GenomeNet

Database: RefSeq
Entry: NC_016818
LinkDB: NC_016818
Original site: NC_016818 
LOCUS       NC_016818            4861101 bp    DNA     circular CON 07-JUL-2013
DEFINITION  Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete
            genome.
ACCESSION   NC_016818
VERSION     NC_016818.1  GI:383187966
DBLINK      Project: 86855
            BioProject: PRJNA86855
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Rahnella aquatilis CIP 78.65 = ATCC 33071
  ORGANISM  Rahnella aquatilis CIP 78.65 = ATCC 33071
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Rahnella.
REFERENCE   1  (bases 1 to 4861101)
  AUTHORS   Martinez,R.J., Bruce,D., Detter,C., Goodwin,L.A., Han,J., Han,C.S.,
            Held,B., Land,M.L., Mikhailova,N., Nolan,M., Pennacchio,L.,
            Pitluck,S., Tapia,R., Woyke,T. and Sobecky,P.A.
  TITLE     Complete genome sequence of Rahnella aquatilis CIP 78.65
  JOURNAL   J. Bacteriol. 194 (11), 3020-3021 (2012)
   PUBMED   22582378
REFERENCE   2  (bases 1 to 4861101)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4861101)
  AUTHORS   Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
            Peters,L., Ovchinnikova,G., Held,B., Detter,J.C., Han,C., Tapia,R.,
            Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Sobecky,P.,
            Martinez,R. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003244.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4089211
            Source DNA and organism available from Robert Martinez
            (rmartinez@bama.ua.edu)
            Contacts: Robert Martinez (rmartinez@bama.ua.edu)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Rahnella aquatilis CIP 78.65
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Host
            num_replicons       :: 4
            ref_biomaterial     :: Missing
            biotic_relationship :: Missing
            trophic_level       :: Missing
            rel_to_oxygen       :: Facultative
            isol_growth_condt   :: Missing
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi06369
            Type Strain         :: Yes
            Funding Program     :: DOE-CSP 2010
            Gene Calling Method :: Prodigal 1.4, GenePRIMP
            Isolation Site      :: drinking water
            Host Name           :: Water, humans
            Cell Shape          :: Rod-shaped
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram-
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4861101
                     /organism="Rahnella aquatilis CIP 78.65 = ATCC 33071"
                     /mol_type="genomic DNA"
                     /strain="CIP 78.65"
                     /isolation_source="drinking water"
                     /culture_collection="ATCC:33071"
                     /db_xref="taxon:745277"
     gene            complement(185..430)
                     /locus_tag="Rahaq2_0001"
                     /note="IMG reference gene:2506707026"
                     /db_xref="GeneID:11793600"
     CDS             complement(185..430)
                     /locus_tag="Rahaq2_0001"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198095.1"
                     /db_xref="GI:383187967"
                     /db_xref="GeneID:11793600"
                     /translation="MIFGARSARQWGKFLSPPCQRRKVTCEPLFAVFVESIPAGIAIG
                     MADHNAIRHRDPPLPDSLDPFYPQAAIGKWVSLADPF"
     gene            489..1880
                     /locus_tag="Rahaq2_0002"
                     /note="IMG reference gene:2506707027"
                     /db_xref="GeneID:11793602"
     CDS             489..1880
                     /locus_tag="Rahaq2_0002"
                     /note="PFAM: domain; Bacterial dnaA protein;
                     TIGRFAM: chromosomal replication initiator protein DnaA"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_005198096.1"
                     /db_xref="GI:383187968"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR010921"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="InterPro:IPR018312"
                     /db_xref="InterPro:IPR020591"
                     /db_xref="GeneID:11793602"
                     /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELNDNTLALYAPN
                     RFVLDWVRDKYLNNINGLLNDFCGTDAPLLRFEVGSKPVIQRVSQPVAASVSSQAAPA
                     IPRLAPSRPSWDSSPAQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGA
                     YNPLFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNAIEEF
                     KRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVED
                     RLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEG
                     ALNRVIANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLS
                     KRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDI
                     KEDFSNLIRTLSS"
     misc_feature    489..1877
                     /locus_tag="Rahaq2_0002"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    498..683
                     /locus_tag="Rahaq2_0002"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    915..1346
                     /locus_tag="Rahaq2_0002"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    990..1013
                     /locus_tag="Rahaq2_0002"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(993..1016,1179..1181,1281..1283)
                     /locus_tag="Rahaq2_0002"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    1167..1184
                     /locus_tag="Rahaq2_0002"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    1317..1319
                     /locus_tag="Rahaq2_0002"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1602..1871
                     /locus_tag="Rahaq2_0002"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1671..1673,1695..1700,1719..1721,1737..1745,
                     1770..1784,1791..1793,1800..1805)
                     /locus_tag="Rahaq2_0002"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1885..2985
                     /locus_tag="Rahaq2_0003"
                     /note="IMG reference gene:2506707028"
                     /db_xref="GeneID:11793604"
     CDS             1885..2985
                     /locus_tag="Rahaq2_0003"
                     /note="PFAM: DNA polymerase III beta subunit, C-terminal
                     domain; DNA polymerase III beta subunit, N-terminal
                     domain; DNA polymerase III beta subunit, central domain;
                     TIGRFAM: DNA polymerase III, beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_005198097.1"
                     /db_xref="GI:383187969"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="InterPro:IPR022634"
                     /db_xref="InterPro:IPR022635"
                     /db_xref="InterPro:IPR022637"
                     /db_xref="GeneID:11793604"
