
                     /db_xref="GI:504099697"
                     /translation="MKFVDEATILVVAGDGGNGCVSFRREKYIPRGGPDGGDGGDGGD
                     VYLVADENLNTLIDFRFVKSYRAERGTNGQSSDCTGKRGKDITIKVPVGTRVLDQSTG
                     EVLADMTQNGQVNMVAKGGFHGLGNTRFKSSVNRSPRQKTMGTKGEERDIALELMLLA
                     DVGMLGLPNAGKSTFIRSVSAAKPKVADYPFTTLVPSLGVVRMDHEQSFVVADIPGLI
                     EGASEGAGLGIRFLKHLERCRVLLHLIDIAPIDESDPIENAKVIINELKQYNAKLAEK
                     PRWLVFNKVDLIEKEEAETRAKAIADALGWEGNYYLISAANREGVNALCWDVMKFINE
                     NPKHMAIEESAPEKVEFMWDDYHREQLAEVESEADDDWDDDWDEDDDEGVEIIYER"
     gene            complement(510652..511743)
                     /locus_tag="RAHAQ2_RS02405"
                     /old_locus_tag="Rahaq2_0500"
     CDS             complement(510652..511743)
                     /locus_tag="RAHAQ2_RS02405"
                     /old_locus_tag="Rahaq2_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein BasS/PmrB"
                     /protein_id="WP_014333692.1"
                     /db_xref="GI:504099698"
                     /translation="MTSMRRRLLVMLALILFVTQLTSVFWLWHESQEQINLLVNDTLS
                     VKVRNAHVEKEIAEAIASLIAPSLLMMSITLVLSFWAISWIIRPLNQLQKRLETRSAD
                     NLSPLPLNSEIREVVAVTNALNQLFSRLSTTIQQERLFTADAAHELRTPLAGVRLHLE
                     IMQKKGVEGSDTLISRIDLLMHTIEQLLMLARAGQNFAKGEYQQVDLISNVIKPLREE
                     LGEMLNERGQTLKVEMPPHAEIQGDAVLLRLMVRNLVENAYRYGPENSEISITIMQQQ
                     NGFLIQIDDAGPGIDETKASELTQAFRRVDQRYGGSGLGLNIVVRITHLHGGTLTLRN
                     RTGNAGLSAQCWLPDIALQSSLTLSPGTR"
     gene            complement(511740..512402)
                     /locus_tag="RAHAQ2_RS02410"
                     /old_locus_tag="Rahaq2_0501"
     CDS             complement(511740..512402)
                     /locus_tag="RAHAQ2_RS02410"
                     /old_locus_tag="Rahaq2_0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014333693.1"
                     /db_xref="GI:504099699"
                     /translation="MKLLIVEDDELLRQGLMLALTSENYACDCASTAAEAQSLIQASQ
                     YSLVILDLGLPDKDGATLLRQWRRQSISLPVLILTARDALEDRVDGLDAGADDYLIKP
                     FALVELQARVRALIRRYQGQSDNQISVGNLKINLSSQQAYLDGTPVEVTPKEFAILSR
                     LMMRAGQTVNRELLQQDLYTWQDDLGSNTLEVHVHNLRRKLGKEVIRTVRGIGYRLEI
                     IV"
     gene            complement(512423..513856)
                     /locus_tag="RAHAQ2_RS02415"
                     /old_locus_tag="Rahaq2_0502"
     CDS             complement(512423..513856)
                     /locus_tag="RAHAQ2_RS02415"
                     /old_locus_tag="Rahaq2_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573811.1"
                     /note="penicillin binding protein 4; penicillin sensitive;
                     catalyzes the formation of D-alanine from
                     D-alanyl-D-alanine; one of four, DD-carboxypeptidase
                     low-molecular weight penicillin-binding proteins that
                     remove terminal D-alanine from pentapeptide side chains;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="WP_014333694.1"
                     /db_xref="GI:504099700"
                     /translation="MRFLRIVSGLACAFVLNTNAAQIENYTEYLPDGTNLAVLVQKIG
                     APAPAIDYHGTQMALPASTMKILTALAALLQLGPDFRFTTTLETPGSVSDGVLKGDLV
                     ARFSGDPTLKRQNIRNMVAVLKKQGVKEITGDVVINTSVFASHDKAPGWPWNDITQCF
                     SAPPAAAIVDRNCFSVSLYSAPKPDENAFIRVASYYPVHMFSEVRTLAKGSPDAQYCE
                     LDVVPGEYNRYTLTGCLTQRSEPLPLAFAIQDGASYAGAILKDELLQADIQIDGTLKR
                     QTQPTPAGTVLAQTQSAPLHDLLHQMLKKSDNMIADTVFRTMGHQRFGVPGTWRAGSD
                     AVRQILRQKAGVDLGNSIQVDGSGLSRHDLLSPATMMQVLQYIAQHDKELDFISMLPL
                     AGHDGTLQYRGGLHEAGVDGKVSAKTGSLSGVYNLAGFITTASGQRMAFVQFLSGYAV
                     PPEDQRTRRAPLVRFESRLYRDIYQNN"
     gene            514141..514617
                     /gene="greA"
                     /locus_tag="RAHAQ2_RS02420"
                     /old_locus_tag="Rahaq2_0503"
     CDS             514141..514617
                     /gene="greA"
                     /locus_tag="RAHAQ2_RS02420"
                     /old_locus_tag="Rahaq2_0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573812.1"
                     /note="necessary for efficient RNA polymerase
                     transcription elongation past template-encoded arresting
                     sites; arresting sites in DNA have the property of
                     trapping a certain fraction of elongating RNA polymerases
                     that pass through, resulting in locked ternary complexes.
                     Cleavage of the nascent transcript by cleavage factors
                     such as GreA or GreB allows the resumption of elongation
                     from the new 3'terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="WP_014333695.1"
                     /db_xref="GI:504099701"
                     /translation="MKPIPMTLRGAERLREELDHLKSVRRPKIISDIATAREHGDLKE
                     NAEYHAAREQQGFCEGRIQEIEAKLSNAQVIDVTKMPVTGRVIFGATVTVMNLDTEEE
                     QKYRIVGDDEADFKQNLISVNSPIARGLIGKEQDDVVVIKTPGGDVEFEVLKVEYL"
     gene            complement(514798..515094)
                     /locus_tag="RAHAQ2_RS02425"
                     /old_locus_tag="Rahaq2_0504"
     CDS             complement(514798..515094)
                     /locus_tag="RAHAQ2_RS02425"
                     /old_locus_tag="Rahaq2_0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573813.1"
                     /note="RNA binding protein found associated to pre-50S
                     subunit of the ribosome; putative role in ribosome
                     assembly; necessary for optimal growth but not cell
                     viability; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein YhbY"
                     /protein_id="WP_013573813.1"
                     /db_xref="GI:503339152"
                     /translation="MNLNNKQKQYLKGLAHPLKPVVMLGNNGLTEGVLAEIEQALQHH
                     ELIKVKVAAEERETKSLIVDAIVRETKACNVQVIGNMLVLYRPSTEDRKIILPR"
     gene            515277..515906
                     /gene="rrmJ"
                     /locus_tag="RAHAQ2_RS02430"
                     /old_locus_tag="Rahaq2_0505"
     CDS             515277..515906
                     /gene="rrmJ"
                     /locus_tag="RAHAQ2_RS02430"
                     /old_locus_tag="Rahaq2_0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009636780.1"
                     /note="Specifically methylates the uridine in position
                     2552 of 23S rRNA in the fully assembled 50S ribosomal
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="WP_014333696.1"
                     /db_xref="GI:504099702"
                     /translation="MSNKKRSASSSRWLQEHFSDKYVLQAQKKGLRSRAWFKLDEIQQ
                     GDKLFKPGMTVVDLGAAPGGWSQYVVTQIGNKGRIIACDILPMDPIVGVDFLQGDFRD
                     ELVLKALLERVGENKVQVVMSDMAPNMSGTPAVDIPKSMYLVELALDMCRDVLAPGGS
                     FLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
     gene            515963..517906
                     /gene="hflB"
                     /locus_tag="RAHAQ2_RS02435"
                     /old_locus_tag="Rahaq2_0506"
                     /gene_synonym="ftsH"
     CDS             515963..517906
                     /gene="hflB"
                     /locus_tag="RAHAQ2_RS02435"
                     /old_locus_tag="Rahaq2_0506"
                     /gene_synonym="ftsH"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411568.1"
                     /note="inner membrane metalloprotease; may be involved in
                     degradation of aberrant cytoplasmic and membrane proteins;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent metalloprotease"
                     /protein_id="WP_037040633.1"
                     /db_xref="GI:739176658"
                     /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNGNKVDYTTFTTEVAQD
                     QVREVRINGRAIDVIKKDSSKYTTYIPVNDPKLLDTLLSKNVKVVGEPPEQQSFLATI
                     FISWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEA
                     KEEVSELVDYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISG
                     SDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLN
                     QMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVH
                     MRRVPLATDVDASVIARGTPGFSGADLANLVNEAALFSARGNKRVVSMVEFEKAKDKI
                     MMGAERRSMVMTESQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLP
                     EGDAISASRQKLESQISTLYGGRLAEEIIYGVEKVSTGASNDIKVATSIARNMVTQWG
                     FSEKLGPLLYAEEEGEVFLGRSVAKAKHMSDETARIIDQEVKSLVERNYIRARTLLME
                     NMDILHSMKDALMKYETIDAPQIDDLMNRTEVRPPAGWDDANGKNGNSNSNDGGAPKA
                     PTPVDEPRTPNPGNTMFEQFSGK"
     gene            518032..518871
                     /gene="folP"
                     /locus_tag="RAHAQ2_RS02440"
                     /old_locus_tag="Rahaq2_0507"
     CDS             518032..518871
                     /gene="folP"
                     /locus_tag="RAHAQ2_RS02440"
                     /old_locus_tag="Rahaq2_0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573816.1"
                     /note="catalyzes the formation of dihydropteroate from
                     2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine
                     diphosphate and 4-aminobenzoate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_014333698.1"
                     /db_xref="GI:504099704"
                     /translation="MHLTARESRLDLTFPQVMGILNVTPDSFSDGGRHNTLDLALRHA
                     QAMVDAGATILDIGGESTRPGAAEVSEDEELARVVPVVEAIARRFDVWISVDTSKASV
                     ICEAANAGMHLINDIRSLQEPGALQAAAETGLPVCLMHMQGEPKTMQQAPHYDDVVVQ
                     VDQYFFEQIARCVNAGIAKDKLLLDPGFGFGKNLEHNYQLLARLADFHHFGMPLLVGM
                     SRKSMVGQLLHVSPEKRVTGSVACAVIAAMQGAKIVRVHDVKETVEAMRIVEATLSAR
                     DKN"
     gene            518874..520214
                     /gene="glmM"
                     /locus_tag="RAHAQ2_RS02445"
                     /old_locus_tag="Rahaq2_0508"
     CDS             518874..520214
                     /gene="glmM"
                     /locus_tag="RAHAQ2_RS02445"
                     /old_locus_tag="Rahaq2_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573817.1"
                     /note="catalyzes the conversion of glucosamine-6-phosphate
                     to glucosamine-1-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="WP_014333699.1"
                     /db_xref="GI:504099705"
                     /translation="MSNRKYFGTDGIRGKVGDTPITPDFVLKLGWAAGKVLARHGSRK
                     VIIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISAS
                     HNPYDDNGIKFFTIDGTKLPDEVEEAIEAELEKPLTCVESAELGKASRIVDAAGRYIE
                     FCKGTFPTELSLNGLKIVVDCANGATYHIAPSVLRELGAKVIAIGCEPDGMNINEECG
                     ATDVRQLQQRVLAEKADVGLAFDGDGDRLIMVDHEGNKVDGDQILYIIAREGLRQGQL
                     KGGAVGTLMSNMGLELALKQLGIPFTRAKVGDRYVLEKMQEKGWRIGAENSGHIILLD
                     KTTTGDGIVAGLQVLTAMVRNHMSLHDLCSGMKLFPQILINVRFAGEHDPLESDDVKQ
                     VTAEVEKQLAGRGRVLLRKSGTEPLLRVMVEGEDAELVEKLANRIADAVKAVKA"
     gene            520450..520785
                     /gene="secG"
                     /locus_tag="RAHAQ2_RS02450"
                     /old_locus_tag="Rahaq2_0509"
     CDS             520450..520785
                     /gene="secG"
                     /locus_tag="RAHAQ2_RS02450"
                     /old_locus_tag="Rahaq2_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_014333700.1"
                     /db_xref="GI:504099706"
                     /translation="MYDALLVIFLIVAIGLVALVMLQQGKGADMGASFGAGASGTLFG
                     SSGSGNFMTRMTGILAALFFIISLILGNMSTNKGQKGSEWENLSQPAKTEQTTAPAAP
                     AAPNSDVPH"
     gene            520870..520956
                     /locus_tag="RAHAQ2_RS02455"
                     /old_locus_tag="Rahaq2_0510"
     tRNA            520870..520956
                     /locus_tag="RAHAQ2_RS02455"
                     /old_locus_tag="Rahaq2_0510"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:520904..520906,aa:Leu,seq:gag)
     gene            521016..521092
                     /locus_tag="RAHAQ2_RS02460"
                     /old_locus_tag="Rahaq2_0511"
     tRNA            521016..521092
                     /locus_tag="RAHAQ2_RS02460"
                     /old_locus_tag="Rahaq2_0511"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:521050..521052,aa:Met,seq:cat)
     gene            521322..521774
                     /locus_tag="RAHAQ2_RS02465"
                     /old_locus_tag="Rahaq2_0512"
     CDS             521322..521774
                     /locus_tag="RAHAQ2_RS02465"
                     /old_locus_tag="Rahaq2_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333701.1"
                     /note="required for the maturation of the 30S ribosomal
                     subunits; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation protein RimP"
                     /protein_id="WP_014411570.1"
                     /db_xref="GI:504224468"
                     /translation="MSTLEQKLTELITAPVEALGFELVGIEFVRARQSTLRIYIDSDA
                     GINVDDCADVSHQVSAVLDVEDPVTVAYNLEVSSPGLDRPMFTAEHYQRFLGDEVSVV
                     LRMAVQNRRKWQGIIKAVEGEMITVTVEGKDEVFALSNIQKANLVPHF"
     gene            521798..523306
                     /gene="nusA"
                     /locus_tag="RAHAQ2_RS02470"
                     /old_locus_tag="Rahaq2_0513"
     CDS             521798..523306
                     /gene="nusA"
                     /locus_tag="RAHAQ2_RS02470"
                     /old_locus_tag="Rahaq2_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012004946.1"
                     /note="modifies transcription through interactions with
                     RNA polymerase affecting elongation, readthrough,
                     termination, and antitermination; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor NusA"
                     /protein_id="WP_014333702.1"
                     /db_xref="GI:504099708"
                     /translation="MNKEILAVVEAVSNEKSLPREKIFEALEIALSTATKKKYEQEIE
                     VRVSIDRKTGDFDTFRRWVAVNEVTQPTREITLEAAQYEDPSIDLGGYIEDQIESVTF
                     DRITTQTAKQVIVQKVREAERAMVVEQFREQQGEIVTGVVKKVNRDSIALDLGSNAEA
                     VILREDMLPRENFRSGDRIRGVLYDVRPEARGAQLFVSRSRNEMLIELFRIEVPEIGE
                     ELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIILW
                     DDNPAQFVINAMAPADVASIVVDEDKCTMDIAVEASNLAQAIGRNGQNVRLASQLLKQ
                     HRGDDKWELNVMTADDLQAKHQAEAHAAIDTFTKYLAIDEDFATVLVEEGFSTLEELA
                     YVPVNELLEIDGLDEDTVDALRERAKEALTTLALAQEESLGDKKPADDLLNLAGLERS
                     MAFKLAAQGVCTLEDLAEQGVDDLADIEGLTDEQAGELIMAARNICWFGDNA"
     gene            523331..526024
                     /gene="infB"
                     /locus_tag="RAHAQ2_RS02475"
                     /old_locus_tag="Rahaq2_0514"
     CDS             523331..526024
                     /gene="infB"
                     /locus_tag="RAHAQ2_RS02475"
                     /old_locus_tag="Rahaq2_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411571.1"
                     /note="Protects formylmethionyl-tRNA from spontaneous
                     hydrolysis and promotes its binding to the 30S ribosomal
                     subunits during initiation of protein synthesis. Also
                     involved in the hydrolysis of GTP during the formation of
                     the 70S ribosomal complex; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_014333703.1"
                     /db_xref="GI:504099709"
                     /translation="MTDVTVKSLAAEIQTPVDRLVQQFADAGISKSESDSVTQQEKET
                     LLAHLNGGNSGATNKLTLQRKTRSTLNIPSTGGKSKSVQIEVRKKRTYVKRDMTEAEL
                     AQAEAEEQAKRDAEEQAQRAAAEQAQREAQEKAKRAAEEQAKREAADKAKRDAAEKDK
                     VTNQNTDEVIKPAQAEKARREAEAAELKRKTEEEAQRKIEENAKRIAEEARKMADSGV
                     WTEATAPSESESADYHVTTSTHARAAEDENDAKVEGERRSRTRGGKATKQKKGNKLSE
                     SKADREEARAVGRNGKGKRKPSTLQQSFNKPVVAVNRDVVVGETITVAELANKMAVKG
                     SQVIKTMMKLGAMATINQVIDQETAQLVAEEMGHKVILRRENELEEALMSDRDTGASA
                     AAEPRAPVVTIMGHVDHGKTSLLDYIRSTKVAAGEAGGITQHIGAYHVETENGMITFL
                     DTPGHAAFTSMRARGAQATDIVVLVVSADDGVMPQTIEAVQHAKAAGVPIVVAVNKID
                     KPDADPDRVRTELSQYGVMPEEWGGESQFIHVSAKVGTGIDDLLQAILLQAEVLELKA
                     VRSGMASGVVIESFLDKGRGPVATVLVQEGTLNKGDIILCGFEYGRVRAMRDEMGRDI
                     TSAGPSIPVEVLGLSSVPAAGDEVTVVRDEKKAREVALYRQGKFREVKLARQQKSKLE
                     NMFANMTEGEVSELNIVLKSDVQGSCEAISDALQSLSTDEVKVKIVGMGVGGITETDA
                     TLAAASNAIILGFNVRADASARRVVESESLDLRYYSVIYNLIDEVKQAMSGMLAPEYK
                     QQIIGLAEVRDVFKSPKFGAIAGCMVTEGMIKRNNPIRVLRENVVIYEGELESLRRFK
                     DDVAEVRNGMECGIGVKNYNDVRTGDVIEVFEIIEIKRTIA"
     gene            526103..526516
                     /gene="rbfA"
                     /locus_tag="RAHAQ2_RS02480"
                     /old_locus_tag="Rahaq2_0515"
     CDS             526103..526516
                     /gene="rbfA"
                     /locus_tag="RAHAQ2_RS02480"
                     /old_locus_tag="Rahaq2_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333704.1"
                     /note="associates with free 30S ribosomal subunits;
                     essential for efficient processing of 16S rRNA; in
                     Escherichia coli rbfA is induced by cold shock; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="WP_014333704.1"
                     /db_xref="GI:504099710"
                     /translation="MAKEFSRTQRVSQEMQKEIAIILQREVKDPRVGMATVSGVEVSR
                     DLAYAKVFVTFLDVLTTDNHDPDRVKNGIKALQDASGFIRTLIGKAMRLRVVPELTFA
                     YDNSLVEGMRMSNLVTNVVKNDAERRSAAGDDEEA"
     gene            526516..527460
                     /gene="truB"
                     /locus_tag="RAHAQ2_RS02485"
                     /old_locus_tag="Rahaq2_0516"
     CDS             526516..527460
                     /gene="truB"
                     /locus_tag="RAHAQ2_RS02485"
                     /old_locus_tag="Rahaq2_0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573822.1"
                     /note="catalyzes isomerization of specific uridines in RNA
                     to pseudouridine; responsible for residues in T loops of
                     many tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="WP_014333705.1"
                     /db_xref="GI:504099711"
                     /translation="MSRPRRRGRDIHGVLLLDKSLGLSSNDALQKVKRLYNANRAGHT
                     GALDPLATGMLPLCLGEATKFSRFLLDSDKRYRVIARMGQRTDTSDAEGAIICEREMT
                     FTQQQLDDALDSFRGETQQIPSMYSALKYEGKKLYEYARQGIEVPRESRSITVYELQF
                     IRWEGFEVELEIHCSKGTYIRTIVDDLGEKLGCGAHVSYLRRLQVATYPSERMVTMEK
                     LHQLIAQAEEQGIEPRLLLDPLLLPMDSACEDFPEVNLLPVVAGYVKQGQPVQASGAP
                     VSGMVRITEGEERKFIGVGEIDDDGRIAPRRLVVEYTD"
     gene            527583..527852
                     /locus_tag="RAHAQ2_RS02490"
                     /old_locus_tag="Rahaq2_0518"
     CDS             527583..527852
                     /locus_tag="RAHAQ2_RS02490"
                     /old_locus_tag="Rahaq2_0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004933502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_014333706.1"
                     /db_xref="GI:504099712"
                     /translation="MSLSVEAKAQIVSDFGRGTNDSGSTEVQVALLTAQINHLQGHFA
                     EHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTSLIERLGLRR"
     gene            528126..530249
                     /locus_tag="RAHAQ2_RS02495"
                     /old_locus_tag="Rahaq2_0520"
     CDS             528126..530249
                     /locus_tag="RAHAQ2_RS02495"
                     /old_locus_tag="Rahaq2_0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide phosphorylase/polyadenylase"
                     /protein_id="WP_014333707.1"
                     /db_xref="GI:504099713"
                     /translation="MLNPTIRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTV
                     VGQKKAKPGQSFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLTSRLIDRPIRPL
                     FPDSFLNEVQVIATVVSLNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQ
                     YVLNPTADELKTSRLDLVVAGTQGAVLMVESEAEVLSEDQMLGAVVFGHEQQQIVIDN
                     INSLVAEVGKPKWDWQPEAVNAELHARVAALSESRLGDAYLITEKQERYNQINVIKAD
                     VVQALQAEDESLDAGEISDILGSIEKNVVRSRVLRGEPRIDGREKDMIRGLDVRTGVL
                     PRTHGSALFTRGETQALVTATLGTARDAQNLDELMGEKTDNFLFHYNFPPYSVGETGM
                     VGSPKRREIGHGRLAKRGVLAMMPKPEDFPYTVRVVSEITESNGSSSMASVCGASLAL
                     MDAGVPIKAAVAGIAMGLVKEGESFIVLSDILGDEDHLGDMDFKVAGSRDGITALQMD
                     IKIEGITREIMQVALNQAKGARLHILGVMEQAISIPRGDISQFAPRIHTIKISPDKIK
                     DVIGKGGSVIRALTEETGTTIEIEDDGTVKIAATDGEKAKYAIRRIEEITAEIEVGRI
                     YQGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQ
                     GRVRLSIKEATAPSQDETTEQPAAE"
     gene            530379..531263
                     /locus_tag="RAHAQ2_RS02500"
                     /old_locus_tag="Rahaq2_0521"
     CDS             530379..531263
                     /locus_tag="RAHAQ2_RS02500"
                     /old_locus_tag="Rahaq2_0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573825.1"
                     /note="lipoprotein that appears to be involved in cell
                     division; interacts with the periplasmic protease Prc and
                     may be activated by protease processing; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein NlpI"
                     /protein_id="WP_014333708.1"
                     /db_xref="GI:504099714"
                     /translation="MKPFLRWCYVATALMLAGCSNHDWRKNEVLAIPLQPTLQQEVIL
                     ARMEQILASRSLTDDERAQLLYERGVLYDSLGLRALARNDFSQALSIRPDMPEVFNYL
                     GIYLTQAGNFDAAYEAFDSVLELDPTYNYARLNRGIALYYGGRFSLAQDDLQAFYRDD
                     PNDPFRSLWLYLAEREINPKNADVALQQRYDKADRGQWGWNIVEFYLGKISESTLMER
                     LKAEATDNTSLAEHLSETDFYLGKHYLSLGDKNSAAALFKLTVANNVHNFVEHRYALL
                     ELALLGHEQDDLSESDQQ"
     gene            531448..533373
                     /locus_tag="RAHAQ2_RS02505"
                     /old_locus_tag="Rahaq2_0522"
     CDS             531448..533373
                     /locus_tag="RAHAQ2_RS02505"
                     /old_locus_tag="Rahaq2_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333709.1"
                     /note="participates in the assembly of the large subunit
                     of the ribosome; plays a key role in optimal cell growth
                     at low temperature and is required for normal cell
                     division; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA helicase"
                     /protein_id="WP_014333709.1"
                     /db_xref="GI:504099715"
                     /translation="MTTELETSFADLGLSAPIISALTDLGYEKPSPIQAECIPHLLNG
                     RDVLGMAQTGSGKTAAFSLPLLHNIDASLKAPQILVLAPTRELAVQVAEAMTDFSKHM
                     HGVNVVALYGGQRYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLNLSNLSGLVLDEAD
                     EMLRMGFIEDVETIMAQIPAQHQTALFSATMPEAIRRITRRFMKDPQEVRIQSSVTTR
                     PDISQSYWSVYGLRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERSGYSSAAL
                     NGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRI
                     GRTGRAGRAGRALLFVENRERRLLRNIERTMKLTIPEVEIPTAEVLGERRLAKFAAKV
                     QQQLESSDLDQYRALLAKLQPAEELDVETLAAALLKMAQGERPLIVAADPVFKSRPPR
                     REFEERGDRGDRGDRRDRPARSNDRPARDGDSPRRERRDAGEMELYRIEVGRDDGVEV
                     RHIVGAIANEGDISSRYIGNIKLFGTHSTIELPKGMPGEILSHFTRTRILNKPMNMQL
                     IGDAVPQAPRRDRPAGAGGERRGNGAPRPFNGERREGGRGTGGAPRTFSGDRREGSSA
                     AGDRRPPSRAPRRTSDV"
     gene            complement(533456..534481)
                     /locus_tag="RAHAQ2_RS02510"
                     /old_locus_tag="Rahaq2_0523"
     CDS             complement(533456..534481)
                     /locus_tag="RAHAQ2_RS02510"
                     /old_locus_tag="Rahaq2_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333710.1"
                     /db_xref="GI:504099716"
                     /translation="MSDKNTVPLSVLDLAPVPQGADPARAFQCSLELAQHAEKWGYQR
                     YWMAEHHNMTGIASAATSVLLGYIAGGTKTIRVGSGGVMLPNHSPLVIAEQFGTLATL
                     YPNRVDLGLGRAPGTDQRTMIALRRHLSGEIDNFPQDVQELQMYFGDVQPQQAVQAVP
                     GQGLHVPIWLLGSSLYSAQLAAALGLPFAFASHFAPDMLYQALAIYRSKFQPSAQLEK
                     PHAMVCINAIAADTDEEARRMFTSNQQQFINLRRGMPGKLPAPVDNIESLWSAQERFG
                     VDNALRMSVVGNKESVRQGLQNILRETEADELMINGQIFDHQARLHSFEIVSQLQGEL
                     VKEQRIG"
     gene            534726..535700
                     /locus_tag="RAHAQ2_RS02515"
                     /old_locus_tag="Rahaq2_0524"
     CDS             534726..535700
                     /locus_tag="RAHAQ2_RS02515"
                     /old_locus_tag="Rahaq2_0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance efflux pump"
                     /protein_id="WP_014333711.1"
                     /db_xref="GI:504099717"
                     /translation="MSKRILLTLLLVAVAVSLAVLFRAHNQDLLLQGEVDAPEVIIAS
                     KAKGRVIERHVERGDDVKAGQLLITLDSPELMAQLRAAEAARDQAKAQLDLSVNGTRE
                     ESIRNLKATLAQSQAEYINARDLYNRNAKVAAKGFISASDLEDSRRARDSAYQQVLVA
                     KANLDEGINGDRVEQRESYAAQLRQAEEDLLEVKAQTDDLQVKAPVDGEVGPIPVEVG
                     ELQNASSPLLTLVRLPDAYFVFNLREDILAGVRKGDKVRMRVPALNNQMIETEVRYIA
                     PLGDYATKRATRATGDFDLKTFEVRLYPAKPVPGLRQGMSALWQWKAK"
     gene            535697..536869
                     /locus_tag="RAHAQ2_RS02520"
                     /old_locus_tag="Rahaq2_0525"
     CDS             535697..536869
                     /locus_tag="RAHAQ2_RS02520"
                     /old_locus_tag="Rahaq2_0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic ABC transporter permease"
                     /protein_id="WP_014333712.1"
                     /db_xref="GI:504099718"
                     /translation="MRPVKAPRSERVKAAWRCFSRAFTRETRHAFRKPVIHWLCWIFP
                     LLLFGLISSNFSEGTLLDLPVSVVDNDHSPLSKTLVRKLDAGSHAHVQAFEGGLPEAE
                     YRLRTAQDYALLYIPDAFEADVLAGKQPSAVLYYNALFYGAGLYSTQDYSGLITELNT
                     RYRSIIAAKIGKTLPSLASVDVSYGSLFNASGSYIYYQQFAATIHLLQLFTVTCMIYV
                     MARSQALLSAPSFTLALLGKLAPYTLCFTTLLMVEIAMLVGFFDARVSGNPLYMLLIG
                     FFYVIAAQSLGLLLFTFTKTTITAYTMMGIFVSIALTFSGMAVPVLSMPLPARIISGI
                     EPLSYALAAMFDVFLREVSVRGILMVCCILLIYPLLTSLLVRKRLYMRMKQQEPGQ"
     gene            536866..538029
                     /locus_tag="RAHAQ2_RS02525"
                     /old_locus_tag="Rahaq2_0526"
     CDS             536866..538029
                     /locus_tag="RAHAQ2_RS02525"
                     /old_locus_tag="Rahaq2_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014333713.1"
                     /db_xref="GI:504099719"
                     /translation="MTGREWFKTWWKTFSKVLTGLLDKPMWMMLLLSLCVMSLVYANR
                     TVWDLPVAVIDQDHSTASRMLARQLDAGSKIATVAYDNLAEAEHDLALRKLFAVIIMP
                     VDLEKKILAGQNIVIPVYGDATNRLANGQIQQDVLSAYQSILTQYNTDLLLSNGFSER
                     QASVVLSPILGQSLDVFNPGISFAAIIFPGLLVMLLQHSLLIASVRVSIVLNSGPSGK
                     PAIPAFLGGISALIPVWLFLSIVLFVLWPWVLGYRQTASIPEILLLTFPFLLAVLGLG
                     KLVTECLRSVELIYLTLAFLTTPVFYISGTIWPLQAMPAWVRAISSMLPSTWATKAIA
                     GVNQMGLPFKDVGGDILMLLILCGFYTFIGIAVGMLRDGVRLRALFRPKPKKS"
     gene            complement(538088..538966)
                     /locus_tag="RAHAQ2_RS02530"
                     /old_locus_tag="Rahaq2_0527"
     CDS             complement(538088..538966)
                     /locus_tag="RAHAQ2_RS02530"
                     /old_locus_tag="Rahaq2_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_014333714.1"
                     /db_xref="GI:504099720"
                     /translation="MKYSLGTLLYYWPKAQVEDFYQAAAASSADVIYLGENVCSKRRE
                     MKVNDWLEIARQLAATGKQVVISTLALLQAPSELNELKRYVENGEFLLEANDFGAVNM
                     AAERNLPFVVGHALNCYNAVTLKLLHKQGMVRWCMPVELSRDWLVNLLNQCQDLGIRD
                     KFEVEVLSYGHLPLAYSARCFTARSENRAKDECETCCIHYPQGRKMLSQENQQVFVLN
                     GIQTQSGYCYNLGNELTSMQGLVDIVRLSPETMDTLATLEAFRTNERGLHPLTLTEKA
                     DCNGYWQRVAGLELRQ"
     gene            complement(538981..539976)
                     /locus_tag="RAHAQ2_RS02535"
                     /old_locus_tag="Rahaq2_0528"
     CDS             complement(538981..539976)
                     /locus_tag="RAHAQ2_RS02535"
                     /old_locus_tag="Rahaq2_0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017457364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_014333715.1"
                     /db_xref="GI:504099721"
                     /translation="MELLCPAGNLPALKAAIDNGADAVYIGLKDDTNARHFAGLNFTE
                     KKLQEAASYVHRHHRKLHIAINTFAHPDGYQRWERAVDMAAQLGADALILADLAMLDY
                     AANKYPHVERHVSVQASATNDEAIRFYKRNFDVARVVLPRVLSMHQVRQLSRTTVVPL
                     EVFAFGSLCIMAEGRCYLSSYLTGESPNTVGACSPARFVRWQQTTQGMESRLNDVLID
                     RYDEGENAGYPTLCKGRYLVDGAKYHALEEPTSLNTLQLLPELFAANIASVKIEGRQR
                     SPAYVSQVARVWRAAIDRCMADPQNFKTDEAWMNTLGSMSEGTQTTLGAYHRKWQ"
     gene            540293..540814
                     /locus_tag="RAHAQ2_RS02540"
                     /old_locus_tag="Rahaq2_0529"
     CDS             540293..540814
                     /locus_tag="RAHAQ2_RS02540"
                     /old_locus_tag="Rahaq2_0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipid carrier protein"
                     /protein_id="WP_014333716.1"
                     /db_xref="GI:504099722"
                     /translation="MLQKLRARMVRQGPSLLSVPLKFTPFALQRQVLQQVLSWQLRQA
                     LADGELDFLEGRWLKIDVSDLNLNWLMSVDEGKLVIAEHGEADVSFSGTANDLILIAA
                     RKEDPDTLFFQRRLRIEGDTELGLYVKNLMDSIDLDTMPLLLKNGLLRLADFVEAGLQ
                     EDRGSKTPVAEPC"
     gene            540808..541311
                     /locus_tag="RAHAQ2_RS02545"
                     /old_locus_tag="Rahaq2_0530"
     CDS             540808..541311
                     /locus_tag="RAHAQ2_RS02545"
                     /old_locus_tag="Rahaq2_0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_014333717.1"
                     /db_xref="GI:504099723"
                     /translation="MLIRTEIPVDAAGIDRLLRASFPTGAEADLVQELREDGLLTLGV
                     VATDDEGGVVGYVAFCPVDIQGEDRNWVALAPLAVEQSLRGQGLGEKLVYEGLDSLNE
                     FGYAAVVVLGDPAYYNRFGFKPAAVHGLHCRWIGTEAAFQLFTLSDDALSDASGEVVF
                     PSAFNRF"
     gene            complement(541352..541624)
                     /locus_tag="RAHAQ2_RS02550"
                     /old_locus_tag="Rahaq2_0531"
     CDS             complement(541352..541624)
                     /locus_tag="RAHAQ2_RS02550"
                     /old_locus_tag="Rahaq2_0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease"
                     /protein_id="WP_037040630.1"
                     /db_xref="GI:739176654"
                     /translation="MLRTPTGMLYTGITTDVTRRLSQHQCGKGAKSLRGKGELLLAFQ
                     CPAGDRSLASKLEIKVKKLSKAQKELLVRNAPECLENYLGLAESGK"
     gene            541776..542216
                     /locus_tag="RAHAQ2_RS02555"
                     /old_locus_tag="Rahaq2_0532"