                     /translation="MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTDGALSL
                     TGTDLEMEMVAKVALSQPHEAGATTVPARKFFDICRGLPEGAEISVALDGDRMLVKSG
                     RSRFSLSTLPATDFPNLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLF
                     ETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVMELVRLLDGGDTTLQLQI
                     GSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLQAGCDLLKQAFARAAILSNE
                     KFRGVRLYVSHNQLKITANNPEQEEAEEILDVGYEGTEMEIGFNVSYVLDVLNALKCE
                     DVNLLLTDSVSSVQIEDAASQSAAYVVMPMRL"
     misc_feature    1885..2982
                     /locus_tag="Rahaq2_0003"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1885..2979
                     /locus_tag="Rahaq2_0003"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1954..1956,2101..2103,2122..2124,2476..2478)
                     /locus_tag="Rahaq2_0003"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2104..2106,2113..2115,2191..2193,2197..2199,
                     2698..2700,2791..2796)
                     /locus_tag="Rahaq2_0003"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2398..2400,2404..2415,2842..2844,2968..2979)
                     /locus_tag="Rahaq2_0003"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2398..2400,2404..2409,2623..2625,2728..2730,
                     2767..2772,2851..2853,2968..2979)
                     /locus_tag="Rahaq2_0003"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2995..4083
                     /locus_tag="Rahaq2_0004"
                     /note="IMG reference gene:2506707029"
                     /db_xref="GeneID:11793605"
     CDS             2995..4083
                     /locus_tag="Rahaq2_0004"
                     /note="PFAM: RecF/RecN/SMC N terminal domain;
                     TIGRFAM: recF protein"
                     /codon_start=1
                     /transl_table=11
                     /product="recF protein"
                     /protein_id="YP_005198098.1"
                     /db_xref="GI:383187970"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR018078"
                     /db_xref="GeneID:11793605"
                     /translation="MALTRLLIKDFRNIEAADLDPSPGFNFLVGPNGSGKTSVLEAVY
                     TLGHGRAFRSLQAGRVIRHDQPEFVLHARVDDGGDRELSIGLSKSRQGDSKVRIDGSD
                     GHKVSELAQMLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHHDPGFFIAWSNLRRLLK
                     QRNAALRQVGRYAQIRAWDQELIPLAERISEWRAAYSEAIAADISATCAQFLPEFALS
                     FSFQRGWDKETEYGELLERNFERDRALTYTASGPHKADFRIRADGTPVEDLLSRGQLK
                     LLMCALRLAQGEFLTRQSGRRCLYLLDDFASELDADRRRLLADRLKATQAQVFVSAIS
                     AEQVTDMMGEKGKMFRVEQGKIAVLSQD"
     misc_feature    2995..4062
                     /locus_tag="Rahaq2_0004"
                     /note="recF protein; Region: recf; TIGR00611"
                     /db_xref="CDD:233051"
     misc_feature    3001..4065
                     /locus_tag="Rahaq2_0004"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    3082..3105
                     /locus_tag="Rahaq2_0004"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(3091..3096,3100..3108,3352..3354,3901..3906,
                     3994..3996)
                     /locus_tag="Rahaq2_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    3343..3354
                     /locus_tag="Rahaq2_0004"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    3802..3831
                     /locus_tag="Rahaq2_0004"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    3889..3906
                     /locus_tag="Rahaq2_0004"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    3913..3924
                     /locus_tag="Rahaq2_0004"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    3982..4002
                     /locus_tag="Rahaq2_0004"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            4103..6517
                     /locus_tag="Rahaq2_0005"
                     /note="IMG reference gene:2506707030"
                     /db_xref="GeneID:11794296"
     CDS             4103..6517
                     /locus_tag="Rahaq2_0005"
                     /note="PFAM: Histidine kinase-, DNA gyrase B-, and
                     HSP90-like ATPase; DNA gyrase B; DNA gyrase B subunit,
                     carboxyl terminus;
                     TIGRFAM: DNA gyrase, B subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_005198099.1"
                     /db_xref="GI:383187971"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="GeneID:11794296"
                     /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
                     DNAIDEALAGHCKEIQVTIHADNSVSVQDDGRGIPTGIHEEEGVSAAQVIMTVLHAGG
                     KFDDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKVHTQTYVHGEPQDPLKVIGDT
                     DATGTTVRFWPSFNTFTNHTEFEYDILAKRLRELSFLNSGVAIRLLDKRDGKNDHFHY
                     EGGIKAFVEYLNKNKTPIHPTVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQR
                     DGGTHLAGFRSAMTRTLNAYMDKEGYSKKSKISATGDDAREGLIAVVSVKVPDPKFSS
                     QTKDKLVSSEVKTAVETLMNEKLVDYLMENPSDAKIVVGKIIDAARAREAARKAREMT
                     RRKGALDLAGLPGKLADCQERDPAHSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKI
                     LNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRT
                     LLLTFFYRQMPEIVERGHVFIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIAMDGATL
                     HANAHAPALAGEPLEKLVAEHHSVQKMIGRMERRYPRALLNNLIYQPTLPGSDLTDQA
                     KVQAWMESLVARLNEKEQHGSSYSAIVRENREHQLFEPVLRIRTHGVDTDYDLDADFV
                     QGGEYRKICALGEQLRGLIEEDAFIERGERRQPVTSFEQALEWLVKESRRGLSIQRYK
                     GLGEMNPDQLWETTMDPEQRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALK
                     AANIDI"
     misc_feature    4103..6514
                     /locus_tag="Rahaq2_0005"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    4208..4543
                     /locus_tag="Rahaq2_0005"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(4226..4228,4238..4240,4247..4249,4313..4315,
                     4319..4321,4325..4327,4331..4336,4451..4462,4502..4504,
                     4508..4510,4523..4528,4532..4534)
                     /locus_tag="Rahaq2_0005"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    4238..4240
                     /locus_tag="Rahaq2_0005"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(4325..4327,4331..4333,4451..4453,4457..4459)
                     /locus_tag="Rahaq2_0005"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    4760..5233
                     /locus_tag="Rahaq2_0005"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    4913..4915
                     /locus_tag="Rahaq2_0005"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5087..5089,5096..5101,5105..5107)
                     /locus_tag="Rahaq2_0005"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5105..5107,5111..5113)
                     /locus_tag="Rahaq2_0005"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    5354..5698
                     /locus_tag="Rahaq2_0005"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(5372..5377,5384..5386,5594..5596,5600..5602,
                     5606..5608)
                     /locus_tag="Rahaq2_0005"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(5372..5374,5594..5596)
                     /locus_tag="Rahaq2_0005"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    <5963..>6247
                     /locus_tag="Rahaq2_0005"
                     /note="Uncharacterized protein, probably involved in
                     trehalose biosynthesis [Carbohydrate transport and
                     metabolism]; Region: Ble; cl19286"
                     /db_xref="CDD:267639"
     misc_feature    6287..6481
                     /locus_tag="Rahaq2_0005"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            6674..7489
                     /locus_tag="Rahaq2_0006"
                     /note="IMG reference gene:2506707031"
                     /db_xref="GeneID:11793700"
     CDS             6674..7489
                     /locus_tag="Rahaq2_0006"
                     /note="PFAM: haloacid dehalogenase-like hydrolase;
                     TIGRFAM: Cof subfamily of IIB subfamily of haloacid
                     dehalogenase superfamily; HAD-superfamily hydrolase,
                     subfamily IIB"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="YP_005198100.1"
                     /db_xref="GI:383187972"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR013200"
                     /db_xref="GeneID:11793700"
                     /translation="MAIELIAIDMDGTLLNPQHEVTPAVKKALSEARAKGVQIVLATG
                     RPFIGVQRYLMELDLQQEGCYCITNNGALVHNAKDGSVIAEIALTIEDYHYFEELARQ
                     LGVHFHALTKTDLFTANRHISKYSVHESFTTGIPLQFCPAEEMDPALTFPKVMMIDDP
                     QLLDRAISQIPAEARERYTIMKSSPYFLEILDKRVNKGEGVKALAEKLGIARESVMTL
                     GDQENDIAMLEYAGIGVAMGNALDSVKAVSQFVTKTNMEDGVAFAIEKFVLNV"
     misc_feature    6674..7483
                     /locus_tag="Rahaq2_0006"
                     /note="sugar phosphate phosphatase; Provisional; Region:
                     PRK10513"
                     /db_xref="CDD:182509"
     misc_feature    6680..7360
                     /locus_tag="Rahaq2_0006"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    6686..>6991
                     /locus_tag="Rahaq2_0006"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(6698..6706,6800..6805)
                     /locus_tag="Rahaq2_0006"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    6698..6715
                     /locus_tag="Rahaq2_0006"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    6800..6802
                     /locus_tag="Rahaq2_0006"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <7262..7480
                     /locus_tag="Rahaq2_0006"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            7515..8777
                     /locus_tag="Rahaq2_0007"
                     /note="IMG reference gene:2506707032"
                     /db_xref="GeneID:11793707"
     CDS             7515..8777
                     /locus_tag="Rahaq2_0007"
                     /note="PFAM: Protein of unknown function (DUF3748);
                     WD40-like Beta Propeller Repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic component of the Tol biopolymer
                     transport system"
                     /protein_id="YP_005198101.1"
                     /db_xref="GI:383187973"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR011659"
                     /db_xref="InterPro:IPR022223"
                     /db_xref="GeneID:11793707"
                     /translation="MEKQLTADARGHQLTNINVWTPDSQWLVYDVRPHGGSFTGSTIE
                     RVNVETGEVQVLYQAPDGAHVGVVTVSPDLPARYAFIHGPENPDESWQYDFHHRRGVI
                     VSEPAREKAVTLDAMDITAPFTAGALRGGTHVHVFSPDGSRLSFTYNDHVLHQHDPAL
                     DLRNVGVALSGYPVVSPKHHPREYDGSHFSILVSETTPYPHPGSDEINRAYEEGWVGR
                     EGYLKPDGRRQRWALAFIGDTLSVRGEKHPEIFVVDLPHNDKDYRQAGDNPLQGTPEL
                     LPAPPAGVKQRRITFTENGIALQPRHWLRASPDGAQIAFLMKDRSGVVQVWTVSPNGG
                     EPVQISHSGQGIQSAFSWSPDGKSLALVCDNSVMRLDWESGKMQRLTQRSEIAPCADA
                     VVYSPDGSKVAFMRQCEGYSQICVADSH"
     misc_feature    7701..8066
                     /locus_tag="Rahaq2_0007"
                     /note="Protein of unknown function (DUF3748); Region:
                     DUF3748; pfam12566"
                     /db_xref="CDD:193082"
     gene            complement(8819..9196)
                     /locus_tag="Rahaq2_0008"
                     /note="IMG reference gene:2506707033"
                     /db_xref="GeneID:11794310"
     CDS             complement(8819..9196)
                     /locus_tag="Rahaq2_0008"
                     /note="PFAM: Protein of unknown function (DUF1375)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative periplasmic lipoprotein"
                     /protein_id="YP_005198102.1"
                     /db_xref="GI:383187974"
                     /db_xref="InterPro:IPR010780"
                     /db_xref="GeneID:11794310"
                     /translation="MMKFALTPLMTGCVFLATSGCSSVMSHTGGDTGYYSGARADVNM
                     MKSDDTSWAMTPLLLIDLPFSALLDTVLLPYDYFRSGKVTTRDRVKASEEHNIAMSNG
                     VDIDHIPPMTTTPRQQKSPTHKK"
     misc_feature    complement(8846..9193)
                     /locus_tag="Rahaq2_0008"
                     /note="Protein of unknown function (DUF1375); Region:
                     DUF1375; cl11456"
                     /db_xref="CDD:264378"
     gene            9577..9987
                     /locus_tag="Rahaq2_0009"
                     /note="IMG reference gene:2506707034"
                     /db_xref="GeneID:11793710"
     CDS             9577..9987
                     /locus_tag="Rahaq2_0009"
                     /note="PFAM: Hsp20/alpha crystallin family"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="YP_005198103.1"
                     /db_xref="GI:383187975"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="GeneID:11793710"
                     /translation="MRNFDLSPLYRSAIGFDRLFNLIESGQNQGGGYPPYNVELVDEN
                     HYRIAIAVAGFAESELDITAHDNMLLVKGAHAPADTGRTYLYQGIAERNFERKFQLAE
                     HIQIKAANLSNGLLYIDLERVVPESSKPRRIEIR"
     misc_feature    9577..9981
                     /locus_tag="Rahaq2_0009"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    9676..9942
                     /locus_tag="Rahaq2_0009"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    order(9682..9696,9721..9723,9727..9729,9733..9738,