     CDS             541776..542216
                     /locus_tag="RAHAQ2_RS02555"
                     /old_locus_tag="Rahaq2_0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333719.1"
                     /db_xref="GI:504099725"
                     /translation="MNNPDDLKHILKFLKKNHVLALCATADGEMWSANCFYVTDADRM
                     TLYFMTELKTLHGSLMSRSPHIVGTIAPHPKTIALIKGIQYRGEATVLEGEEESRARS
                     QYCQHFPVALTMKAPVWALKLSHIKMTDNALGFGKKLLWDREGE"
     gene            complement(542245..542763)
                     /locus_tag="RAHAQ2_RS02560"
                     /old_locus_tag="Rahaq2_0533"
     CDS             complement(542245..542763)
                     /locus_tag="RAHAQ2_RS02560"
                     /old_locus_tag="Rahaq2_0533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general stress protein"
                     /protein_id="WP_014333720.1"
                     /db_xref="GI:504099726"
                     /translation="MSKKIAVLITDEFEDSEFTSPAEAYREAGHQVITIEKKAGNVIK
                     GKQGKASVTIDKSIDDVQVADFDALLLPGGHSPDTLRGDDRFVEFTRAFAQSGKPIFA
                     ICHGPQLLINADVVRGRKLTTVKPVVVDVKNAGAEFYDKEVVVDNNTLVTSRTPDDLP
                     AFNRESLKILAA"
     gene            542949..543590
                     /locus_tag="RAHAQ2_RS02565"
                     /old_locus_tag="Rahaq2_0534"
     CDS             542949..543590
                     /locus_tag="RAHAQ2_RS02565"
                     /old_locus_tag="Rahaq2_0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333721.1"
                     /db_xref="GI:504099727"
                     /translation="MAKVLLLGGSGLIGRELLRLLQLDPRVSRIVAPSRRPLPPGKKL
                     INPLGANLTSLVVALDEPVDLLFCCLGTTRKQAGSAQAFRAVDYDLVVDCAKAARELG
                     ARHCLAVSAHGADAHSRFLYNRTKGEMELALMQQGWPLLTLVRPSLLVGQRHPPRLLE
                     QLSAPLFKMLPGKWKAIESDIVAKALQEQAFNAGLGGITVLESDQIAASIEEL"
     gene            complement(543689..544327)
                     /locus_tag="RAHAQ2_RS02570"
                     /old_locus_tag="Rahaq2_0535"
     CDS             complement(543689..544327)
                     /locus_tag="RAHAQ2_RS02570"
                     /old_locus_tag="Rahaq2_0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_014333722.1"
                     /db_xref="GI:504099728"
                     /translation="MTDIISPFSLADEQDYARPKIGQQVELNGSQLGQYVHIADNAII
                     EETQIGDYSYTAGNNQIFYATIGKFVSIATYVRINPGNHPTYQRVAQHHFTYRSSAYG
                     LGEDDQGFFDWRREHHVTVGNDVWIGHNAVLMPGVKVGNGAVIGTSAVVTKDVEPYSI
                     VAGVAAKKIGMRFDEGMIDRIEKSQWWNWDHETLKERIPDFRDLAVFAEKYL"
     gene            complement(544336..544911)
                     /locus_tag="RAHAQ2_RS02575"
                     /old_locus_tag="Rahaq2_0536"
     CDS             complement(544336..544911)
                     /locus_tag="RAHAQ2_RS02575"
                     /old_locus_tag="Rahaq2_0536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 1,5-bisphosphokinase"
                     /protein_id="WP_014333723.1"
                     /db_xref="GI:504099729"
                     /translation="MSRLLYLMGASGSGKDSLLDALRQHLPASVIVAHRYITRPADAG
                     SENHIALSEAEFFQRRQQGLFALEWHAHQCRYGVGIEIDHWLQLGCHVVVNGSRAHLE
                     KALERYGQRLLPVCLQVSDTVLASRLLQRGREDAAQIACRLQRAREYASALPAECHLL
                     NNDGALQETLQHLLAILSLPVSAPVYPVTSL"
     gene            complement(544936..546072)
                     /locus_tag="RAHAQ2_RS02580"
                     /old_locus_tag="Rahaq2_0537"
     CDS             complement(544936..546072)
                     /locus_tag="RAHAQ2_RS02580"
                     /old_locus_tag="Rahaq2_0537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnM"
                     /protein_id="WP_014333724.1"
                     /db_xref="GI:504099730"
                     /translation="MIINNVRLVLDDQVVEGSLEMKNGVISAFADSSSQLPQALDAQG
                     GWLLPGLIELHTDNLDKFFTPRPKVDWPAHSAMSSHDALMVASGITTVLDAVAVGDVR
                     DGGHRLDNLQKMIDAIINSQNAGLNRAEHRLHLRCELPHETTLPLFEKLMDTSILSLV
                     SLMDHSPGQRQFATPQKYREYYQGKYNLNDQQMDDYQEEQIALSRRWAQPNREAIAAH
                     CRARNISLASHDDATAAHVEESLALGSVIAEFPTTEEAARASHANGLQVLMGAPNIVR
                     GGSHSGNVAAHHLASLGLLDILSSDYYPASLLDAVFRIATDDNNAFSLPQAVKLVTRN
                     PANALGLQDRGEIAEGKRADLVLARAHGDHHYVQNVWRQGIQVF"
     gene            complement(546069..546776)
                     /locus_tag="RAHAQ2_RS02585"
                     /old_locus_tag="Rahaq2_0538"
     CDS             complement(546069..546776)
                     /locus_tag="RAHAQ2_RS02585"
                     /old_locus_tag="Rahaq2_0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter ATP-binding protein"
                     /protein_id="WP_014333725.1"
                     /db_xref="GI:504099731"
                     /translation="MTTKLRVENLSKTFVLHNQNSARLPVFSHTSLTVDAGECVVLHG
                     HSGSGKSTLLRSLYGNYLPDSGNIWVEHQGQQIDMVSAEAREILAVRRHTVGWVSQFL
                     RVIPRISALNLVMQPLLELGVDKAQSESRASALLRHLNVPERLWHLAPSTFSGGEQQR
                     VNIARGFVVDYPVLLLDEPTASLDAVNRAAVVTLIEQAKARGAAVVGIFHDEDVRERV
                     ADRLYEMSPETAPEVSV"
     gene            complement(546805..547596)
                     /gene="phnK"
                     /locus_tag="RAHAQ2_RS02590"
                     /old_locus_tag="Rahaq2_0539"
     CDS             complement(546805..547596)
                     /gene="phnK"
                     /locus_tag="RAHAQ2_RS02590"
                     /old_locus_tag="Rahaq2_0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase"
                     /protein_id="WP_014333726.1"
                     /db_xref="GI:504099732"
                     /translation="MNTPLNLTAGPLLSVNNLTHLYAPGKGFCDVSFNLFPGEVLGIV
                     GESGSGKTTLLQSISARLAPQQGNVIYNNGQAPAQSLYDMPESDRRRLLRTDWGVVHQ
                     HPMDGLRRQVSAGGNIGERLMAVGERHYGNIRKKAGQWLEDVEIPVSRIDDLPTTFSG
                     GMQQRLQIARNLVTHPRLVFMDEPTGGLDVSVQARLLDLLRTLVVEMQLAVVIVTHDL
                     GVARLLAHRLLVMKQGQVVESGLTDRVLDDPHHPYTQLLVSSVLS"
     gene            complement(547596..548471)
                     /locus_tag="RAHAQ2_RS02595"
                     /old_locus_tag="Rahaq2_0540"
     CDS             complement(547596..548471)
                     /locus_tag="RAHAQ2_RS02595"
                     /old_locus_tag="Rahaq2_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573843.1"
                     /note="required for use of phosphonate and phosphite;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex subunit PhnJ"
                     /protein_id="WP_014333727.1"
                     /db_xref="GI:504099733"
                     /translation="MNNNAAQTITGYNHGYLDEQTKRMIRRGILKAVAIPGYQVPFAG
                     REMPMPYGWGTGGIQLTASVIGEKDVLKVIDQGADDTTNAVSIRKFFQSVAGVKTTEK
                     TVEASLIQTRHRIPETPLQEDQILIFQVPIPEPLRFIEPRETETRKMHALEEYGVMQV
                     KLYEDIARFGHIATTYAYPVKVNDRYVMDPSPIPKFDNPKMNMMPALQLFGAGREKRI
                     YALPPFTKVESLDFDDHPFTVQQWDEPCAICGSHHSYLDEVVLDDQGNRMFVCSDTDF
                     CAQQVEQQASNEGNR"
     gene            complement(548461..549543)
                     /locus_tag="RAHAQ2_RS02600"
                     /old_locus_tag="Rahaq2_0541"
     CDS             complement(548461..549543)
                     /locus_tag="RAHAQ2_RS02600"
                     /old_locus_tag="Rahaq2_0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333728.1"
                     /note="required for the use of phosphonate and phosphite;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex subunit PhnI"
                     /protein_id="WP_014333728.1"
                     /db_xref="GI:504099734"
                     /translation="MYVAVKGGEKAIAAAHQLLAHERRGNTGVNEIGCDQIEQQLGLA
                     VDRVMSEGGIYDRELAALAIKQSGGDLVEAIFLLRAYRTTLPRLATSEPLNTQAMRLE
                     RRISAIYKDLPGGQVLGPTYDYTHRLLDFALLAEGEAPFTPIADEPQPEECGHVFDLL
                     TSQQLAVREEDDGTEPEDITRTPPVFPASRAARLQQLVRGDEGFLLSLSYSTQRGYGR
                     THPFAGEIRTGWLTVEIVPEELGFAIDIGEILLTECEMVNGFIAPEDKPPHFTRGYGL
                     VFGRAERKAMSMSLVDRALQTREYNEQISSPAQDEEFVLSHADNVEAAGFVSHLKLPH
                     YVDFQAELELLKRLRAAKEQDPANEQ"
     gene            complement(549543..550124)
                     /gene="phnH"
                     /locus_tag="RAHAQ2_RS02605"
                     /old_locus_tag="Rahaq2_0542"
     CDS             complement(549543..550124)
                     /gene="phnH"
                     /locus_tag="RAHAQ2_RS02605"
                     /old_locus_tag="Rahaq2_0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein PhnH"
                     /protein_id="WP_014333729.1"
                     /db_xref="GI:504099735"
                     /translation="MSLVASFQHPVADAQYSFRRILKALSEPGVSVQLPAMPGFGALG
                     SASACVLLTLIDQDTPLWLSASLNDEILRKNLRFHTGAVLTDDPSAVSFALADPALDS
                     ATLLAFPCGDEMSPELSTSVIVQLESLTGGTPLRLRGPGIENSRTLSPQLPDCVRDYL
                     LNRPHRFPLGLDFMFTCGEELIAIPRTTRVEVC"
     gene            complement(550128..550571)
                     /locus_tag="RAHAQ2_RS02610"
                     /old_locus_tag="Rahaq2_0543"
     CDS             complement(550128..550571)
                     /locus_tag="RAHAQ2_RS02610"
                     /old_locus_tag="Rahaq2_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein PhnG"
                     /protein_id="WP_014333730.1"
                     /db_xref="GI:504099736"
                     /translation="MDHLQTRQRWMSVLAHSRPDELLAHWQPLNLSPQFERLRAAETG
                     LTQLQGRMGGTGKRFVMGDMTVTRAVIRTDSGVCGYSYVAGRNKAHAELCAIIDALLQ
                     IQGMDELLHKRVIAPLAALQQERRQQRAREVASSRVDFFTLVRGE"
     gene            complement(550572..551297)
                     /locus_tag="RAHAQ2_RS02615"
                     /old_locus_tag="Rahaq2_0544"
     CDS             complement(550572..551297)
                     /locus_tag="RAHAQ2_RS02615"
                     /old_locus_tag="Rahaq2_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333731.1"
                     /note="may be involved in phosphonate uptake and
                     biodegradation; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonates metabolism transcriptional
                     regulator PhnF"
                     /protein_id="WP_014333731.1"
                     /db_xref="GI:504099737"
                     /translation="MNLSRHPTSHTTVYQQIAAELEQELRNGYRCGDYLPPEQQLAER
                     FQVNRHTLRRAVDELVDRGWLQRRQGIGTLVLMRPYDYPLHSQARFSQNLLDQGSHPT
                     SERLLAVLRPATDHVAAALSRQEGDTVIHLRTLRRVNGVPVCVIDHYLPDLDWWPALQ
                     NFHSGSLHDFIREEIKQKLTRRTTRINARRALAKESKLLEIVPQAPLLCVRTLNICEG
                     NESVAEYSVSLTRADMIELTMEH"
     gene            551969..552535
                     /locus_tag="RAHAQ2_RS02620"
                     /old_locus_tag="Rahaq2_0545"
     CDS             551969..552535
                     /locus_tag="RAHAQ2_RS02620"
                     /old_locus_tag="Rahaq2_0545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, pilin FimA"
                     /protein_id="WP_014333732.1"
                     /db_xref="GI:504099738"
                     /translation="MLKKSKILLLPVCLFASSMAASAEDGTITFTGTISDATCIVEGG
                     TDAGLTPSGTFTVNLKPVSTTALSAPGKKAGDTPFYISLSGAECPNGKFANVSWERAA
                     STKIDSATGNLQNSTATGSATKVQVVLSDENKQAIDLRVPVTDPTTGKEITNNTARFD
                     YWAQYIATGGASTSGTVNTDIVYSIIYN"
     gene            552592..553314
                     /locus_tag="RAHAQ2_RS02625"
                     /old_locus_tag="Rahaq2_0546"
     CDS             552592..553314
                     /locus_tag="RAHAQ2_RS02625"
                     /old_locus_tag="Rahaq2_0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012908876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, chaperone PapD"
                     /protein_id="WP_014333733.1"
                     /db_xref="GI:504099739"
                     /translation="MKLNLAILLPLLFVFLSPAEASIQVMGTRVIFNAKEKEQSVRIN
                     NVGDAPALIQVWLDSRRESKIDDKENLPFVINPPISRINKGKGKVLRIFPTDETTAKY
                     PQDRETMLWINILDIPPEDENAADKNLMNIAVRTRLKFFYRPAGLKGDLITASENVQW
                     SAQKTATGYKFTGSNNSPYYISYASIKMVGQEKNILQGDTIEPFSSKVFEFKDVKSVA
                     SPVLNYTFITDLGAFVSKEFKL"
     gene            <553482..>555806
                     /locus_tag="RAHAQ2_RS02630"
                     /old_locus_tag="Rahaq2_0547"
     CDS             <553482..>555806
                     /locus_tag="RAHAQ2_RS02630"
                     /old_locus_tag="Rahaq2_0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008499740.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040646.1"
                     /db_xref="GI:739176671"
                     /translation="IESSNSVKEKKSIKFNNGFMVGNLAGMDLSAFDNESVTQPGNYH
                     VDIEINGKSIGTKKVKYVAVAGTHDVQPCLTKEYVYQFDIDTSKLQAGWDQDECILLS
                     KLIPSASFKYDADEETLSFSIPQVSLLNNPEGYVNPELWDNGVPSLAVNYSLSATNMR
                     SNDHTSDDYYYGNAISSLKLGAWRFYTYDSVTKDSTSTQWDHISSYVQRAIAPLKAEM
                     KAGDINTSGELFNTVSLRGVTLETDERMLPDSLRGYAPVIRGVADTNAKITIRQNGNV
                     LKELTVPPGEFEITDLYATGYGGDLEVTITEATGQVRTFVTPYSSVPMLLRPGQSRFS
                     TTVGEVRNDSLRHKPLVMEGTYQYGLTNQVTAYTGFQTTDNNEYSALMAGAAVNTPIG
                     ALGADITRSFTSFEKEDEESCDSFCDMSVKLSLAKFFNDTGTNLSLAGYRYSSKDYYT
                     LSDALMTAQALEDDEGKYLPINYRDKVEINISQNLIDGWGNVYLSGYYGRAWDSKTEK
                     NNASSYQFGYSNSWHAMSYNINFSKTIDEDGNTDDAIYLSMSVPFGTLHSKVPKLNAS
                     VSYSDQDSSIRTALNGTAGEYNQMSYGGWINYVQDHQTNAGINLGYSGSAVQGNVGYS
                     QTETSFMTTMNASGGVVLHEGGVNYTSALSDTFGIVEAKGATGSHVYPDMTSQVSENG
                     YAIISSLNPYQYNDVYLDTKGAEADVEVEDTKASLVPTAGASVKLNFKTKNNVTKFLV
                     IKDKQGSVIPYGAMIKDSNKNILGIVGQGGRTMIA"
     gene            556344..556964
                     /locus_tag="RAHAQ2_RS02635"
     CDS             556344..556964
                     /locus_tag="RAHAQ2_RS02635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040626.1"
                     /db_xref="GI:739176650"
                     /translation="MYFPDAAECISSCTEPADKVLLEFVQTGTINSGTIPAGVIGEVN
                     LVADSNPGTPVKIVTISLSTPVDVAPKSCAILTPVQNVELGTYSLADFQNRVVRRGAE
                     IPFTIKLDCPQETSIEFSFSGDFPVGATKGYIDNCDETSCANNVGVRLLSSTSSAVDT
                     QGKYSTAVKFTGERTFGYKAQIYPYNYAEMTAGKIDTKVIFNIRMN"
     gene            556998..558728
                     /locus_tag="RAHAQ2_RS02640"
                     /old_locus_tag="Rahaq2_0549"
     CDS             556998..558728
                     /locus_tag="RAHAQ2_RS02640"
                     /old_locus_tag="Rahaq2_0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin-binding protein"
                     /protein_id="WP_014333736.1"
                     /db_xref="GI:504099742"
                     /translation="MYRTYKYLGAGLLALSFSGQSAMLAPMNSNRELDQLERRQTQMN
                     IEQEKKREAEVLNAGKSAEQLPDSFAKAGPGYKFDINDIVVLGDEEFNDSPARQKIVD
                     AYKHTKMGQYEIIKLISELTNFYVGKGYTTTTVTIQESSLKSGILTLKVLWGKIDGVS
                     VEGKAPTFRQSTRLFSAMPFASGKVLNMSDVDQGLDNLLRVSGSDKLIIVPSEKNGYS
                     TIDLQNSDVNLFSGSLGTNNSGTEKDGWAQYSASLSANNLAGFNDVLNYYNSFNDLNN
                     NNDNQKSWSLGYSVPLGYWAFDAQYYHSSYDKTIGGDFGGYGSDGTSDRMSLKVSRML
                     FRDAKGKTSAYAKVESSDSTNNIENSPIDVSSKRFSNVTLGLTRVGTLFDGSLYADLS
                     TTFGVPWFGAAWKNDPDLTGFDVDAVKYNGLLSWSKSLYQLGRVGVEYELGSGFQYTD
                     DILVSDDNMSVGDEYTVRGYKDSYMSVNSAAYISNTFKFPISIFKFGINQISPFIGYD
                     LAVVKDNCSQDVSLCHAEYMTGAAVGLKFSAKHINSALTYSRPLTEPTSLRHTGMSEE
                     ALYYNASVSF"
     gene            558771..568040
                     /locus_tag="RAHAQ2_RS02645"
                     /old_locus_tag="Rahaq2_0550"
     CDS             558771..568040
                     /locus_tag="RAHAQ2_RS02645"
                     /old_locus_tag="Rahaq2_0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006178436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="filamentous hemagglutinin family N-terminal
                     domain protein"
                     /protein_id="WP_014333737.1"
                     /db_xref="GI:504099743"
                     /translation="MNKNCNKNHSSKVIKLKPLYLAMASIFSSFADAGAIIPDNREHN
                     APTMNQSANGTPVINIVDPNASGVSHNKFSEFNVNQEGVVFNNSMTDGASKIGGFIIK
                     NNQLTHESKAIISEVTGTKGTQINGAMEVFGKKADIIIANQNGISVNGVSTVNANNLT
                     LTTGKINAQADGRIQLSVEKGEVNVQGKGISTEGLSYFDIISRSAVLEGEIAGQADIK
                     VVTGLNEYDIQSRTHTVRDANASDRPEVSIDGSALGSMYGNRIQLISTESGAGVRHEG
                     SVVGKNGIEISANGDLRLSGLKSEQGGVTLTGNNISVQKNSAGQGGIISQLDLVMNAL
                     GHVELGADAISAQGRILIDASSMLQNAATLMAENDQAAAVNVPSIQINIANEYQIVGS
                     LYAVDQSGNQISGAVISLENGDYVVRQNGQVIDAGVASNAQLISNSGDIAVNAKTVKN
                     NNGGIFAQKGALVLNIDEAFENNGMINASGKLSINTRAFKNKGIIFTNSQLINTNSFE
                     NAGGLYAQNAVEVNTDSLSNSGQMSSTDSDIQLNVNGVSASNSGSISAKNISINQKNQ
                     GNKSAVFTNDGRIDTEEKLHINSDSVSNSGTLIAGTTVELALTKELKNTGAAAEIIAE
                     QDLLIHSNLSDHALNIFNEAGWIQGDNLSISDIDTYSNTAGATLIANGNIELSNINNI
                     FNDDSLIKADSVLLSHIQNLSNTQNSVIEGSNSLTITDVKKLINDKSSLQSDGDVTIS
                     GITDLNNVNGLISSGGTLDINQVENFLNTAVSTIQASTALLINSVTSLENSDGSALLS
                     QDVMNIDAVKNILNDESSNIISDTELTVSNSDRLDNAGFIQSNGNLLIKDVNTLLNSG
                     ESSLIAALDNLTIENISNLSNTDKATISAGLELVLNSIVTLVNHAALIQSEDSMTVNA
                     ANLTNLAGNIQSYGNIALNINNVLENLFEDGIDEYGNPVKFGGNLLSDGTLDIHAATL
                     VNNSEINATNILINANDVNNTSGNIEGYETAELKITNDFINKEGTVRGNDRMSLDLDK
                     DYVFDENAGSLTTLEELSIHSDGNITVRGSLESAGDLILDAGKDITNYYAIVSNKDIT
                     LTANNITNAFNAETVDRDGNAIPAMSSLIWAFGDVNIDAREGTFHNEKYGNVLSVGDM
                     SIIANEIINDAGIIRSEGDMALDARSIKNLSEYSGGDWKTGPIQEGRGFVEFYSGLNY
                     YSRTIKTYLPTLSSDITMLTKAEISSSGKIDINQRNIFENTSSNPLEILNEGGIIQST
                     GDMTITGNLTNRPKYTQAPLYDYLTEPLAQPIEIDIYHKLVNDDNIPATFNTIYSFLN
                     WMFADGNPSTIDGKEYGDDYVPHTPQPPFIVIDPVIRIGEYKDAFLNSLRKAASGGDK
                     SVESPQLNTVMTMIFGESWLTKDLDTLRSDWVNLGKSSDSTDIGTDAALKEKGFYFLP
                     NDKGSIVTLGTFTHNGGELNNGIGDFHTETGTSGSVNVEKVGDQEITPIGGSTEVLVN
                     IKDIEEYRAGISPMSTIEAMSKLPAMFPYSPEWNQRNTDEPNLKDGPTNTVTPVFETR
                     FEMIDQSQYFGSDYFFEQVGYVPDEPVYVIGDNYYISELIRRQINDSVGTYFAVRDGV
                     DGVDLVKMLMDNAMEVVNYGVADTSGTEDSDEVSSSAMSSTSSNNSPGQTLSVETSTA
                     MSGTSPAMSSTNSNNIPGQTLSVETGTTMSGASAPTGATISNGQVVSSGTGITMSGAS
                     APTGATISNGQVVSSGTGITMSGASAPTGATISNGQVVSSGTGITMSGASAPTGATIS
                     NGQVVSSGTGITMSGTSAPTGGSISNGQVVSAGAGAVAGDTSSAMGSTNSINLPGQTL
                     EGGAGAIAGGTTSETGATSSNNIPGQTLSGDTTAASSPETSGTASNNNLPGQTSDTAS
                     STTTAVKSNSTKENLGLVVGEPLTEEQRGKLDKDIVWFVNQTIDGEQVLVPFVYLANS
                     TIEAMSTGAKESSGSAVIHAKNDVNIDASSVNNQNAVISAGNDANITAKGDINNSSNG
                     ANGGIVAKKDVSMVSTEGSINNDGAYVKAGNDINMSAENGSIEMTASVGRDAEGKQQV
                     HTYDDAVSAGGDINMKAKDITSNAANIEAGNDVNMKSTEGDITFNEMHEISAEYTNEL
                     DKKNALNFTHTETETTTATAIESKVKAGGKLNIDSAEDVVMKGGEYSGTSGNIKAAGE
                     VDMQATQDYEHSESVVESREFTLTGNANAVGYSASAEHSALEGGSSSTNAGDYGFDYG
                     SEFGGHGSKSPGKAPVAPAAEAFVGFRSSTDKATSDTTTNQNASFNFSDDLNIEAKTV
                     DIGGADIKAGDELNITADELKTTKYVDTHDETFSHEGLSVGVTGSASSVILDVLDKNA
                     GMVVNEANNPDVDFDALTTAAQVAGDATNLIFNDYASYNTTWGVDYNKSSGSSSSTSE
                     NITHLDAGKINIKTKGDTTLNGVDMKANDVAIDAGGDVNMRAAEKTSSYTEDGMNVSI
                     GVTAGAAIDRDTAGAGASLDASGGNNHTDKSSKSYTNTTILADNVDIKSGNDINLHGA
                     DITANTADVKAEGDLNIVSVQDTVNNDASSWHAGLSVGAAVTTDSKGIPIPTASANAG
                     GGSDYLDSAKTAKQSGIHTSGELNVDVSGDLNMNGSHLISDDHTGNVDVAGSINVQDL
                     VDTVEQDGAYGGGGGGVTKTGPSVNIYAQTTDEVHYQENQHSTIDVGNTTAGQINGDV
                     NTDGTKTSEVVKDEKEWGSDISATVSWSPSKSDSYDVKTPDAVKPKPADTTDGVTPRP
                     EPTPQPKPEPTPEPTPQPKPEPTPEPTPQPKPEPTPEPTPQPKPEPTPEPTPQPKPEP
                     TPEPTPEPTPEPAPTPKPDESETQKTGDDDTPVKPDDGTKPDDGTKPDDGTKPDDGTK
                     PDDGTKPDDGTKPDDGTKPDTDETDSPDKKPRPSEYNGKKWEVKTPERVVLTPGSATG
                     NTTWIEPPKSGPGKDGTQYQGVPRSGAVKTRDTTPKTPAADTKKADPSQYQGKKYPIV
                     QPVKPIIASPGSSTNNITPNDTPRDGNKNNGTEYEGQPVRQEVKLPDGAAIWKPLMPE
                     HVMASAHTYQETEWSESNTPINQRGTKNA"
     gene            complement(568232..568696)
                     /locus_tag="RAHAQ2_RS02650"
                     /old_locus_tag="Rahaq2_0551"
     CDS             complement(568232..568696)
                     /locus_tag="RAHAQ2_RS02650"
                     /old_locus_tag="Rahaq2_0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333738.1"
                     /note="activates anaerobic ribonucleoside-triphosphate
                     reductase under anaerobic conditions; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleotide reductase-activating
                     protein"
                     /protein_id="WP_014333738.1"
                     /db_xref="GI:504099744"
                     /translation="MNFHQYYPIDVVNGPGTRCVLFVSGCVHECRGCYNKSTWRLDSG
                     KPFTQADEDRIIADLQNTVIPRQGLTLSGGDPLHPQNLSAIHQLLVRVQAECPGKDVW
                     MWTGYTLGELSAEQQEVVALINVLVDGKFVQELKDPSLIWRGSGNQVIHYLR"
     gene            complement(568701..570839)
                     /locus_tag="RAHAQ2_RS02655"
                     /old_locus_tag="Rahaq2_0552"
     CDS             complement(568701..570839)
                     /locus_tag="RAHAQ2_RS02655"
                     /old_locus_tag="Rahaq2_0552"
                     /EC_number="1.17.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014411578.1"
                     /note="Catalyzes the reduction of nucleoside
                     5'-triphosphates to 2'-deoxynucleoside 5'-triphosphates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-triphosphate reductase"
                     /protein_id="WP_037040622.1"
                     /db_xref="GI:739176646"
                     /translation="MQPIVIKRDGCQVPFDEVLIKQAVQRAAEAAGIDSIGYCEQVAR
                     IVAQNLQDQARVDIHEIQDAVENQLMAGPYKKLARAYIEYRHDRDVKREMRGRLNQEI
                     RGLVEQSNMALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHILPRDVVLAHERGEIH
                     YHDLDYSPFFPMFNCMLIDLKGMLNHGFKMGNAEIDTPKSISTATAVTAQIIAQVASH
                     IYGGTTINRIDEVLAPFVTASFNKHRQTAEEWQIADAEAFAHNRTEKECYDAFQSLEY
                     EVNTLHTANGQTPFVTFGFGLGTSWESRLIQQSILRNRIAGLGKNRKTAVFPKLVFAI
                     RDGLNHKAGDASYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYE
                     ENGEMIHEGRNNIGVISLNLPRIALEANRDEAAFWKLLDERLLLAKKALMTRIARLEG
                     IKARVAPILYMEGACGVRLKADDDISGIFKNGRASISLGYIGVHETINALFGDQTHVF
                     DASQLREKAVAIVARLKAATESWKDETGYGFSLYSTPSENLCDRFCRLDKAEFGLVAG
                     VTDKGYYTNSFHLDVEKKVNPYEKLDFEAPYPPLSNGGFICYGEYPNLQHNLKALEDV
                     WDYSYTRVPYYGTNTPIDECYDCGYTGEFECTSKGFTCPKCGNHEPSRVSVTRRVCGY
                     LGSPDARPFNAGKQEEVKRRIKHLGNGQLG"
     gene            complement(571183..572826)
                     /locus_tag="RAHAQ2_RS02660"
                     /old_locus_tag="Rahaq2_0553"
     CDS             complement(571183..572826)
                     /locus_tag="RAHAQ2_RS02660"
                     /old_locus_tag="Rahaq2_0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose-6-phosphate hydrolase"
                     /protein_id="WP_014333740.1"
                     /db_xref="GI:504099746"
                     /translation="MNSELPWWKNGVIYQIYPKSFQDTTGSGTGDINGITQRLDYLKT
                     LGVDAIWLTPMYLSPQIDNGYDVADYCEIDPAYGTLEDFERLTAEAHQRGIRIVMDMV
                     FNHTSTHHEWFRQSQDAGSPFRPFYIWRDGAAEGGPPNNWRSKFGGGAWQWHETSGQY
                     YLHLFATEQADLNWEYPPVREALKKVCQFWADKGVDGLRLDVINLVSKQQDFPSDNAG
                     DGRRFYTDGPRIHAFLQEFSRDVFKPLGLMTVGEMSSTQLEHCRRYAANDGSELSMTF
                     NFHHLKVDYPNGEKWTDAPPDFVQLKQIFRDWQQGMHGHAWNALFWCNHDQPRIVSRF
                     GDEGALRTTSAKMLAMVLHGLQGTPYIYQGEEIGMTNPGFRHLEQYRDVESLNMFAEL
                     KSDGRDTAELLRILARKSRDNARTPMQWTAGEQAGFTTGTPWISVSQNAKDINTEQAL
                     ADKDSVFYLYQQLIRLRKTLPVLTGGDYQDLLPEHPQLWCFSRTADGNTLRVVANLSD
                     RAQTFTLPEVSGEMVLSNYATAAVSGTLRPYECRWQLAG"
     gene            complement(572849..574267)
                     /locus_tag="RAHAQ2_RS02665"
                     /old_locus_tag="Rahaq2_0554"
     CDS             complement(572849..574267)
                     /locus_tag="RAHAQ2_RS02665"
                     /old_locus_tag="Rahaq2_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573854.1"
                     /note="phosphoenolpyruvate-dependent sugar
                     phosphotransferase system; catalyzes the phosphorylation
                     of incoming sugar substrates concomitant with their
                     translocation across the cell membrane; IIB is
                     phosphorylated by IIA and then transfers the phosphoryl
                     group to the sugar; IIC forms the translocation channel;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS maltose transporter subunit IIBC"
                     /protein_id="WP_014333741.1"
                     /db_xref="GI:504099747"
                     /translation="MSKVKQQDVDQLIALVGGSDNIAMVTHCITRLRFVLNDPSKADP
                     KGLEALPMVKGCFTNAGQFQVVIGPEVDDYYKVLLASTGKSQAGKEQAKIAARQNMSW
                     FERSISHFAEIFFPLLPALISGGLILGFRNVIGEIPMSDGQTLAQMHPLWQSIYDFLW
                     LLGEAVFMFLPVAVCWSTVRKMGGTEILGIVLGITLVSPQLMNSYNLGQQIPEVWNFG
                     WFTIEKVGYQAQVIPSVLAGMALAMIENGLKRIVPNYLYLVIVPVSSLLIAVFLAHTL
                     IGPFGRMVGDGVAFAVKFIMTGSLAPIGAALFGFLYAPLVITGVHQTTLAIDMQMVQS
                     TGGTPVWPLIALSNIAQASAVVGVIIVSRKHNEREISVPAAISAFLGVTEPAMYGINL
                     KYRFPMLCAMIGSACAGLICGLFHVTANGIGVGGLPGILSIKPQFWSIYALAMLVAIV
                     VPVILTVLVYQRKARRGELAVV"
     gene            complement(574393..575349)
                     /gene="treR"
                     /locus_tag="RAHAQ2_RS02670"
                     /old_locus_tag="Rahaq2_0555"
     CDS             complement(574393..575349)
                     /gene="treR"
                     /locus_tag="RAHAQ2_RS02670"
                     /old_locus_tag="Rahaq2_0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573855.1"
                     /note="regulates genes involved in trehalose metabolism;
                     binds the intermediate trehalose-6-phosphate; binds a
                     dimer; regulates treBC operon; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose repressor"
                     /protein_id="WP_014333742.1"
                     /db_xref="GI:504099748"
                     /translation="MTQQNRLTINDIARLSGVGKSTVSRVLNNEGNVSPQTRERVLQV
                     IEQQHFSPSKSARAMRGFSDKIVAIIVSRLDSPSENLAVRAMLPLFYQQGYDPIVLES
                     QFSAERVKEHLQVLKQRNIDGIVLFGFTGLSAQMLTPWQDKMVVLARDMPGLSSVCYD
                     DAGAVQLLMQKLLAQNIREIGFIGVSPQDTTTGQRRSAAFRAFCKEHGLTPHIALGEL
                     TYQSGFDLIPQLLKNDIQAVVCASDTIAIGAQKYLQQQQIRGVQVCGIGNNPLLHFLF
                     PESYSVELGYGAGGEAAAKQLLAQLSGSASVRQLIIPGKLAF"
     gene            575696..578395
                     /locus_tag="RAHAQ2_RS02675"
                     /old_locus_tag="Rahaq2_0556"
     CDS             575696..578395
                     /locus_tag="RAHAQ2_RS02675"
                     /old_locus_tag="Rahaq2_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333743.1"
                     /note="P-type; involved in magnesium transport into the
                     cytoplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-transporting ATPase"
                     /protein_id="WP_014333743.1"
                     /db_xref="GI:504099749"
                     /translation="MFKNFTSRLLSALSRNLPRRLVRRDPMLENVSARAAQAIPAAMS
                     AHCQACARATEDQLYLQFASHPEGLTAHEADAIREVSGLNQTGDQQPAPWWRHLWHCY
                     RNPFNLLLTVLGLVSYATDDLTAALVIGAMVFISTFMHFIQEARSNKAADALKAMVSN
                     TATVLRSDAQTGRSETVEIPISQLVPGDLLKLSAGDMIPADLRILSAKDLFISQAALT
                     GESLPVEKHACEKKPIAADPLELNTLCFMGTNVVSGTAIAMVIATGSKAWFGQLAERV
                     VQEDTQPNAFQAGISKVSWLLIRFMMVMTPVVLVINGYTKGDWWEAALFALSVAVGLT
                     PEMLPMIVTSTLAKGAVKLSRQKVIVKRLDAIQNFGAMDILCTDKTGTLTQDKIVLER
                     HTDVLGETSDDVLHLAWLNSHYQTGLKNLLDVAVLEAGDAGTAHNSLKIDEIPFDFDR
                     RRMSVVVAENDQNHRLICKGALEEMLSICTLVQLNGEIVPLTDVLLARIRRITDDLNQ
                     QGLRVVAVAHKVMPSRTQGYGVTDESSLILAGYIAFLDPPKESTAPALDALQRKGVTV
                     KILTGDNPLVARKVCKDVGLQADNVLIGSDIDAMDDSQLLRVARDTTVFAKLTPMHKE
                     RIVRVLRGEGHVVGFMGDGINDAPALRAADIGISVDSAVDIAKEAADIILLEKSLMVL
                     EQGVTEGRRTFANMLKYIKMTASSNFGNVFSVLVASAFLPFLPMLPLHLLIQNLIYDV
                     SQVAIPFDNVDEEQLAKPQRWNAGDIGRFMVFFGPISSVFDILTFSLMWWVFKANTVE
                     AQTLFQSGWFIEGLLSQTLIVHMIRTRKVPFIQSRASWPLCIMTLMVVITGIALIYSP
                     VAGFLQLQALPLSYFPWLIAILAGYMVLTQCVKGWFVRRYGWQ"
     gene            578638..579289
                     /locus_tag="RAHAQ2_RS02680"
                     /old_locus_tag="Rahaq2_0557"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            579282..579536
                     /locus_tag="RAHAQ2_RS02685"
                     /old_locus_tag="Rahaq2_0558"
     CDS             579282..579536
                     /locus_tag="RAHAQ2_RS02685"
                     /old_locus_tag="Rahaq2_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333745.1"
                     /db_xref="GI:504099751"
                     /translation="MPKNGVFFKLFRMVLTAIEKVVAFIIYYLFEFAFAPLIIFGTIL
                     CIMYIEPWPIKFAGIGTWLIFLYVLYKVIDKITGRDKRDN"
     gene            579926..580384
                     /locus_tag="RAHAQ2_RS02690"
                     /old_locus_tag="Rahaq2_0560"
     CDS             579926..580384
                     /locus_tag="RAHAQ2_RS02690"
                     /old_locus_tag="Rahaq2_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015698694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014333746.1"
                     /db_xref="GI:504099752"
                     /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQVFYGEKRRAVGSILRKL
                     CEWKNVHILEAECCADHIHMLVEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRN
                     REFWCRGYYVDTVGKNTSKIQEYIKHQLEQDKLGEQLSIPYPGSPFTGGK"
     gene            complement(<580824..582026)
                     /locus_tag="RAHAQ2_RS02695"
                     /old_locus_tag="Rahaq2_0562"
     CDS             complement(<580824..582026)
                     /locus_tag="RAHAQ2_RS02695"
                     /old_locus_tag="Rahaq2_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333747.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_037040617.1"
                     /db_xref="GI:739176640"
                     /translation="MQTPSSPSFLKRFTDSSLVMQILVGLIAGIILAALAPEVAKTAG
                     LLGSLFVGALKAVAPLLVLVLVTASITNHPKGRKTSLGPILFLYLFGTFSAALIAVVV
                     SFMFPSTLDLKVANVEITPPGGIAEVLKGLIMSIVSNPFRALIDANYIGILAWAIGLG
                     LALRQAADTTKNLVTDVSVAVTKIVRVVIRFAPLGIFGLVAETLATSGFGALYDYAHL
                     LVVLIGCMLLVALVFNPLIVLVKTRRNPYPLVFACLRESGVTAFFTRSSAANIPVNMN
                     LCRKLGLDEDTYSVSIPLGATINMAGAAITITVLTLAAVTTLGIEVDILTALLLSVMA
                     AVCACGASGVAGGSLLLIPMACSLFGIPNDIAMQVVAVGFIIGILQDSAETALNSSTD
                     VLFTAAACQ"
     gene            complement(582162..583130)
                     /locus_tag="RAHAQ2_RS02700"
                     /old_locus_tag="Rahaq2_0563"
     CDS             complement(582162..583130)
                     /locus_tag="RAHAQ2_RS02700"
                     /old_locus_tag="Rahaq2_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014333748.1"
                     /db_xref="GI:504099754"
                     /translation="MNSVGNPMLWGSFAVVVIIMLAFDLLLQGRKGAQTMSMKSAALW
                     SLVWIGLSLLFNFGFWWYLNGEFGREVADAKATMFLTGYLLEKALAVDNVFVWLILFS
                     YFSIPASLQRRVLVYGVLGAIVLRTGMIFAGSWLVGQFSWILYVFGAFLLFTGIKMAL
                     AKEDDGEVGEKPMIRWLRSKMRMTDELQGEKFFVRRNGILFATPLLLVLIMVELSDVI
                     FAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAMYFLLAGVAERFSMLKYGLAVILIFI
                     GIKMLLLDVFHIPVGISLGVIASILIITLLINTWVNRRADLAKSKK"
     gene            complement(583541..584287)
                     /locus_tag="RAHAQ2_RS02705"
                     /old_locus_tag="Rahaq2_0565"
     CDS             complement(583541..584287)
                     /locus_tag="RAHAQ2_RS02705"
                     /old_locus_tag="Rahaq2_0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333749.1"
                     /note="Catalyzes the transfer of the ammonia group from
                     glutamine to a new carbon-nitrogen group; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_014333749.1"
                     /db_xref="GI:504099755"
                     /translation="MIAPSQKPLLILQTGHAPEPIRRAHDNFPQMFIRQGDIDAQQVV
                     IVDLQAGERPLPPENYCGAIITGSRSMVTEHLAWSEEAADWVRLGMLQELPMFGACYG
                     HQLMAYALGGEVDYHPQGIEVGTHEVTLTPDGHLDPLVSQLPAQFAANLIHLQTVITP
                     PATATVLAKTQHDPHQILRYGPNAISTQFHPEFSLAVMKTYLSWLGSIAEDDNVDFAH
                     QAQQLSETPLSRSLLLSFVGALGKRQALAG"
     gene            complement(584314..585300)
                     /locus_tag="RAHAQ2_RS02710"
                     /old_locus_tag="Rahaq2_0566"
     CDS             complement(584314..585300)
                     /locus_tag="RAHAQ2_RS02710"
                     /old_locus_tag="Rahaq2_0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014333750.1"
                     /db_xref="GI:504099756"
                     /translation="MIRFAVVGTNWITQRFIDAAHESGKMKLTAIYSRTLEGAKKLGE
                     DYPVGHYFDSLEEMAASDLIDAVYIASPNSLHYPQSLLFLSHKKHVICEKPLASNLRE
                     AESLIACAKENNVVLFEAFKTAYLPNFLHMKGALNRIGKLRKAILNYCQYSSRYPRYL
                     AGENPNTFNPAFSNGSIMDIGYYCLASAISLFGEPESVKATATLLESGVDGQGTVILS
                     YADDFEVVIHHSKISDSHLPSEIQGEDGTLQMEKLSECQTLSLTPRGSQKLDLTQPQH
                     INTMLYEAETFAILVDSQFVAHPGLEVSRITAKVLTEIRRQTGVVFPADNQP"
     gene            complement(585333..585839)
                     /locus_tag="RAHAQ2_RS02715"
                     /old_locus_tag="Rahaq2_0567"
     CDS             complement(585333..585839)
                     /locus_tag="RAHAQ2_RS02715"
                     /old_locus_tag="Rahaq2_0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333751.1"
                     /db_xref="GI:504099757"
                     /translation="MPELTYLQGYPESLQAQVRQLIDQERLGNVLLTRYPEPHELTTD
                     KSLYQYTLDLKNQFLRSSSPLSKVAYDNKIHVMKHALGLHTAISRIQGGKLKAKAEIR
                     VATVFKSAPEAFLKMIVVHELAHLKEKEHNKAFYSLCCHMTPDYHQLEFDTRMYLTHL
                     EIFGKLYT"
     gene            586010..587161
                     /locus_tag="RAHAQ2_RS02720"
                     /old_locus_tag="Rahaq2_0568"
     CDS             586010..587161
                     /locus_tag="RAHAQ2_RS02720"
                     /old_locus_tag="Rahaq2_0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="WP_014333752.1"
                     /db_xref="GI:504099758"
                     /translation="MSQFETETGGQLLQLRLERYPLEEAATQLQAWEAADEYLLQNLN
                     TEALNGRPLLIFNDAFGTLACALQPYNPTSVNDSFMSQLAMRHNLRLNGFDEDSVAAQ
                     SSLVPLPINPGLVIIKVPKTLALLEQQLLALREVVTPDTRIIAGAKARDIHTSTLQLF
                     EKILGPTKTSLAWKKARLIHCEATLPAQTAEPVISEWALDDSEFRISNHANVFSRGGL
                     DIGARFFMQHLPEGIEGRMADLGCGNGVIGMTALALNPDAQMLFVDESYMAVESSRIN
                     VENNLPQDVSRCHFEVNNMLAGVERETLHAVLCNPPFHQGTVVSDDTAWRMFCDAKRC
                     LQTGGELRIVGNRHLDYYQKLRRLFGNCTTIATNQKFVILRAVKTAAHH"
     gene            complement(587250..587789)
                     /locus_tag="RAHAQ2_RS02725"
                     /old_locus_tag="Rahaq2_0569"
     CDS             complement(587250..587789)
                     /locus_tag="RAHAQ2_RS02725"
                     /old_locus_tag="Rahaq2_0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014333753.1"
                     /db_xref="GI:504099759"
                     /translation="MSAFNSLWRYPAVVTLVFLSGLTGGCGLTQSISDGTSAMTQAIF
                     YKQIKTLKLDFIARASVNPDEEGASLATDVWIYQLKDRKIFDQTDYQTLLTQASTVLK
                     DDILAGKDIRVRPDGGATLNMPIEKEAMYVAVVAHFRTPDLQKDSWRLVLQREELIPD
                     APLKIILEGNVLQLQAEKE"
     gene            complement(587776..588858)
                     /locus_tag="RAHAQ2_RS02730"
                     /old_locus_tag="Rahaq2_0570"
     CDS             complement(587776..588858)
                     /locus_tag="RAHAQ2_RS02730"
                     /old_locus_tag="Rahaq2_0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333754.1"
                     /db_xref="GI:504099760"
                     /translation="MEREPQPVYSRLIRDMGDKLPYTNFYRFCQLIEQSSPRRPPLGS
                     TSSPKDDLIRFRPHPGMGFPVSELKALECDRDHPERPPTVRTTFLGLYGVDSPLPTSY
                     LDDIAQRREGHEAVEEFLDIFNHRIMTQFYRVWRKYSYPASFEAGGTDETSQRLLGLM
                     GLGIPGTAKNIATPVSRFLALLSNMRMPTRTAEGVIALVDLLSSETTASVRLHYPRTI
                     AIKPLRFGDKTPLGLRPVLGHSAKEVNSMFELQLYTENPAEAQAWLPGGQLSEDLLVL
                     LRVYLGWRVDARILLTLPRHILPPARLHTSSDGGFRGQLGYTTVMRSASTSSEVPLNA
                     TLTIRLSDYQGLKPNLKTREVINVCF"
     gene            complement(588822..590585)
                     /locus_tag="RAHAQ2_RS02735"
                     /old_locus_tag="Rahaq2_0571"
     CDS             complement(588822..590585)
                     /locus_tag="RAHAQ2_RS02735"
                     /old_locus_tag="Rahaq2_0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein ImpG"
                     /protein_id="WP_014333755.1"
                     /db_xref="GI:504099761"
                     /translation="MEDLTLRYFDAEMRYLREAAKEFATAHPDRAAEIGLMTPGSADA
                     SVERLFQGFSFSMGRLREKLDDDLPELTEGLVSMLWPHYLRTIPSLSIVELAPAWQEM
                     KMTETLVAHFEVISQPVGTEGTRCRYRTTRDLQLQPLILSHASLAMEPDGQHIIRLRF
                     SCSRLANWQSVDLTSLPLYLNGDAPLACALLLALTHQVRKCYLRLPGQVDRQPVTLHF
                     KAEGLGELANLWERGDATCCGYQQLLEYFTFREKFMFVSLCGLERVELPATLAGFEVD
                     IVLDSPFPSDFSLDASHLRLHCVPVINLFSLDAKPLSISNQETDYLLQPLCKQPACTE
                     IFSVDNVTSSRRTHAQVYTPFRTFRYHGGTLRRHLPARYYHTRVKPGVTGLHETWLIL
                     GGDGFEQERQIADETLTLSLTGTNGQLPRLALRSTLLNATTQALPVPLNILNLCPPTM
                     PAYPPNRDRFHWRVLSHLGTHFLSMMDNAEVLRNTLALYDWTESEDNRRRLDAIVKVE
                     HFRLQRFEKGLLLRGVDIEVTVESPGFYGEGDIYLFGEVLNRFLALYADIHLFNRLTL
                     IVQPSGKCLQWKENHSQYIPG"
     gene            complement(590594..593929)
                     /locus_tag="RAHAQ2_RS02740"
                     /old_locus_tag="Rahaq2_0572"
     CDS             complement(590594..593929)
                     /locus_tag="RAHAQ2_RS02740"
                     /old_locus_tag="Rahaq2_0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein VasK"
                     /protein_id="WP_014333756.1"
                     /db_xref="GI:504099762"
                     /translation="MINPFASRPSGASLLAMVFGAILAAVLYFFSERWGLSPLLRSLI
                     WALGMALLFAVMAIYRNSRRPPPARSPVSKKETHSAADGETQSPYTEELCDYLRHRYG
                     RFWRSKVRLVVLVGQSRLVGMIAPELISQQWIEADGTVLLWGGNITSASDSNRIAALR
                     KLRRRPPQAIVWVCDARHQQVSLADTAARQLRDRAKLLGWQVPLYVWQIENSESPPAS
                     RETQPIGCLLPANSTPQMLEEALRELTSQLTVQGTQQVLQKPADDFMLRLSHQLLNGE
                     IARLRATLAPLLSGPYAAPLRGIMFSQPLRFVEGVDKFRWLPDASWKGILNDLSSVRA
                     KRIGIPWAKGLRYSLAGLLIFWCFAAVLSFTANRAVLRESVDLTVRISDPAIPLEKRL
                     MNLQELQRKIGQLQYRAVHGAPWYLRFGMNQNEALLAALWPHYLKINNTFIRDAAASK
                     LTQQMNALLSLPPDSPQRGLMARQAYDQLKAYLMMARPEKMDAQYFTTTMMKQWPQRN
                     GVSDAVWRNYGPSLLSFYAQNLSAHPQWKITQDEAMVGQVRTLLLRQIGMRNAEASLY
                     QKMLLQVARHYADMHLEDMVGDTSARPLFSTDSVVPGMFTRKAWEEAVQPAIDDVVNT
                     RRDEIDWVLNDNKHPVKEDISPQALKARLTERYFADFSGAWLGFLNSIHWRRADTLSD
                     AIDQLTLLADIRQSPLVALLNTLDYQGKTGRQNEALTESLVKSAQNLIHADQKPAIDQ
                     RDKNTKGPLDDTFTPLLTLMNSNAGGDGYNSLSLQSFLTRITRVRLRLQQVTNTADPQ
                     AMTQALAQTVFQGKSVDVTDTRDYGSLVAASLGQEWSGFGQAMFVQPMEQAWQQVLTP
                     TAESINAQWRNAIVQDWSADFNGRYPFAPVQSEVSLALMSQYLRNDTGRIARFITTNL
                     NGVIKRQGRHWEPDVISAQGLHFDPEFLQALNQLSELADVVFTHGDASLHFELMAKPA
                     KDVMQTELTLDQQNLKYFNQMESWQPFNWPDSQWKPRVTLSWVSVRAGTRLYADYPGI
                     WGFIRLLEKAKVTQIDSSTFRLVWKAPDGLPLNYLMRTEAGEGPLALLALKGFKMPQS
                     IFLPPPATANDAGDNQSGSDTPD"
     gene            complement(593926..595071)
                     /locus_tag="RAHAQ2_RS02745"
                     /old_locus_tag="Rahaq2_0573"
     CDS             complement(593926..595071)
                     /locus_tag="RAHAQ2_RS02745"
                     /old_locus_tag="Rahaq2_0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011148316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333757.1"
                     /db_xref="GI:504099763"
                     /translation="MSWDIPLPYVVKHPAPLQWNGWWRGVSLLVMLCVAAGCGLWYWL
                     KDPRILLLTFGAVITVTVLFLGIAGWRLFSYGVNAEHAESMEQQNEWHQEKWQVWAQS
                     GLNILDFSYIFPAEIPHPFEHRTLVNNEVAFSLPSRPPLLYLFEELLAPLAASLRMLR
                     NPLDVYLPCNDDEAARRAFALTWEKLGLSLSAVSDFFSGAVTKPWADQTTQWLNDGNS
                     NAKLLIFFQWPENDQPRIHTDGAIAWLIAANGSGSVRSRCRLHRPVTGTAEEAEHNAG
                     LFLKYQAPAMNVSDQWYNQTAIAAQNILTLKRCRQLRVQNPASNPPVPEQQFIPYWLG
                     KPGPATDYFTITLMMLMAEYRYAPQSLVLSQADALVFATVSPGEDIS"
     gene            complement(595077..595346)
                     /locus_tag="RAHAQ2_RS02750"
                     /old_locus_tag="Rahaq2_0574"
     CDS             complement(595077..595346)
                     /locus_tag="RAHAQ2_RS02750"
                     /old_locus_tag="Rahaq2_0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333758.1"
                     /db_xref="GI:504099764"
                     /translation="MPKGIIRLGDKLTSGGVVMSASSTMIIEGIVAALIGDVVICPLL
                     GHGVNRIVSTTPTWLSDGKQVAFDQAVCACGCKVLSSLPTTYIEG"
     gene            complement(595449..596555)
                     /locus_tag="RAHAQ2_RS02755"
                     /old_locus_tag="Rahaq2_0575"
     CDS             complement(595449..596555)
                     /locus_tag="RAHAQ2_RS02755"
                     /old_locus_tag="Rahaq2_0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011148320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333759.1"
                     /db_xref="GI:504099765"
                     /translation="MEKETDERLVNYTSCLRSEFKDLDRLEGCFVSLELYIKNRTRKI
                     KEYDEMNRPGSKEDPANQMYSRIFIEETRLSLIRAKEYLRQVEAEKNSFPPLPELPPT
                     KPLIKISGIVEELSIKKVIGYFDFSEYSTEKARAEEKIKRDNEGASLLLLLQFFAGDA
                     PHARFNDGRRKESQCIYVTGKVDSRVFSGWLRHSNMQVGDYVEIAAMPENNEYRMYAV
                     ANPKTRIISTTQNCHFGRKYSNVKEFTVLTGIFYTSIFIFLCLLEFPTLEKFFYALLT
                     IFFLTFTTTFFITRGIKNENRAPGELFEKICNVLEISNGETLNLAKYSRHKIKKIKKT
                     NNQSGNEKVPSAIIQTLDKGIFDVFYYPEKDNLT"
     gene            complement(596601..597710)
                     /locus_tag="RAHAQ2_RS02760"
                     /old_locus_tag="Rahaq2_0576"
     CDS             complement(596601..597710)
                     /locus_tag="RAHAQ2_RS02760"
                     /old_locus_tag="Rahaq2_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011148320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333760.1"
                     /db_xref="GI:504099766"
                     /translation="MEKETDEQLVNYTSCLRSEYRDLERLEVSLDCLDIYIEHRSEKI
                     NEYDEMKNPIQEEESSPEAYKRMFIDETRLSVIRAEEYLKQVQAEINSFPTPPELPPT
                     KQLIKISGIVEELSIKKVIGYFDFSEYSTEKARAEEKIKRDNEGASLLLLLQFFAGDA
                     PHARFNDGKRKESRCIYVEGKVDGKFFSGWLKQTNIQVGDYVEMAAMPEDDGFKIYAA
                     AKPQLETISVTTGCYAGKNRFSIRYVIKGTGIFFFFMVFIYASFASLSLEEWGYAVLI
                     YLSLTGGFSFVLFRGLNNDARAPGDLFERICATLNIPNGNTLDLDKFTREKIKYKQEK
                     GEWIKPEKGIVSTPQIIIQGGFDVYYYPVKDNANQ"
     gene            complement(597723..600488)
                     /locus_tag="RAHAQ2_RS02765"
                     /old_locus_tag="Rahaq2_0577"
     CDS             complement(597723..600488)
                     /locus_tag="RAHAQ2_RS02765"
                     /old_locus_tag="Rahaq2_0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011148321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333761.1"
                     /db_xref="GI:504099767"
                     /translation="MSQPEVVICPRCQPGGPAILPVRYAPIPDSLSPKLPGWAKPEID
                     FPKTTGYDYGLRAMRAGFLYVWYEADAHWETWSITPDGGLWKQNDALSAQPKYTSDCE
                     RGFHKSANIEFIVLDKLALTSTLWLAYTPAKWNPALLDIYATDAGKRKARMQQVEPWQ
                     WTAPEEEKGIAQATQAPLQTVLDYQPPGPACPAGKLPFSTDISRISNISSISDIPDPP
                     PFYTFAADAVRPRTTLYPWSTERAGKESVTLTALASRGTLPDGTPVKPLIMAVNDPIG
                     IAHELTSWCDDMTLMHKRYRDELGVEFATYYDIKGLERVIRQAEEQQFDQTFPEKASR
                     HSIETVLNGAGFDLKGTTPSYEELEKIYAESRAKWKLNAVNKAWQKYADKFEQRWITD
                     FEIAYGELTRTVEEKTGILIGLRLLWLQHPLFIACIDDFNSDLTQDHLNYREMVGYAL
                     ASINLSETGKAQINTWADSYSTLDNKNLLWRYQFFNSPAVMTSVNPLLAQIKSQKAPS
                     AGEQIKTDTQFILNNLGVYADAVDRALTAMMSSGQAQSLTQRIMGFGDRALTTMTNQV
                     LAGTVVDTFQGKALRALFLLDSGVAKDQLVKMMNDAIAHPAGESIFTAEARENIQKIR
                     DNKLSQIDKNLSDLDEFKNKYNKLNESVKGKETIKLFRIKSLGIIMYSILALSLAESS
                     KGSVKDITALSIPLLFAGSSLAAMIEEAYRNVIEIEIKANIWKMRAASLGSVAAGLTV
                     IMDIRDIFDKGEKKGWVSWSVVLSFAKFSSDTAFALSTINDILLSKNKVLAAMGKQGL
                     KFTLLSTATEGIGLGVTRLVGFMSTWQVMVAIVFAQMLYEMWTDNEIQDWCEQTVFGT
                     KSNNHNTMYLTAYDISALVQKQEELLHTAMQIVFNLPLSEEEIKKAEDERRKRQQDIN
                     THFRLKY"
     gene            complement(600485..601516)
                     /locus_tag="RAHAQ2_RS02770"
                     /old_locus_tag="Rahaq2_0578"
     CDS             complement(600485..601516)
                     /locus_tag="RAHAQ2_RS02770"
                     /old_locus_tag="Rahaq2_0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011148322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333762.1"
                     /db_xref="GI:504099768"
                     /translation="MTTLEYDKEKVLFDYGDTAIKQQATTIFNELSEHLLRNGENVFL
                     LIDPAKLELNITSPWLITLTERRPEPVALRHASIPQSYYPWLITLDLTRPEDQTLLQE
                     SIIRSLQEIDPAKLMAGCGRTLCGWLTSMQPASVVARQLGSTAVQKLKEGGNILLRYF
                     DPAVNNTLWPHLSSFQQQRMLGILSGWHFPDGDGRLVSRRHTTSPQPLLTFSLALQEN
                     DNAMLERVGIINQALRQYRDLTRHDSRRSEAALRSMAELALQRIAHSPVITTFDERAL
                     FAFHVLRYHPHIDLSPEFQYLLSTETQPVDIRYRQRICALTSKDWQRLADECQHLTAA
                     THKNKELLS"
     gene            complement(601529..603901)
                     /locus_tag="RAHAQ2_RS02775"
                     /old_locus_tag="Rahaq2_0579"
     CDS             complement(601529..603901)
                     /locus_tag="RAHAQ2_RS02775"
                     /old_locus_tag="Rahaq2_0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
                     /protein_id="WP_014333763.1"
                     /db_xref="GI:504099769"
                     /translation="MDIASSTPLNIVSSLNRYQLAVHNSTAPLDVESFVAREHLSRAY
                     RYVVDVTSVIQDIDPQTILMQDASFIMQSLPATAFNIFTPPQVQRTVHGVITQFARLS
                     ESRDEAHYRLTLEPHLVLLDHTRRCAIYQNMSVPEIVEKILRDNHRYQGWQFEFRLSQ
                     SYPRRELVTQWQLSDFDFIRRLLSEVGIWFTFEMDNRLREEVVIFGDAQQYYQFDVKL
                     PVKDVSGMNDNAAESVWSLSALHQIVESAVRVKDYNYRDAANTLTVENSVVSEDKTTT
                     GNIYHYAEGFLKTGGVQKPEPDSAGFYAFLRHERDLNDQHQLWGKTNATRLAPGQMLE
                     IDGIIPKAYGKGILITGTVARASRSTSYQVTFTGIPYSETVGFRPALRARPKIIGTLP
                     ARITSISPNDIYSHIDKDGRYRLNFNFDLDTWKDGYESPWIRLARAYAGDTYGLHLVL
                     LAGTEVAVAFDGGHPDKPYIAHALHDSRHPDHVTIENYKRNVLRTPANNKLRLDDERG
                     KEHVKVATEYGKSQVSIGHLVDNKKEQRGEGFELRTDHWGAIRAAKGIFISADGQLQA
                     QGKVLDMHEALDELEAAHREAISLHTAAKMAKAELADIEKQASLMNDTLKQLQQRALL
                     LSAPAGIAQVTPASLQLSAGENLIATAGKNADISIAQKLRIASGEILSLFAKAMGIKM
                     FAAAGRIQIQAQSDALDMFSKKDMSIASSDGKVTVSAKTELLLECGGGFIRIKGGNVE
                     IGGPGSVSVKSATLQKVGPDSQNASLKLPEHCASMIDEAAAGQGPTVSLS"
     gene            complement(604059..604691)
                     /locus_tag="RAHAQ2_RS02780"
                     /old_locus_tag="Rahaq2_0580"
     CDS             complement(604059..604691)
                     /locus_tag="RAHAQ2_RS02780"
                     /old_locus_tag="Rahaq2_0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008813060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DotU family type IV / VI secretion system
                     protein"
                     /protein_id="WP_014333764.1"
                     /db_xref="GI:504099770"
                     /translation="MTSIDGLLQGTWLLVISLRRNDQPTGEPFYQQGIIQVDAVRKAL
                     KDQNISVENIDHITYTQCALLDESASGNTRQRVVWQNQPLQVRFFQTFQAGEELYDRI
                     RQVLQQPSPDIRVLTCFQRALALGFQGIYRDKPTPARQALLNELNELVPDFDFPLNTP
                     VIINRRFIRRGGWLRSPWLIGCGLLLITLLLSGGLNLQLEQLLHQWLPER"
     gene            complement(605251..607287)
                     /gene="fadH"
                     /locus_tag="RAHAQ2_RS02785"
                     /old_locus_tag="Rahaq2_0581"
     CDS             complement(605251..607287)
                     /gene="fadH"
                     /locus_tag="RAHAQ2_RS02785"
                     /old_locus_tag="Rahaq2_0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333765.1"
                     /note="catalyzes the formation of trans-2- enoyl-CoA from
                     2,4-dienoyl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-dienoyl-CoA reductase"
                     /protein_id="WP_014333765.1"
                     /db_xref="GI:504099771"
                     /translation="MTERASLFYPHLLAPLDLGFTRLKNRVLMGSMHTGLEERQDGPE
                     RLAAFYAERAAAGVGLIVTGGISPNAQGVVYQGGSVLAEQEHLTHHRVVTDAVHAAGG
                     KIALQILHAGRYSYQPHPVAPSALQAPINRFTPHALSEEEIESTLADFARCARLAKES
                     GYDGVEIMGSEGYLINQFLTARTNQRTDRWGGSADNRMRFATETVRRVRETCGREFII
                     IYRLSMLDLVEEGSDWQEVETLAQRIEQAGASMINTGIGWHEARIPTIATMVPRAAFS
                     WVTQKLMGKVGIPLITTNRINDPEVAEKILAEDCADMVSMARPFLADPAFVEKAAQGR
                     ADEINTCIGCNQACLDQIFAGEVTSCLVNPRACRETQLPVTRALITRRLAVVGSGPAG
                     LAFATTAASRGHHVTLFEAHNEIGGQFNIAKQIPGKEEFYQTLRYYARQLTLLGVTLR
                     LGETVNASQLTGYDDVILACGISPRLPDIAGIDHPSVLTYLDVLRDKKPVGQRVAIIG
                     AGGIGFDTAEYLSHSGSSSSLSPQAFSHEWGIDQSLTYRGGLSPIGPQPEPAARDIVL
                     LQRKTTKVGAGLGKTTGWIHRTSLLQRGVKMQSGVSYERIDDAGLHLMMNGEPVCLEV
                     DNIIICAGQEPQRALYQPLQAAGQTVHLIGGADVAVELDARRAIDQGTRLALKI"
     gene            607683..608549
                     /locus_tag="RAHAQ2_RS02790"
                     /old_locus_tag="Rahaq2_0582"
     CDS             607683..608549
                     /locus_tag="RAHAQ2_RS02790"
                     /old_locus_tag="Rahaq2_0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573863.1"
                     /note="regulator of pathogenicity factor RpfF; involved in
                     synthesis of a diffusible signal factor involved in the
                     regulation of extracellular enzymes; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_014333766.1"
                     /db_xref="GI:504099772"
                     /translation="MNLIDHTACRPFTEAGHLSQIAAYYEEGRNVMWMMLRSYPRPCF
                     NQELIEDIMALTYTAKASGLRFDFWVTGSLVPNMYNVGGDLSFFVDSIVNNKREALRA
                     YARSCVDCVHAAARGFDVGAISLSMIEGTALGGGFEAALAHHYVLAQNTARMGFPEIA
                     FNLFPGMGGYSLVTRKAGMKLAEELISSGESHTAEWFESRGLVDVLFQPGEAFNATRT
                     FMDVLRPKLNGIRAMIRARQRVLQLSRSELMDITEDWVDAAFTLEEKDLSYMERLVML
                     QNRHTASLRKTG"
     gene            complement(608579..610597)
                     /locus_tag="RAHAQ2_RS02795"
                     /old_locus_tag="Rahaq2_0583"
     CDS             complement(608579..610597)
                     /locus_tag="RAHAQ2_RS02795"
                     /old_locus_tag="Rahaq2_0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573864.1"
                     /note="c-di-GMP phosphodiesterase; probably degrades
                     signalling molecule c-di-GMP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase II stability modulator"
                     /protein_id="WP_014333767.1"
                     /db_xref="GI:504099773"
                     /translation="MVDSQDASLLYLHFGTPRPYWRLSSDSNALELSAEKGVVNIAIP
                     LTQWQAGKIKQLTGITSSFALDITLFGSPVRLYLVGRKIDSKAWAGTASAYHDTESVA
                     HDLEVGLTFAEQVVSEANSVIVIIDQEGKVHRFNRLSEEYTGLREEDVIGRSAYDLFM
                     SMEEGLASRQNITGFFQHQQSYEVERWINTVKGQRLFLFRNKFVHSGSGKQQKYLICS
                     GSDITDERKAQERLRVLANTDLVTGFANRNALQESLARALLERGENKVGLIYLDLDNF
                     KKVNDAYGHMFGDHLLRAVSDAIQDCLSPDDKLARLGGDEFIILSTHAEIKTLEALSQ
                     RVLRRLTLPFRIGLIEVYTGCSAGIAICPEHGTDGDTLLQNADTAMYAAKEKGKNVHC
                     VFSSGMNEKASEYMWLDTHLRKALSEKDQLVLHYQPKVSLYGNVQSVEALLRWHSPER
                     GLIQPQSFIPYAEESGLITPIGKWVIETATRQATEWQKKGLNLRVAVNLSGRQLNNAS
                     FITTLSDAMKKAGMKGCLLDFELTESCLVEDEGAAVTMINQLHKLGAQVHLDDFGTGY
                     SSLSQLARIPLDCIKLDQSFIRGINDNPVSQALVRAIVAVAKTLQLTVVAEGVETAEE
                     EKLIDEIGVDSKQGFLYAKPMPASELEHWLEEKMIASPHVFKHKAKQK"
     gene            complement(610880..613177)
                     /locus_tag="RAHAQ2_RS02800"
                     /old_locus_tag="Rahaq2_0584"
     CDS             complement(610880..613177)
                     /locus_tag="RAHAQ2_RS02800"
                     /old_locus_tag="Rahaq2_0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573865.1"
                     /note="catalyzes the hydrolysis of terminal
                     beta-D-glucosyl residues; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-D-glucoside glucohydrolase"
                     /protein_id="WP_014333768.1"
                     /db_xref="GI:504099774"
                     /translation="MNTHHMLGALVLLVSSASSLAVETTGIPQDQVKERNAFIADLMK
                     KMTLDEKIGQLNLVTVGPEYQKEAIMADIRAGKVGGVFNTVTKPDIRRMQDQVQYSRL
                     KIPPFYAYDVVHGQRTIFPISLGLAASWDMQAVATSARISALETAADGLNMTFSPMVD
                     ITRDPRWGRVSEGFGEDTYLTSRLAHEMVTGYQGKDPSAPDAVMANVKHYALYGAVEG
                     GREYNTVDMSLTRMFNDYMPPYKAAVDAGAGGVMVALNSINGIPATSNTWLLKDILRD
                     DWQFKGLTVSDHGAIGGLVKHGVAEDDRQAAAMALKAGVDMDMADNMYGKYLKGLLAD
                     GLVSQKDIDRAVRDVLAAKWDMGLFVDEYRHLGPPSSDPADTNAESRLHRQEAREVAR
                     TSLVLLKNNDQTLPLQKKGTIAVVGALADSKRDVMGSWSAAGKAAQAVTVLQGMKDVL
                     GDKGTILYARGANVTDDQAMVDFLNSYEKQVINDPRKPQDMIDEAVKTAEKADVVVAV
                     VGEAQGMAHEASSRSDINIPQSQRDLLKALKATGKPLVVVLMNGRPLTLSWENEISDA
                     MLETWFSGTEGGHAIADVLFGDYNPSGKLPMTFPRSVGQIPLYNSVLNTGRPFNPQHP
                     DKYTTRYFDITNGPLFPFGYGLSYTRFSVSDVNLSSTTMDAGHPLTASVTVKNTGKVS
                     GATIVQMYLQDVTASISRPVKELKNFEKINLQPGEEKIVTFAITEKDLRFYNDKLKWA
                     SEPGKFNVFVGLDSQDVKKTSFLLK"
     gene            complement(613559..613843)
                     /locus_tag="RAHAQ2_RS02805"
                     /old_locus_tag="Rahaq2_0585"
     CDS             complement(613559..613843)
                     /locus_tag="RAHAQ2_RS02805"
                     /old_locus_tag="Rahaq2_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013573866.1"
                     /db_xref="GI:503339205"
                     /translation="MGTLTAGILMMRWELLSAFLMFCTSQLNIVCRQSSRNTMAFVCS
                     GIGLTVTCFFVMSLMGMSYNAVAVAQFWANTKDVFFDVMSKTPTDMSYYY"
     gene            complement(614096..616822)
                     /locus_tag="RAHAQ2_RS02810"
                     /old_locus_tag="Rahaq2_0586"
     CDS             complement(614096..616822)
                     /locus_tag="RAHAQ2_RS02810"
                     /old_locus_tag="Rahaq2_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333769.1"
                     /note="Positively regulates the transcription of the
                     maltose regulon whose gene products are responsible for
                     uptake and catabolism of malto-oligosaccharides; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014333769.1"
                     /db_xref="GI:504099775"
                     /translation="MLIPSKLSRPVRQQNTVVRERLLTKLSTAPNYRLTLVASPAGYG
                     KTTLVAHWAAGKSDLGWYSLDESDNQPERFASYLIAAVQQACGGHCVKSEALSLKHQY
                     ASLPALFAQLFVELSDWHSPLLLVIDDYHLISNDAIHEGMRFFLRHQPENLSLVVLSR
                     TLPPLGIANMRVRDQLLELNASHLAFTHPETQQFFDNRLKDPIDQADSSRLCDEVAGW
                     ATALQLIALSARQSSHSSQHSTQQSARKLAGLNASHLSEYLVDEVLDRVDAPTRDFLL
                     RCSLLRSMNDALIVRLTGSENGQQRLEELERQGLFINRMDDSGEWFNFHPLFATFLRQ
                     RCQWELASELPAIHRAAAEGWLAQGFPAEAIHHALGAEDTNLLRDILLQHAWALFNQS
                     ELALLEECLAALPYDRLIQNPKLVLLQAWLAQSQHRYAEVDVLLARAESEMKQHNIVM
                     EQTLAAEFDALRAQVAINDGRQDEAEKLAAEALRYLPYESYYSRIVATSVTGEIQHCK
                     GDLTRALPLMQQTEQIARRYEAYHYALWALLQQSEILIAQGFLQAAFEMQDRAFELVR
                     EQHLEQLPMHEFLLRLRSQLLWSWSRLDDAEEAAREGLNVLSNFQPQQQLQCLAMLAK
                     CSLARGQLDNAHHHLQRCEALLKTGQYHIDWLTNTDKPRVIYWQMIGDKNAARQWLQQ
                     ARKPDMADNHFQQGQWRNIARVQILLEQFDEAEVVLDELNQNARQLRLTSDLNRNLLL
                     SNLLYWQTGRKSDAQKVLIEALGLANRTGFVSHFVIEGEMMAQQLRQLIQLNLLPELE
                     QRRAQQILREINQHHRHKFAHFDEGFVNKLLTHPQVPELIRTSPLTQREWQVLGLIYS
                     GYSNDQIAGELDVASTTIKTHIRNLYQKLGVAHRQEAVQQAQHLLQVMGYGA"
     gene            617145..619547
                     /locus_tag="RAHAQ2_RS02815"
                     /old_locus_tag="Rahaq2_0587"
     CDS             617145..619547
                     /locus_tag="RAHAQ2_RS02815"
                     /old_locus_tag="Rahaq2_0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen phosphorylase"
                     /protein_id="WP_014333770.1"
                     /db_xref="GI:504099776"
                     /translation="MQVTLDKTQFSAALKRQWQGFGLQQAQDMTPHQWWQATSAALSE
                     QLSAQPAPKATKQPQRHVNYISMEFLIGRLTANNLINLGWYDTVSQVLKEQGVGLADV
                     LEQETDPALGNGGLGRLAACFLDSMATVGQPATGYGLNYQYGLFRQSFSEGKQQEAPD
                     NWHRECYPWFSHNSSLSVDVAFGGKLTKNEKGAEQWHPAFTLRGEAWDLPVVGYKNGV
                     TQPLRLWQATDVHPFDLTLFNDGEFLQAEQKGIDAAKLTKVLYPNDNHQAGKRLRLMQ
                     QYFQCACSVADILRRHHFLGRKIEDLPKFEVIQLNDTHPTIAIPELLRILLDEHQLEW
                     DAAWAITRQTFAYTNHTLMPEALECWDEKLVRSLLPRHFSLIKAINARFKKVVEKQWP
                     GDKAVWEKLSVHQNKQVRMANLCVVSGFAVNGVAALHSELVVKDLFPEYHLLWPNKFH
                     NVTNGITPRRWLKQCNPALSSLIDDTLKTEWVNDLDALKGLESSADDKQFRQRYQAIK
                     RENKIKLAHYVKQVMGLTLNPDAIFDVQIKRLHEYKRQHLNLLHILSLYRQLRDNPEM
                     DLVPRVFLFGAKAAPGYYLAKNIIYAINKVAEKVNNDPLVRDRIKVVFIPDYRVSVAE
                     LMIPAADVSEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAGEVGEDNIFIFG
                     HTVDQVKALQAKGYDPLKIRKKDKHLDKILKELENGFFSHGDKQAFSLMLDSLLGGGD
                     PYLVLADFADYCAAQQKVDALYRDQDEWTRKTILNTARVGMFSSDRSIRDYQQRIWQA
                     KR"
     gene            619557..621647
                     /gene="malQ"
                     /locus_tag="RAHAQ2_RS02820"
                     /old_locus_tag="Rahaq2_0588"
     CDS             619557..621647
                     /gene="malQ"
                     /locus_tag="RAHAQ2_RS02820"
                     /old_locus_tag="Rahaq2_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573869.1"
                     /note="amylomaltase; acts to release glucose from
                     maltodextrins; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-glucanotransferase"
                     /protein_id="WP_014333771.1"
                     /db_xref="GI:504099777"
                     /translation="MENKALEQAAREAGISSGFINAHGKQQAIAPETKRELLSAMGWV
                     AANRRPVATPVPPVKVFVTGSRLALPVGGEGEYAWTLKQESGATQKGRISGKMTLALP
                     GKIPAGYHQLTLTQDEQQWDCRIIVAPKRCYEPDALLAGKKLWGACVQLYTLRSENNW
                     GIGDFGDLNLMLKNVAERGGAFVGLNPIHALYPANPVAASPYSPSSRRWLNVIYIDVS
                     AVEDFRLSDAAQQWWHQPLTQQRLQAVRANDWVDYANVMPLKLEGLRLAYAHFLERKA
                     QDPQVKSLRNFVKQGGESLYLQAAFDALYEYLAKESDVALGWNRWPEKYHDARGPAVR
                     AFCEQHAQDVEFYLWLQWLAETQFTQCYHTSQQHEMPMGLYRDLAVGVVAGGSETWGD
                     GELYCLKASVGAPPDILGPLGQNWDLRPMDPHVMVRRGYQPFIDLLRSNMTSCGALRI
                     DHVMTLLRLWWIPAGETADKGAYVQYPVDDLLAILALESQRHRCMVIGEDLGTVPVEI
                     VSKLRESGVYSYKVLYFERDEENNFRAPQSYPVQAMATITTHDLPTLRGYWQSDDLAL
                     GKSLGLYRDEAVLEALYADRARARQGLLDGLHHYGCIPQKTGHKAALMEMTPVLNRGL
                     QRYVADSACALLGLQPEDWLDMSAPVNVPGTSDEYPNWRRKLSHTLEEMFADEQVNKL
                     IKDLDKRRRKVSVS"
     gene            621848..622189
                     /locus_tag="RAHAQ2_RS02825"
                     /old_locus_tag="Rahaq2_0589"
     CDS             621848..622189
                     /locus_tag="RAHAQ2_RS02825"
                     /old_locus_tag="Rahaq2_0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Helix-turn-helix protein"
                     /protein_id="WP_014333772.1"
                     /db_xref="GI:504099778"
                     /translation="MKRSQSLLVSENLLQQLREMGRLLAESRIARKMTQSEAAVRANL
                     GRNTVSRIENGDTSVAIGQILRYLDAIRPGVTLADLLSGEDNVVHSMNEKIRPQRARA
                     LSERELKDYDF"
     gene            622179..623522
                     /locus_tag="RAHAQ2_RS02830"
                     /old_locus_tag="Rahaq2_0590"
     CDS             622179..623522
                     /locus_tag="RAHAQ2_RS02830"
                     /old_locus_tag="Rahaq2_0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011797993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HipA-like protein"
                     /protein_id="WP_014333773.1"
                     /db_xref="GI:504099779"
                     /translation="MTSESTLLVHAFLPGASQAVPAGKLKMTEAGAEVLSCSFIYGLK
                     YLKRNGAIEIDPISLNFLNGRDVSRMELFPANISLFGGIRDAAPDSWGRRVIEAKNRM
                     PANSLPESVYLLEAGANRVGALNITADGEATRALTQSSDIRSLGYIQDAFDRVEQGLP
                     VPANLHNLLDAGSSMGGMRPKATLLDDDDTHWLAKFSSPNDRGLNIPTVERATLELAR
                     AAGLHVPPTQLKEVGDNHFAMLIKRFDRVGSGEFVGRRHFNSALTFMDLHEMDSPKSS
                     YADMADAMRMHLNAKFLQQDLTELFKRMIFNILINNDDDHLRNHGFILMDEPAQFAVS
                     ACQEPPQSVSLAWRLSPLYDVVPRPSGTYSRLLHLGVGQFGREATLINAVSWSERFGL
                     SRQLAINEIDSVWQAVREWRNCFEEFAVGGQDIDSVKSAFRHIREIGGKELGLCD"
     gene            complement(623644..624534)