                     9862..9864,9916..9921)
                     /locus_tag="Rahaq2_0009"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            complement(10016..10111)
                     /locus_tag="Rahaq2_0010"
                     /note="IMG reference gene:2506707035"
                     /db_xref="GeneID:11793598"
     CDS             complement(10016..10111)
                     /locus_tag="Rahaq2_0010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198104.1"
                     /db_xref="GI:383187976"
                     /db_xref="GeneID:11793598"
                     /translation="MPSSVLDVTVQLPDGEPKLFHFLAVNNDGRR"
     gene            10144..10578
                     /locus_tag="Rahaq2_0011"
                     /note="IMG reference gene:2506707036"
                     /db_xref="GeneID:11789764"
     CDS             10144..10578
                     /locus_tag="Rahaq2_0011"
                     /note="PFAM: Hsp20/alpha crystallin family"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="YP_005198105.1"
                     /db_xref="GI:383187977"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="GeneID:11789764"
                     /translation="MRNYDISPLLRQWIGFDKLASSMQGADQVFPPYNIEKSDDNHYR
                     ISLALAGFQQSELNIEVEGPRLTVSGTPAQPENQVEYLHQGLVIKPFTLSFTLAEHMR
                     VSAAEFTHGLLHINLVREVPEALQPQKIAIGTEKPALENQSE"
     misc_feature    10144..10539
                     /locus_tag="Rahaq2_0011"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    10234..10500
                     /locus_tag="Rahaq2_0011"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    order(10240..10254,10279..10281,10285..10287,10291..10296,
                     10420..10422,10474..10479)
                     /locus_tag="Rahaq2_0011"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            complement(10656..11909)
                     /locus_tag="Rahaq2_0012"
                     /note="IMG reference gene:2506707037"
                     /db_xref="GeneID:11789765"
     CDS             complement(10656..11909)
                     /locus_tag="Rahaq2_0012"
                     /note="PFAM: Aminotransferase class I and II"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine-alpha-ketoisovalerate (or
                     valine-pyruvate) aminotransferase"
                     /protein_id="YP_005198106.1"
                     /db_xref="GI:383187978"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11789765"
                     /translation="MTFSAFGDKFTRFSGITRLMGDMNDGLRTPGAVMLGGGNPAQIP
                     EMQDYFQTLLTEMLAAGMLTEALCNYDGPQGKDVLRHALAEMLQKELGWQLDAQNIAL
                     TNGSQSAFFYLFNLFAGRRADGSMSKVLFPLAPEYLGYADAGLDENLFVSAKPNIELL
                     PEGQFKYHVDFDHLNITDDIGLICVSRPTNPTGNVITDEELIRLDALAQQKDIPLLID
                     NAYGVPFPGIVFTDATPLWNPNIILCMSLSKLGLPGSRCGIVIADEKIIKAISNMNGI
                     ISLSPGSVGPAIAHEMIVRGDLLRLSEDVIKPFYFQRVQETIATLRRYLPEERCLIHK
                     PEGAIFLWLWFKDLPITTEVLYQRLKQRGVLMVPGDYFFPGLEHPWPHTHQCMRMNYV
                     PDAEQIERGVKILAEEVEKAHAENL"
     misc_feature    complement(10662..11909)
                     /locus_tag="Rahaq2_0012"
                     /note="valine--pyruvate transaminase; Provisional; Region:
                     avtA; PRK09440"
                     /db_xref="CDD:236517"
     misc_feature    complement(10689..11744)
                     /locus_tag="Rahaq2_0012"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(11142..11144,11163..11168,11172..11174,
                     11247..11249,11340..11342,11499..11501,11589..11597))
                     /locus_tag="Rahaq2_0012"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(11046..11048,11055..11057,11142..11150,
                     11268..11270,11451..11453,11586..11588))
                     /locus_tag="Rahaq2_0012"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(11163..11165)
                     /locus_tag="Rahaq2_0012"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            12168..13376
                     /locus_tag="Rahaq2_0013"
                     /note="IMG reference gene:2506707038"
                     /db_xref="GeneID:11789766"
     CDS             12168..13376
                     /locus_tag="Rahaq2_0013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198107.1"
                     /db_xref="GI:383187979"
                     /db_xref="GeneID:11789766"
                     /translation="MKKSIIIMNLVMAGGGDYALGKKIKEIARSTQAEGMLFTVDAES
                     RHSRIKTQEHFNPGKPVNYTNPIIIVTPHSIMTPHILASVLKTFLYENKINATTIILI
                     DEMDALRDNESNDLDYKAVLNHLGFKNIIIHSLGFSEKSLGYLPMPEQEVISIKKSAK
                     QDVIKLLDSYNLSLPESCALYFAYLSSDAEVTCSQVFIINTLIEEKDFQNNSAYVFVC
                     REKNAITRVLKGLNNCFSKPPYNDLFSECHFSTMKDESTIMSHGNIRGTGNKKIHICI
                     TTTLPSTTFKNLTSVSKTGMMSGDQSLSDYLSLKESLPYYDKQSWKEPLIDGLNARAR
                     ELGGEELFNKLQTMVAGRRPFTGTITFKLLTAGDVPTPTLKNSLLAFNNEIYARKADR
                     NIREMLMKYL"
     gene            complement(13439..14416)
                     /locus_tag="Rahaq2_0014"
                     /note="IMG reference gene:2506707039"
                     /db_xref="GeneID:11789767"
     CDS             complement(13439..14416)
                     /locus_tag="Rahaq2_0014"
                     /note="PFAM: D-isomer specific 2-hydroxyacid
                     dehydrogenase, NAD binding domain; D-isomer specific
                     2-hydroxyacid dehydrogenase, catalytic domain"
                     /codon_start=1
                     /transl_table=11
                     /product="lactate dehydrogenase-like oxidoreductase"
                     /protein_id="YP_005198108.1"
                     /db_xref="GI:383187980"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11789767"
                     /translation="MKPSIVLYKKLPADLHQRLEEHFTITEFDGITESNRSQVFDALQ
                     NAEGLLGSGGKIDKELFDHAPRLRAVSTISVGYDNFDVKELTRRQIPMMHTPTALTDT
                     VADTVMALVLATARRVVNVAERVKAGEWNDNIGADWFGTDVHHKTMGIVGMGRIGLAL
                     AQRAHFGFDMPILYNARSQHKEAEEKFGARKCELDELLKESDFVCILLPMTEQTFHLI
                     GKNELAQMKSSAILINAGRGPVIDEPALIDALKAKTIYGAGLDVFETEPLPKDSPLLS
                     LPNVVALPHIGSATHETRYDMAACAVDNLIAALKGDVKQFCVNPEVLKK"
     misc_feature    complement(13454..14416)
                     /locus_tag="Rahaq2_0014"
                     /note="Lactate dehydrogenase and related dehydrogenases
                     [Energy production and conversion / Coenzyme metabolism /
                     General function prediction only]; Region: LdhA; COG1052"
                     /db_xref="CDD:223980"
     misc_feature    complement(13484..14410)
                     /locus_tag="Rahaq2_0014"
                     /note="D-glycerate dehydrogenase/hydroxypyruvate reductase
                     (GDH); Region: GDH; cd05301"
                     /db_xref="CDD:240626"
     misc_feature    complement(order(13535..13537,13541..13552,13556..13576,
                     13592..13594,13616..13621,13913..13918,13928..13933,
                     13985..13999,14000..14020,14027..14029,14033..14035,
                     14039..14041,14063..14065,14069..14071,14081..14083,
                     14090..14095,14099..14104,14111..14116,14198..14200,
                     14255..14263,14381..14383,14387..14392))
                     /locus_tag="Rahaq2_0014"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240626"
     misc_feature    complement(order(13553..13555,13562..13564,13706..13708,
                     14120..14122,14189..14197,14258..14260))
                     /locus_tag="Rahaq2_0014"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240626"
     misc_feature    complement(order(13553..13558,13562..13564,13631..13636,
                     13706..13714,13775..13780,13790..13798,13877..13879,
                     13886..13894,13949..13963,14108..14110,14189..14194))
                     /locus_tag="Rahaq2_0014"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:240626"
     misc_feature    complement(order(13562..13564,13619..13621,13706..13708))
                     /locus_tag="Rahaq2_0014"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240626"
     gene            complement(14413..15705)
                     /locus_tag="Rahaq2_0015"
                     /note="IMG reference gene:2506707040"
                     /db_xref="GeneID:11789768"
     CDS             complement(14413..15705)
                     /locus_tag="Rahaq2_0015"
                     /note="PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate permease"
                     /protein_id="YP_005198109.1"
                     /db_xref="GI:383187981"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11789768"
                     /translation="MNQSRIAARRWWYIMPIVFITYSLAYVDRSNFSFASAAGINDDL
                     GITKGMSSLLGALFFLGYFFFQIPGTIYAERRSVKKLIFWCLLLWGGFASLTGVVTNI
                     PMLAVIRFALGVVEAAVMPAMLVYISNWFTKSERSRANTFLILGNPVTVLWMSVLSGY
                     LIKSFGWREMFIFEGIPAIAWAVIWWFTVKDKPEEVSWLSDREKQALAAQLEKEQKNI
                     QAVGGYREAFRSRNVVLLCLQYFFWSIGVYGFVLWLPSILRDGKSMGMVEAGWLSSAP
                     YLAATLAMILVSWASDKMQNRKLFVWPLLLVGALAFFGSWAAGTNNFWLSYSLLVIAA
                     AAMYAPYGPFFAIIPEMLPKNVAGGAMALINSLGALGSFFGSWFVGYLNGNTGSPAAS
                     FIFMAVSLLVSAGLTLLVRPRKANIPPKEVSLTQGSKS"
     misc_feature    complement(14473..15657)
                     /locus_tag="Rahaq2_0015"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(14476..15648)
                     /locus_tag="Rahaq2_0015"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    complement(order(14590..14592,14599..14604,14611..14616,
                     14623..14628,14659..14661,14668..14673,14683..14685,
                     14692..14697,14704..14706,14854..14856,14866..14868,
                     14875..14877,14887..14889,14899..14901,14941..14943,
                     14950..14955,14962..14967,14974..14976,15253..15255,
                     15271..15276,15283..15288,15322..15324,15331..15336,
                     15343..15348,15355..15360,15496..15501,15505..15510,
                     15520..15522,15529..15534,15541..15543,15595..15600,
                     15604..15612,15619..15621))
                     /locus_tag="Rahaq2_0015"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(15749..16498)
                     /locus_tag="Rahaq2_0016"
                     /note="IMG reference gene:2506707041"
                     /db_xref="GeneID:11793739"
     CDS             complement(15749..16498)
                     /locus_tag="Rahaq2_0016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198110.1"
                     /db_xref="GI:383187982"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="GeneID:11793739"
                     /translation="MKREIVIVTAAYGNSVVKARGGQAELLSVIADAKADGVEIRREL
                     FSAEELDSLPALAEKIKNHGLFAVYSVPFPLFSPAGKLNPDAPQYFEEARILNARTIK
                     FSLGEFVPGQDLTPLKVVLATSPVKLVVENDQSPDCGILSRINAFMFAAESLHLPLSM
                     TFDMANWLWVGQDPAVAAERLARHVGYVHVKAAQKRSGKWHAVALDDSDGSWEPLLKS
                     LPQDVPRGIEFPLEGDDLTAVTHHYVELLRQ"
     misc_feature    complement(15872..16420)
                     /locus_tag="Rahaq2_0016"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     gene            complement(16712..17746)
                     /locus_tag="Rahaq2_0017"
                     /note="IMG reference gene:2506707042"
                     /db_xref="GeneID:11789769"
     CDS             complement(16712..17746)
                     /locus_tag="Rahaq2_0017"
                     /note="PFAM: Bacterial regulatory proteins, lacI family;
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198111.1"
                     /db_xref="GI:383187983"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11789769"
                     /translation="MSKKQEPGATVRATIRDVASAAKTGKTSVSRYLNGEQHLLSDSL
                     KERIGRAISLLDYQPSQMARSLKSGQTRLVGLILADITNPYSVEVMRGVEAACRQEGL
                     TLLVCNTNNELDQEKHYLQLLSSYRVDGIVVNAVGMREAAISTLQQANLPMVLIDRKV
                     ANFACDVIGLNNVEATQMMTGHLLKQGFEALLFISEPATINTRFDRLHAFLKCMQQYP
                     QNIAEQGEIELSNTEGLDNLLKAFVARHADKHKAVMCVNGALTLQVARAMQRLNLRWG
                     PDIGLSGFDELVWADLAGVGITTLRQPTYDMGVAALRQLVTRIQGNSDPVTDLEFSGE
                     LIARGSTAAR"
     misc_feature    complement(16715..17710)
                     /locus_tag="Rahaq2_0017"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(17543..17701)
                     /locus_tag="Rahaq2_0017"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(17546..17551,17555..17560,17567..17569,
                     17576..17578,17615..17617,17624..17626,17630..17632,
                     17645..17647,17654..17659,17663..17677,17699..17701))
                     /locus_tag="Rahaq2_0017"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(17549..17578)
                     /locus_tag="Rahaq2_0017"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(16733..17530)
                     /locus_tag="Rahaq2_0017"
                     /note="Ligand-binding domain of DNA transcription
                     repressor RegR and other putative regulators such as KdgR
                     and EndR; Region: PBP1_RegR_EndR_KdgR_like; cd06283"
                     /db_xref="CDD:107278"
     misc_feature    complement(order(16937..16942,16949..16951,16961..16963,
                     17048..17050,17366..17374,17381..17383,17390..17392,
                     17423..17425,17429..17443,17462..17467,17471..17476,
                     17483..17491,17528..17530))