                     /gene="malG"
                     /locus_tag="RAHAQ2_RS02835"
                     /old_locus_tag="Rahaq2_0591"
     CDS             complement(623644..624534)
                     /gene="malG"
                     /locus_tag="RAHAQ2_RS02835"
                     /old_locus_tag="Rahaq2_0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333774.1"
                     /note="with MalKFE is involved in the transport of maltose
                     into the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose transporter permease"
                     /protein_id="WP_014333774.1"
                     /db_xref="GI:504099780"
                     /translation="MPMVKPKSQKVRLLITHLLLLCFLALILFPLLMVFAISLRPGNF
                     ATGSLIPDQVSWDHWKLALGIAVTNSDGSITPPPFPVMLWLWNSVKIAGITAVGIVAL
                     STTCAYAFARMKFRGKSSLLKGMLIFQMFPAVLSLVALYALFDRLGMYVPFLGLNTHG
                     GVIFAYMGGIALHVWTIKGYFETIDGSLEEAAALDGASPWQAFRLVLLPLSVPILAVV
                     FILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAILSAIPITA
                     VFLIAQRWLVGGLTAGGVKG"
     gene            complement(624548..626092)
                     /gene="malF"
                     /locus_tag="RAHAQ2_RS02840"
                     /old_locus_tag="Rahaq2_0592"
     CDS             complement(624548..626092)
                     /gene="malF"
                     /locus_tag="RAHAQ2_RS02840"
                     /old_locus_tag="Rahaq2_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333775.1"
                     /note="with MalKGE is involved in maltose transport into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose transporter membrane protein"
                     /protein_id="WP_014333775.1"
                     /db_xref="GI:504099781"
                     /translation="MPRAKKRPFSNAFKWLIIALLACLTGYLIVLMYAQGETLFAILT
                     LILSGVGLYIYGNRRAYSWRYVYPGLAGMLLFVLFPLVCTIAIAFTNYSSTNQLTFER
                     AQSVLMGREFQGGKALNFALYPAGDKWQLALTSPDNSETLVSPPFAFDAQAPQTLDML
                     PQTAPSAEKAGLRVVTQNRLALGLISAKLPDGETLRMSSLRQFSGTQPLYKLGEDKKQ
                     LTNAQTGTIYRPNMDSGFYQAVNAQGEWQAEKLSPGFTVGIGWGNFLRVLHDEGIQKP
                     FLSIFVWTVVFALLTVVLTVAVGMVLACVVQWEELKGKAAYRILLILPYAVPAFISIL
                     IFKGLFNQSFGEINLMLSALFGIKPAWFSDPWTAKSMIIIVNTWLGYPYMMILCMGLL
                     KAIPDDLYEASAMDGATPMQNFFRITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNG
                     GPDMLGTTTPAGHTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAVVNLKA
                     SRMKFD"
     gene            complement(626164..627363)
                     /gene="malE"
                     /locus_tag="RAHAQ2_RS02845"
                     /old_locus_tag="Rahaq2_0593"
     CDS             complement(626164..627363)
                     /gene="malE"
                     /locus_tag="RAHAQ2_RS02845"
                     /old_locus_tag="Rahaq2_0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333776.1"
                     /note="functions in the MalKFGE ABC transporter complex to
                     transport maltose into the cell by using ATP hydrolysis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_014333776.1"
                     /db_xref="GI:504099782"
                     /translation="MTLSIKKIVKHTLALSALATLVLSSSAFAKIEEGKLVIWINGDK
                     GYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKYPQVAATGGGPDIIFWAHDRFGGYAQS
                     GLLAEISPDQAFKDKLFPFTWDAVTFNGKLIGYPVAVEALSLIYNKDIIKEAPKTWEE
                     IPALDKELRATGKSAIMWNLQEPYFTWPIIAADGGYAFKYENGKYNIKDTGVNNAGSQ
                     AGLQFIIDLVKNKHINADTDYSIAEAAFNKGQTAMTIDGPWAWSNLDKSKINYGVTLL
                     PSFHGKPSKPFVGVLTAGINAASPNKELAKEFLENYLITDDGLAVVNKDKPLGAVALK
                     SYQEKLEKDPRIAATMANSKNGEIMPNIPQMSAFWYAERSAIINAVNGRQTVPQALKD
                     VETRITK"
     gene            627730..628839
                     /locus_tag="RAHAQ2_RS02850"
                     /old_locus_tag="Rahaq2_0594"
     CDS             627730..628839
                     /locus_tag="RAHAQ2_RS02850"
                     /old_locus_tag="Rahaq2_0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012147164.1"
                     /note="with malEFG is involved in import of
                     maltose/maltodextrin; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_014333777.1"
                     /db_xref="GI:504099783"
                     /translation="MASVSLNSVYKAFGDTVISSDINLEIEEGEFVVFVGPSGCGKST
                     LLRMIAGLEDITSGELKIGDKRMNEVPPADRGIGMVFQSYALYPHLSVAENMSFGLKL
                     AGAKKAEINQRVNQVSEVLQLAHLLDRRPKALSGGQRQRVAIGRTLVAEPTVFLLDEP
                     LSNLDAALRVQMRIEISRLHKRLKRTMIYVTHDQVEAMTLADKIVVLDAGHIAQVGKP
                     LELYHYPANRFVAGFIGSPKMNFLPVKVTGAEPARVQVELPNRQQVWLPVEGSDVKVG
                     SNLSLGIRPEHLLPSDVAEVTLSGEVQVVEQLGNETQIHIQIPAIRQNLVYRQNDVVL
                     VEEGATFAIGLPPHRCHLFREDGTACRRLHPEPGV"
     gene            628869..630164
                     /gene="lamB"
                     /locus_tag="RAHAQ2_RS02855"
                     /old_locus_tag="Rahaq2_0595"
     CDS             628869..630164
                     /gene="lamB"
                     /locus_tag="RAHAQ2_RS02855"
                     /old_locus_tag="Rahaq2_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333778.1"
                     /note="porin involved in the transport of maltose and
                     maltodextrins; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltoporin"
                     /protein_id="WP_014333778.1"
                     /db_xref="GI:504099784"
                     /translation="MITMRSSSLALAVAAGILSTQAMAVDFTGYARSGIGWTGSGGEQ
                     QCFKATGADSKYRLGNECETYAELKLGQEVWKEGDKSFYFDTNVAYSVSQQNDWESTD
                     PAFREANVKGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGLEDIDLGF
                     GKLSLAATRNTESGGSYGYIADQRDEVPTSNDVFDVRLAGLQTNPGGVLELGVDYGRA
                     NARDGYTLADDATKDGFLVTAEHTQSIYNGYNKFVLQYASDSMTDPGQGAANGHSNGA
                     AINNNGSMVRVLDHGAIDFNDTWSLMYVAMYQDVDRDNNNGTTWYTVGVRPMYKWTPI
                     MSTLLEVGYDNVKSQRTGDKNGQYKVTLAQQWQAGDSIWSRPAIRVFATYANWDEKWG
                     YDTDSGTSNGLAMNDTSTRTFSRGNDDEVTFGAQMEIWW"
     gene            630395..631291
                     /locus_tag="RAHAQ2_RS02860"
                     /old_locus_tag="Rahaq2_0596"
     CDS             630395..631291
                     /locus_tag="RAHAQ2_RS02860"
                     /old_locus_tag="Rahaq2_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose operon protein"
                     /protein_id="WP_014333779.1"
                     /db_xref="GI:504099785"
                     /translation="MKKNLLSLCLSLSLLAAVPAGVNAAQNDANTAPAISSQTLRNLS
                     WTPLVPPVTQDVTLGTSGSQINQGEIQGAVGAFALPADRGSLEITLTSIATGKTVYAP
                     NVLVLDEQMRPAAFYPSSYFPYQKPGIVSSDRLEGTLKLTPALGQKQIYLLVYTTRQD
                     LAATTQMVNPAKAFAAGVGNAVPDIPDPIARHTPTGTLSLKVTAEQKTGNVMIGQIFP
                     SSAPAAATPVVVGSTQAPAPAAAPAKPSEPMLSDSETYFNDAIKKAVKAGDVDKALKL
                     LDEAERLGSKTARKTFIESVKH"
     gene            complement(631529..631789)
                     /locus_tag="RAHAQ2_RS02865"
                     /old_locus_tag="Rahaq2_0597"
     CDS             complement(631529..631789)
                     /locus_tag="RAHAQ2_RS02865"
                     /old_locus_tag="Rahaq2_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_037040591.1"
                     /db_xref="GI:739176613"
                     /translation="MMTSHDWHPADIIAALRKKGTTLAAVSRAAGLSSSTLSNALSRP
                     WPKGEMLIAQAIGVQPSLIWPSRYFDQETMTFIERKIRIRGK"
     gene            632351..633190
                     /locus_tag="RAHAQ2_RS02870"
                     /old_locus_tag="Rahaq2_0599"
     CDS             632351..633190
                     /locus_tag="RAHAQ2_RS02870"
                     /old_locus_tag="Rahaq2_0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014333782.1"
                     /db_xref="GI:504099788"
                     /translation="MASANWVDLSKDKDSGIETIHAHFEGHAYDPHWHDSYLVGVTQY
                     GLQQFSCRRQKHQSLPGKVFMLEPGEIHDGDAVQPGGFTYHMLYLDPQWLSRELAARR
                     DSLSSAGDPSFENTLAQDPQLAQATSRAFQALHGRDLRIVRQTALDSLLGALGGHLTW
                     QPPRIQGEAPWSRLAHQAREYLHAHLHEDVGLEQLAAATGESRFVVSRAFKAEFGLPP
                     HAYLIQLKLTRAREGLALGRTPAAVAADLGFADQSHLGRWFRRAYQLTPAHYRRLCTN
                     LPD"
     gene            633242..633679
                     /locus_tag="RAHAQ2_RS02875"
                     /old_locus_tag="Rahaq2_0600"
     CDS             633242..633679
                     /locus_tag="RAHAQ2_RS02875"
                     /old_locus_tag="Rahaq2_0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333783.1"
                     /db_xref="GI:504099789"
                     /translation="MNTTATTLPSSPERCVIVINQQLAAGHAANAAAVLALTLGQRHP
                     ALVGAPLIDADNREHPGLIPIGISVLVADAQQLTQLHQHLLNDDEMDGIIFPVEGQQT
                     TDYAAFREAVSVVPTNNLQLLGIALAGNKKVVRKLTGKLGLLG"
     gene            633750..634448
                     /locus_tag="RAHAQ2_RS02880"
                     /old_locus_tag="Rahaq2_0601"
     CDS             633750..634448
                     /locus_tag="RAHAQ2_RS02880"
                     /old_locus_tag="Rahaq2_0601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="WP_014333784.1"
                     /db_xref="GI:504099790"
                     /translation="MRKSLVALLLFTLGSTFAVQATEEAKPFITSQELDLTQYLPAPP
                     ADDSAQTQAELKELLQIQATRTPEQEKAAIADAQENVWRFADVMGPGFDAEKLPKTAA
                     LFERIVATEDVVDDHAKKAFNRPRPYMLDEQIHPLLKKSKSGSWPSGHSTIGYLMATV
                     LGEMVPEKRNALFARASGYAENRLVAGFHYRSDTVMSRTGAALIAQKMEEQPDFKTEF
                     DAAKAELRAQSGLK"
     gene            634512..634997
                     /locus_tag="RAHAQ2_RS02885"
                     /old_locus_tag="Rahaq2_0602"
     CDS             634512..634997
                     /locus_tag="RAHAQ2_RS02885"
                     /old_locus_tag="Rahaq2_0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="WP_014333785.1"
                     /db_xref="GI:504099791"
                     /translation="MEYRFKRMASPVGLLTLAAKGDKLTAILWECEIDGRVPLGEMLE
                     DPAFPILLKTEQQLNEYFAGKRTCFELDLDFTGTAFQKEVWAALLEIPFGETRSYGDI
                     ARRIGRPKAVRAVGAANGRNPISIVAPCHRVIGSSGKLTGFAGGLENKLLLLRLEGRK
                     S"
     gene            635111..636454
                     /locus_tag="RAHAQ2_RS02890"
                     /old_locus_tag="Rahaq2_0603"
     CDS             635111..636454
                     /locus_tag="RAHAQ2_RS02890"
                     /old_locus_tag="Rahaq2_0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573881.1"
                     /note="converts 2-oxoglutarate to glutamate; in
                     Escherichia coli this enzyme plays a role in glutamate
                     synthesis when the cell is under energy restriction; uses
                     NADPH; forms a homohexamer; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="WP_014333786.1"
                     /db_xref="GI:504099792"
                     /translation="MDQIQSLEQFLSSVQQRDPHQVEFSQAVREVMTTLWPFLEQHPQ
                     YRRSALLERLVEPERVIQFRIAWVDDTNQVQVNRGWRVQFSSAIGPYKGGMRFHPSVN
                     LSILKFLGFEQTFKNALTTLPMGGGKGGSDFNPKGKSEGEIMRFCQALMLELYRHLGP
                     DTDVPAGDIGVGGREVGYMAGMMKKLSNNTASVFTGKGLSFGGSLIRPEATGYGLIYF
                     TESMLKRHGLDFEGMRVAVSGSGNVAQYAIEKAMSLGARVITASDSSGTVVDEAGFTT
                     EKLALLTEIKASRDGRVADYAQKLGLTYLEGQQPWNVPVDIALPCATQNELDASAARV
                     LIANGVKAVAEGANMPTTIEATDLFTDAGVLFAPGKAANAGGVATSGLEMAQNAARLS
                     WKADEVDARLRHIMLDIHQSCVEYGGESQQTQYVRGANIAGFVKVADAMLAQGVL"
     gene            complement(<636599..638500)
                     /locus_tag="RAHAQ2_RS02895"
                     /old_locus_tag="Rahaq2_0604"
     CDS             complement(<636599..638500)
                     /locus_tag="RAHAQ2_RS02895"
                     /old_locus_tag="Rahaq2_0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333787.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate sugar epimerase"
                     /protein_id="WP_037040609.1"
                     /db_xref="GI:739176631"
                     /translation="MNKKSVPALMCFHLLELLGSMSRFGKRFISVIADILMISLAFWG
                     GYWVRLDDAFPITSIKHWVLLLALSVFSVFVFARLGLYRAVLRFVSFRVLWTIALGTG
                     ASTLFLVMSSFYFSVFLPRTVTIIYFAFMVLFVGGVRLFFRALLNITRVVRTPVIIYG
                     AGAAGRQLQMALLQGNEFYPVAFVDDDTATHGYQLQGASVHPPSQIPALLTRHHAEKI
                     LLAMPSISRSRRQNVLQSLETYPCEILSIPGMSDLVNGVATISELRYVSIEDLLGRVP
                     VEPFDELMNANIHGKCVMVTGAGGSIGSELCRQIIACRPSRLVLFELSEYGLYTIHAA
                     LTELDSEVEVIPLLGSVQRKRRLVTVMKRFAVDTVYHAAAYKHVPLVEYNVVEGIRNN
                     VFGTWYCAQAALEAGVNNFVLISTDKSVRPTNTMGASKRLAELVLQALAKENHHTKFC
                     MVRFGNVLGSSGSVVPLFREQISRGGPVTVTHEDIIRYFMTIPEAAQLVIQAGAMGEG
                     GDVFVLDMGNPVKIMDLAKRMIRLSGLTVKDSEHPDGDIEIKVTGLRPGEKLYEELLI
                     GGNVSDTPHPRILKAMELDMPWPLLEGKLRELDEACHLFQHEKIRELLMELPLLFIPK
                     DEICDLVWAA"
     gene            complement(638500..639504)
                     /locus_tag="RAHAQ2_RS02900"
                     /old_locus_tag="Rahaq2_0605"
     CDS             complement(638500..639504)
                     /locus_tag="RAHAQ2_RS02900"
                     /old_locus_tag="Rahaq2_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005302829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramyl pentapeptide
                     phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
                     transferase"
                     /protein_id="WP_014333788.1"
                     /db_xref="GI:504099794"
                     /translation="MFLSILLMSVLISWLLTAVFRRYAIRHQVMDIPNARSSHNVPTP
                     RGGGMAIVISFSLVLLLFVGTNPIFSSLWLWIMLPLLLIAAIGFIDDHHSLSPKFRLI
                     VQFFAAALILFGIGHIPALSLAKWIITPDWWLWGIFAFGLVWLINLYNFMDGIDGLAS
                     GEAITVCLGIAALHWTEGDTDAVTYIALLLAATCSGFFYWNRPPAKIFMGDGCSGFLG
                     LALGALMLIDALKDPERLWAWLILLGIFVVDASWTLLTRWRQGDRLSEAHRSHAFQHA
                     AQRWGHSAVTASSACITIVWLMPIAWLVFSGRCYGLVAVVIAYAPLCVLAKRLNAGRK
                     "
     gene            complement(639514..640464)
                     /locus_tag="RAHAQ2_RS02905"
                     /old_locus_tag="Rahaq2_0606"
     CDS             complement(639514..640464)
                     /locus_tag="RAHAQ2_RS02905"
                     /old_locus_tag="Rahaq2_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate-sugar epimerase"
                     /protein_id="WP_014333789.1"
                     /db_xref="GI:504099795"
                     /translation="MSKNLETKSVLVTGANGFIGRAIAKSIETAGMTVRRAVRRNYHE
                     PTAWHSPDLDEFADWSEGLSGIDCVIHCSARVHQMQEQTSDALAEFRKVNTSGTLTLA
                     KQAAAASVSRFIFLSSCKVNGEETVKGSPFREAVPRPPQDPYGLSKYEAETGLLDISA
                     STGMEVVIIRLPLVYGPDVKANFALLIKIISLGIPLPFASIDNRRSLLALDNLCHFIL
                     HVINHPAAAGEVFLIADEPAVSTSTLIKMIARAKGKPALLFPFPITLLKVLATITGKR
                     KAVARLVGSLELDTGKTQVLLGWHPPFKTDEALKKIFNNG"
     gene            complement(640461..641585)
                     /locus_tag="RAHAQ2_RS02910"
                     /old_locus_tag="Rahaq2_0607"
     CDS             complement(640461..641585)
                     /locus_tag="RAHAQ2_RS02910"
                     /old_locus_tag="Rahaq2_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_014333790.1"
                     /db_xref="GI:504099796"
                     /translation="MRILHFFKTYYPVAFGGVQQVIYQLAEGACRNGAEVDVLSLTEE
                     KTAHVGKIGYHNVHTSKQDLYIASTGFSLSAFKDFRRLAEQADVIHYHFPWPYMDLVH
                     FMVRPDKPTVVTYHSDIVKQKNLLRLYQPLMRRFLNDVDAVVASSPNYVQTSPVLQSL
                     KRPVDVIPFGLDDSSYPKAPVSVTEKWQALLRGRFFLFIGFLRYYKGLSYLLDAIAGL
                     DYPLVIIGEGPCEQELKEQAERLKLKNIHFVGAVSDEDKCALLELCYSVVFPSHLRSE
                     AFGMTLLEAAMYGKPMISCEIGTGTTFINLHKETGLVVKPTDPVSLRAALVELWENPC
                     ATSQMGQNAKARFDHMFTAERMVESYMSLYKKVIAEHPQK"
     gene            complement(641761..642645)
                     /locus_tag="RAHAQ2_RS02915"
                     /old_locus_tag="Rahaq2_0608"
     CDS             complement(641761..642645)
                     /locus_tag="RAHAQ2_RS02915"
                     /old_locus_tag="Rahaq2_0608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-6-deoxy-D-lyxo-4-hexulose reductase"
                     /protein_id="WP_014333791.1"
                     /db_xref="GI:504099797"
                     /translation="MTQRALITGLNGFTGQYMARELADAGYEVHGLENLAATAAGNRQ
                     VDLCDPEAVRQAIRAIKPNIVVHLAAIAFVAHGNADDFYRVNLMGTRNLLAALSEVAE
                     GIDCVLLASSANVYGNRTGGILTEESLPDPANDYAVSKLAMEYMAKLWMDKLPIVIAR
                     PFNYTGVGQSENFLIPKIVSHFRRKEQRIELGNLDVWRDFSNVRSVCNAYANLIKMRP
                     VGQTFNVCSGVGTSLREVVSALETLAGYQIELNVNPAFVRANEVKVLTGSAERLNSVI
                     PDWKPITLEETLRWMYSI"
     gene            complement(642647..643684)
                     /locus_tag="RAHAQ2_RS02920"
                     /old_locus_tag="Rahaq2_0609"
     CDS             complement(642647..643684)
                     /locus_tag="RAHAQ2_RS02920"
                     /old_locus_tag="Rahaq2_0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-D-mannose dehydratase"
                     /protein_id="WP_014333792.1"
                     /db_xref="GI:504099798"
                     /translation="MNNIAVITGITGQDGAYLAELLLSKGYTVYGTYRRTSSVNFWRI
                     EELGIQNHSNLHLVEYDLTDLSSSIRLLQNSGAMEVYNLAAQSFVGVSFEQPVTTAEI
                     TGIGALNLLEAIRIVNPKIRFYQASTSEMFGKVQAIPQSESTPFYPRSPYGVAKLYAH
                     WMTINYRESYDIFACSGILFNHESPLRGREFVTRKITDSVAKIKLGKLDVLELGNLDA
                     KRDWGFAKEYVEGMWRMLQADEPDSYVLATNRTETVRDFVLMSFKAAGINVQFSGHAE
                     KEIAVDVATGKTVVSISPKFYRPAEVELLIGDPAKAKEKLGWEPKTTLEQLCQMMVEE
                     DMRRNEAGFSF"
     gene            complement(643681..644802)
                     /locus_tag="RAHAQ2_RS02925"
                     /old_locus_tag="Rahaq2_0610"
     CDS             complement(643681..644802)
                     /locus_tag="RAHAQ2_RS02925"
                     /old_locus_tag="Rahaq2_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013501176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_014333793.1"
                     /db_xref="GI:504099799"
                     /translation="MSFYFDYSTMVGWQGTPTGIPRTVYYLAQELSSQISDFKLVAID
                     DDLKSFHTVDVNGQVATVSKKVDFCEGDIFFSAGANWAFACYNEEIRRMKELGVKYIQ
                     LFYDIIPDLFPYFYKDGIGFGDYIGRWVDETVALCDQSFSISECTKKDIVLRSNKLGI
                     DMSDMKVIRLGDDFVASPSDDTQYSSRYTDGEKFILCVGTLEIRKNQVALLHAYRILD
                     KRYPGLLPKLVLVGRKGWIDSEIDFQVENDRALNGLVDVITDASDNELSWLYSNCLFT
                     LFPALYEGWGLPVSESLWHGKPCISSNTSSMVEIAPELTIFASPYSVESWVDQIECLL
                     FKPGMLDKQTEKVLREYVPTEWCNTAATIKDVIFEEYTK"
     gene            complement(644799..645920)
                     /locus_tag="RAHAQ2_RS02930"
                     /old_locus_tag="Rahaq2_0611"
     CDS             complement(644799..645920)
                     /locus_tag="RAHAQ2_RS02930"
                     /old_locus_tag="Rahaq2_0611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018308085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_014333794.1"
                     /db_xref="GI:504099800"
                     /translation="MKVIFDCTSLTNWIGHPTGIQRVVSEIGNELLGCLPNIRLGLFQ
                     ADSTCLEYDIQLRKTTENIELNAGDIIITAGSNWDYIEHHKVLMKLRQQGIKLGILFY
                     DAIPCILPFTYGPGFPEIYKEWLIETINACDLAFAISENTKRDLKHFSTEHGLELPPV
                     TVVRLGDEVPTTEGDPSADIVQKISEPYLLTVGSIEYRKNHIMLLNAWRYMIEEQNYI
                     PPKLYIVGKQGWLDNDIEYQIANDLRLKGRIEVLKGLQDIDLRVLYENSMFTLYPSFY
                     EGWGLPIAESLCFGKPCIASRSSSMVEIAPGLVRHAHPLLLNEWVEQIRLLVDNPEEL
                     QNECERVRTGYKLSSWKDTALQMCEGLFANYPEIMEIAE"
     gene            complement(645917..647119)
                     /locus_tag="RAHAQ2_RS02935"
                     /old_locus_tag="Rahaq2_0612"
     CDS             complement(645917..647119)
                     /locus_tag="RAHAQ2_RS02935"
                     /old_locus_tag="Rahaq2_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006025388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333795.1"
                     /db_xref="GI:504099801"
                     /translation="MKILQMATYDVERPDHGGKLRSHHIRRSLRTQFNVETLSFEWDE
                     KVDASSLSVRLDQNRWTEFGISGMLSDWGICNFLEKDEKCYEQVCRNVHNFDPDIILL
                     EQPFLWPLVERFFDDGTLARNVRVIYSSHNIEVIMKRQIYQDLFSPEIAKKYTDYVDN
                     IEKGVIKACSGAIAVSEIDAAYITRLNPDAPVKIYFNGHSKPKNGPEDKKWQSRFENR
                     DANWVFVGSWHPPNINGLRDLVMALAQKKGEKNFALWALGSVGNGLVATTPGFDAKDY
                     PWLHITGLVSAEDIDSAILCSSGIVLPIWEGGGSNLKTAQALLSTKCILGAEFSFRAF
                     EHVTSEPGVFLVKDADSLANLVTETRPERHYARSEEVYALEWERVLQSLPDFVLKIID
                     SGKEEHLS"
     gene            complement(647166..648896)
                     /locus_tag="RAHAQ2_RS02940"
                     /old_locus_tag="Rahaq2_0613"
     CDS             complement(647166..648896)
                     /locus_tag="RAHAQ2_RS02940"
                     /old_locus_tag="Rahaq2_0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018405810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_014333796.1"
                     /db_xref="GI:504099802"
                     /translation="MKERDPKLYIDCTSTFRSGLNTGVQRVVRALIGEAKTFSEITQL
                     DCIPICYQFNGFYTLEDAQKITLDTVSDFVALEFNFRDIYLCPDAFWSYGMTSWYDYF
                     RDHGVSIATVVYDLIPIVNPEFSDPTARHEFESALVDVVRKSDLLFTISQSTRKDLIE
                     YCSSKGEIFDSERCQVIPLAPALQAARSDIDSERLPDGLFFLMVGTVEPRRGYIEAIS
                     EYQTYLASGGNSSLLIIGKEGGASEEVTEFISHAGNKVIWLTDASDAELMAAYQHAVA
                     VICPSKSEGYGMSVSEGLAYNGLVLANRLPVFGEFAGSSPYYFEIERSGDLARLLTDT
                     PHLKRQDKLSDMGTWKNTATVLASELVSISKSHGRHKAIELRKNSEEAIRWAYWLLFD
                     RKCSPEETSNWLKFENIQDMFEALRFESRNLTSPVSKEAIRWIQLIINGRDSVDNQEM
                     EYWLEFGKIQDMIEAVKYENMNLTSTLSKDAIRWIQLIINERDSVDDEEISYWRSQSK
                     SISGLRHKILEEHFRPEAPLSKLFVRWAFVAYLGELDPKPDELNAWFESAGTNGEFLT
                     KLKLTKSNIQ"
     gene            complement(648910..649908)
                     /locus_tag="RAHAQ2_RS02945"
                     /old_locus_tag="Rahaq2_0614"
     CDS             complement(648910..649908)
                     /locus_tag="RAHAQ2_RS02945"
                     /old_locus_tag="Rahaq2_0614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_014333797.1"
                     /db_xref="GI:504099803"
                     /translation="MKNSETKKVNVVFGVYPWAFDCPGGGERQLMAWKYHLELRGHNV
                     TLYDPWKPVPEEFKIFHFFSVMPGSFQLCEYIKKKGYALVITPNLWVTPETKWDYPHD
                     DIQRLISIADRIVVNSSLEAKALSEVYDIEIERFRVVYNGVEKSFFNIATPDLFHSYS
                     KLMDKRYLLNVANVEPRKNQLRFLQALKDHPELTLVVVGHARDSAYLEECKQVGKEQF
                     VYLGPLEYGSELLRSSMAGAEAFVMPSTLETPSIAALEAAASGCRILVTEVGSTKEYF
                     GDNAIYIDPNSNASMSHGIGQVLTMPKQCLRQRTHDNFTWENVILDLEKIYRELLS"
     gene            complement(649935..651047)
                     /locus_tag="RAHAQ2_RS02950"
                     /old_locus_tag="Rahaq2_0615"
     CDS             complement(649935..651047)
                     /locus_tag="RAHAQ2_RS02950"
                     /old_locus_tag="Rahaq2_0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018437957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_014333798.1"
                     /db_xref="GI:504099804"
                     /translation="MKVIFDCTALTKWIGKPTGIQRVISELGISLARAMPETFTVIFD
                     SDGKCYSYSPESKEIGNEIKIDKGDMIFASGHDWDYPEHFKHLCHYAENDVKLAVLFY
                     DIIPLKFPFTYSSEFVARFEFWLNRALSLASLCFTISASTRSDLLEYAKKSNLRIPNI
                     DILRIGDNLPVVKNQVSEQISENIKGSYILSVGTIEYRKNHIILLNAYRYMIDVLGMD
                     VPKLYIAGRQGLYDANVHIQVEGDPLLKGKVEILSGLDDSDLGALYGSAMFTVYPSIY
                     EGWGLPVAESLCYGVPCITSKSSSMLEIAPELTPFANPLMTNEWVDIMRLWIEKPDEL
                     AKVRKQVNAQYHKTSWDDTASLLRDSLMKFSHILIN"
     gene            complement(651065..652021)
                     /locus_tag="RAHAQ2_RS02955"
                     /old_locus_tag="Rahaq2_0616"
     CDS             complement(651065..652021)
                     /locus_tag="RAHAQ2_RS02955"
                     /old_locus_tag="Rahaq2_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333799.1"
                     /db_xref="GI:504099805"
                     /translation="MKRVLLTTYPEAFLYQGGGEREILLLNEALNSSGIISEIYGPTS
                     RPLSNYDAVIHLSMNGGSEHIIGAISNVDIPVILWPNLWFVEPPSEDNSVHLAAFLKS
                     FDAVVFRSQAEERHFSHYLNIENKDVIHISPLISPKFLRKNITDVFRESYGLKSYAIW
                     TGIIEPQKNQLAAVRAFNDLDLDLVISGGIRDKKYADECKRLAGPNIKFISTIPFGSE
                     QHLSALSHSQMVVELPFDFPGTSAIEAAAMGSRLLLSRSEWTEEMLGPYCTQVDPRNE
                     NEIRQAVLQLLKEPHNPLSSSANIFPDMVDAIAPLVNYLQSI"
     gene            complement(652021..652620)
                     /locus_tag="RAHAQ2_RS02960"
                     /old_locus_tag="Rahaq2_0617"
     CDS             complement(652021..652620)
                     /locus_tag="RAHAQ2_RS02960"
                     /old_locus_tag="Rahaq2_0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018591908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040588.1"
                     /db_xref="GI:739176610"
                     /translation="MEIYLLRHGASTSNEKRIVCGAADYPLSEKGKAQAYQVCQTLNN
                     IPFTHVYTSPLSRARETIANLTCSSNAIIEEELVELNTGLVSHITVDELWETEPRYRY
                     QGLDPDFKYPEGECLNDMLLRVGNWFEKRFIEWNSSDTILIAGHEGTVCGILHRLLKL
                     QIDHYPTFTIGNCEYIRITINEDRQIRYQFFPLHPVEIF"
     gene            complement(<652850..>653530)
                     /locus_tag="RAHAQ2_RS02965"
     CDS             complement(<652850..>653530)
                     /locus_tag="RAHAQ2_RS02965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016860436.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040606.1"
                     /db_xref="GI:739176628"
                     /translation="YNIGYWFCEMQKIPDEWARQLEFFDEIWTASSFCQSTIARSADI
                     PVIKIPLMIDPQPKSLRIQSRQAGLCNDPFTFLTIFNTYSDAERKNALFTLRAFIEAH
                     GNNPAVRIIVKVSNLEHDKILSEKLASIRKSFSNIEVIEGYVEDSVVHELYGRADAYV
                     SLHRAEGFGLTISDAMARGIPVITTGYSGNMEFCDAYDTRLVGYQLRTVGHERLRYRS
                     TDVWAEPDM"
     gene            complement(653803..655011)
                     /locus_tag="RAHAQ2_RS02970"
                     /old_locus_tag="Rahaq2_0619"
     CDS             complement(653803..655011)
                     /locus_tag="RAHAQ2_RS02970"
                     /old_locus_tag="Rahaq2_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_014333802.1"
                     /db_xref="GI:504099808"
                     /translation="MAENVNHSSIPESCILFATADWDEPYWTNKQHSAKALADLGVNV
                     LYVESVGLRAPSASSSRDWQRLRERFTKGLRSLIFGAPKRASNIRVLSPLLIPAGYRN
                     PFTRWLNRWLLKVTIWRNMPHKVKSPPLVWTYHPFMLEIFAALKGSQLLYHCVDDLAA
                     VPGVDANAFREAEERLLKQADVVFATAPALAERCSQFNNNTHFLPNVVDAEHFGKALD
                     KKDLPDDLACIPEPRLGYHGVLSDFKIDFRLLLESARMRPDWQWVFIGAEREGQKSPL
                     ITELAELPNVHFLGYRAYQVLPDYLRGIQVGLLPSLINDYTRSMFPMKYYEYLAAGIP
                     VTSTRIAFTESQLEAIEIAEGTVEFINAISIQINRGKFSKEQAGALVNSNTWQGRTLK
                     MVSALHGIRL"
     STS             654211..655892
                     /standard_name="ha2182"
                     /db_xref="UniSTS:515503"
     gene            complement(655004..656131)
                     /locus_tag="RAHAQ2_RS02975"
                     /old_locus_tag="Rahaq2_0620"
     CDS             complement(655004..656131)
                     /locus_tag="RAHAQ2_RS02975"
                     /old_locus_tag="Rahaq2_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="WP_014333803.1"
                     /db_xref="GI:504099809"
                     /translation="MKILIALGTRPEVIKLAPIILALRGRAEVRICASGQHREMLAQA
                     LGAFSLVPDIQLDTMSPGRSLNILASRQLSAFDEVFEQEKPDWVVVQGDTTTAFCAGL
                     AAFHQGIRVAHVEAGLRTGDLASPFPEEANRSLLGRITTLHCAPTNAAQAALRIENVP
                     ADAIVVTGNTVVDAIYQASESWAEGKPETLSSELDDWTSAAPYVLLTCHRRENFGDIM
                     ENICHMIARLCQRHPDLHWIFPVHLNPAVSVPVRRILGQIPNLLLTDPVDYHTSLYLI
                     KNARLVISDSGGIQEEAPTFGTPVVVMREHTERMEGVKAGFATLAGQSPERIEEAVDY
                     WLTHPEAVDKLKQLPNPYGDGHAATRIADALLGLPVETFCG"
     gene            complement(656128..657690)
                     /locus_tag="RAHAQ2_RS02980"
                     /old_locus_tag="Rahaq2_0621"
     CDS             complement(656128..657690)
                     /locus_tag="RAHAQ2_RS02980"
                     /old_locus_tag="Rahaq2_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="WP_014333804.1"
                     /db_xref="GI:504099810"
                     /translation="MIGILYSWEDRKTGELVLTAMRRSVTTSGASRIASGDIAKNDFI
                     LAINPDEYLGEKLLVWLSEGARKLILFGRLPDNLLNHFKIVPAAWPEPTDDWARSPAA
                     LSGQFAESKASIHYSHSALALKTSDWDRALERFDFTDEWNNLGFGAVRAEGSIWSIAS
                     ACHAPESAELARIQTREHVITSYSALFEEPKTSVLWVNREVGLIDSYEWRLIEAFISN
                     WRHDVLPCLPVLSEIPFGYDAAITMRLDCDEDIASVQQLWEAYQQADVPLSLALHTNI
                     LPNEKHEKFLKTFIETGGAVLSHTATHAPNWGGSYEAAHWEGVESRAKIENATGINVK
                     YAVSPFHQSPEYALAALCDAGYLGCIGGIIRNDPEFLIARGGELAHLPAGFVGHSQQS
                     MLHGDCMLTDGDPLTIFKQAFDRAVETRTLFGYLDHPFSERYQYGWSDEKTRVTAHLN
                     FIKYMREQSAQPLFLDECQTLDFLRARAAIQFTFSSRHQIASVPVTCNGLRFAAEFRG
                     LLYEITDGAVLS"
     gene            complement(657687..659060)
                     /locus_tag="RAHAQ2_RS02985"
                     /old_locus_tag="Rahaq2_0622"
     CDS             complement(657687..659060)
                     /locus_tag="RAHAQ2_RS02985"
                     /old_locus_tag="Rahaq2_0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F390 synthetase-like protein"
                     /protein_id="WP_037040604.1"
                     /db_xref="GI:739176626"
                     /translation="MSSQHPLLLASERLFSVQPFSLIKGLVSAHIAYPLAERHEKRQV
                     REKVQALRRHYSQPFSQRLVQAQEALVETLHFARSEVPYYRDLFASLGFNPDSVKQDI
                     RYLQDLPLLTKDIIREQGERLYARPLNDIRHHMCKTGGSTGLSCHIAYDQPAADWSAA
                     VTLFARESAGNRKWRSELHFACRFPDMVDPGWPTLEDFKCFAMNRSNIFFDRLDDAGL
                     AEIWEILKRRKPYMVHAHPSTIYALACYIERQYGSAKSFEVFESSGELLEPYMRETIS
                     RVLGARIVDRYGLAELGVMAYELQGHDKGLQVLDSEGWPEGHITDSGEHQLVFTGFHN
                     RLMPLIRYTTGDLAHVEQRDDGFYLTEITGRIHDIVHLDGVAYPTHTIQDMLDYRVGC
                     IQEFQIDMRGEIPVMRIVPESYADKAEIVSKIESYWPNAMKVEFVGHDDLIRVGHRAK
                     FRHVVTA"
     gene            complement(<659107..659820)
                     /locus_tag="RAHAQ2_RS02990"
                     /old_locus_tag="Rahaq2_0623"
     CDS             complement(<659107..659820)
                     /locus_tag="RAHAQ2_RS02990"
                     /old_locus_tag="Rahaq2_0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333806.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_037040601.1"
                     /db_xref="GI:739176623"
                     /translation="MQTYIRAEKLCVEFPIFDNSHRSLKNTVMHLTTGGRIGVNVGQH
                     PVVRALNEIDFDIREGDRVGLTGHNGSGKTTLLRVLSGVYAPVYGKLSMHGRIASLLD