                     /locus_tag="Rahaq2_0017"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107278"
     misc_feature    complement(order(16841..16843,16892..16894,17060..17062,
                     17129..17131,17237..17239,17276..17278,17345..17347,
                     17480..17482,17489..17494))
                     /locus_tag="Rahaq2_0017"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107278"
     gene            complement(17814..19100)
                     /locus_tag="Rahaq2_0018"
                     /note="IMG reference gene:2506707043"
                     /db_xref="GeneID:11789770"
     CDS             complement(17814..19100)
                     /locus_tag="Rahaq2_0018"
                     /note="PFAM: LacY proton/sugar symporter;
                     TIGRFAM: oligosaccharide:H+ symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="oligosaccharide:H+ symporter"
                     /protein_id="YP_005198112.1"
                     /db_xref="GI:383187984"
                     /db_xref="InterPro:IPR000576"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018457"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR022814"
                     /db_xref="GeneID:11789770"
                     /translation="MNPTQTSDHCFYKNNTNFWIFGSYFFLYFFIMATCYPFLPIWLS
                     DVIGLSKTETGIVFSSMSLFAILFQPVFGIISDKLGLKKHLLWIIAVLLFLFAPFFIY
                     VFAPLLKLNIVLGAILGGAYIGFVFAGGSGATEAYIERVSRNSSFEYGKARMFGCFGW
                     GICASTAGVLFNINPDIVFWMGSGAAIILMILLLIARPQENKNAQVLDKLGANQPQFS
                     LKTAAMLLKERKLWMLILYVIGVACVYDVFDQQFATFFKTFFASPQQGTEMFGYVTTA
                     GELCNALIMFCSPWIINRIGAKNTLLLAGTIMSIRIVGSSFATTAIEVILLKMLHALE
                     VPFLLVGVFKYITQIFDVRFSATLYLIGFNFAKQLAAIFLSAFAGNLYDRIGFSDTYL
                     ILGGIAFGVTIISAFTLSSRPKVEVVPPVETAEGLR"
     misc_feature    complement(17859..19073)
                     /locus_tag="Rahaq2_0018"
                     /note="galactoside permease; Reviewed; Region: lacY;
                     PRK09528"
                     /db_xref="CDD:236549"
     misc_feature    complement(17880..19049)
                     /locus_tag="Rahaq2_0018"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(17988..17990,17997..18002,18009..18014,
                     18024..18029,18060..18062,18069..18074,18084..18086,
                     18093..18098,18105..18107,18246..18248,18258..18260,
                     18267..18269,18279..18281,18291..18293,18333..18335,
                     18342..18347,18363..18368,18375..18377,18621..18623,
                     18639..18644,18651..18653,18660..18662,18696..18698,
                     18705..18710,18717..18722,18729..18734,18882..18887,
                     18891..18896,18906..18908,18915..18920,18927..18929,
                     18981..18986,18990..18998,19005..19007))
                     /locus_tag="Rahaq2_0018"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(19160..21286)
                     /locus_tag="Rahaq2_0019"
                     /note="IMG reference gene:2506707044"
                     /db_xref="GeneID:11789771"
     CDS             complement(19160..21286)
                     /locus_tag="Rahaq2_0019"
                     /note="PFAM: Melibiase"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="YP_005198113.1"
                     /db_xref="GI:383187985"
                     /db_xref="InterPro:IPR000111"
                     /db_xref="InterPro:IPR002252"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11789771"
                     /translation="MENQIVHLTAAHTSLIVRCTPFAEILYWGKRLSQFSADDIISLS
                     RAVPNGRIDVEAPVNFSADTGRGSFGTPGMEGHRDGLDWSPVFNTTQVKHNGNQLTLI
                     TEDPLAGLQFRSELRLDDSGVLQARNSLTNLKPGTYQVTRLAVTLPLPERAAEVMAFH
                     GRWIKEFQPHRTQLDHGGIIQENRRGKTSSEYFPAMMIGHPGFSEEQGEIWGIHLGWS
                     GNHRLRADIKIDGRRLVQAEALYFPGEQRLKQGETLETPWLYASYSASGLNRMSQQFH
                     RFVREQILRFPDEKPRPVHLNTWEGIYFDHDPDYIMQMATESAALGVERFIIDDGWFR
                     GRDHDRAALGDWYLDEKKYPNGLKPVIDHVKKLGMEFGIWVEPEMINPDSDLYRAHPD
                     WLLALPGYQQPSGRHQYVLDLNNPQVFDYLVERMSWLLGEHDVDYVKWDMNREIVQPG
                     HDGRAALTAQTQQFYRLLDVLGERFPQIEFESCASGGGRIDFEVLKRSHRFWTSDNND
                     ALERQKIQRGMSYFFPPEVMGSHIGNKLCHATSRQHSIEFRGLTALFGHMGIELDPVK
                     EGEAERAGFAKYTRLHQQLRPLLHSGDVYRVDTHDGTMLINGVVSETRDSAVFLVSQL
                     AMPTWSLPGVLRVPGLKPDARYRVTVLDEPPLLAGGGSGHTMRVQPAWLHESPVLSGE
                     WLANAGLTLPVLDPESALLLGFEEVR"
     misc_feature    complement(19166..21280)
                     /locus_tag="Rahaq2_0019"
                     /note="Alpha-galactosidase [Carbohydrate transport and
                     metabolism]; Region: GalA; COG3345"
                     /db_xref="CDD:225882"
     misc_feature    complement(19358..20530)
                     /locus_tag="Rahaq2_0019"
                     /note="Melibiase; Region: Melibiase; pfam02065"
                     /db_xref="CDD:251067"
     gene            complement(21428..22435)
                     /locus_tag="Rahaq2_0020"
                     /note="IMG reference gene:2506707045"
                     /db_xref="GeneID:11789772"
     CDS             complement(21428..22435)
                     /locus_tag="Rahaq2_0020"
                     /note="PFAM: Bacterial regulatory proteins, lacI family;
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198114.1"
                     /db_xref="GI:383187986"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11789772"
                     /translation="MSLKAIAKDLGISVTTVSRALNGYDDVSAETKARVQAAANVRGY
                     RPNTLARRLKMGKIDAVGLIFPFSSHPLSNSAFIEMVGCITRELAKHEIDLLLVPDEL
                     GTFSWRRLIESKRVDAMLVAHTLDNDPRLLDLQQRNFPFLALGRSGCLTQDYAWFDFD
                     NRAGMQMAVDHLAALGHQRIAFLGENNQQSFIGQRYQGYLDGLRANALAVNADYIHKI
                     TPSRRAGYQATQALLALPVPPTAIVCDCNMHGEGAALALHEAGLLLSGGVSLIIFDGL
                     PCDSVPDVAVTAVRQGTREAVGLQIANMTMSLIRNEPLSNLQVLWQPELQAGVTAHSP
                     R"
     misc_feature    complement(21431..22435)
                     /locus_tag="Rahaq2_0020"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(22274..22426)
                     /locus_tag="Rahaq2_0020"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(22274..22279,22283..22288,22295..22297,
                     22304..22306,22343..22345,22352..22357,22370..22372,
                     22379..22384,22388..22402,22424..22426))
                     /locus_tag="Rahaq2_0020"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(22277..22306)
                     /locus_tag="Rahaq2_0020"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(21461..22258)
                     /locus_tag="Rahaq2_0020"
                     /note="Ligand-binding domain of DNA transcription
                     repressors specific for raffinose (RafR) and
                     alpha-glucosides (AglR) which are members of the LacI-GalR
                     family of bacterial transcription regulators; Region:
                     PBP1_AglR_RafR_like; cd06271"
                     /db_xref="CDD:107266"
     misc_feature    complement(order(21614..21616,21698..21700,21851..21853,
                     21959..21970,22004..22009,22196..22198,22208..22210))
                     /locus_tag="Rahaq2_0020"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107266"
     gene            complement(22540..23202)
                     /locus_tag="Rahaq2_0021"
                     /note="IMG reference gene:2506707046"
                     /db_xref="GeneID:11789773"
     CDS             complement(22540..23202)
                     /locus_tag="Rahaq2_0021"
                     /note="PFAM: OmpA family"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein/peptidoglycan-associated
                     (lipo)protein"
                     /protein_id="YP_005198115.1"
                     /db_xref="GI:383187987"
                     /db_xref="InterPro:IPR006664"
                     /db_xref="InterPro:IPR006665"
                     /db_xref="InterPro:IPR006690"
                     /db_xref="GeneID:11789773"
                     /translation="MSKRLLVVAGVLCVTLGLSACTTNPYTGESEAGKSGIGAGIGAA
                     LGAGVGMLSSSKHDRGKGALIGAAAGAALGGGAGYYMDVQEAKLRDKMKGTGVSVTRQ
                     GDNIVLNMPNNVTFDTNSSTLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGTRAL
                     NMKLSQQRADGVGSALITQGVEGSRVRTTGAGPDNPIASNSTEAGKAQNRRVEITLSP
                     LQ"
     misc_feature    complement(22546..23202)
                     /locus_tag="Rahaq2_0021"
                     /note="putative outer membrane lipoprotein; Provisional;
                     Region: PRK10510"
                     /db_xref="CDD:182507"
     misc_feature    complement(22555..22866)
                     /locus_tag="Rahaq2_0021"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    complement(order(22573..22575,22585..22587,22711..22713,
                     22720..22725,22735..22737,22744..22749,22846..22851))
                     /locus_tag="Rahaq2_0021"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(23423..23866)
                     /locus_tag="Rahaq2_0022"
                     /note="IMG reference gene:2506707047"
                     /db_xref="GeneID:11789774"
     CDS             complement(23423..23866)
                     /locus_tag="Rahaq2_0022"
                     /note="PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_005198116.1"
                     /db_xref="GI:383187988"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11789774"
                     /translation="MIRAARPADTEAILMLWLRSSLLSHAFIAESYWIESLQMVREDF
                     LPKARTWVDCDQDDQVCGFISVLNQQFIGALFVEASHYGDGTAQRLMAAAKEEYPVLL
                     LEVYQQNDRAVSFYRKENFEITANTRHPGTDMPTYILRWHRPLSE"
     misc_feature    complement(23435..23866)
                     /locus_tag="Rahaq2_0022"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     misc_feature    complement(23504..23842)
                     /locus_tag="Rahaq2_0022"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     gene            complement(23863..24435)
                     /locus_tag="Rahaq2_0023"
                     /note="IMG reference gene:2506707048"
                     /db_xref="GeneID:11789775"
     CDS             complement(23863..24435)
                     /locus_tag="Rahaq2_0023"
                     /note="PFAM: Methyladenine glycosylase;
                     TIGRFAM: DNA-3-methyladenine glycosylase I"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="YP_005198117.1"
                     /db_xref="GI:383187989"
                     /db_xref="InterPro:IPR005019"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="GeneID:11789775"
                     /translation="MATTRCSWVSKEPIYLEYHDKEWGVPVKDGRELFEMLCLEGQQA
                     GLSWITVLRKRDGYRQNFHHFDPVRIAKMTDDDVERLVLDAGIIRHRGKIKAIISNAQ
                     AYLAMQAGGEDFSEFIWNFVGGQPVINNPLGPEGVPATTIVSDAMSKALKKKGFKFIG
                     STICYAFMQAAGLVNDHQSYCFCHPANQPS"
     misc_feature    complement(23881..24414)
                     /locus_tag="Rahaq2_0023"
                     /note="Methyladenine glycosylase; Region: Adenine_glyco;
                     pfam03352"
                     /db_xref="CDD:251892"
     gene            24627..26633
                     /locus_tag="Rahaq2_0024"
                     /note="IMG reference gene:2506707049"
                     /db_xref="GeneID:11789776"
     CDS             24627..26633
                     /locus_tag="Rahaq2_0024"
                     /note="PFAM: Autotransporter beta-domain; GDSL-like
                     Lipase/Acylhydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase/lecithinase/hemolysin"
                     /protein_id="YP_005198118.1"
                     /db_xref="GI:383187990"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="InterPro:IPR005546"
                     /db_xref="InterPro:IPR008265"
                     /db_xref="InterPro:IPR017186"
                     /db_xref="GeneID:11789776"
                     /translation="MAGKKKSILRLSQGAFAVALCLGLQASAQAFDQLYVFGDSLSDT
                     GNIGRWTFDSSSHQLYDEILANNIGTTLTPSSKGGLNYAEGGGVAVPGLDSDYTTQAQ
                     VQSYLASTGGQADPNGLYVHWIGGNDLAAAALSLNPVTAVEIATNSATQAASQVSDLL
                     KAGAGTVVVPTVPNIGLTPVLMEGVIQVGLLPVQQQALEAAYRYLNAQNTPDADARTG
                     AIHNALAAAAAEGSNIPLVQDIIGKGLAAAYDALKEVAGGLTDTYNTTEDIALAKTGG
                     NIARVDINGLFGEVVADPALYGFANTAGTACPVGTSASECTSGLPGFDSSKAFLFSDH
                     FHPTPQAHALIAQYMQSVLDGPLEASALSQGSLSLARNTQGLLDSRYQQLRTQDNDAG
                     TFGMFGGYAGQSADSKFSPSLGLGDGDLTSNSLNIGMDYQMTDRWMMGLMLSGSDDKD
                     DPTDHYSYRTRGWMATAFTGIKIAENGWINGDVHYGSLNYDDIKRRITLGPTTRTERG
                     ETDGKQIGGRVTAGWDFPVLPVLKTGPVAQYSWDYSSVDGYSEKGNNSTSMRFGDQTS
                     HSQIGALGWRVNAELGIVNPYAQVTYDRQFGDKTYSTTGAIKSTRTRFSRTTGEQDDD
                     WVDMTAGLNVQITHSISAFAAISQTTGLDSGEQTSYNAGLSARF"
     misc_feature    24681..25787
                     /locus_tag="Rahaq2_0024"
                     /note="Phospholipase/lecithinase/hemolysin [Lipid
                     metabolism / General function prediction only]; Region:
                     COG3240"
                     /db_xref="CDD:225780"
     misc_feature    24717..25685
                     /locus_tag="Rahaq2_0024"
                     /note="Triacylglycerol lipase-like subfamily of the SGNH
                     hydrolases, a diverse family of lipases and esterases. The
                     tertiary fold of the enzyme is substantially different
                     from that of the alpha/beta hydrolase family and unique