                     VSTGIDPDASGFENIYLRGITDGLKPAHIRSKIDEIADFTGLGDYLNLPVRTYSSGMQ
                     LRLAFAISTSVNAEILIMDEWLSVGDAEFSAKAAVRLDSLVSNASILVLASHSPELIS
                     RVCNRKMHLEHGLIVSDERI"
     gene            complement(659825..660673)
                     /locus_tag="RAHAQ2_RS02995"
                     /old_locus_tag="Rahaq2_0624"
     CDS             complement(659825..660673)
                     /locus_tag="RAHAQ2_RS02995"
                     /old_locus_tag="Rahaq2_0624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014333807.1"
                     /db_xref="GI:504099813"
                     /translation="MNPNVSDLTREKAEANNAPPGWKEHNGKTDMLEGIKAYHVWLIW
                     GWHDIRQRYRRSVLGPFWFTLTTLIMVGALGFLYSELLGQEISTYLPYLGVGLVVWQF
                     ISTAANEGCTCLIGSVHIIKQIRMPLTTHVCRMAWRNFIILLHSLPVVIIFMFFFGHM
                     LTWEIIWVIPGLLIVLLNAVWSGIVFGILCSRFRDVAPIIGSLFQVCFFVTPVMWQTS
                     ALKERGWIADFNPFYHLIEIVRAPILGTPVPFISWASSIALLVVGFAFAQYLMNRYRD
                     RVAYWL"
     gene            complement(660888..662252)
                     /locus_tag="RAHAQ2_RS03000"
                     /old_locus_tag="Rahaq2_0625"
     CDS             complement(660888..662252)
                     /locus_tag="RAHAQ2_RS03000"
                     /old_locus_tag="Rahaq2_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333808.1"
                     /note="capsular polysaccharide biosynthesis protein;
                     catalyzes the formation of  D-mannose 6-phosphate  from
                     alpha-D-mannose 1-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase"
                     /protein_id="WP_014333808.1"
                     /db_xref="GI:504099814"
                     /translation="MSALTCFKAYDIRGRLGDELNSDIAYSIGRAFGQYMNAKTVAIG
                     GDIRLSSETLKASLAEGLQDSGVNVIDLGVTGTEEIYFSAFHLDIDGAIEVTASHNPM
                     DYNGMKLVGRGAKPISGDSGLNDIRDLIEKGEFKTFATKGNYSKRSLLDSYIHHLMSY
                     IDVNNIKPLKLVVNAGNGAAGHVIDAIEEKFSQLNVPVEFIKINHAPDGNFPNGIPNP
                     LLPENRAATADAVKEYKADMGIAWDGDFDRCFLFDENADFIEGYYIVGLLAEAFLTKN
                     KGAKIIHDPRLTWNTVEVVQQAGGIPVKSKTGHAYIKERMRAENAIYGGEMSAHHYFR
                     DFAYCDSGMIPWLLVIELISSKGTSLSKLVHEAMQAYPCSGEINFKVSNAKDILIRIE
                     KAFESDAVSIDFTDGLSIDMPEWRLNVRTSNTEPLLRLNIESRGNPELVWQKVAEVEH
                     LIKM"
     gene            complement(662266..663678)
                     /gene="cpsB"
                     /locus_tag="RAHAQ2_RS03005"
                     /old_locus_tag="Rahaq2_0626"
     CDS             complement(662266..663678)
                     /gene="cpsB"
                     /locus_tag="RAHAQ2_RS03005"
                     /old_locus_tag="Rahaq2_0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333809.1"
                     /note="capsular polysaccharide colanic acid biosynthesis
                     protein; catalyzes the formation of GDP-mannose from GTP
                     and alpha-D-mannose 1-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="WP_014333809.1"
                     /db_xref="GI:504099815"
                     /translation="MLLPVIMAGGTGSRLWPMSRELYPKQFLRLHGHLSMLQETVERL
                     NGLDVREPVVICNEEHRFLVAEQLRQIDKLSQNIILEPVGRNTAPAIALAALNAIADG
                     SDPLMLVLAADHIINDSEAFHQAIAFATPYAEKNSLVTFGIVPTGPETGYGYIQRGEV
                     FGNNSELFKVKRFVEKPNEKTAEEYINAGEYYWNSGMFMFRAKKYLEELKKYRPDILE
                     ACELAIEKSNKTDSFTNIDKDSFMACPDESVDYAVMEKTDEAVVVSLNAGWSDVGSWS
                     ALWDVSEKDKLNNAITGDAFLHNTKNCYINTDERLVAAIGVENLVIVSTKDAVLVVDK
                     NKVQDVKKIVEFLKAEQRSEYRKHRESYRPWGRSDAIVQEKRFNVNRVTVKPGGAFSK
                     QMHHHRAEHWVVLSGTGKVIIEGKEFLLTENQSTFIPVGSFHSLENPGKIPLELLEIQ
                     SGSYLGEDDIIRIQDQYGRN"
     gene            complement(664883..665266)
                     /locus_tag="RAHAQ2_RS03010"
                     /old_locus_tag="Rahaq2_0627"
     CDS             complement(664883..665266)
                     /locus_tag="RAHAQ2_RS03010"
                     /old_locus_tag="Rahaq2_0627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333810.1"
                     /db_xref="GI:504099816"
                     /translation="MKIKHFFRSLTAGVILSSLTALSAPAFAVDLPFSANCQNHSAIA
                     VAAPNTGITFRKNPNSTATRAATATVFSIHGLHNITIPANVVSCFYAVQGNDNYCFQA
                     SNNAAAFANINAVANTNTAAAPSCQ"
     gene            complement(665498..666157)
                     /locus_tag="RAHAQ2_RS03015"
                     /old_locus_tag="Rahaq2_0628"
     CDS             complement(665498..666157)
                     /locus_tag="RAHAQ2_RS03015"
                     /old_locus_tag="Rahaq2_0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333811.1"
                     /db_xref="GI:504099817"
                     /translation="MTYSVSVANKSGLQQNVAVYLGDSADNNDFSLVWWLKPINNSGN
                     ATFSWDENDYGLGWGNTSEHIDIGVKFSQGQDPTPAFPNVAGGDNVLPVSFNNAGFFS
                     GVPYSDNKITNKLEISTDSSFTVSDSLTMAIALFINKLPTIIMQGSPNMTYYFMIPKL
                     SYYLVVTDFKQGVVLPAMDPMYDCNTSGRSVGKPVKIAFGAGATNLAYTLDGSLNFIA
                     N"
     gene            complement(666381..667010)
                     /locus_tag="RAHAQ2_RS03020"
                     /old_locus_tag="Rahaq2_0629"
     CDS             complement(666381..667010)
                     /locus_tag="RAHAQ2_RS03020"
                     /old_locus_tag="Rahaq2_0629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333812.1"
                     /db_xref="GI:504099818"
                     /translation="MSSYSISVKNSSGGAANVAIYQTYPNLVTGLPLVWLLQTVNDGN
                     TNSYNWSIDWALNWGTTEQPLAPGVLWSSGGPIQNMNPTASGGKNAMGVTYTNGQFQT
                     QPTAYNNPEVASGSMLVKTDSTFTVGQSKAMSLAVYMNSLPAFAMQGKPNGNFMFDTH
                     PTYWICTTDSKIGVAVSGTFVSSPLQFAFADGITSLSFELNDTLQFVPL"
     gene            complement(667950..668026)
                     /locus_tag="RAHAQ2_RS03025"
                     /old_locus_tag="Rahaq2_0631"
     tRNA            complement(667950..668026)
                     /locus_tag="RAHAQ2_RS03025"
                     /old_locus_tag="Rahaq2_0631"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(667990..667992),aa:Met,seq:cat)
     gene            668170..668667
                     /locus_tag="RAHAQ2_RS03030"
                     /old_locus_tag="Rahaq2_0632"
     CDS             668170..668667
                     /locus_tag="RAHAQ2_RS03030"
                     /old_locus_tag="Rahaq2_0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA glycosylase"
                     /protein_id="WP_014333814.1"
                     /db_xref="GI:504099820"
                     /translation="MITDIIADDLLVVFCGINPGLSSAHKGYPFANGSNRFWKVIHQA
                     GFTGRQLMPEQWQQLKDFGCGITALVARPTVAASELMRDELREGGEVLKGKILRHQPR
                     ALAILGKQAFSKAFGVSKVNWGRQALKIGDTEIWVLPNPSGLNRATLEELTASYRELY
                     DALNS"
     gene            complement(668749..670587)
                     /locus_tag="RAHAQ2_RS03035"
                     /old_locus_tag="Rahaq2_0633"
     CDS             complement(668749..670587)
                     /locus_tag="RAHAQ2_RS03035"
                     /old_locus_tag="Rahaq2_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017493531.1"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; this is the primary sigma
                     factor of bacteria; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_013573945.1"
                     /db_xref="GI:503339284"
                     /translation="MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDI
                     IQMINDMGIQVLEEAPDADDLMLAENRPDTDEDAAEAAAQVLSSVESEIGRTTDPVRM
                     YMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAGEVRL
                     SDLITGFVDPNAEEEIAPTATHVGSELTTEEQDDDDEDEDEDDDAEDDNSIDPELARQ
                     KFTELREQHEATRLVIKKNGRSHKSAAEEILKLSDVFKQFRLVPKQFDFLVNSMRSMM
                     DRVRAQERLIMKVCVEQCKMPKKNFVNLFAGNETSDTWFDAALAMGKPWSEKLKEVTE
                     DVQRGLMKLRQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKK
                     YTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
                     IPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMET
                     PIGDDEDSHLGDFIEDTTLELPLDSATSESLRSATHDVLAGLTAREAKVLRMRFGIDM
                     NTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
     gene            complement(670891..672639)
                     /gene="dnaG"
                     /locus_tag="RAHAQ2_RS03040"
                     /old_locus_tag="Rahaq2_0634"
     CDS             complement(670891..672639)
                     /gene="dnaG"
                     /locus_tag="RAHAQ2_RS03040"
                     /old_locus_tag="Rahaq2_0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333815.1"
                     /note="synthesizes RNA primers at the replication forks;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_014333815.1"
                     /db_xref="GI:504099821"
                     /translation="MAGRIPRVFINDLLARIDIVDLIDARVKLKKQGKNYHACCPFHH
                     EKTPSFTVNGDKQFYHCFGCGAHGNAVDFLMNYDRLEFVESIEELATMQGLEVPYEAG
                     IGPSQMERHQRQSLYQLMAPLSEFYQQSLKQPAGAPAREYLARRGLSEDVISHFAIGF
                     APPGWDNALKRFGKNADDKASLIDAGMLVTNDNGRSYDRFRERVMFPIRDKRGRVIAF
                     GGRVLGNDTPKYLNSPETEIFHKGRQLYGLYEAQLKHPTPARLLVVEGYMDVVALAQF
                     GIDYAVASLGTSTTADHIQLMFRSTDNIVCCYDGDRAGREAAWRALETALPYLNDGRQ
                     LRFMFLPDGEDPDTLVRKEGKEVFEQRMEQAMPLSTFLFDSLLPQVDLSSPDGRTKLS
                     MLALPLIRQVPGETLRMYLRQQLGNKLGILDDSQLEKLMPKQAESSNVYQAPQLKRTT
                     MRILIGLLVQNPQLATLIPSLQGLEQAKQPGLDLFRELVTTCLAQPGLTTGQLLELYR
                     DNKFYQQLETLATWNHMIVEDMVEEEFRATLASLYDSILEQRLETLIAKARTHGLSPE
                     ERTEVSSLNQVLARKS"
     gene            complement(672775..672990)
                     /gene="rpsU"
                     /locus_tag="RAHAQ2_RS03045"
                     /old_locus_tag="Rahaq2_0635"
     CDS             complement(672775..672990)
                     /gene="rpsU"
                     /locus_tag="RAHAQ2_RS03045"
                     /old_locus_tag="Rahaq2_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C5BHG0.1"
                     /note="a small basic protein that is one of the last in
                     the subunit assembly; omission does not prevent assembly
                     but the subunit is inactive; binds central domain of 16S
                     rRNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_001144069.1"
                     /db_xref="GI:447066813"
                     /translation="MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTE
                     RKRAKASAVKRHAKKLARENARRTRLY"
     gene            673307..674320
                     /locus_tag="RAHAQ2_RS03050"
                     /old_locus_tag="Rahaq2_0636"
     CDS             673307..674320
                     /locus_tag="RAHAQ2_RS03050"
                     /old_locus_tag="Rahaq2_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573947.1"
                     /note="universal genome maintenance protein;
                     Kae1/Qri7/OSGEP/YgjD family protein; in Archaea, some Kae1
                     are found as fusion proteins similar to two distinct
                     proteins in yeast that are involved in the KEOPS complex;
                     kinase associated endopeptidase 1 (Kae1) and a
                     serine/threonine protein kinase (Bud32); in Pyrococcus
                     Kae1 has atypical AP endonuclease activity and inhibits
                     the kinase activity of Bud32; the protein is essential in
                     Escherichia coli and Bacillus subtilis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA threonylcarbamoyladenosine modification
                     protein TsaD"
                     /protein_id="WP_015695844.1"
                     /db_xref="GI:505734161"
                     /translation="MRVLGIETSCDETGIAVYDSEAGLLANQLYSQVKLHADYGGVVP
                     ELASRDHVRKTVPLIQAALKEAGLTAQDIDGVAYTAGPGLVGALLVGATIGRSLAFAW
                     DVPAVPVHHMEGHLLAPMLEDNPPDFPFVALLVSGGHTQLISVTGIGEYTLLGESIDD
                     AAGEAFDKTAKLLGLDYPGGPLLSKMAAQGVAGRFTFPRPMTDRPGLDFSFSGLKTFA
                     ANTIRGNDSDPQTHADIARAFEDAVVDTLAIKCKRALDQTGFKQLVMAGGVSANRTLR
                     AKLAEVMAKRGGQVFYARPEFCTDNGAMIAYAGMVRLKSGATPELGVTVRPRWPLAEL
                     PPV"
     gene            complement(674516..675145)
                     /locus_tag="RAHAQ2_RS03055"
                     /old_locus_tag="Rahaq2_0637"
     CDS             complement(674516..675145)
                     /locus_tag="RAHAQ2_RS03055"
                     /old_locus_tag="Rahaq2_0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695845.1"
                     /note="involved in acylation of glycerol-3-phosphate to
                     form 1-acyl-glycerol-3 phosphate for use in phospholipid
                     biosynthesis; functions with PlsX; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_015695845.1"
                     /db_xref="GI:505734162"
                     /translation="MSATALGMIIFAYLCGSISSAILVCRVARLPDPRTAGSGNPGAT
                     NVLRLGGRLAAAAVLIFDVLKGMLPVWLAYRLNIPPMYLGLTAIAACLGHIYPVFFHF
                     KGGKGVATAFGAIAPIGWDLTGLMTGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKP
                     EFTFPVAMLSCLILLRHHDNIQRLWRGQEGKIWDKLKKKRKAAKEDKTE"
     gene            675253..675609
                     /gene="folB"
                     /locus_tag="RAHAQ2_RS03060"
                     /old_locus_tag="Rahaq2_0638"
     CDS             675253..675609
                     /gene="folB"
                     /locus_tag="RAHAQ2_RS03060"
                     /old_locus_tag="Rahaq2_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695846.1"
                     /note="catalyzes the conversion of 7,8-dihydroneopterin to
                     6-hydroxymethyl-7,8-dihydropterin and can also catalyze
                     the epimerization of carbon 2' of dihydroneopterin and
                     dihydromonapterin; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin triphosphate 2'-epimerase"
                     /protein_id="WP_015695846.1"
                     /db_xref="GI:505734163"
                     /translation="MDIVFIEQLNVITTIGAYEWEQTIKQKLVFDIEMAWDNRKSAAS
                     DDVNDCLSYADVSDAVIGHVSSQNFALVERVAEEVATLLLSRFNSPWVRIKLSKPGAV
                     AQAANVGVIIERGKRF"
     gene            675796..676620
                     /locus_tag="RAHAQ2_RS03065"
                     /old_locus_tag="Rahaq2_0639"
     CDS             675796..676620
                     /locus_tag="RAHAQ2_RS03065"
                     /old_locus_tag="Rahaq2_0639"
                     /EC_number="3.6.1.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695847.1"
                     /note="BacA; phosphatase activity in Escherichia coli not
                     kinase; involved in bacitracin resistance as bacitracin
                     supposedly sequesters undecaprenyl disphosphate which
                     reduces the pool of lipid carrier available to the cell;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP pyrophosphate phosphatase"
                     /protein_id="WP_037040598.1"
                     /db_xref="GI:739176620"
                     /translation="MVESHSLLVAAILGVVEGLTEFLPVSSTGHLIIVGNLLGFTGDT
                     SKSFEVVIQLGSILAVVVMFWRRLFSMIGLHFGKPPVHEGTGTRRLNLLHIILGMIPA
                     TVIGLVFHSQIKSLFEPKFVMYSLVVGGVLLIAAELLKPKKPRAEGLDDISYLQAFMI
                     GVFQCLALWPGFSRSGATISGGMLMGISRFAASEFSFLLAVPMMMGATALDLYKSYSF
                     LTLADLPMFVTGFVSAFIVALIAIKTFLAVIKRISFIPFAIYRFFVAIAVYYVFIA"
     gene            complement(676697..677932)
                     /locus_tag="RAHAQ2_RS03070"
                     /old_locus_tag="Rahaq2_0640"
     CDS             complement(676697..677932)
                     /locus_tag="RAHAQ2_RS03070"
                     /old_locus_tag="Rahaq2_0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA nucleotidyl transferase"
                     /protein_id="WP_015695848.1"
                     /db_xref="GI:505734165"
                     /translation="MEIYLVGGAVRDSLLNLPVSEHDWVVVGATPEYMLENGYQQVGK
                     DFPVFLHPVTHDEYALARTERKSGSGYNGFTCYAAPDVTLEQDLMRRDLTINAIAKNQ
                     DGELFDPYHGQRDIEQRLLRHVSDAFGEDPLRVLRVARFAARFAHLGFTVAPETQTLM
                     QQMAESGELEALTPERVWKETEKALQTQDPQVFFQVLRDCDALKVLFPEIDALFGVPA
                     PEKWHPEIDTGIHTLMTLKIASTLTPDIDVRFSALCHDLGKALTPPQFWPAHHGHGPA
                     GVKLVEKLCQRLKVPTHIRDLAKLVAEFHDLIHTVNKLRPETLLKLFDTIDVWRKPQR
                     LEQMIMTSEADARGRTTFENNPYPQGDYLREAFEIASSVSNKEVLDAGFQGMAIRDEL
                     RKRRTQALADWKHTQDVAI"
     gene            complement(678064..678684)
                     /locus_tag="RAHAQ2_RS03075"
                     /old_locus_tag="Rahaq2_0641"
     CDS             complement(678064..678684)
                     /locus_tag="RAHAQ2_RS03075"
                     /old_locus_tag="Rahaq2_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695849.1"
                     /db_xref="GI:505734166"
                     /translation="MQKLRLIGFALLGLSMTWGAHADEKRYISDDLITYIHSGPGNQY
                     RIVGTLNAGEEVTLRSVNDSTKYGEIVDSKGKTAWIPLDQLSNVPSLRTRVPDLEQQV
                     KTLTDKLTNIDSSWNQRTAQMQAKVASSDGIIDGLKKENQDLKNQLIVAKKKVDAVNV
                     QLDDKQRTIILQWFMYGGGVAGVGLVLGLVLPHLVPRRRKKDRWMS"
     gene            678964..680271
                     /locus_tag="RAHAQ2_RS03080"
                     /old_locus_tag="Rahaq2_0642"
     CDS             678964..680271
                     /locus_tag="RAHAQ2_RS03080"
                     /old_locus_tag="Rahaq2_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate cyclase"
                     /protein_id="WP_037040584.1"
                     /db_xref="GI:739176606"
                     /translation="MTVEIELKFIATPAAIAELPSQLAGFHSEHTAPSKLTNIYFETA
                     ENYLRSHDIGLRIRGFDDQYEMTIKTGGKVVGGLHQRPEYNVELKKPVLKLSAFPKDI
                     WPEGCKPAALQKELAPLFRTDFTREKWVITYGESEIELGLDQGEVVAGELTEPLAEIE
                     LELKKGNTTDLLALAAEIGAHGGLRQGGFSKAARGYHLAKGNPARDIKPLPVFKAKAK
                     ATVEQAMSAMFELALDHWQYHEELWVRGDKTARLTVLQAVETVRQVLVLFGGLVPRKA
                     SSELRNLLTDLVPALEQKSADAQEICYGAAYLKCKLVLTSWLVTSGWTPFIDDKSAKK
                     LEGSFKRFADIMLGRTAADLKEAFAQPLTEEGYRDQLARLKRQIITFHLLAGAYPEKE
                     VAAYIAGWVELQQAIVQQQHAWEDSARSHAVMMDAFWLNGQPR"
     gene            680329..683166
                     /locus_tag="RAHAQ2_RS03085"
                     /old_locus_tag="Rahaq2_0643"
     CDS             680329..683166
                     /locus_tag="RAHAQ2_RS03085"
                     /old_locus_tag="Rahaq2_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573954.1"
                     /note="catalyzes the ATP-dependent addition of AMP to a
                     subunit of glutamine synthetase; also catalyzes the
                     reverse reaction - deadenylation;
                     adenylation/deadenylation of glutamine synthetase subunits
                     is important for the regulation of this enzyme; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional glutamine-synthetase
                     adenylyltransferase/deadenyltransferase"
                     /protein_id="WP_015695851.1"
                     /db_xref="GI:505734168"
                     /translation="MLPLSSVLQSHAQSLPERWREHPENLPLPDDEQLAVLSSSEFMT
                     DSLLAFPQWWHEIVQNPPQAQEWQLYRQWLDESLTQVTDEAGLMKALRLFRRRILTRI
                     AWSQSAQTSEAKDTLHQLSELAELLIVSARDWLYAACCREFGTPVNAAGEPQRMLILG
                     MGKLGGGELNFSSDIDLIFAYPENGQTRGGRRELDNAQFFTRLGQRLIKALDQPTIDG
                     FVYRVDMRLRPFGDSGPLVMSFPALEDYYQEQGRDWERYAMVKARLMGGAEDISSQEL
                     RKMLMPFVFRRYIDFSVIQSLRNMKGMIAREVRRRGLKDNIKLGAGGIREIEFIVQVF
                     QLIRGGREPALQQRALLPTLQALENLGLLPVEQVLQLRNSYLFLRRLENLLQAIADEQ
                     TQTLPSDELNQARLAWGMNYAGWPQLLDAVNAHMQAVRSVFNDLIGDDTPDAEDDVQL
                     SRFSSLWIDTLEPDELAPLVPQLDENAQRHVLHQIADFRRDVDKRTIGPRGRDQLDLL
                     MPRLLAQVCTYKNADVTLQRLMQLLLNIVTRTTYIELLVEYPGALKQLIRLCAASPMV
                     ATQLARHPLLLDELLDPRTLYQPIEPGAYRDELRQYLMRVPTEDEEQQLEAVRQFKQA
                     QHLRIAAGDISGALPVMKVSDHLTYLAEAILDVVVQQAWEQMVVKYGQPTHLQHREGR
                     GFAVVGYGKLGGWELGYSSDLDLVFLLDCAPEVMTDGERSIDGRQFYLRLAQRIMHLF
                     STRTSSGILYEVDPRLRPSGASGMLVSTIEAFADYQANEAWTWEHQALVRARVVYGDP
                     QLTQQFNATRRDILCRQRDADGLRKEVREMREKMYAHLGSKRADEFDLKADPGGITDI
                     EFIAQYLVLRFAHDEPKLTRWSDNVRIFELMARHDIMPEEEARHLTQAYVTLRDEIHH
                     LALQEHSGKVAADSFATERAQIRASWANWLG"
     gene            683254..684681
                     /locus_tag="RAHAQ2_RS03090"
                     /old_locus_tag="Rahaq2_0644"
     CDS             683254..684681
                     /locus_tag="RAHAQ2_RS03090"
                     /old_locus_tag="Rahaq2_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695852.1"
                     /note="catalyzes the phosphorylation of
                     D-glycero-D-manno-heptose 7-phosphate to form
                     D,D-heptose-1,7-bisphosphate and catalyzes transfer of ADP
                     to D-glycero-D-manno-heptose 1-phosphate forming
                     ADP-D,D-heptose; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional heptose 7-phosphate kinase/heptose
                     1-phosphate adenyltransferase"
                     /protein_id="WP_015695852.1"
                     /db_xref="GI:505734169"
                     /translation="MKVTLPDFHRAGVLVVGDVMLDRYWYGPTNRISPEAPVPVVKVS
                     TIEERPGGAANVAMNISSLGASSRLIGLTGVDDAARALSERLAEVKVNCDFVALSTHP
                     TITKLRILSRNQQLIRLDFEEGFEGVDLQPMLTKIEQALPQSGALVLSDYAKGALTEV
                     QKMIQLARKAGVPVLVDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEDEIVTRGMQ
                     LIADFELSALLVTRSEHGMTLLQPGKAPFHMPTQAQEVYDVTGAGDTVIGTLAAALAA
                     GNTLEESCFLANAAAGVVVGKLGTSTVSPVELENAIGGRSDVGFGVMNEEQLKAAVAM
                     ARQRGEKVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNSDASTKRLKGETRPVNT
                     LQNRMIVLGALGAVDWVVSFEEDTPQRLIAGILPDLLVKGGDYKPEQIAGCQEVWANG
                     GEVRVLNFEDGLSTTKIINQIKSQD"
     gene            684784..686034
                     /locus_tag="RAHAQ2_RS03095"
                     /old_locus_tag="Rahaq2_0645"
     CDS             684784..686034
                     /locus_tag="RAHAQ2_RS03095"
                     /old_locus_tag="Rahaq2_0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695853.1"
                     /note="uncharacterized member of the APC superfamily of
                     amino acid transporters; unknown function; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_015695853.1"
                     /db_xref="GI:505734170"
                     /translation="MSGLKQELSLAQGVGLLSTSLLGTGVFAVPALAAQLAQNDSLWA
                     WPVLILLVFPIAIGFAALGRHFPSAGGAAHFVGKAFGPHMARVTGWLFLSVIPVGLPA
                     ALHIAAGFWQAAFGWSSTNLLLVQLGTLFFIWFLGTRSAGSSANIQTIIAFLVIALVV
                     AIWWKGDISLPEIPLPPVRDVSPSNLFDALAVMFWCFVGLEAFAHLATEFRHPERDFP
                     RALLIGMLVAGAVYWGCTVAVLKFHAWGEGREAGASLPGIVVQLFGQKALWIACIIGY
                     LACFASVNIYTQSFSRLVWSQAQLKPQSKLAQLSAQQVPVPALNLVVGCCAFFTLLIY
                     WLHLPLGALITYANGIFILIYLLCMLAGIRILAGRSKWMAMLGAVLCCGLLAMVGWKA
                     LYAVVVFAGLWLLLPRAKTVLHVR"
     gene            complement(686100..686372)
                     /locus_tag="RAHAQ2_RS03100"
                     /old_locus_tag="Rahaq2_0646"
     CDS             complement(686100..686372)
                     /locus_tag="RAHAQ2_RS03100"
                     /old_locus_tag="Rahaq2_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695854.1"
                     /db_xref="GI:505734171"
                     /translation="MIDPKKIEQIARQVHESMPKGIREFGEDAEKKIRQVLQAQFSRM
                     DLVNREEFDVQTQVLLRTREKLAVLEQRLAALEGKLTEAEKPQDPA"
     misc_binding    686505..686680
                     /note="FMN riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="flavin mononucleotide"
     gene            686814..687467
                     /gene="ribB"
                     /locus_tag="RAHAQ2_RS03105"
                     /old_locus_tag="Rahaq2_0647"
     CDS             686814..687467
                     /gene="ribB"
                     /locus_tag="RAHAQ2_RS03105"
                     /old_locus_tag="Rahaq2_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573958.1"
                     /note="DHBP synthase; functions during riboflavin
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="WP_015695855.1"
                     /db_xref="GI:505734172"
                     /translation="MNQTLLSEFGTSAERVERALDAMRNGVGVLVLDDEDRENEGDLI
                     FAAENMTVEQMALTIRHGSGIVCLTMNEDSRKKLDLPMMVENNSSPFQTPFTVTIEAA
                     EGVTTGVSAADRITTIRAAIKDGAKPSDLNRPGHIFPLRAQAGGVLTRGGHTEASVDL
                     AVLAGLKPFGVLCELTNDDGSMAHAPEVIVFARQHNMPVVTIADLVAYRQAQTRQAS"
     gene            complement(687455..687714)
                     /locus_tag="RAHAQ2_RS03110"
                     /note="ABC transporter ATP-binding protein; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            687716..688504
                     /locus_tag="RAHAQ2_RS03115"
                     /old_locus_tag="Rahaq2_0648"
     CDS             687716..688504
                     /locus_tag="RAHAQ2_RS03115"
                     /old_locus_tag="Rahaq2_0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573960.1"
                     /note="seems to be involved in biofilm formation; in
                     asymptomatic bacteriuria E. coli strains 83972 and VR50,
                     the ygiD gene is upregulated during biofilm formation in
                     urine; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LigB family dioxygenase"
                     /protein_id="WP_015695856.1"
                     /db_xref="GI:505734173"
                     /translation="MTTQRMPALFLGHGSPMNVLEDNIYTRAWHALGETLPRPKAILA
                     VSAHWFTRGTAVTAMESPRTIHDFGGFPQALFDKRYPAPGSPALAKRVQELLSPVNVV
                     ADTSEWGFDHGTWGVLIKMYPDADIPVIQLSIDGTQPPEYHYELGRKLAALRDEGVMI
                     VASGNVVHNLRMVKWGGDAEAYPWATSFETFVKENLTWKGEAKDHPLVKFMEHEGGAL
                     SNPSPDHYLPLLYVLGAWDGAEPITQPTDGIVMASLSMLSVQVG"
     gene            complement(688556..689716)
                     /locus_tag="RAHAQ2_RS03120"
                     /old_locus_tag="Rahaq2_0649"
     CDS             complement(688556..689716)
                     /locus_tag="RAHAQ2_RS03120"
                     /old_locus_tag="Rahaq2_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695857.1"
                     /db_xref="GI:505734174"
                     /translation="MKRLPINERPGWREKATEFGFNFHTMYGEPYWCEDAYYQFTLAQ
                     IEEIEDATAEIHQMCLKVVERVVNDDKLMAKFQIPKHVWEFVRSSWRTQQPSLYSRLD
                     LAYDGVNPPKLLENNADTPTSLYEAAFFQWLWLEDQIAAGNLSQDADQYNSLQEKLIE
                     RFAELKNQHGFSLLHIACCQDTEEDRGTVQYLQDCALEAELASEFLFIEEIGLGERGQ
                     FTDTQDQVISNLFKLYPWEFMFREVFATKLEDAGVRWLEPAWKAILSNKALLPLLWEM
                     FPDHPNLLPAYFAEDPHPELDHYVVKPLFSREGANIKVIEKGQEVARVDGPYGAEGMI
                     VQQFHPLPVFEGSYTLIGSWLVNDQPCGIGIREDKALITQDLSRFYPHTIVG"
     gene            complement(689726..690397)
                     /locus_tag="RAHAQ2_RS03125"
                     /old_locus_tag="Rahaq2_0650"
     CDS             complement(689726..690397)
                     /locus_tag="RAHAQ2_RS03125"
                     /old_locus_tag="Rahaq2_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_015695858.1"
                     /db_xref="GI:505734175"
                     /translation="MKRTQRVNLATFRKSWRSSRITPVALAVSAVFMLAGCEKTDETV
                     SLYQNADDCSKANPSGSAQCVAAYDAAKQEAAKTAPKYASREDCIAEFGEGQCTQAPA
                     QSGVATAENQSSGGSMWMPLMAGYMMGRMMSGGGYAQQPLFSSKNPASPANGKFVDAT
                     GKNYGPATAGGRTMNVPRTAMAPKPAVTNTITRGGFGDSVAKQTSMQRTSSATTRSPG
                     RSMGG"
     gene            complement(690583..692076)
                     /locus_tag="RAHAQ2_RS03130"
                     /old_locus_tag="Rahaq2_0651"
     CDS             complement(690583..692076)
                     /locus_tag="RAHAQ2_RS03130"
                     /old_locus_tag="Rahaq2_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane channel protein"
                     /protein_id="WP_015695859.1"
                     /db_xref="GI:505734176"
                     /translation="MKKLLPLLIGLSLGGFSTISQAENLMQVYQQARTSNPDLRKSAA
                     DRDAAFEKINESRSPLLPQLGLGADYNYTNGYRDANGVNSDVGSASLQLTQTIFDMSK
                     WRALTLQEKTAGIQDVSYQTDQQSLILNSATAYFNVLSAIDSLSYTEAQKQAIYRQLD
                     QTTQRFNVGLVAITDVQNARSQYDTVLANEVTARNNLDNALESLRQVTGMYYPQLSSL
                     NVDNFNTTRPQPVATLLKEAESRNLSLLSARLSQDLAREQIRYAETGHMPTVDLTAST
                     GISNTKYHGDKTGGSSSYQDADAGQNKIGLSFSLPLYSGGSVTSQVKQAQYNFVGASE
                     QLESAHRSVVQTVRSSFNNISASISSINAYKQAVVSAQSSLDAMEAGYQVGTRTIVDV
                     LDATTTLYNAKQQLSSARYTYLINQLNIKSALGTLNESDLLALNGTLGKPVPTAPDQV
                     APETPDQDAAADGYGNKTATAPAPRAQNASATTATTTPKKSGNPFQN"
     gene            692307..692939
                     /gene="nudF"
                     /locus_tag="RAHAQ2_RS03135"
                     /old_locus_tag="Rahaq2_0652"
     CDS             692307..692939
                     /gene="nudF"
                     /locus_tag="RAHAQ2_RS03135"
                     /old_locus_tag="Rahaq2_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573964.1"
                     /note="ADP-sugar pyrophosphatase; catalyzes the formation
                     of D-ribose 5-phosphate from ADP-ribose; can also act on
                     ADP-mannose and ADP-glucose; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="WP_015695860.1"
                     /db_xref="GI:505734177"
                     /translation="MSSFKRSPVTFGKDDVEIIARETRYKGFFSIIAYRFRHRLFNGE
                     MSGEVVREVFERGHAAVLLPYDPQRDEVVLIEQIRIPALDSSDTPWLLEMVAGIIEEG
                     ETVEDVARREALEEANIVVKRCKPAVNYLASPGGTSERLSIMVGEVDATTAEGIHGLE
                     AENEDIRVHVVSREQAYRWVEEGAIDNAASVIALQWLQLHHESLRKEWAN"
     gene            692939..693364
                     /locus_tag="RAHAQ2_RS03140"
                     /old_locus_tag="Rahaq2_0653"
     CDS             692939..693364
                     /locus_tag="RAHAQ2_RS03140"
                     /old_locus_tag="Rahaq2_0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_015695861.1"
                     /db_xref="GI:505734178"
                     /translation="MIKRYTPDFPEMMRLCETNFAQLRRLMPRTDEPGETVTYQVSSA
                     TYCLTILESTRYTSLIEIKQTAPAVSYWSLPSLTVRLYHDAMVAEVCASQQIFRFKAR
                     YDYPNKKLHQRDEKHQINQFLADWLRYCLAHGAMAIPVC"
     gene            693392..694222
                     /locus_tag="RAHAQ2_RS03145"
                     /old_locus_tag="Rahaq2_0654"
     CDS             693392..694222
                     /locus_tag="RAHAQ2_RS03145"
                     /old_locus_tag="Rahaq2_0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3',5'-cyclic-nucleotide phosphodiesterase"
                     /protein_id="WP_015695862.1"
                     /db_xref="GI:505734179"
                     /translation="MESLFTLPLVNGAKVRILQITDTHLFAGEDETLLGVNTFNSYRA
                     VLDAIKAQQREVDIIAATGDLAQDQSVEAYHQFARGISELTAPCVWLPGNHDFQPAMV
                     NALQDAGISPSKHVLLGEHWQIILLDTQVFGVPHGELSDYQLEWMERCLNACPDRFTL
                     LMLHHHPLPSGCTWLDQHSLRNAHMLANTLVNYPKVNTLLCGHIHQELDLDWYGRRLY
                     ATPSTCVQFKPHCTNFTIDTVAPGWRYLDLYPDGRVETEVFRLETSEFHPDTESDGYE
                     "
     gene            694219..694800
                     /locus_tag="RAHAQ2_RS03150"
                     /old_locus_tag="Rahaq2_0655"
     CDS             694219..694800
                     /locus_tag="RAHAQ2_RS03150"
                     /old_locus_tag="Rahaq2_0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573967.1"
                     /note="Displays esterase activity toward palmitoyl-CoA and
                     pNP-butyrate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_015695863.1"
                     /db_xref="GI:505734180"
                     /translation="MNTLLYLHGFNSSPNSAKATALKNWLSVNHPHINMIIPQLPPYP
                     ADAAEELESLVISNAGKKLGIVGSSLGGYYATWLSQCFAVPAVVVNPAVKPYELLIDF
                     LGQNENPYTGQQYVLESRHVYDLKVMQVEPLESPDLLWLLQQTGDEILDYRQAVAYYT
                     TCRQTVEPEGNHAFVGFERYFSPIVDFLELAAD"
     gene            694917..696812
                     /locus_tag="RAHAQ2_RS03155"
                     /old_locus_tag="Rahaq2_0656"
     CDS             694917..696812
                     /locus_tag="RAHAQ2_RS03155"
                     /old_locus_tag="Rahaq2_0656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573968.1"
                     /note="decatenates newly replicated chromosomal DNA and
                     relaxes positive and negative DNA supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="WP_015695864.1"
                     /db_xref="GI:505734181"
                     /translation="MSQSTYNADSIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNS
                     VDEALAGHAKRIEVILHEDQSLEVIDDGRGMPVDIHAEEGVPAVELIFCRLHAGGKFS
                     NKNYQFSGGLHGVGISVVNALSKRVEVAVKRGGEVYEMAFENGDKVQDLHVTGTCGKR
                     NTGTSVHFWPDGSFFDSPRFSVSRLSHLLKAKAVLCPGVEILFKDKVNNTEQRWCYDD
                     GLTDYLMEAVNGLITLPEKAFVGAFAGDTEAVDWALLWLPEGGELLTESYVNLIPTMQ
                     GGTHVNGLRQGLLDAMREFCEFRNILPRGVKLSAEDIWERCAYVLSVKMQDPQFAGQT
                     KERLSSRQCAAFVSGVVKDAFSLWLNQNVQAAEQLAELCISSAQRRLRAAKKVVRKKL
                     TSGPALPGKLADCTSQDLNMTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWE
                     VSSDEVLASQEVHDISVAIGIDPDSEDLTQLRYGKICILADADSDGLHIATLLCALFV
                     RHFRSLVRGGHVYVAMPPLYRIDLGKEVFYALDEQEKEGVLEQLKRKKGKPNVQRFKG
                     LGEMNPLQLRETTLDPNTRRLVQLTIDEDDIDQTLRMMDMLLAKKRSEDRRNWLQEKG
                     DTAELDV"
     gene            complement(696895..697200)
                     /locus_tag="RAHAQ2_RS03160"
                     /old_locus_tag="Rahaq2_0657"
     CDS             complement(696895..697200)
                     /locus_tag="RAHAQ2_RS03160"
                     /old_locus_tag="Rahaq2_0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695865.1"
                     /note="catalyzes the oxidation of menadiol to menadione;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinol monooxygenase"
                     /protein_id="WP_015695865.1"
                     /db_xref="GI:505734182"
                     /translation="MITVIAEIKVKPGRRDSVMEKITALLPSVLAEKGCHRYEPYVDF
                     NGQIPWRKTVPDSIFMLEDWESLAHLEAHQQAEHMDRHRENIKADVLDVVIHIIEKA"
     gene            complement(697231..697818)
                     /locus_tag="RAHAQ2_RS03165"
                     /old_locus_tag="Rahaq2_0658"
     CDS             complement(697231..697818)
                     /locus_tag="RAHAQ2_RS03165"
                     /old_locus_tag="Rahaq2_0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695866.1"
                     /note="involved in drug resistance; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH quinone reductase MdaB"
                     /protein_id="WP_015695866.1"
                     /db_xref="GI:505734183"
                     /translation="MSNILIINAGKTFAHSKGALNNSLTEVAGSFLRDKGHDVRVTVL
                     EDGYDVQTEIESYLWADAIIYQQPGWWMGMPWTLKKYIDEVFTEGHGKLYASDGRTRS
                     DQSKKYGSGGLLHGKCYMLSVTWNAPLEAFEDKEQFFHGVGVDGVYMAQHKANQFIGL
                     DTLPTFMCNDVIKQPDVEGDFARYRAHLENVFGQA"
     gene            698150..700423
                     /locus_tag="RAHAQ2_RS03170"
                     /old_locus_tag="Rahaq2_0659"
     CDS             698150..700423
                     /locus_tag="RAHAQ2_RS03170"
                     /old_locus_tag="Rahaq2_0659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695867.1"
                     /note="decatenates newly replicated chromosomal DNA and
                     relaxes positive and negative DNA supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="WP_015695867.1"
                     /db_xref="GI:505734184"
                     /translation="MSEMTHDGTERLALHTFTENAYLNYSMYVIMDRALPFIGDGLKP
                     VQRRIIYAMSELGLSNNAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYP
                     LVDGQGNWGAPDDPKSFAAMRYTESRLSKYAEVLLRELGQGTVDYVPNFDGTMQEPKM
                     LPARLPNILLNGTTGIAVGMATDIPPHNIREVAAAAVALLEKPNSSLEDLLEFVQGPD
                     FPTEAEIITPRHEIRKMYESGKGSVRMRAVWHKEDGSAVITALPHQVSGAKVLEQIAG
                     QMRAKKLPMVEDLRDESDHENSTRLVVVPRSNRIDLDQVMNHLFATTDLERSYRINMN
                     MIGLDHRPQVKGLVEILTEWLAYRRDTVRRRLNFRLDKVLKRLHILEGLLTAFLNIDE
                     VIHIIRTEDEPKPVLMQRFELSDTQAEAILELKLRHLAKLEETKIRGEQDELAKERDQ
                     LQALLASERKLSTLIRKEIQADADAFGDERRSPITEREEAKAMSEHDFIPSEPVTIVL
                     SESGWVRSAKGHDIDASGLSYKAGDSFRAAAKGKSNQPVVFMDSTGRSYALDPTTLPS
                     ARGQGEPLTGKLTPPPGATIEHVLMAADDQKLLMASDAGYGFVCTFNDLVARNRAGKA
                     MITLPDNAKAFPPMELHGNDDMLLSITAAGRMLLFPVADLPQLSKGKGNKIVSIPAAQ
                     AASGEDKLAWLLVLPPQTSITLHVGKRKLVLRPEDLQKFRAERGRKGTLLPRGLQRID
                     RVEVDSPVRAGGGDSEE"
     gene            700640..701377
                     /locus_tag="RAHAQ2_RS03175"
                     /old_locus_tag="Rahaq2_0660"
     CDS             700640..701377
                     /locus_tag="RAHAQ2_RS03175"
                     /old_locus_tag="Rahaq2_0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695868.1"
                     /note="catalyzes the formation of 1,2-diacyl-sn-glycerol
                     3-phosphate from 1-acyl-sn-glycerol 3-phosphate using
                     either acyl-CoA or acyl-ACP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_015695868.1"
                     /db_xref="GI:505734185"
                     /translation="MLFILRLIIVVIYSILVSVFGCIYCLFSPRNPKHVATFGKLFGH
                     LAPVLGLRVEKRIPAEAVNNGNCIYIANHQNNYDMVTASSVVMPGTVTVGKKSLAWIP
                     FFGQLYWLTGNLLIDRDNRAKAHGTIAQVVAQIKKKNLSIWMFPEGTRSRGRGLMPFK
                     TGAFHAAIAAGVPIVPICVSNTSNKVKLNRWSNGLVIVEILPPIDTSGYTKERLRELS
                     DHCRQIMADKIAELDAEVARREAAAKK"
     gene            701462..702877
                     /locus_tag="RAHAQ2_RS03180"
                     /old_locus_tag="Rahaq2_0661"
     CDS             701462..702877
                     /locus_tag="RAHAQ2_RS03180"
                     /old_locus_tag="Rahaq2_0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:E8XXT6.1"
                     /note="septal ring component that protects the divisome
                     from stress; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsI"
                     /protein_id="WP_015695869.1"
                     /db_xref="GI:505734186"
                     /translation="MSLSRRSFLQASGVALAAGALPLKAEASGSQPALPVPPLLESRR
                     GQPLFLTLQAAHWSFLGGAKAPVWGINGMYLGPTVKVHSGDDVKLIYSNRLAEPVSMT
                     VSGLLEPGTLTGGAARLMQPGVDWSPVLPIRQAAATCWYHANTPDRMAPHVYNGLAGM
                     WIVEDEVSKNLPLPNHYGVDDFPLIIQDKRLDGFGVPQYDTPASGGFFGDTMLVNGVQ
                     SPYVEVSRGWVRLRLLNASNARRYELSMTDNRAFHVVASDLGFLPAPMTVKRLSLGPG
                     ERREVLVDMSQGEEVSITAGEAAGVMDRLRGLFEPSSILVSTIALTLKPTGLLPLVTD
                     NLPMRLLADQILSGNVVRTRDLRLGDSEPGINGAMWDINRIDLTAQQGTWERWTVHAD
                     MPQTFHAEGVSFLVKSVNGAAPLVEDAGFKDTVWVDGDVELLVYFNQPSYEHFPFVYR
                     SGALELADRGSAGNMLVQPSM"
     gene            complement(702944..703768)
                     /gene="dkgA"
                     /locus_tag="RAHAQ2_RS03185"
                     /old_locus_tag="Rahaq2_0662"
     CDS             complement(702944..703768)
                     /gene="dkgA"
                     /locus_tag="RAHAQ2_RS03185"
                     /old_locus_tag="Rahaq2_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695870.1"
                     /note="methylglyoxal reductase/beta-keto ester reductase;
                     catalyzes the reduction of 2,5-diketo-D-gluconic acid to
                     2-keto-L-gulonic acid; also catalyzes the reduction of
                     methylglyoxal, ethyl-2-methylacetoacetate and
                     ethyl-acetoacetate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-diketo-D-gluconic acid reductase"
                     /protein_id="WP_015695870.1"
                     /db_xref="GI:505734187"
                     /translation="MATQPIIKLHDGNLMPQLGLGVWKASNQEASSAVKTAIETGYRH
                     IDTAAIYKNEEGVGEAIAANLVPREELFITTKLWNDDQLNAPQALETSLKKLKTDYVD
                     LYLIHWPQPAQGHYVDAWKALLKLKEQGLAKSVGVCNFPLQHLQKLKDETGIFPVVNQ
                     IELHPLMQQRQLHAWNATHTIATESWSPLAQGGEGVFDQPLIQKLAEKYDKTPAQIVI
                     RWHLDNGLIVIPKSVTPKRIRENFDVFDFKLEKEELAEVTKLDKGQRLGPDPEKGL"
     gene            complement(703896..704933)
                     /locus_tag="RAHAQ2_RS03190"
                     /old_locus_tag="Rahaq2_0663"
     CDS             complement(703896..704933)
                     /locus_tag="RAHAQ2_RS03190"
                     /old_locus_tag="Rahaq2_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_015695871.1"
                     /db_xref="GI:505734188"
                     /translation="MSAPAAENTFNAWAAAGPNQPLEAFPYDAGPIGDEEIEVAIDYC
                     GVCHSDLSMLNNDWGITQYPFVPGHEVVGKIVKIGNHAQNKGLKVGQIVGVGWNRGSC
                     MHCHPCMSGDQHLCHDVEATIIGHHGGFADRIRSHWAWAIPLPEGVDITSAGPLFCGG
                     ITVFNPLLQFGVLPTHRVGVIGIGGLGHMALRFLNAWGCEVTAFTSSLAKRDEALSLG
                     AHRVIATRDSEELKKIAGQLDFIMVTANASLDWDAIIGALAPKGRLHFVGVVPEAVPL
                     HVMALISKQAEISGSPTGSPSRLADMLAFCARHDITPQVEHFPLSKINDAVEHLHEGK
                     ARYRVVLDMNA"
     gene            705239..706174
                     /locus_tag="RAHAQ2_RS03195"
                     /old_locus_tag="Rahaq2_0664"
     CDS             705239..706174
                     /locus_tag="RAHAQ2_RS03195"
                     /old_locus_tag="Rahaq2_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_015695872.1"
                     /db_xref="GI:505734189"
                     /translation="MENVNSLCARMAARVAQLSGDNSLTPSAVPQVTLMYTTRYHPRQ
                     PVLYNPGIVILFQGRKVGYLRKKTFSYDPHNYLMLTVPLPFECETFSSPEEPLAGIQI
                     SIDNLMLQDLLMDMGDESVVRQKEPSTGINSGVLDGDILCATERLLDVMDKPLHARIL
                     GPKIIREILFFILTSENGGALQALVNRHTHFSQIAKSLRRIEAQYADNLSVEALASEV
                     NMSISAFHHNFKAVTSTSPLQYLKTYRLHRARTLMIFDGVKASVAALQVGYESASQFS
                     REFKRYFGVTPSDEMARLREGSSGVLALADVALKA"
     gene            complement(706184..706843)
                     /locus_tag="RAHAQ2_RS03200"
                     /old_locus_tag="Rahaq2_0665"
     CDS             complement(706184..706843)
                     /locus_tag="RAHAQ2_RS03200"
                     /old_locus_tag="Rahaq2_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_015695873.1"
                     /db_xref="GI:505734190"
                     /translation="MAVICDIFHALWQHDFSMLADPKLLWVIYAVLFATLFLENGLLP
                     ASFLPGDSLLLLTGALIAKGVMSFFPTLIILVIAASLGCWLSYIQGRWLGHTRLVKGW
                     LLQLPAHYHQRAHHMFIQHGLMALLVGRFLAFVRTLLPTMAGISGLNNARFQFFNWLS
                     AILWVGVVISLGFALSHIPLVKRHEDQVMAGLMILPVLLLVMGLFGGLVVVWKKRKCR
                     A"
     gene            complement(707057..708250)
                     /locus_tag="RAHAQ2_RS03205"
                     /old_locus_tag="Rahaq2_0666"
     CDS             complement(707057..708250)
                     /locus_tag="RAHAQ2_RS03205"
                     /old_locus_tag="Rahaq2_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695874.1"
                     /note="catalyzes the formation of L-homocysteine from
                     cystathionine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="WP_015695874.1"
                     /db_xref="GI:505734191"
                     /translation="MSSKKIETALVSAGRDKKFTQGSVNAVIQRASSLVFDTVADKKH
                     ATANRANGELFYGRRGTLTHFSFQEAMVELEGGAGCALYPCGAAAVSNAVLSFVSSGD
                     HILVAGSAYEPTQDFCEKVLKKLGVSTTYFPSTVGAALGTLMQPNTKVVFLESPGSIT
                     LEVPDIPAMVQAVRAVNPDVVIMIDNTWAAGILFKALEFDIDISIQAGTKYIVGHSDA
                     MIGTAVSNARCWEQLREHSYLMGQMADADTAYVASRGLRTLAVRLKQHAESSLRIARW
                     LAERPEVAVVNHPALPGSKGHEFWKRDFTGSCGLFSFVLKQRLSKQQLSDYLDHFDHF
                     SMAYSWGGFESLVLANQPEEIQAIRPAETVDFSGTLVRLHIGLENCDDLIADLSTAFE
                     RITTS"
     gene            complement(708428..709720)
                     /locus_tag="RAHAQ2_RS03210"
                     /old_locus_tag="Rahaq2_0667"
     CDS             complement(708428..709720)
                     /locus_tag="RAHAQ2_RS03210"
                     /old_locus_tag="Rahaq2_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011091985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_015695875.1"
                     /db_xref="GI:505734192"
                     /translation="MDALILLLTLAVMLAIGVPVAYAVGLSALVGAWWIDLPFEALMI
                     QLTNGVNKFSLLAIPFFILAGAIMAEGGIARRLVSFAYIFVGFIRGGLSLVNIVASTF
                     FGAISGSSVADTASIGSVMIPEMEKKGYPRDFAAAVTASGSVQAILTPPSHNSVIYSL
                     ATGGTVSIAALFIAGILPGLLLSLTLMVMCVVFAHKRGYPKGERVPFRQALKIFIDTL
                     WGLMTIVIIMGGILSGIFTATESAAIACLWSFFVTMFIYRDYKWSELPKLMYRTVKTV
                     SIVMILIGFAASFGAVMTYMQLPMRITEFFTSISDNKYVILMWINIMLLVIGTLMDMA
                     PIILILTPVLLPVVLSLGIDPVHFGMIMLVNLGIGLITPPVGSVLFVASAVSKQSIEN
                     VVRAMMPFYCVLFVVLLLVTYIPTISLFLPKLFGVYTG"
     gene            complement(709733..710245)
                     /locus_tag="RAHAQ2_RS03215"
                     /old_locus_tag="Rahaq2_0668"
     CDS             complement(709733..710245)
                     /locus_tag="RAHAQ2_RS03215"
                     /old_locus_tag="Rahaq2_0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_015695876.1"
                     /db_xref="GI:505734193"
                     /translation="MVSSYHTLMDILYRGAMWLAGIALLLMVAVIPVGIFARYVMNSA
                     LSWPEPIAIMCMVTFTFIGAAVSYRAGSHIVVAMVTDRLPPALKKFSALLADLMMLAI
                     SVFIFWYSLQLCSELWQQPVAEFPLLTAGQTYLPLPVGSALTLLFIIEQIIAGPQHQR
                     PVVMLGNSDA"
     gene            complement(710302..711279)
                     /locus_tag="RAHAQ2_RS03220"
                     /old_locus_tag="Rahaq2_0669"
     CDS             complement(710302..711279)
                     /locus_tag="RAHAQ2_RS03220"
                     /old_locus_tag="Rahaq2_0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_015695877.1"
                     /db_xref="GI:505734194"
                     /translation="MKMQKALLSLCLSSATLLFTHGVSAQTLKAADVHPQGYPNVVAV
                     QHMGEKLQKQTDGRLEIKTFPGGVLGDEKQEIEQAQLGALDIIRVSMTPVASILPEIN
                     VFTLPYIFRDEDHMHKVLDGQIGKEIGDKITSNPNSRLVFLGWMDGGTRNLITKKPVV
                     KPEDLHGMKIRVQGSPIALATLKAMGANPVAMGVSEVFSGMQTGVIDGTENNPPTFVA
                     HNYLPVVKNYTYSRHFIIPELFLYSKVKWDKLKPEDQQLILKLAKEAQDEQRELWKAY
                     NEKALATMKAGGVQFYEIDPATYVKATQSVRDEFGKDHQDLMQQIADVK"
     gene            711967..712719
                     /locus_tag="RAHAQ2_RS03225"
     CDS             711967..712719
                     /locus_tag="RAHAQ2_RS03225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010280258.1"
                     /note="membrane spanning protein in TonB-ExbB-ExbD
                     complex; involved in the tonB-independent energy-dependent
                     transport iron-siderophore complexes and vitamin B12 into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbB"
                     /protein_id="WP_037040594.1"
                     /db_xref="GI:739176616"
                     /translation="MQPAPTETAPVIPTDLSVMGMYHHADVVVKTVMIGLLLASVVTW
                     ALLFSKGAEVFTGKRRMRREFDALSSVRTLDEAAEQAESFAASSISAQMIRDAQNELE
                     LSAGSTDNNGIKERTGFRLERRVSAAGRYMGRGNGILATIGAISPFVGLFGTVWGIMN
                     SFIGIAQTQTTNLAVVAPGIAEALLATAVGLVAAIPAVVIYNIFARTITSYRHQVGDV
                     AAQIILLQGRDLDLAASEGNAPRGQTGQLRVG"
     gene            712729..713163
                     /locus_tag="RAHAQ2_RS03230"
                     /old_locus_tag="Rahaq2_0671"
     CDS             712729..713163
                     /locus_tag="RAHAQ2_RS03230"
                     /old_locus_tag="Rahaq2_0671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695879.1"
                     /note="membrane spanning protein in TonB-ExbB-ExbD
                     complex; involved in the tonB-independent energy-dependent
                     transport iron-siderophore complexes and vitamin B12 into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_015695879.1"
                     /db_xref="GI:505734196"
                     /translation="MAIRLNDDIDESGEMHDINVTPFIDVMLVLLIIFMVAAPLATVD
                     VRVDLPASTAKQQPRPEKPIFLSVKADKQLFLGDTPVNGSNLTAMLDERTQGNKQSTI
                     FFRADKSVDYETLMSVMDNLRKAGYLKVGLVGAEQTGATAAQ"
     gene            complement(713236..714807)
                     /gene="garD"
                     /locus_tag="RAHAQ2_RS03235"
                     /old_locus_tag="Rahaq2_0672"
     CDS             complement(713236..714807)
                     /gene="garD"
                     /locus_tag="RAHAQ2_RS03235"
                     /old_locus_tag="Rahaq2_0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695880.1"
                     /note="catalyzes the formation of
                     5-dehydro-4-deoxy-D-glucarate from D-galactarate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactarate dehydrogenase"
                     /protein_id="WP_015695880.1"
                     /db_xref="GI:505734197"
                     /translation="MSRNKDKEHATEALFIKVHESDNVAIIVNDNGLKAGTRFANGLE
                     LIEHIPQGHKVALETIAKGGDIIRYGEVIGYAVRDIAQGGWIDESLVELPVAPELNSL
                     PLATRVPPALPPLEGYTFEGYRNADGSVGTKNLLGITTSVHCVAGVVDYVVKIIERDL
                     LPKFPNVDGVVALNHLYGCGVAINAPAAIVPIRTIHNLALNPNFGGEVMVVGLGCEKL
                     QPERLLEGTPDVQAISLDDTHIVRLQDEQHVGFQSMVDDILTVAQFHLERLNRRQRET
                     CPASDLVVGTQCGGSDAFSGVTANPAVGYASDLLVRCGATVMFSEVTEVRDAIHLLTP
                     RAADVDVGKRLLEEMAWYDNYLSLGQTDRSANPSPGNKKGGLANVVEKALGSIAKSGT
                     SAISEVLSPGQRPTKKGLIFAATPASDFVCGTQQLASGITVQVFTTGRGTPYGLLAVP
                     VIKMATRTTLANRWHDLMDINAGTIATGDATIEDVGWELFHFILDIASGRKKTWSDTW
                     GIHNALAVFNPAPVT"
     gene            715359..716705
                     /locus_tag="RAHAQ2_RS03240"
                     /old_locus_tag="Rahaq2_0673"
     CDS             715359..716705
                     /locus_tag="RAHAQ2_RS03240"
                     /old_locus_tag="Rahaq2_0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactonate transporter"
                     /protein_id="WP_015695881.1"
                     /db_xref="GI:505734198"
                     /translation="MNIQSQSRTIAQSKVRTHIRYYILLIIFLITAVNYADRATLSIA
                     GTEVARELGLDAADMGQIFAAFGWAYLIMQLPGGWLLDRFGSKKVYTYSLFFWSLFTL
                     LQGFVGWFPLAYGALTLFMLRFMLGFSEAPSFPANARIVAAWFPTTERGTASAIFNSA
                     QYFSLALFSPLLGWLTYAWGWEHVFIVMGVIGFVLTLVWIKFIHNPPEHPNISKSELE
                     YLKDGGAVVDIDHKKTDSANSGPKWSYVRQMLSSRMMLGIFFGQYFINSITWFFLTWF
                     PIYLVQEKGMSILKVGMIAAIPALCGFAGGVLGGVFSDFLIRRGYSLTVARKIPIVLG
                     MLLATSIILCNYTDNNVLVVTLMALAFFGKGFGALGWPVIADTAPKEVIGLCGGIFNV
                     FGNVASIVTPLVIGYIVKGLHSFNMALIFVGCSALMAMLCYLLVVGDIKRLELKKQ"
     gene            716763..717533
                     /locus_tag="RAHAQ2_RS03245"
                     /old_locus_tag="Rahaq2_0674"
     CDS             716763..717533
                     /locus_tag="RAHAQ2_RS03245"
                     /old_locus_tag="Rahaq2_0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695882.1"
                     /note="cleaves 5-dehydro-4-deoxy-glucarate and
                     2-dehydro-3-deoxy-D-glucarate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-dehydro-beta-deoxy-D-glucarate aldolase"
                     /protein_id="WP_015695882.1"
                     /db_xref="GI:505734199"
                     /translation="MSNQMIPNRFRQDLLQGKTLIGCWSALSSPISTEVLGVAGFDWL
                     LLDGEHAPNDVGTFVPQLMALKGSRSAPVVRPQFNDPVVIKRLLDIGFYNFLIPFVET
                     QEQAELAVASTRYPPAGIRGVSVSHRSNMFGTVPDYFNLINDNIAVMVQIESQQGVDN
                     LDAIAAVDGIDGIFVGPSDLAAGMGHLGNAGHPDVQAAIRHIFARAKAHGKPSGILAP
                     VEADARRYLEWGATFVAVGSDLGVFRAGTQALCDRFTQ"
     gene            717571..718455
                     /gene="garR"
                     /locus_tag="RAHAQ2_RS03250"
                     /old_locus_tag="Rahaq2_0675"
     CDS             717571..718455
                     /gene="garR"
                     /locus_tag="RAHAQ2_RS03250"
                     /old_locus_tag="Rahaq2_0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573987.1"
                     /note="catalyzes the reduction of tartronate semialdehyde
                     to glycerate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tartronate semialdehyde reductase"
                     /protein_id="WP_015695883.1"
                     /db_xref="GI:505734200"
                     /translation="MKIGFIGLGIMGKPMSKNLLKAGYELVVMDRNPDTVGEIVKLGA
                     TAADTPKAVAAVSDVIITMLPNSPQVKEVALGENGLIEGARPGTIFIDMSSIAPLASR
                     EISEALAAKHIAMLDAPVSGGEPKAIDGTMSVMVGGDKAVFDKCYEIMKSMAGSVVHT
                     GDIGAGNVTKLANQVIVALNIAAMSEALVLATKAGVDPDLVFQAIRGGLAGSTVLEAK
                     APMVMDRNFKPGFRIDLHIKDLANALDTSHGVGAQLPLTSLVMEMMQALKADGHGQSD
                     HSAIARYYETLAKVEVTR"
     gene            718572..719711
                     /locus_tag="RAHAQ2_RS03255"
                     /old_locus_tag="Rahaq2_0676"
     CDS             718572..719711
                     /locus_tag="RAHAQ2_RS03255"
                     /old_locus_tag="Rahaq2_0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
                     /protein_id="WP_015695884.1"
                     /db_xref="GI:505734201"
                     /translation="MKIVIAPDSYKESLSALDVAKAIESGFREIFPEAEYVKLPVADG
                     GEGTVEAMVAATGGRVVKVNVTGPLGTPLEAFFGLSGDEKIAFIEMAAASGLESVPPA
                     QRNPLRTTSYGTGELIHSALGHGVKHCIIGIGGSATNDGGAGMMQALGAKLLTKEGKS
                     IGQGGGELEKLHHIDISGLDPRIKKCRFEVACDVTNPLTGKDGASAIFGPQKGATPEM
                     IEQLDGYLHHYARVIKQDLGIDVEHVPGAGAAGGMGAALYGFCHAELRQGIEIVTDAL
                     GLDELVKDATLVITGEGRIDSQSINGKVPIGVARVAKRYNKPVIGIAGSLTKDVDVVY
                     DHGLDAVFSVLYSICTLDDALKNAADNLRKSARNIAATIKLSQKL"
     gene            719829..721136
                     /locus_tag="RAHAQ2_RS03260"
                     /old_locus_tag="Rahaq2_0677"
     CDS             719829..721136
                     /locus_tag="RAHAQ2_RS03260"
                     /old_locus_tag="Rahaq2_0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015689388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid deaminase"
                     /protein_id="WP_015695885.1"
                     /db_xref="GI:505734202"
                     /translation="MSEIDFSQQPVNTQTKGLGPLSDGARMGDIREQGWNILREDVSL
                     PVAVLLEERIEHNLSWMREFIQRYQLKLAPHGKTTMSPELYQMQLAFGAWGITLATAP
                     QVRAAFAHGVRNVIMANQLVGKGNMAIIAGLLREDNAFDFACIVDSADNADALGHYFA
                     SQQLKLRVMFEYGIAGGRTGIRTEQQEADVLAAVKRWPQSLALVGVELYEGVSNDEAV
                     IRRFLRHVMSRTEALAQAGEFAEPQVILTGAGSAWFDVVAEELTRKETHLDAEKHYVL
                     DIILRSGCYVTHDVGAYQAALERMQTSNPVAREMNSSLQPALQVWAAVQSLPEPGRAI
                     IAFGKRDAGYDAGYPKAAGHFRPRSATQAGYTTVVPAPDDWKVFAMMDQHAFMSIPEG
                     ADLQVGDMLVFDICHPCLTFDKWRQLLLVNEQWDVTGAVTTWF"
     gene            complement(721164..723914)
                     /locus_tag="RAHAQ2_RS03265"
                     /old_locus_tag="Rahaq2_0678"
     CDS             complement(721164..723914)
                     /locus_tag="RAHAQ2_RS03265"
                     /old_locus_tag="Rahaq2_0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695886.1"
                     /note="part of the two-component regulatory system with
                     UvrY; involved in the regulation of carbon metabolism via
                     the csrA/csrB regulatory system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensory histidine kinase"
                     /protein_id="WP_015695886.1"
                     /db_xref="GI:505734203"
                     /translation="MTKYSLRARMMILILAPTLMIGLLLSTFFVVHRYNELQNQLTEA
                     GASIIEPLAVASEYGMTFREREPVKRLISRLHRNHSDIVRSISVFDGENKLFASSTSQ
                     HDDSPLQVKRIEDIPRELTKTRSGDVLILRTPIQAENHTEADDETFSASPDNRLGYIA
                     IELDLRSVKLAQYQEAFVSTMLLLLCLGIATLFAYRLMRDVTGPIRNMVNTVDRIRRG
                     QLDSRVEGNMPGELSMLKNGINSMAMSLTAYHEEVQQNIDQATSDLRETLEQMEIQNV
                     ELDLAKKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRQTLKTPLSPTQADYLQTIE
                     RSANHLLTIINDVLDFSKLEAGKLVLEHIPFSLREMLDEVVILLAHTAHDKGLELTLN
                     VHNNVPENVLGDPMRMQQVVTNLLGNAIKFTETGNIDINVELRSQNNLQVELEVQIHD
                     TGIGISERQQSQLFQAFRQADASISRRHGGTGLGLVITQRLVKEMGGDISFYSQLNRG
                     STFWFHVTLELNENRHITPVSMSHLEGKRLAYVEANPAAAKATMEILQATPLDVTHRT
                     TLAALPDPWYDIMLCSIPVKPDQVLADYDGKLQKVLGMTQHLLLALPSQFQVDAEELK
                     RRGVQACLIKPMSSIRLLPLLLHEQPASVRVIGNDEDKTSRLPLTAMAVDDNPANLKL
                     IGALLEELVETTVLCHSGEEAIDVARHTDLDIILMDIQMPDIDGIRASEIIHQMARHA
                     KTPVVAVTAHSLSGEREQLLKLGMDDYLSKPIDESMLKNVLSRHHQHQTQLDSPLQAN
                     ESLAPISTLDWQLALSQSANKVALAQDLLQMLVEFLPQVAERVEAVTRGEPDNDILAL
                     IHKLHGSCSYSGVPRLKQLCFYIEQQLRQGVSVETLEPEWFELLDEIDNVKRAAVAYL
                     PG"
     gene            723978..725348
                     /gene="rumA"
                     /locus_tag="RAHAQ2_RS03270"
                     /old_locus_tag="Rahaq2_0679"
     CDS             723978..725348
                     /gene="rumA"
                     /locus_tag="RAHAQ2_RS03270"
                     /old_locus_tag="Rahaq2_0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695887.1"
                     /note="in Escherichia coli this enzyme catalyzes the
                     SAM-dependent methylation of U1939 in the 23S ribomal RNA;
                     binds an iron-sulfur cluster [4Fe-4S]; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="WP_015695887.1"
                     /db_xref="GI:505734204"
                     /translation="MAQFYSPNRRVTTRQTITVTATDLDTFGQGVARHNGKAVFVSGL
                     LPGEQAEVTLTEDKSKYAKGKLKRLLTTSDDRVKPVCPHYSTCGGCQQQHASEALQQR
                     SKSAALLRLISRETGVQADPQPVIAGPQYGYRRRARLGLQIAGVKPGRKTGAAGGPLV
                     MGFRQEGSNDLVAVTRCPVLRPELEQLLVPVQECLSSLSAVKRLGHLEMVLADNGSLL
                     VLRHLDPLSEADRARLTAFAAQHQLTIFLAPDSETLEPLCGEPPYYQIDSLNLKFGPR
                     DFIQVNDAVNQQMVAQALDWLELTPEDRVLDLFCGMGNFTLPLAKRAKQVVGVEGVAT
                     LVANGQDNARNNGLENVSFFHENLEEDVSKQPWAAQGFNKILLDPARGGAAGVMTHIV
                     KLAPARVVYVSCNPTTLARDSKILLEAGYRLAQVRMLDMFPHTGHLESMALFINPSDT
                     GVVSET"
     gene            725358..727595
                     /gene="relA"
                     /locus_tag="RAHAQ2_RS03275"
                     /old_locus_tag="Rahaq2_0680"
     CDS             725358..727595
                     /gene="relA"
                     /locus_tag="RAHAQ2_RS03275"
                     /old_locus_tag="Rahaq2_0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573992.1"
                     /note="(p)ppGpp synthetase; catalyzes the formation of
                     pppGpp and ppGpp from ATP and GTP or GDP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP pyrophosphokinase"
                     /protein_id="WP_015695888.1"
                     /db_xref="GI:505734205"
                     /translation="MVAVRSAHLNTAGEFALDDWINSLGLSSQQSCERLAETWRYCEQ
                     QTQGHPDASLLLWRGLEMVEILSTLSMDNDSMRAALLFPLVDDGIIDEDTLTQQFGKG
                     ITDLVHGVRDMDAIRQLKATQNDSMASEQVDNVRRMLLAMVEDFRCVVLKLAERIAHL
                     REVKDAPEEERVLAAKECTNIYAPLANRLGIGQLKWELEDFCFRYLHPDEYKRIAKLL
                     HERRIDREQYIDDFVSTVKNAMAEEGIKVDVYGRPKHIYSIWRKMQKKSLSFDELFDV
                     RAVRIVVERLQDCYAALGIVHTHFRHLPDEFDDYVANPKPNGYQSIHTVVLGPRGKTL
                     EVQIRTRQMHEDAELGVAAHWKYKEGTAVVGGRSGGYEGRIAWLRKLIAWQEEMADSG
                     EMLDEVRSQVFDDRVYVFTPKGDVIDLPMGSTPLDFAYHIHSDVGHRCIGAKIGGRIV
                     PFTYQLQMGDQIEIITQKHANPSRDWLNPSLGYVTTSRGRSKIQNWFRKQDRDKNIIA
                     GKQILDDELDRLDISIKDAEKLLLPRYNVNSLDEVLAAIGNGDIRLNQMVNFLQSQLK
                     KPSAEELDKEALRQLTQKTTPPPTRTKDNGRVVVEGVGNLMHHIARCCQPIPGDEIVG
                     YITQGRGISIHRADCDQLEDLRSNAPERVVDAVWGESYSSGYSLVVRVVANDRSGLLR
                     DITTILANEKVNVLGVASRSDTRQQLATIDMDIEIYNPQVLGRVIAKLNQLPDVIEAK
                     RLHGS"
     gene            727672..728475
                     /gene="mazG"
                     /locus_tag="RAHAQ2_RS03280"
                     /old_locus_tag="Rahaq2_0681"
     CDS             727672..728475
                     /gene="mazG"
                     /locus_tag="RAHAQ2_RS03280"
                     /old_locus_tag="Rahaq2_0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695889.1"
                     /note="functions in degradation of stringent response
                     intracellular messenger ppGpp; in Escherichia coli this
                     gene is co-transcribed with the toxin/antitoxin genes
                     mazEF; activity of MazG is inhibited by MazEF in vitro;
                     ppGpp inhibits mazEF expression; MazG thus works in
                     limiting the toxic activity of the MazF toxin induced
                     during starvation; MazG also interacts with the GTPase
                     protein Era; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate pyrophosphohydrolase"
                     /protein_id="WP_015695889.1"
                     /db_xref="GI:505734206"
                     /translation="MTDSSLQRLLSIMKTLRDPEAGCPWDKEQTFETIAPYTLEETYE
                     VLDAIARKDYDDVRDELGDLLFQVVFYAQMGSEQGLFEFDDICNAISDKLERRHPQIF
                     GQEAAWSKDASSRDVLVKWEARKAQERAEKSLHSALDDIPSALPALMKAHKIQKRCSN
                     VGFDWTTLGPVLDKVYEEIDEVMFEARQAVIDEEKLGEEIGDLLFATVNLSRHLGHKA
                     EDALQAANRKFERRFRQVEEIIRGKGLNMEDATLEQMEAAWQQVKKQEG"
     gene            728825..730462
                     /gene="pyrG"
                     /locus_tag="RAHAQ2_RS03285"
                     /old_locus_tag="Rahaq2_0682"
     CDS             728825..730462
                     /gene="pyrG"
                     /locus_tag="RAHAQ2_RS03285"
                     /old_locus_tag="Rahaq2_0682"
                     /EC_number="6.3.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015670957.1"
                     /note="CTP synthase; cytidine triphosphate synthetase;
                     catalyzes the ATP-dependent amination of UTP to CTP with
                     either L-glutamine or ammonia as the source of nitrogen;
                     in Escherichia coli this enzyme forms a homotetramer;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase"
                     /protein_id="WP_013573994.1"
                     /db_xref="GI:503339333"
                     /translation="MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPY
                     INVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTRRNNFTTGRIYSDVLRK
                     ERRGDYLGATIQVIPHITNNIKERIIEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQM
                     AVEVGREHTLYMHLTLVPYMAAAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAVPA
                     NERAKIALFCNVPEKAVISLKDVDSIYKIPALLKSQGLDDYICKRFSINAPEANLSEW
                     EQVVYEEANPGGEVTIGMVGKYIELPDAYKSVIEALKHGGLKNRLTVNIKLIDSQDVE
                     TRGVEVLKGLDAILIPGGFGYRGVEGKVATARYARENNIPYLGICLGMQVALIEFARN
                     VAGMENANSTEFVPDCKFPVVALITEWRDEEGNVEVRSEDSDLGGTMRVGGQQCHLND
                     GSLVREMYGEPTIVERHRHRYEVNNMLLKQIEAAGLRVAGRSGDKQLVEIIELPNHPW
                     FVACQFHPEFTSTPRDGHPLFAGFVKAAGEYQKRQVK"
     gene            730539..731843
                     /gene="eno"
                     /locus_tag="RAHAQ2_RS03290"
                     /old_locus_tag="Rahaq2_0683"
     CDS             730539..731843
                     /gene="eno"
                     /locus_tag="RAHAQ2_RS03290"
                     /old_locus_tag="Rahaq2_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017490877.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     2-phospho-D-glycerate in glycolysis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="WP_015695890.1"
                     /db_xref="GI:505734207"
                     /translation="MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTG
                     SREALELRDGDKSRFLGKGVLKAVAAVNGPIAQAVTGKDAKDQANIDKIMIDLDGTEN
                     KSKFGANAILAVSLAAAKAAAASKGLPLYAHIAELNGTPGKYSMPLPMMNIINGGEHA
                     DNNVDIQEFMIQPVGATTLKEAIRMGSEVFHTLAKVLKSKGMGTAVGDEGGYAPNLGS
                     NAEALAVIAEAVKQAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHF
                     LEDLTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIDKG
                     IANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQI
                     KTGSMSRSDRVAKYNQLIRIEEALAAAGTPAPFNGLKEVKGQ"
     gene            732011..732682
                     /locus_tag="RAHAQ2_RS03295"
                     /old_locus_tag="Rahaq2_0684"
     CDS             732011..732682
                     /locus_tag="RAHAQ2_RS03295"
                     /old_locus_tag="Rahaq2_0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ biosynthesis protein"
                     /protein_id="WP_015695891.1"
                     /db_xref="GI:505734208"
                     /translation="MQYPINEMFETLQGEGYFTGVPAIFVRLQGCPVGCSWCDTKHTW
                     DKIADREVDMQRILVKTEESDAWGNATSEQLLDIIARQGYTARHVVITGGEPCIYDLT
                     ELTSLLEKSGFSCQIETSGTHEVRCSVNTWVTVSPKVNMRGGYDILPQALKRADEVKH
                     PVARQRDIDALDALLETLTDSKARIIALQPISQKEEATRLCIATCIARNWRLSMQTHK
                     YLNIA"
     gene            complement(732812..733171)
                     /locus_tag="RAHAQ2_RS03300"
                     /old_locus_tag="Rahaq2_0685"
     CDS             complement(732812..733171)
                     /locus_tag="RAHAQ2_RS03300"
                     /old_locus_tag="Rahaq2_0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-carboxy-5,6,7,8-tetrahydropterin synthase"
                     /protein_id="WP_013574001.1"
                     /db_xref="GI:503339340"
                     /translation="MTTTLFKDFQFEAAHHLPHVPAGHKCGRLHGHSFTVRLEITGEV
                     DPHTGWVMDFAELKAAFNPTLDRLDHYNLNDIPGLENPTSEVLAAWIWNEMKPKLPLL
                     SAVRVKETCTAGCVYKG"
     gene            733341..734345
                     /locus_tag="RAHAQ2_RS03305"
                     /old_locus_tag="Rahaq2_0686"
     CDS             733341..734345
                     /locus_tag="RAHAQ2_RS03305"
                     /old_locus_tag="Rahaq2_0686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695892.1"
                     /db_xref="GI:505734209"
                     /translation="MITVLRCAVLALLFSAGVQAETTAPAQESAPAAAKPVQPVAKAS
                     PVAKTPASKAPLAFPPGSGVMHIALTPGKKPLEVFTYQPVGADETTPVVMVMTGVDRN
                     AATYRNDWITVADQYHLRVVVPHFSEQDFPGAAGYNLGNLTDSKTHHRLPKSQWAFSI
                     VDNLFTTLQKQGITRQTQYYLFGNSAGCQFVHRMLTLLPEPNVKAAVCAAAGWWTLPD
                     TDQRWPYGLREAPVAVSQQQLNDYFAKPVLIAVGAEDDDPENHLLRKSKQAMAQGTNR
                     LERAEGYFTTSQQRAEQNNTPFNWHFMDLSDTGHSGSKMSVFAAGQFAWFEQHNAFHL
                     "
     gene            734692..736494
                     /gene="cysJ"
                     /locus_tag="RAHAQ2_RS03310"
                     /old_locus_tag="Rahaq2_0687"
     CDS             734692..736494
                     /gene="cysJ"
                     /locus_tag="RAHAQ2_RS03310"
                     /old_locus_tag="Rahaq2_0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574003.1"
                     /note="catalyzes the reduction of sulfite to sulfide in
                     the biosynthesis of L-cysteine from sulfate; a
                     flavoprotein with flavin reductase activity; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase subunit alpha"
                     /protein_id="WP_015695893.1"
                     /db_xref="GI:505734210"
                     /translation="MTTQAPPISLLPLTPEQMARLQSAIGDYSPTQMAWLSGYFWGMV
                     NQQPGAVADPAPVQAAASVTLISASQTGNARRVAEQLRDDLIATKINVNLVNAGDYKF
                     KQIGQEKLLLIVASTQGEGEQAEEAVALHKFLQSKKAPNMKGTAFAVFALGDTSYEFF
                     CQAGKDFDTRLGELGAERLLDRVDADVEYKEAAENWRKRIVDVLKQRVPADTGAQPAP
                     TLAGSVNQVDSSPYTKEAPLTATLSVNQKITGRDSDKDVRHLEIELGDSGLRYQPGDA
                     LGIWFENDPQLVQEIVELLWLKGDEIVEVNDKKLPLSEALQHHIELTQNTTPIIEKYA
                     ALCRDEHLTGLLADKPALQQYAQTVPFADMVRRAPTELDAQQLVDLLRPLTPRLYSIA
                     SSQAETETEVHITVGVVRYDIDGRARSGGASGFLADRLDEDGEVKVFIEHNDNFRLPA
                     DPETPVIMIGPGTGIAPFRAFIQQRDNDGATGKNWLFFGNPHFTDDFLYQVEWQRYVK
                     DGLLTNISLAWSRDQAEKVYVQDKLREQGAEVWQWLQEGAHVYVCGDANRMAKDVEQA
                     LLEIIAKYGVMDLETADEYLSELRLDRRYQRDVY"
     gene            736522..738258
                     /locus_tag="RAHAQ2_RS03315"
                     /old_locus_tag="Rahaq2_0688"
     CDS             736522..738258
                     /locus_tag="RAHAQ2_RS03315"
                     /old_locus_tag="Rahaq2_0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695894.1"
                     /note="hemoprotein; NADPH dependent; with the alpha
                     subunit (a flavoprotein) catalyzes the reduction of
                     sulfite to sulfide; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase subunit beta"
                     /protein_id="WP_015695894.1"
                     /db_xref="GI:505734211"
                     /translation="MSNKLWSELNPGPGPLIVDAPLADAERLKKESNFLRGTIAEDLK
                     DGLTGGFNGDNFLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMMLRCRLPGGVMTPAQ
                     WLGIDKFAEDSTLYGSIRITNRQTFQFHGILKPNVKPVHQLLNKLGLDALATANDVNR
                     NVLCTSNPVESELHQEAYQWAKKISEHLLPRTRAYAEVWLDQEKVETTDEEPILGATY
                     LPRKFKTTVVIPPQNDVDLHANDLNFVAIADNGKLVGFNVLVGGGLSIAHGDKATYAR
                     TASELGFIPLENTLAVAEAVVTTQRDWGNRTNRKNAKTKYTLERVGVPVFKAEVEKRA
                     GIQFADIRPYAFTGRGDRIGWVKGIDKQWHLTLFIENGRILDYPGKPLKTGLAEIAKI
                     HKGDFRLTANQNLIVAGVSEKDKDAIETLARNHGLIDDGITEQRKNSMACVSYPTCPL
                     AMAEAERFLPEFVTKVEGIMHNHGVGDEHIVLRVTGCPNGCGRALLAEIGLVGKAINR
                     YNLHLGGNRAGTRIPRMYRENISDAEILSIIDELVGRWSKEREAGEGFGDFVIRAGII
                     RPVLDPARDFYD"
     gene            738283..739020
                     /locus_tag="RAHAQ2_RS03320"
                     /old_locus_tag="Rahaq2_0689"
     CDS             738283..739020
                     /locus_tag="RAHAQ2_RS03320"
                     /old_locus_tag="Rahaq2_0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695895.1"
                     /note="catalyzes the reduction of 3'-phosphoadenylyl
                     sulfate into sulfite; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="WP_015695895.1"
                     /db_xref="GI:505734212"
                     /translation="MSWLNLTLAELNELPKSGQSMALAEINVSLEKLSAQERVQWALE
                     NMPGEFALSSSFGIQAAVCLHLVTQQKPDIPVILTDTGYLFPETYQFIDTLTEKLNLN
                     LQVFRAEHSAAWQEARYGKLWEQGVEGIEKYNHINKVEPMNRAIQTLGVQTWFAGLRR
                     EQSGSRAHLPVLAVQRGVFKILPIIDWDNRQIFRYLQDNGLSYHPLWDQGYLSVGDTH
                     TTKKWEEGMKEEDTRFFGLKRECGLHE"
     gene            complement(739179..740216)
                     /locus_tag="RAHAQ2_RS03325"
                     /old_locus_tag="Rahaq2_0690"
     CDS             complement(739179..740216)
                     /locus_tag="RAHAQ2_RS03325"
                     /old_locus_tag="Rahaq2_0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695896.1"
                     /note="catalyzes the sequential removal of 2
                     amino-terminal arginines from alkaline phosphatase isozyme
                     1 to form isozymes 2 and 3; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase isozyme conversion
                     aminopeptidase"
                     /protein_id="WP_015695896.1"
                     /db_xref="GI:505734213"
                     /translation="MFSFSRMKRTLLALSLSCVCMGHAMAASAPLPPMGMIASQQIRH
                     IATYFPGRMAGSPAELIAADYLNQQFNKLGYKSDLRGFDTRYVYTSSAGKKNWQNIHA
                     TSVIAARAGEVPQQIIVMAHFDTYVPQSDSDTNHNLGGLTLQGVDDNASGVGVMLELA
                     ERMQAIPTHYSLRFVALSAEETGAKGAEEFVKRMSAEEKKNTLLVINLNSLITGDRLY
                     FNSGANTSVAVAKLTRVRALNLARSLGIPAESHEGAHCCDGIKALDDARLPLLNVTAT
                     NFALGKKDGVQQRAITSHFPLGTTRYQSQFDNLQYLDKTLPGRIEKRSRDTVKVLFPL
                     LKDLAKPAKHA"
     gene            740468..741892
                     /locus_tag="RAHAQ2_RS03330"
                     /old_locus_tag="Rahaq2_0691"
     CDS             740468..741892
                     /locus_tag="RAHAQ2_RS03330"
                     /old_locus_tag="Rahaq2_0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sirohydrochlorin ferrochelatase"
                     /protein_id="WP_015695897.1"
                     /db_xref="GI:505734214"
                     /translation="MDYLPIFADLKQRPVLVVGGGEVAARKIDLLLRAGAQVRIVAQA
                     LSPELEQRRQTAEVSWSAQAFLPEQLDDVFLVIAATDDAALNAEVFEQANRRHVLANV
                     VDDQPKCSFIFPSIVDRSPIVVAISSSGKAPVLARMLREKLETLLPNSLGQMADIAGR
                     WRDNVKTQFSSMRARRRFWEQLFAGRFASLASAGKLAEAEQALQQQLENAEDISHSGN
                     VTLVGAGPGDAGLLTLRGLQVMQQADVVLYDHLVSEDVLDLVRRDADKICVGKRAGSH
                     SVAQEETNRLLVELAQQGKKVVRLKGGDPFIFGRGGEELQAVQAAGIPFQVVPGVTAA
                     AGATAYAGIPLTHRDYAQSVIFVTGHCRPENNGVQWETLAKGQQTLAIYMGTLKAAEI
                     SQQLIAHGRAAHTPVAVIGRGTRSDQQVLTGTLDNLEHLAQQAPAPALLVIGEVVSLH
                     QQLAWFGHHPETDGTQRPSVVNLA"
     gene            741903..742811
                     /locus_tag="RAHAQ2_RS03335"
                     /old_locus_tag="Rahaq2_0692"
     CDS             741903..742811
                     /locus_tag="RAHAQ2_RS03335"
                     /old_locus_tag="Rahaq2_0692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004094410.1"
                     /note="with CysN catalyzes the formation of
                     adenylylsulfate from sulfate and ATP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit 2"
                     /protein_id="WP_015695898.1"
                     /db_xref="GI:505734215"
                     /translation="MDEKRLTHLRQLEAESIHIIREVAAEFANPVMMYSIGKDSSVML
                     HLARKAFFPGTLPFPLLHVDTGWKFREMYEFRDRTAKNYGFELLVHKNPEGVAMGINP
                     FVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDP
                     KNQRPELWHNYNGQINKGESIRVFPLSNWTELDIWQYIYLENIEIVPLYLAAPRPVLE
                     RDGMLLMVDDDRIDLQPGEVIEKKMVRFRTLGCWPLTGAVESGAQTLLEIIEEMLVST
                     TSERQGRAIDRDQAGSMELKKRQGYF"
     gene            742825..744252
                     /gene="cysN"
                     /locus_tag="RAHAQ2_RS03340"
                     /old_locus_tag="Rahaq2_0693"
     CDS             742825..744252
                     /gene="cysN"
                     /locus_tag="RAHAQ2_RS03340"
                     /old_locus_tag="Rahaq2_0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017490867.1"
                     /note="may be GTPase that regulates ATP sulfurylase
                     activity that is involved in converting ATP and sulfate to
                     diphosphate and adenylylsulfate; in Escherichia coli this
                     enzyme functions in cysteine biosynthesis in the first
                     step; forms a heterodimer with CysD; part of the
                     GTP-binding elongation factor family CysN/NodQ; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit 1"
                     /protein_id="WP_015695899.1"
                     /db_xref="GI:505734216"
                     /translation="MNNAIAQQIAEQGGVEAYLHAQQHKSLLRFLTCGSVDDGKSTLI
                     GRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYF
                     STEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFIATLLGI
                     RHLVVAVNKMDLVDYSETVYEQFKQDYLDFAQQLPTDLDIKFVPLSALEGDNVATPSG
                     KMSWYTGPTLLDVLETVNIINIREQQPMRFPVQYVNRPNLDFRGYAGTLASGSVRVGQ
                     KVKVLPSGVESTVARIVTFDGDLPEAWAGDAITLALADERDISRGDTLVDAEETVKPV
                     QNAKVDVVWMAEQPLSVGQSYDIKVGGKKARARVENIEYQVEINTLTQRVVENLPLNG
                     IGLVELAFDEPLVLDNYQSNAVTGGIIFIDRLTNVTVGAGLVREAIEQVYQESDKYSA
                     FELELNSLVRRHFPHWGARDLLGGK"
     gene            744254..744877
                     /locus_tag="RAHAQ2_RS03345"
                     /old_locus_tag="Rahaq2_0694"
     CDS             744254..744877
                     /locus_tag="RAHAQ2_RS03345"
                     /old_locus_tag="Rahaq2_0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574010.1"
                     /note="converts ATP and adenylyl sulfate to ADP and
                     3'-phosphoadenylyl sulfate; in Escherichia coli this
                     enzyme functions in cysteine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylylsulfate kinase"
                     /protein_id="WP_015695900.1"
                     /db_xref="GI:505734217"
                     /translation="MASPDGSLLKDDNVVWHPHAVTRADREKQHGHRGAVLWFTGLSG
                     SGKSTVAGALEQALHAQGVSTYLLDGDNVRHGLCRDLGFTDDDRRENIRRVGEVAKLM
                     VDAGQVVLTAFISPHRAEREMVRDLLGDGQFIEVFVDTPLAICEARDPKGLYKKARAG
                     ELKNFTGIDSEYQPPETPDVHLDGEQLVTQLVPQLLEVMRQRAIINP"
     gene            745006..745317
                     /locus_tag="RAHAQ2_RS03350"
                     /old_locus_tag="Rahaq2_0695"
     CDS             745006..745317
                     /locus_tag="RAHAQ2_RS03350"
                     /old_locus_tag="Rahaq2_0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_037040574.1"
                     /db_xref="GI:739176595"
                     /translation="MRVPIPATDSADTEEPSYSIQGGFIGFVFYWLAFAIPFLIYGSN
                     TLFFLLYTWPFFLALMPVSVLIGIAFSMFFGGGWFKSSAVSGICVVSMFWAVFSFLSG
                     W"
     gene            745485..745805
                     /gene="ftsB"
                     /locus_tag="RAHAQ2_RS03355"
                     /old_locus_tag="Rahaq2_0696"
     CDS             745485..745805
                     /gene="ftsB"
                     /locus_tag="RAHAQ2_RS03355"
                     /old_locus_tag="Rahaq2_0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574012.1"
                     /note="forms a complex with FtsL and FtsQ; colocalizes to
                     the septal region of the dividing cell; membrane protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsB"
                     /protein_id="WP_013574012.1"
                     /db_xref="GI:503339351"
                     /translation="MGKLTLLLLILLGWLQYSLWLGKNGIHDYVRVNDDVQVQQVNNG
                     KLKSRNDQLFAEIDDLNGGQEAIEERARNELGMIKPGETFYRLVPDNKRAPGSTVSQN
                     NLNQ"
     gene            745808..746527
                     /locus_tag="RAHAQ2_RS03360"
                     /old_locus_tag="Rahaq2_0697"
     CDS             745808..746527
                     /locus_tag="RAHAQ2_RS03360"
                     /old_locus_tag="Rahaq2_0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="WP_015695902.1"
                     /db_xref="GI:505734219"
                     /translation="MSHTAVSLPEVIAVLPAAGIGSRMQAECPKQYLSVGGKTLIEHS
                     IRALLQSGRVTQVIVALSPHDTQFAQLPIASDPRIRVVAGGAERAESVMAGLDVAGDS
                     GWVLVHDAARPCLHPDDLNNLLAISATSNVGGILAAPVRDTMKRGEPGLAAIAHTVER
                     QDLWHALTPQFFPLELLKTCLRRALDEGATVTDEASAMEYCGFHPMLIPARADNIKVT
                     RPEDLALAEFYLTRLSQEENA"
     gene            746527..747000
                     /gene="ispF"
                     /locus_tag="RAHAQ2_RS03365"
                     /old_locus_tag="Rahaq2_0698"
     CDS             746527..747000
                     /gene="ispF"
                     /locus_tag="RAHAQ2_RS03365"
                     /old_locus_tag="Rahaq2_0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004955219.1"
                     /note="catalyzes the conversion of
                     4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate
                     into 2-C-methyl-D-erythritol 2,4-cyclodiphosphate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="WP_015695903.1"
                     /db_xref="GI:505734220"
                     /translation="MRIGHGFDVHKFGGEGPLVIGGVRIPYPQGLLAHSDGDVALHAA
                     TDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAYRRIRAKGYKLGNLDITIIAQA
                     PKMAPHIPQMRVFLAEDLQCHMDDVNVKATTTEQLGFTGRGEGIACEAVALLIKE"
     gene            747023..748069
                     /gene="truD"
                     /locus_tag="RAHAQ2_RS03370"
                     /old_locus_tag="Rahaq2_0699"
                     /gene_synonym="ygbO"
     CDS             747023..748069
                     /gene="truD"
                     /locus_tag="RAHAQ2_RS03370"
                     /old_locus_tag="Rahaq2_0699"
                     /gene_synonym="ygbO"
                     /EC_number="5.4.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574015.1"
                     /note="catalyzes the modification of U13 in tRNA(Glu);
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase D"
                     /protein_id="WP_037040573.1"
                     /db_xref="GI:739176594"
                     /translation="MDMSRLTWLLGKPVATGQLKANPEDFIVEEDLGFEPDGEGEHLL
                     VRIRKNGCNTQFVAEQLARFAKVHPRDVSYAGLKDRHAVTEQWFCLHLPGKTDPDLSQ
                     FDLEGCEVVRASRHRKKMRIGTLKGNAFTLVLRQLSDIADVEARLEKIARQGVPNYFG
                     TQRFGRGGNNLVQAKRWATNEARPKERAKRSFYLSASRSAMFNIVASQRLAEGAVRQP
                     MLGDALQLSGRGSWFVAKGEEFESLLPRVESGELLVTAPLPGDGPLGTLEDAEAYEQA
                     CLHGQGDLLSLLKRERVEPARRAIMLQPLQMQWQRWDDVTLELKFWLPAGSYATSVVR
                     ELMNLDESDADITE"
     gene            748050..748814
                     /gene="surE"
                     /locus_tag="RAHAQ2_RS03375"
                     /old_locus_tag="Rahaq2_0700"
     CDS             748050..748814
                     /gene="surE"
                     /locus_tag="RAHAQ2_RS03375"
                     /old_locus_tag="Rahaq2_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574016.1"
                     /note="broad specificity 5'(3')-nucleotidase and
                     polyphosphatase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stationary phase survival protein SurE"
                     /protein_id="WP_015695905.1"
                     /db_xref="GI:505734222"
                     /translation="MRILLSNDDGVLAPGIQALASALREFADVKLVAPDRNRSGASNA
                     LTLDGPLRIQSYPNGDTAVINGTPTDCVYLGVNTLMRPKPDIVVSGINAGPNLGDDVI
                     YSGTVAAAMEGRHLGFPALAVSLDGYQHYDTAAIITCRILRALAREPLRTGKILNVNV
                     PDLPLSRILGIKVTRCGSRHPAEQVFCQQDPRGQDLYWIGPPGDKFDVAPDTDFAAVA
                     QGYVSVTPLQVDLTAYAAQDVVVSWLEKAGVSANGE"
     gene            748804..749430
                     /gene="pcm"
                     /locus_tag="RAHAQ2_RS03380"
                     /old_locus_tag="Rahaq2_0701"
     CDS             748804..749430
                     /gene="pcm"
                     /locus_tag="RAHAQ2_RS03380"
                     /old_locus_tag="Rahaq2_0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695906.1"
                     /note="catalyzes the methyl esterification of
                     L-isoaspartyl residues that are formed in damaged
                     proteins; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="WP_015695906.1"
                     /db_xref="GI:505734223"
                     /translation="MVNKPMYNLLEQLRQQGIHDEKLLHAIEAVPRERFVDEAFQHKA
                     YENTALPIGSGQTISQPYTVARMTELLRLEPSSRVLEIGTGSGYQTAILAHLVEHVFS
                     VERIKGLQWQAKRRLKQLDLHNVSTRHGDGWQGWPSRGPFDAIIVTAAPPEIPQDLLQ
                     QLDDGGVLILPVGEENQTLQRVTRRGDEFIAETIEAVRFVPLVKGELA"
     gene            749691..750692
                     /locus_tag="RAHAQ2_RS03385"
                     /old_locus_tag="Rahaq2_0702"
     CDS             749691..750692
                     /locus_tag="RAHAQ2_RS03385"
                     /old_locus_tag="Rahaq2_0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_037040570.1"
                     /db_xref="GI:739176591"
                     /translation="MKTLSRIAMCTFISAWMAGCTNNSTTSAPISSVNGGGGSGNSSQ
                     NTPNSASPMAPAVGPGGHIVYNRSYNSIPKGSYSGSTYQVKRGDTLFYIAWITGNDFR
                     DLAARNNIPAPYSLEVGQTIQINNVSSAASTGGAIAVTDATNGGVPKAPTGGMLTGSV
                     VASQPTTTYSDSSGKQNVGKMLPSSGAVTTTTPVAVASTPVATSANNGGPVSSWKWPT
                     DGKIIDNFSASEGGNKGIDIAGSRGQSVVATASGRVVYAGNALRGYGNLIIIKHNDDY
                     LSAYAHNDTMLVREQQEVQAGQKIATMGSTGTSSVRLHFEIRYKGKSVNPLRYLPQR"
     gene            750744..751730
                     /locus_tag="RAHAQ2_RS03390"
                     /old_locus_tag="Rahaq2_0703"
     CDS             750744..751730
                     /locus_tag="RAHAQ2_RS03390"
                     /old_locus_tag="Rahaq2_0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574019.1"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; this sigma factor controls a
                     regulon of genes required for protection against external
                     stresses; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoS"
                     /protein_id="WP_013574019.1"
                     /db_xref="GI:503339358"
                     /translation="MSQNTLKVNELHDDVDFDENSAEAFDEKAIVEETADNDAEEELL
                     SQTVSQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVPSRRRMIESNLRLVVK
                     IARRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQT
                     RTIRLPIHIVKELNVYLRTARELAHKLDHEPSAEEIAEQLDKPVHDVSRMLRLNERIT
                     SVDTPLGGDSEKALLDILADEKDNGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRF
                     GLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQGQGLSIEALFRE"
     gene            complement(751829..754384)
                     /locus_tag="RAHAQ2_RS03395"
                     /old_locus_tag="Rahaq2_0704"
     CDS             complement(751829..754384)
                     /locus_tag="RAHAQ2_RS03395"
                     /old_locus_tag="Rahaq2_0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695908.1"
                     /note="This protein performs the mismatch recognition step
                     during the DNA repair process; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_015695908.1"
                     /db_xref="GI:505734225"
                     /translation="MTNNVNLDAHTPMMQQYLRLKAENPEVLLFYRMGDFYELFYDDA
                     KRASQLMDISLTKRGASAGEPIPMAGVPYHAVEGYLAKLVQLGESVAIAEQIGDPALS
                     KGPVERKVVRIVTPGTVSDEALLSERHDNLLAAIWQDGRGFGYATLDISSGRFRVAQP
                     DDLETMAAELQRTNPAELLYPESFEAMPLIASRRGLRRRPMWEFELETAKQQLNLQFG
                     TRDLSGFGVEQATQALRAAGCLLQYVKDTQRTALPHIRGVTMERQQDGIIMDAATRRN
                     LELTQNLAGGIENTLAAVLDQAVTPMGSRMLKRWIHMPSRDIKLLTHRQQAIGALQDI
                     TADLQPVLRQVGDLERILARLALRSARPRDLARMRHAMQQLPEIREILQGTDAAHVKT
                     LVEQTGEFTELVELLERAVIESPPVLVRDGGVIAPGYNAELDEWRALADGATDYLDRL
                     EIREREKLGLDTLKVGFNGVHGYYIQVSRGQSHLVPIHYVRRQTLKNAERYIIPELKE
                     YEDKVLTSKGKALSLEKALYEELFDLLMPHLSALQQSASALAELDVLSNLAERAYTLN
                     YACPTMSEKPGINITGGRHPVVEQVLSEPFISNPLNMSPARRMLIITGPNMGGKSTYM
                     RQAALIVLMAHIGSYVPAEAAVIGPVDRIFTRVGAADDLASGRSTFMVEMTETANILH
                     NATENSLVLMDEIGRGTSTYDGLSLAWACAENLASRIKAMTLFATHYFELTTLPEKME
                     GTVNVHLDAIEHGDTIAFMHSVQDGAASKSYGLAVAALAGVPRDVIKRARQKLKELET
                     LSNNAAASKVDGPQLALLTEEVSPAVEALESLDADSLSPRQALEWIYRLKDMV"
     gene            754915..755529
                     /locus_tag="RAHAQ2_RS03400"
                     /old_locus_tag="Rahaq2_0705"
     CDS             754915..755529
                     /locus_tag="RAHAQ2_RS03400"
                     /old_locus_tag="Rahaq2_0705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013360197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695909.1"
                     /db_xref="GI:505734226"
                     /translation="MSAKRNVLKASVIALTLVSAFANAADDGIVSDDGGVTLLGHVYT
                     GTCVVTTNGQDSKDTVRPEVTMPSILIADVKDAAIGDLLGDNFSKFNVEVSGCADDVV
                     PKAIAFNQGVFGVDSAGVDSYKNDFIGQGSTPVATGVNAAIVLPSAPTAAVTFGQELP
                     LVKTSAGDTDFTGNVEVGAQFVKTAATIGSGAFTSVATFDIVYN"
     gene            755587..756315
                     /locus_tag="RAHAQ2_RS03405"
                     /old_locus_tag="Rahaq2_0706"
     CDS             755587..756315
                     /locus_tag="RAHAQ2_RS03405"
                     /old_locus_tag="Rahaq2_0706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, chaperone PapD"
                     /protein_id="WP_015695910.1"
                     /db_xref="GI:505734227"
                     /translation="MKQNLIKCTLAVLLAAGFCQSANADLVLSGTRVIFPAEKKDVTV
                     QLTNKGTHPLLAQSWIDAGDPSARPESVDVPFYLTPPVSRIDPEKGQTLRIVYNQPKL
                     PKDRESVFWLNVLEIPAKAKKGESSEVDNTLQLAFRTRVKIFYRPTGLKSQPNLAAKD
                     VIWSKVGTNKIKANNPTPYYISYSAVNLSSGAKKVELGDAMLAPFSTTELQSKQNINE
                     NSWAINYAFINDYGGSENGNAALK"
     gene            <756505..758967
                     /locus_tag="RAHAQ2_RS03410"
                     /old_locus_tag="Rahaq2_0707"
     CDS             <756505..758967
                     /locus_tag="RAHAQ2_RS03410"
                     /old_locus_tag="Rahaq2_0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010426889.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041682454.1"
                     /db_xref="GI:754018951"
                     /translation="SEGVEFNEGFLSGYGIDISKFNEGNPVIPGHYIVRFITNDVDKG
                     DKAVDFIDTNKDGVGDACLTPVLLKQAGIKDAGWDKDTDQEETDEKRCVDLKKYIPTA
                     RWNLDVNTQTFRLDVPQVNTFVSEDGTVDPELWQNGINAVLLDYNFNAYSTKNDAETS
                     RTVSGNYNGGINLGAWRFRTNAYSNWSEESGSTFDTGDYYLERDIAFLRGQVRLGNAY
                     SDGQLFDSFNVNGFTLKSDDRMLPFSQQGFFPVIRGVAESNAKVKVKQNDYVIYETTV
                     PPGAFEFSNIRSGNVGTDIQVEVTEADGRVKTFVVPYSTSSQMLRPGVFRYNFTVGEY
                     DAGSTYSDKPLVAQGTWQQGLSNTITAYGGLQGTESYWAAVVGGTLNTSIGAFSFDVT
                     NSNTQIPTDKTYNGQSYELSYDQFIDATKTNFQLAAYRYSTSGYFSLSDAMDYIYDDN
                     IDDLSQLSRSRNKFQLNISQALPQGYGSLYLNGSIEDYWDAEKGKNTQYQMGYSNNWS
                     KVSYSISASKYYDGTEGRSDTQLYVNLSIPLDWSDGKSTTPPVFDSLNVGYGTNNKHE
                     TSTNIGANGYRPENEFSYGVNAYYNTTRDGGQDISSVSGNSSINTRFSRLGGTATRSN
                     DGNQQVSMSVNGGLVGHSGGITFAPDVSLNGPMALIEAKGASGSKVQNGSAKVDGNGY
                     ALATNLSPYIENKVALDISSMEGDAEMKGTMSNVIPHDGSIVRVKFDTDERRFVMFVA
                     KRQKDFIPLGADVYNEAGEHIGNAAQGGKLLTRGASDKGELTVRWGEDAASSCRVSYQ
                     LPPELKETKPGETATVEGLLCQ"
     gene            758958..759530
                     /locus_tag="RAHAQ2_RS03415"
                     /old_locus_tag="Rahaq2_0708"
     CDS             758958..759530
                     /locus_tag="RAHAQ2_RS03415"
                     /old_locus_tag="Rahaq2_0708"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695912.1"
                     /db_xref="GI:505734229"
                     /translation="MSVISASILKKMTHTLGGLMLMSAFPGHAASLNMEFKARLVAET
                     CTFAATSKTFAFGNVYPQEILQETKFVTQDIAVSSCTGSPQNMQFYLTPITGTSNSAT
                     TRNLLVPPGKSYGIETTLSILNGSNQQQGNIIYLPFEPTSAVSITNQSMVGKKIRLTA
                     GLVPVPGKTSGADFEVGAFSAVATLNIVYF"
     gene            759559..760119
                     /locus_tag="RAHAQ2_RS03420"
                     /old_locus_tag="Rahaq2_0709"
     CDS             759559..760119
                     /locus_tag="RAHAQ2_RS03420"
                     /old_locus_tag="Rahaq2_0709"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040553.1"
                     /db_xref="GI:739176574"
                     /translation="MLIFTLLTAVLSSAKLMADDAGNQLQMTFGGRVNISTCRVIIPE
                     KIVVMPSALIADFSPLKTGDLFAEREFSVSVADCNGGEGNINQVVLYFEPKTATYDDK
                     FPAFKNDAGDAVQPRATGIGAVITDERDDRNVTGNDQKPVAMTYDTEINPLGSEYKFI
                     ARYIKTSTTVTSGYFSSDVIITATYQ"
     gene            760145..760756
                     /locus_tag="RAHAQ2_RS03425"
                     /old_locus_tag="Rahaq2_0710"
     CDS             760145..760756
                     /locus_tag="RAHAQ2_RS03425"
                     /old_locus_tag="Rahaq2_0710"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695914.1"
                     /db_xref="GI:505734231"
                     /translation="MKIKHHFYFLPLVIAGVVPLSVQAASTGLNLTVNATIQPGTCYF
                     NTSALTFDFGTVYPANIASSDPTLRPASDDKTITSVAQTSGDNSTRHLACDPSAAVMK
                     FNIDAQGHSALGADNKDIITLFADPGQTGAAAAGFGITVYKVDTVNSSQSETPIMLGQ
                     DTDMGTPGNFILRARLVPLNGNLGKDITGGYIHAQATLDISYQ"
     gene            760772..761491
                     /locus_tag="RAHAQ2_RS03430"
                     /old_locus_tag="Rahaq2_0711"
     CDS             760772..761491
                     /locus_tag="RAHAQ2_RS03430"
                     /old_locus_tag="Rahaq2_0711"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695915.1"
                     /db_xref="GI:505734232"
                     /translation="MKIKLLTLSLVLFVHAACAGDGIKTIDLNFTGTVIQPSCMITFQ
                     NGGSTQNVNFGAVNVSDIRYFKNNEVDNMYTYSKTIDSPLFGIKIRGCLPGNISTDSS
                     GKQFTLSIAAGAGSQWISSSADNQNYMGGGLSPTSGATDYAAKVLVPATFPAQVSPTS
                     WKTLTASGINGRNYPDEGNMGVISDMPIAFSDLITSGTGSDQSWELPMKVALGMAGAG
                     SGSGENAGAFSVSAILTVSYF"
     gene            761591..762748
                     /locus_tag="RAHAQ2_RS03435"
                     /old_locus_tag="Rahaq2_0712"
     CDS             761591..762748
                     /locus_tag="RAHAQ2_RS03435"
                     /old_locus_tag="Rahaq2_0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015698480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, pilin FimA"
                     /protein_id="WP_015695916.1"
                     /db_xref="GI:505734233"
                     /translation="MKFLSLLLFLFIVDIPLCHAYLITTTGATSDTKCEFVNVVKAQQ
                     VSIRNIRIDASQIVNLASGQYYELPQTLSMHPGNETIAFVVNCDEWGKRLEKTKQTTK
                     ISSSNTYATIKESSIIGASQIPGELNGDVSLFTTNIPGLFYYYEFSSGFSYRLPSAVE
                     GTDTLSIKEDLRSDVFAVLVVNNEFRGVPEGASISSTAGQTSFDWYDANVTGGAVLTN
                     RVTLNTIPPGEIKIIASCNYSLSNNGIVDFGDQNLSKVTNNRTTTVKKPLTLYMRNCY
                     GVNKVKTYITNATTTLENGLLLGNTQTSNAATNVAIGINVAASSAKNSENNGSPMYMD
                     GSNPLEWELGNDHSLDAISKEIPLDVFLLKSGGEPTSGDFKATATIMMDFI"
     gene            763048..765708
                     /locus_tag="RAHAQ2_RS03440"
                     /old_locus_tag="Rahaq2_0713"
     CDS             763048..765708
                     /locus_tag="RAHAQ2_RS03440"
                     /old_locus_tag="Rahaq2_0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695917.1"
                     /db_xref="GI:505734234"
                     /translation="MQLQFKLNMINDAWYPTLDLNEMKSTSGGTVDIKEKLVIVFSAP
                     GKITVGDINVETNPWKPLGTKVESTDVGGGVFDIKVTIEPTDGQPVGDAIQKIHMGLN
                     VSSADSPAWSDFRETFALAADEEPGMTGELSVSCPPLPAGLTNAALELRLARGDKTLR
                     VLPGFGHVSTFAVNAGNYTVFATDLSTDDGTVRVPVNIGQAEITIDKGRTTSLAITFG
                     AVDRSTTIDVALNFSGLAGLRDEELTLICSENGTDKLSLPVRSGQQHRLEHLPVSGRF
                     EIRLADVRLNNIHYLFDDYDGQFDGQYHSINYTQAQVSQRGDSQSNAAKLTVNVKAET
                     AVSKSLTLRLTDNAVPPRQYRFDAIAAQNGSIEQPVLVAPGSYTVVSGTFIHNGVVHY
                     VDVSPQPLLISANAPAQLNVAIVKGANLHVKGFPEFLTFGACANMVPTNVDDFAAARV
                     SSIFKYSGDDGMGDAGDYLSPSKEPTLQIIKMARDVSAKLNETVLPVMVSYTCNLSLG
                     DVPNIIADPVRHKFSFANFIQSLQMAQSQQDAEHPVPAGYIVNPDYLGECQKYGFLPT
                     YEIPVRQPLSEALAHHNVNVQVPAGITNTLKGYIRAVNWLTRVVAPDVVLGWQVNLWG
                     VAGSQWIYKDFSYDDVFDAADGQHKKMTVDPFTAGRLTAQYALLVGVFDDIEYIRADG
                     APDVAKGADFMAADRYEADDFTIRSYANGYCYSPYEWERTFDFCASLSRHLRQPVLPW
                     QVPASHLPTSADEVNADFNTQNWGSGGSYLMGHSEIGTSVDAIHERLLALKFDAAYAS
                     MMGHDTRELFSRHSWDLSTPKYLDFPSRGIFHVHLGGGATTGVISGVGDASSWMRNKL
                     KAYRDNPVKFEESTTLKSGSQWRSKSPVTK"
     gene            765862..766965
                     /locus_tag="RAHAQ2_RS03445"
                     /old_locus_tag="Rahaq2_0714"
     CDS             765862..766965
                     /locus_tag="RAHAQ2_RS03445"
                     /old_locus_tag="Rahaq2_0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574022.1"
                     /note="membrane-bound lytic murein transglycosylase B;
                     catalyzes the cleavage of the glycosidic bonds between
                     N-acetylmuramic acid and N-acetylglucosamine in
                     peptidoglycan; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein hydrolase B"
                     /protein_id="WP_015695918.1"
                     /db_xref="GI:505734235"
                     /translation="MRHLAVILPLVLILSACSSHKPAPQPEGPRNPFSDGRNASVNTV
                     PAGGFLLQPEHTGAVQTGDFAYDPAMNQFVDKMVREHGFDRQQLHDVLSQTKRLAFVL
                     RLMDQQAPSGPPSTVPNGAWNRYRSKFITPDNVQNGVVFWNQYQDALQRAEQVYGVPP
                     EIIVGIIGVETRWGRVMGKTRIIDALATLSFAYPRRAEYFSGELETFLLMSRREGDDP
                     LSLRGSFAGAMGYGQFMPSSYKDYAVDFNGDGHANLWDPIDAIGSVANYFKAHGWAKG
                     APIAVPAAGQAPLLENGFKTQYPLYTLKAAGLSPLGSLGNYQEASLLRLDMGTHYQYW
                     YGLPNFYTITRYNHSVHYAMAVWQLGEAVKAAR"
     gene            767126..767620
                     /locus_tag="RAHAQ2_RS03450"
                     /old_locus_tag="Rahaq2_0715"
     CDS             767126..767620
                     /locus_tag="RAHAQ2_RS03450"
                     /old_locus_tag="Rahaq2_0715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695919.1"
                     /db_xref="GI:505734236"
                     /translation="MDEKRLHELSVEIGAALKAQGRWITCAESCTGGLIAKSITDIAG
                     SSAWFDRGFVTYSNAAKHELLGVSESTLEQYGAVSEQVVHEMALGVLHAAGADVAVSV
                     SGIAGPDGGSEEKPVGTVWFGFAGKDGRVLTAKQQFSGDREAVRLQAAVFSLQTAWDE
                     FLKN"
     gene            767728..768792
                     /gene="recA"
                     /locus_tag="RAHAQ2_RS03455"
                     /old_locus_tag="Rahaq2_0716"
     CDS             767728..768792
                     /gene="recA"
                     /locus_tag="RAHAQ2_RS03455"
                     /old_locus_tag="Rahaq2_0716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005273986.1"
                     /note="catalyzes the hydrolysis of ATP in the presence of
                     single-stranded DNA, the ATP-dependent uptake of
                     single-stranded DNA by duplex DNA, and the ATP-dependent
                     hybridization of homologous single-stranded DNAs; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_015695920.1"
                     /db_xref="GI:505734237"
                     /translation="MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTG
                     SLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
                     IYAKKLGVDIDNLLCSQPDTGEQALEICDALTRSGAVDVIIVDSVAALTPKAEIEGEI
                     GDSHMGLAARMMSQAMRKLAGNLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKF
                     YASVRLDIRRIGAIKEGDVVVGSETRVKVVKNKIAAPFKQAEFQILYGEGININGELI
                     DLGVKHKLIEKAGAWYSYNGEKIGQGKANSCNYLKENPKVAAELDKKLRDMLLSGTGE
                     LSVATTADDADDNMETSEEF"
     gene            769039..769605
                     /locus_tag="RAHAQ2_RS03460"
                     /old_locus_tag="Rahaq2_0717"
     CDS             769039..769605
                     /locus_tag="RAHAQ2_RS03460"
                     /old_locus_tag="Rahaq2_0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RecX family transcriptional regulator"
                     /protein_id="WP_037040568.1"
                     /db_xref="GI:739176589"
                     /translation="MNTLINRAMRLLSQRDHGETELRRKLLIPPMPFVKPQNKKNSWS
                     SRKKPAQNIFADEEVVRAKPEPLPVPEEIAEEHVQAVIDYCYQHHWLDDAKFASRYIS
                     GRSNKGYGAQRIRSELLQKGVDKETITMALENTDVDWCVLARDLAVRKFGENLPTDWK
                     EKSKVLRYLLYRGFFQEEIQSIYRDFDD"
     gene            769744..772371
                     /locus_tag="RAHAQ2_RS03465"
                     /old_locus_tag="Rahaq2_0718"
     CDS             769744..772371
                     /locus_tag="RAHAQ2_RS03465"
                     /old_locus_tag="Rahaq2_0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="WP_015695922.1"
                     /db_xref="GI:505734239"
                     /translation="MSKSTAEIRQAFLDFFHSKGHNVVSSSSLVPTNDPTLLFTNAGM
                     NQFKDVFLGLDKRDYNRATTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDY
                     FKHDAINYAWELLTGENWFNLPKEKLWVTVYETDDEAFEIWEKEVGVPKERIIRIGDN
                     KGGAYASDNFWQMGDTGPCGPCTEIFYDHGDHIWGGPPGSAEEDGDRYIEIWNLVFMQ
                     FNRQADGTMLPLPKPSVDTGMGLERITAVMQHVNSNYDIDLFQKLIAAVADVTGATDL
                     SNKSLRVIADHIRSCAFLIADGVIPSNENRGYVLRRIIRRAIRHGNMLGAKDTFFYKL
                     VAPLIEVMGPAATELKEQQAMVEQLLKTEEEQFARTLERGLALLDEELSALKGDTLDG
                     EIAFRLYDTFGFPLDLTADVCRERNLKVDEVGFEKAMDVQRRRARESSGFSADYNSMV
                     RVDGVTQFSGYEHLQRHSNVVALFVEGQPVNEIEAGVNAIVVLDDTPFYGESGGQVGD
                     KGILKTAAGVFSVSDTQKYGKAIGHQGALNAGKLSIGDSVEAEVDVARRDRIRLNHSA
                     THLLHAALRQVLGKHVAQKGSLVNDSYLRFDFSHFEAMKPEEIRQVEDLVNAQIRRNL
                     PIQTTIMDLDEAKEKGAMALFGEKYEDSVRVLSMGDFSTELCGGTHASRTGDIGLFRI
                     QSESGTAAGVRRIEGITGENAINALHQQSDLLQDVAHLVKGDVNSITDKIRSLIERSR
                     VLEKELQQVKGQQAAQESASLSSQTKEVKGVKLLVRQLDNVEPKILRTMVDDLKNQLG
                     SVIIVLATIADDKVSLIAGVTKDLTDRVKAGELIASVAQQVGGKGGGRPDMAQAGGSD
                     VQALPAALATVEAWVEAKL"
     gene            772628..772813
                     /locus_tag="RAHAQ2_RS03470"
                     /old_locus_tag="Rahaq2_0719"
     CDS             772628..772813
                     /locus_tag="RAHAQ2_RS03470"
                     /old_locus_tag="Rahaq2_0719"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2VHD3.1"
                     /note="affects carbohydrate metabolism; has regulatory
                     role in many processes; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator"
                     /protein_id="WP_013574027.1"
                     /db_xref="GI:503339366"
                     /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHR
                     EEIYQRIQAEKSQQTSY"
     gene            773138..773230
                     /locus_tag="RAHAQ2_RS03475"
                     /old_locus_tag="Rahaq2_0720"
     tRNA            773138..773230
                     /locus_tag="RAHAQ2_RS03475"
                     /old_locus_tag="Rahaq2_0720"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:773172..773174,aa:Ser,seq:gct)
     gene            773239..773315
                     /locus_tag="RAHAQ2_RS03480"
                     /old_locus_tag="Rahaq2_0721"
     tRNA            773239..773315
                     /locus_tag="RAHAQ2_RS03480"
                     /old_locus_tag="Rahaq2_0721"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:773273..773275,aa:Arg,seq:acg)
     gene            773426..773502
                     /locus_tag="RAHAQ2_RS03485"
                     /old_locus_tag="Rahaq2_0722"
     tRNA            773426..773502
                     /locus_tag="RAHAQ2_RS03485"
                     /old_locus_tag="Rahaq2_0722"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:773460..773462,aa:Arg,seq:acg)
     gene            773683..773759
                     /locus_tag="RAHAQ2_RS03490"
                     /old_locus_tag="Rahaq2_0724"
     tRNA            773683..773759
                     /locus_tag="RAHAQ2_RS03490"
                     /old_locus_tag="Rahaq2_0724"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:773717..773719,aa:Arg,seq:acg)
     gene            774080..774646
                     /locus_tag="RAHAQ2_RS03495"
                     /old_locus_tag="Rahaq2_0726"
     CDS             774080..774646
                     /locus_tag="RAHAQ2_RS03495"
                     /old_locus_tag="Rahaq2_0726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695923.1"
                     /note="YqaB; catalyzes the dephosphorylation of fructose
                     1-phosphate, 6-phosphogluconate and p-nitrophenyl
                     phosphate (pNPP); presents beta-phosphoglucomutase
                     activity at a lower extent; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1-P/6-phosphogluconate phosphatase"
                     /protein_id="WP_015695923.1"
                     /db_xref="GI:505734240"
                     /translation="MYDRYEGLIFDMDGTILDTEPTHRKAWHQVLTKYSMQYDVDSMV
                     ALNGSPTWRIARFVIDSNKVEMDPHLLAAEKTAAVQEMLLDTVRPLPLIDVVKSYHGR
                     RPMAVGTGSEHWMADALLRHLGLRDYFDAIVGANDVKNHKPAPDTFLRCAELIGVPPE
                     KCVVFEDADFGIEAAKRANMDFVDVRKL"
     gene            774643..775071
                     /locus_tag="RAHAQ2_RS03500"
                     /old_locus_tag="Rahaq2_0727"
     CDS             774643..775071
                     /locus_tag="RAHAQ2_RS03500"
                     /old_locus_tag="Rahaq2_0727"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_015695924.1"
                     /db_xref="GI:505734241"
                     /translation="MSRALALASLFGSSFLSATLLPGNSEVLLVALLSAGSAMPAALV
                     LSASVGNTLGGITNVIIGRFLPQLKPQRGLNVAQGWLKRFGPAALLLSWLPVVGDVLC
                     VLAGWLRMPWGPVVFFMFIGKAVRYILLTFVTLEGLSWFG"
     gene            775157..776728
                     /locus_tag="RAHAQ2_RS03505"
                     /old_locus_tag="Rahaq2_0728"
     CDS             775157..776728
                     /locus_tag="RAHAQ2_RS03505"
                     /old_locus_tag="Rahaq2_0728"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695925.1"
                     /note="involved in the first step of glutathione
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_015695925.1"
                     /db_xref="GI:505734242"
                     /translation="MIPDVSQALSWLEAHPQALKGIRRGIERETLRVNPDGSLATTGH
                     PESLGAALTHRWITTDFAEALLEFITPVDDNIEHLMAFLRDIHRHVARELGDERMWPF
                     SMPCFIESGQDIELAQYGSSNVGRLKTLYREGLKNRYGALMQVISGIHYNFSLPMTFW
                     QERLGVTDTQSGKEAISAGYFKLIRNYYRFGWVIPYLFGASPAICSSFLKGRETDLPF
                     EYTEGGLCYLPYATSLRLSDLGYTNKSQSNLGITFNDLSTYVQGVKKAIRTPSAEYAE
                     MGVKKDGKYLQLNTNVLQIENELYAPIRPKRVTKSGETPSDALMRSGIEYIEVRSLDV
                     NPFSPVGIDATQARFLDLFLVWCALADAPEMNSDELLCTRKNWNRVILEGRKPGQTIG
                     IGCDDQRQPLASVGNALFADLNRVAQVMDNQNGDHLYQDVCKELVAAFDDPELTYSAR
                     ILKDLKQQGVGNLGLELAEKYRQMLVSEPLEVLDESALMAEQDGSWQRQRTLETSDKL
                     SFEEYLAANAGSSNE"
     gene            776886..777401
                     /locus_tag="RAHAQ2_RS03510"
                     /old_locus_tag="Rahaq2_0730"
     CDS             776886..777401
                     /locus_tag="RAHAQ2_RS03510"
                     /old_locus_tag="Rahaq2_0730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010286009.1"
                     /note="catalyzes the hydrolysis of S-ribosylhomocysteine
                     to homocysteine and autoinducer-2; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteinase"
                     /protein_id="WP_015695926.1"
                     /db_xref="GI:505734243"
                     /translation="MPLLDSFTVDHTRMAAPAVRVAKTMKTPHGDTITVFDLRFCRPN
                     IEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGVPEEQRVAD
                     AWKAAMADVLKVKEQRQIPELNEYQCGTYEMHSLKEAQEIAQHILDHEVVVNRNDDLA
                     LPKEKLSELHI"
     gene            complement(777471..778760)
                     /locus_tag="RAHAQ2_RS03515"
                     /old_locus_tag="Rahaq2_0731"
     CDS             complement(777471..778760)
                     /locus_tag="RAHAQ2_RS03515"
                     /old_locus_tag="Rahaq2_0731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_015695927.1"
                     /db_xref="GI:505734244"
                     /translation="MEHVSTTTLIITLIIMVVVSAYFSASETGMMTLNRYRLRHLAKQ
                     GNRAARRVEKLLKRPDQLISLVLIGNNLVNILASALATIVGIRLYGDAGVAIATGVLT
                     FVVLLFAEVLPKTFAALNPERIAFPSSILLRPLQTIMMPLVWILNSLSRLLMRMFGIK
                     TTTSLSDAVSKEELRSIVNESRSNISRRNQDMLLSVLDLEKVSVDDIMVPRNEIVGID
                     INDDWKSIIRQLTHSPHGRIVLYRDSLDDAIGMLRLREAYRLMTEKKEFTKENLLRAA
                     DEIYYIPEGTPLNIQLVKFQRNKKKVGIVVDEYGDIQGLVTVEDILEEIVGDFTTSMS
                     PTLAEEVTPQSDGSVLIEGSANVRELNKAFNWHLPAEEARTINGMLLEVLEEIPTIGT
                     NLRIEDYEVEILDVQDNMIKQVQVRPLQPLQSSVNQH"
     gene            complement(778777..779568)
                     /locus_tag="RAHAQ2_RS03520"
                     /old_locus_tag="Rahaq2_0732"
     CDS             complement(778777..779568)
                     /locus_tag="RAHAQ2_RS03520"
                     /old_locus_tag="Rahaq2_0732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015689394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013574033.1"
                     /db_xref="GI:503339372"
                     /translation="MSVFALVAMLAYLLSLALIIPSIIRKNSAYRRLALISVVVALVC
                     HAVALQQRIFDVSTGQNLSLVNIGSVVSLIIGTVMTIVASRNRGWFVLPIVYSFSLIN
                     LAFVTFLPGEFITHLEESKGLLVHIGLALFSYATLMIAALYALQLAWLDYQLKNKRLT
                     FTADMPPLMSIERKLFHITQIGVILLTLTLCTGLLYLNNLFSPENIDKAVLSILAWFV
                     YIVLLWGHYHEGWRGRRVVWFSMAGAILLTLAYFGSRLIQQIMVH"
     gene            779733..781094
                     /locus_tag="RAHAQ2_RS03525"
                     /old_locus_tag="Rahaq2_0733"
     CDS             779733..781094
                     /locus_tag="RAHAQ2_RS03525"
                     /old_locus_tag="Rahaq2_0733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="WP_015695928.1"
                     /db_xref="GI:505734245"
                     /translation="MFENLSDRLSRTLRNISGRGRLTEENIKETLREVRMALLEADVA
                     LPVVRDFINRVKESAVGVEVNKSLTPGQEFVKIVQKELETAMGEANTELNLAAQPPAV
                     VLMAGLQGAGKTTSVGKLAKFLKEKKKKKVLVVSADVYRPAAIKQLETLAQQVEVDFF
                     PSDAQEKPVDIVNRALQQAKLKFYDVLIVDTAGRLHVDEAMMDEIKQVHAAINPVETL
                     FVVDAMTGQDAANTAKAFNEALPLTGVILTKVDGDARGGAALSIRHITGKPIKFLGMG
                     EKTDALEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDGFDLTDF
                     LEQLKQMRNMGGMASMMSKLPGVGQLPDNVKSQMDDKVLVRMEAIINSMTLKERAKPE
                     IIKGSRKRRIAMGSGMQVQDVNRLLKQFDDMQRMMKKMKNGGMAKMMRGMKGMMPPGF
                     PGR"
     gene            781273..781521
                     /gene="rpsP"
                     /locus_tag="RAHAQ2_RS03530"
                     /old_locus_tag="Rahaq2_0734"
     CDS             781273..781521
                     /gene="rpsP"
                     /locus_tag="RAHAQ2_RS03530"
                     /old_locus_tag="Rahaq2_0734"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZBU7.1"
                     /note="binds to lower part of 30S body where it stabilizes
                     two domains; required for efficient assembly of 30S; in
                     Escherichia coli this protein has nuclease activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="WP_015689395.1"
                     /db_xref="GI:505727264"
                     /translation="MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFFNPLAS
                     GQAEALRMDLDRVAHWVGLGATVSDRVSALIKDAKKAA"
     gene            781540..782088
                     /gene="rimM"
                     /locus_tag="RAHAQ2_RS03535"
                     /old_locus_tag="Rahaq2_0735"
     CDS             781540..782088
                     /gene="rimM"
                     /locus_tag="RAHAQ2_RS03535"
                     /old_locus_tag="Rahaq2_0735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009639223.1"
                     /note="Essential for efficient processing of 16S rRNA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA-processing protein M"
                     /protein_id="WP_015695929.1"
                     /db_xref="GI:505734246"
                     /translation="MSKQSNPVVPAEPLVLGKMGSTYGIRGWLRVFSSTEDAESIFDY
                     QPWFIQRAGKWQVVELEGWKRHTQDLIIKVKGIDDRDAANLLTNCEIVVDSKQLPPLE
                     DGDYYWKDLFGCQVVTTSGYELGKIIDMMETGSNDVMVVKANLKDAFGLKERLIPFLD
                     GQVIKKVDLATRTVEVDWDPGF"
     gene            782165..782938
                     /gene="trmD"
                     /locus_tag="RAHAQ2_RS03540"
                     /old_locus_tag="Rahaq2_0736"
     CDS             782165..782938
                     /gene="trmD"
                     /locus_tag="RAHAQ2_RS03540"
                     /old_locus_tag="Rahaq2_0736"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574037.1"
                     /note="methylates guanosine-37 in various tRNAs; uses
                     S-adenosyl-L-methionine to transfer methyl group to tRNA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N1)-methyltransferase"
                     /protein_id="WP_013574037.1"
                     /db_xref="GI:503339376"
                     /translation="MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSVNCWSPRDFAYD
                     RHRTVDERPYGGGPGMLMMVQPLREAIHAAKAAAGEGVKVIYLSPQGRKLDQTGVCEL
                     AAHQKIILVCGRYEGIDERIIKTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVL
                     GRQASAEEDSFADGLLDCPHYTRPEVLEGMEVPPVLLSGNHADIRRWRLKQSLGRTWL
                     RRPELLENLALTDEQEVLLREFQKEHRLSQQNYEGNAKA"
     gene            782987..783334
                     /locus_tag="RAHAQ2_RS03545"
                     /old_locus_tag="Rahaq2_0737"
     CDS             782987..783334
                     /locus_tag="RAHAQ2_RS03545"
                     /old_locus_tag="Rahaq2_0737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012768745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="WP_013574038.1"
                     /db_xref="GI:503339377"
                     /translation="MSNIIKQIEQEQMKQDVPAFRPGDSLEIKVWVVEGSKKRLQAFE
                     GVVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVIDSITVKRRGAVRKAKLYYLRE
                     RTGKSARIKERLN"
     gene            complement(783671..784750)
                     /locus_tag="RAHAQ2_RS03550"
                     /old_locus_tag="Rahaq2_0739"
     CDS             complement(783671..784750)
                     /locus_tag="RAHAQ2_RS03550"
                     /old_locus_tag="Rahaq2_0739"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_015695931.1"
                     /db_xref="GI:505734248"
                     /translation="MLTDLQLPVGARIAPVFSLKIKNKVLEQNISDHIISLTVTDKSG
                     FEADTLTLTFDDSDGQVQMPARGTVLHLHLGWSKQALYDCGYFTVDTVNHQGSPDRID
                     VTARSADFRGSFETKLSQSYDDYTLGAIIRMISSRNQLSLPVIPPELDSIKIPHIDQT
                     EENDGYFLTRLAQLYGAQVTVKNGAILFFKPGTGRTASGQPLPWKTLTRSDGDNHIFK
                     IADKKAYEGVNARWHDIKTATTSNVALKNTSEKSYTAGTKDNVLQLAKIFPDEETAKR
                     AADSVFNQVQADSASFSIRLALGRADLGAQTPVNVQGFKDVIDNQHWIIDSAVHNLNE
                     KGFTTTLNLKIYVADITYESSILQY"
     gene            complement(784753..785223)
                     /locus_tag="RAHAQ2_RS03555"
                     /old_locus_tag="Rahaq2_0740"
     CDS             complement(784753..785223)
                     /locus_tag="RAHAQ2_RS03555"
                     /old_locus_tag="Rahaq2_0740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail assembly protein"
                     /protein_id="WP_015695932.1"
                     /db_xref="GI:505734249"
                     /translation="MMMSLGLFVFKLNTLPYQNTSRQVNYGWGTNTRFGQRPVSQFLG
                     LGEEAMTLKGQLLPEVTGGVRYLQALQVMADSGRAWPLIEGSGTIYGMFVIKSITNDN
                     AEFNSSGQARSITFTLNLTRVDESQAAMFGDLLTQAEGLYNKASSALSNFASGA"
     gene            complement(785220..786851)
                     /locus_tag="RAHAQ2_RS03560"
                     /old_locus_tag="Rahaq2_0741"
     CDS             complement(785220..786851)
                     /locus_tag="RAHAQ2_RS03560"
                     /old_locus_tag="Rahaq2_0741"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail tape measure protein"
                     /protein_id="WP_015695933.1"
                     /db_xref="GI:505734250"
                     /translation="MSNLEQLPDTLEKINQDLAVFRAETDRVRKNLLALPGKTLFSVV
                     SEDMADASLQFETSLFAPDSGTETQAFSGLKKKVASQSLEKLRQQRPMQMEHKGQEIG
                     QQFKNRELKIGQLKNISSSALSFAQPKLTLAQNFLKPGAELESGLAEVQSVLGLKNDD
                     PQLAALRQQSLSMAAAGHSPAEVVAKQQALAKNGMNADQVLEQTPAALNGATPAAQMA
                     VTVKGDNLDGDITKLFATWDTIRINLFDGQSAALRELTQTATSWLGTINTWITDNPVL
                     VNSLLGLALGITGIIGGLGSLGMVIAPVLSGINMLMAGAGLLGTIFTGTGGVIAAAFA
                     AIGLPLLPVIALIAGIGIAVVKLWEPISAFVGGVIDGFTAAMGPISGAFAPFRTALGW
                     ITDLFEPIHFTQNTLSGFTDIGKAVGEAIAEIFVTLNKAVSQIGEVFNWAKKGWDSLF
                     GGSDPAERPDISAPPSDSISPTGGALNLYQPAKSSVANNLTDNRATTVNLSFTATPET
                     DHNQIRTWIEDSLNQREWNNTNNLLSQYNNGGIYP"
     gene            complement(786844..786978)
                     /locus_tag="RAHAQ2_RS03565"
     CDS             complement(786844..786978)
                     /locus_tag="RAHAQ2_RS03565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail fiber protein"
                     /protein_id="WP_037040551.1"
                     /db_xref="GI:739176572"
                     /translation="MDDLMADIAVIFHWPPSEMDGMSLTDLLNWRYKALQRSGVKTDE
                     "
     gene            complement(786999..787286)
                     /locus_tag="RAHAQ2_RS03570"
                     /old_locus_tag="Rahaq2_0743"
     CDS             complement(786999..787286)
                     /locus_tag="RAHAQ2_RS03570"
                     /old_locus_tag="Rahaq2_0743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015695934.1"
                     /db_xref="GI:505734251"
                     /translation="MNLTDINDNTVILDVPLKRGEMEITEIQVTKPTAGSLRGIGLAA
                     LANADVDALITILPRITYPNLTKEECSRLELPDLIALAGKVIGFLSPKPVV"
     gene            complement(787345..787854)
                     /locus_tag="RAHAQ2_RS03575"
                     /old_locus_tag="Rahaq2_0744"
     CDS             complement(787345..787854)
                     /locus_tag="RAHAQ2_RS03575"
                     /old_locus_tag="Rahaq2_0744"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major tail tube protein"
                     /protein_id="WP_015695935.1"
                     /db_xref="GI:505734252"
                     /translation="MALPKKLKYLNLFNDGNSYLGLVSSLTLPKLTRKLQNYRGGGMS
                     GSVAVDFGLDDDALTLEWSIGGLDELVLQQWGSTSDIPLRFAGSLQRDDTGDVSAVEV
                     MMRGRHKEFDFGEYKQGEDTETKVTTQCTYFKLTIDGKELIEIDTVNMVEIVNGVDRL
                     AEHRTALGL"
     gene            complement(787869..789038)
                     /locus_tag="RAHAQ2_RS03580"
                     /old_locus_tag="Rahaq2_0745"
     CDS             complement(787869..789038)
                     /locus_tag="RAHAQ2_RS03580"
                     /old_locus_tag="Rahaq2_0745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail sheath protein"
                     /protein_id="WP_015695936.1"
                     /db_xref="GI:505734253"
                     /translation="MADYHHGVRVVEINDGTRIISTVSTAIIGMVCTAEDADATVFPL
                     NMPVLITDVLAASGKAGTSGTLRAALLAIADQCKPVTVVVRVATGEDEAATTSNIIGG
                     SDANGRYTGMKALLSAQAELGVKPRILGVPGLDNQAVATALAGVCQQLRAFGYVSVYG
                     AKTLSDAIKYRDNFSQRELMLIWPDFVNWNTTTSQSDIAYATARALGLRAKIDQDTGW
                     HKTLSNVGVNGVTGLSASVFWDLQATGTDADLLNEAGVTTLVRKDGFRFWGNRTCSDD
                     TLFLFENYTRTAQILADTMAEAHMWAVDKPMTPTLVRDMIDGIKAKMREMKSAGYIID
                     GDCWYDETANTAETLKAGKLYIDYDYTPVPPLEDLTLRQRITDSYLVNFAASINS"
     gene            complement(789209..790240)
                     /locus_tag="RAHAQ2_RS03585"
                     /old_locus_tag="Rahaq2_0746"
     CDS             complement(789209..790240)
                     /locus_tag="RAHAQ2_RS03585"
                     /old_locus_tag="Rahaq2_0746"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_015695937.1"
                     /db_xref="GI:505734254"
                     /translation="MTAKYYALLTNLGAAKLANATALGTQLSLTQMAVGDGGGILPTP
                     DPAQTKLIGEKRRASLNALSVDPANTNQIIAEQIIPEDQGGFWIREIGLFDQDNTLIA
                     IANCPETYKPQLQEGSGRTQTVRMILVVNSTDAVTLKIDPSVVLATRKYVDDKAIEVK
                     AYADDLLAKHVAAVNPHPQYDLPVGIPLPWPTATPPAGWLKCNGAAFDKAKYPKLALA
                     YPSGLLPDLRGEFIRGWDDGRGVDAGRVIYSAQGATGIRTAALDYFGADETTTGGTIG
                     TPFVAADSAIAGQPPGAKSPNNSTLIPIMADNCMTAVQLPASLSNPAGVWITMRPRNI
                     AFNYIVRAA"
     gene            complement(790230..790844)
                     /locus_tag="RAHAQ2_RS03590"
                     /old_locus_tag="Rahaq2_0747"
     CDS             complement(790230..790844)
                     /locus_tag="RAHAQ2_RS03590"
                     /old_locus_tag="Rahaq2_0747"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_015695938.1"
                     /db_xref="GI:505734255"
                     /translation="MSDRLLPSGSTQLEVAAAQALSQIGNLSVPLRELWDPDFCPLEL
                     LPYLGWAFSVDRWDENWTEPAKRSAVRAAWFVHKHKGTIGALRRVVEPLGYLIRVTEW
                     WQTHDVPGTFRLDVGVLETGITEEMYQELERLITDAKPCSRHLIGLSINLDVTGDFYI
                     AAATYDGEELTVYPYLPETITASGPAFTGSAIHLIDNLRVNYDS"
     gene            complement(790837..791745)
                     /locus_tag="RAHAQ2_RS03595"
                     /old_locus_tag="Rahaq2_0748"
     CDS             complement(790837..791745)
                     /locus_tag="RAHAQ2_RS03595"
                     /old_locus_tag="Rahaq2_0748"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate assembly protein"
                     /protein_id="WP_015695939.1"
                     /db_xref="GI:505734256"
                     /translation="MATIDLSQLPPPDVVEELDYESLLKARKTTLISLYPADQQEAIS
                     RTLTLESEPLVKLLQENAYRELILRQRVNEAARAVMVAYATGSDLDQLAANFNVQRLV
                     LQPANNNTIPPTAAVLEADSDLRMRIPQAFEGLSVAGPTGAYEYHARSADGRIADASA
                     ISPSPAEVTVTILSRDNDGVASADLLVAVEKALNHEDVRPVADRVTVQAADIVPYQID
                     AVLYVLPTPEIEPVRAASEAQLKTYINTQSRLGRDIRLSAIYAALHVEGVQRVELSSP
                     LADIVLDKTQASLCTGYSLTVGGSDE"
     gene            complement(791751..792101)
                     /locus_tag="RAHAQ2_RS03600"
                     /old_locus_tag="Rahaq2_0749"
     CDS             complement(791751..792101)
                     /locus_tag="RAHAQ2_RS03600"
                     /old_locus_tag="Rahaq2_0749"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate assembly protein"
                     /protein_id="WP_015695940.1"
                     /db_xref="GI:505734257"
                     /translation="MSNPKYLGMNRNSGIAIEDLDHIRQSVSDILNTPVGSRVMRRTY
                     GSLLSELIDQPQNGALRLQMMAICYTALLQWEPRISLNAITFDTGYDGKMVVELTGSR
                     TDTATDFSLNIPVS"
     gene            complement(792098..792739)
                     /locus_tag="RAHAQ2_RS03605"
                     /old_locus_tag="Rahaq2_0750"
     CDS             complement(792098..792739)
                     /locus_tag="RAHAQ2_RS03605"
                     /old_locus_tag="Rahaq2_0750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate assembly protein"
                     /protein_id="WP_015695941.1"
                     /db_xref="GI:505734258"
                     /translation="MNTTLQLNDMMRLIGNMVRIGKVSELDLANARCRVATGSNVTAW
                     LPWMTHRAGRTRSWWAPSVGEQVLLLSMGGELNTAFVLPAVFSDASPAPSSSADALHL
                     VFPDGAIFEYEPETSALKVTGIKTAVINATQKVDVTAPEIRCTASTRITLDTPEVVCT
                     RKLTTGSLEVKQGGTLTGNLTHSGGNLTSNGIVVHTHRHSGVQTGSGQTGGPQ"
     gene            complement(792819..793280)
                     /locus_tag="RAHAQ2_RS03610"
                     /old_locus_tag="Rahaq2_0751"
     CDS             complement(792819..793280)
                     /locus_tag="RAHAQ2_RS03610"
                     /old_locus_tag="Rahaq2_0751"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_015695942.1"
                     /db_xref="GI:505734259"
                     /translation="MQKPIQLQQRLIEQIPLLAAAPEKLVIATGPVNVVATSAPSLSF
                     EYRYPLTMTITDDTLSETLVDLAVVTVLDWLQVNQPEILGNALHRLNDFTFTQQERSL
                     VLLLQLTERVQVSDKDEVRTITHLPEPPLPENVALPRQVYLNGELISSWTV"
     gene            complement(793376..793801)
                     /locus_tag="RAHAQ2_RS03615"
                     /old_locus_tag="Rahaq2_0752"
     CDS             complement(793376..793801)
                     /locus_tag="RAHAQ2_RS03615"
                     /old_locus_tag="Rahaq2_0752"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015695943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysis regulatory protein"
                     /protein_id="WP_015695943.1"
                     /db_xref="GI:505734260"
                     /translation="MRTLLAILAAMVLLIAMLILSNRSLQHDLNNASQQRDALMSQLQ
                     QREQLIATLNQQMRQREQAELSLR