                     among all known hydrolases; its...; Region:
                     Triacylglycerol_lipase_like; cd01847"
                     /db_xref="CDD:238883"
     misc_feature    order(24744..24746,24882..24884,25005..25007,25623..25625,
                     25632..25634)
                     /locus_tag="Rahaq2_0024"
                     /note="active site"
                     /db_xref="CDD:238883"
     misc_feature    order(24744..24746,25623..25625,25632..25634)
                     /locus_tag="Rahaq2_0024"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238883"
     misc_feature    order(24744..24746,24882..24884,25005..25007)
                     /locus_tag="Rahaq2_0024"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238883"
     misc_feature    25392..26630
                     /locus_tag="Rahaq2_0024"
                     /note="outer membrane autotransporter barrel domain;
                     Region: autotrans_barl; TIGR01414"
                     /db_xref="CDD:233402"
     misc_feature    25905..26630
                     /locus_tag="Rahaq2_0024"
                     /note="Autotransporter beta-domain; Region:
                     Autotransporter; cl17461"
                     /db_xref="CDD:266702"
     gene            26800..27714
                     /locus_tag="Rahaq2_0025"
                     /note="IMG reference gene:2506707050"
                     /db_xref="GeneID:11789777"
     CDS             26800..27714
                     /locus_tag="Rahaq2_0025"
                     /note="PFAM: Glycyl-tRNA synthetase alpha subunit;
                     TIGRFAM: glycyl-tRNA synthetase, tetrameric type, alpha
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit alpha"
                     /protein_id="YP_005198119.1"
                     /db_xref="GI:383187991"
                     /db_xref="InterPro:IPR002310"
                     /db_xref="InterPro:IPR006194"
                     /db_xref="GeneID:11789777"
                     /translation="MQKFDTKTFQGLILTLQDYWAQQGCTIVQPLDMEVGAGTSHPMT
                     SLRALGPEPFAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVMIKPSPENIQELYLGSL
                     KELGLDPLIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVT
                     GEITYGLERLAMYIQGVDSVYDLVWSNGPLGKTTYGDVFHQNEVEQSTYNFEYADVDF
                     LFTCFEQHEKEAQTLLALEKPLALPAYERILKAAHCFNLLDARKAISVTERQRYILRI
                     RTLTKAVAEAYYASREVLGFPMCKKNEK"
     misc_feature    26821..27675
                     /locus_tag="Rahaq2_0025"
                     /note="Class II Glycyl-tRNA synthetase (GlyRS) alpha
                     subunit core catalytic domain. GlyRS functions as a
                     homodimer in eukaryotes, archaea and some bacteria and as
                     a heterotetramer in the remainder of prokaryotes and in
                     arabidopsis. It is responsible for the...; Region:
                     GlyRS_alpha_core; cd00733"
                     /db_xref="CDD:238375"
     misc_feature    order(26827..26829,26839..26841,26851..26853,26875..26880,
                     26884..26886,26890..26901,26947..26949,26974..26976,
                     26986..26988,27034..27036,27352..27354,27403..27405,
                     27412..27417,27436..27438,27442..27444,27451..27453,
                     27460..27465,27472..27477,27484..27486,27493..27495,
                     27505..27507,27517..27528,27535..27537,27547..27549)
                     /locus_tag="Rahaq2_0025"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238375"
     misc_feature    26872..26895
                     /locus_tag="Rahaq2_0025"
                     /note="motif 1; other site"
                     /db_xref="CDD:238375"
     misc_feature    order(26908..26910,26914..26916,26989..26991,27037..27039,
                     27043..27045,27049..27057,27220..27225,27235..27237,
                     27283..27288,27292..27297,27301..27306)
                     /locus_tag="Rahaq2_0025"
                     /note="active site"
                     /db_xref="CDD:238375"
     misc_feature    26986..26997
                     /locus_tag="Rahaq2_0025"
                     /note="motif 2; other site"
                     /db_xref="CDD:238375"
     misc_feature    27295..27306
                     /locus_tag="Rahaq2_0025"
                     /note="motif 3; other site"
                     /db_xref="CDD:238375"
     gene            27724..29793
                     /locus_tag="Rahaq2_0026"
                     /note="IMG reference gene:2506707051"
                     /db_xref="GeneID:11789778"
     CDS             27724..29793
                     /locus_tag="Rahaq2_0026"
                     /note="PFAM: Glycyl-tRNA synthetase beta subunit; DALR
                     anticodon binding domain;
                     TIGRFAM: glycyl-tRNA synthetase, tetrameric type, beta
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit beta"
                     /protein_id="YP_005198120.1"
                     /db_xref="GI:383187992"
                     /db_xref="InterPro:IPR002311"
                     /db_xref="InterPro:IPR006194"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR015944"
                     /db_xref="GeneID:11789778"
                     /translation="MTEKTFLVEIGTEELPPKALRSLAESFAANLTAELDAANLPHGD
                     VKWFAAPRRLALKVSGLHESQADREVEKRGPAVAQAFDAEGKPSKAAEGWARGCGITV
                     DQADRLVTDKGEWLVYRAHVKGESAQQLLPAMIATSLAKLPIPKLMRWGDSDVQFVRP
                     VHTVTLLLGDELIPAKILGIDSARTLRGHRFMGEPEFTIDNADQYPQILLERGKVIAD
                     YEQRKTLIKQDAEKAAKEIGGIADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEA
                     LVYTMKGDQKYFPVYDAAGKLLPNFIFVANIESKDPQQIISGNEKVVRPRLADAEFFF
                     NTDRKKRLEDNLPRLETVLFQKQLGTLRDKTDRIQALSGWIADKIGANVENAKRAGLL
                     SKCDLMTNMVFEFTDTQGVMGMHYARHDGEQEEVAVALNEQYQPRFAGDELPASLVAC
                     ALAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLPLDLQTLTEEAV
                     RLYGDKLTNARVVDDVVDFMLGRFRAWYQEEGHAVDTIQAVLARRPTKPADFDARVKA
                     VSYFRTLDEAATLAAANKRVSNILAKSTDVLLDHVHASVLKEPAELKLATHLVVLRDK
                     LEPLFAAGQYKEALVELAALRETVDTFFDTVMVMDENEAVRINRLTLLSKLRELFLQV
                     ADISLLQ"
     misc_feature    27733..29790
                     /locus_tag="Rahaq2_0026"
                     /note="glycyl-tRNA synthetase subunit beta; Validated;
                     Region: glyS; PRK01233"
                     /db_xref="CDD:234925"
     misc_feature    27739..29382
                     /locus_tag="Rahaq2_0026"
                     /note="Glycyl-tRNA synthetase beta subunit; Region:
                     tRNA_synt_2f; pfam02092"
                     /db_xref="CDD:251082"
     misc_feature    29467..29760
                     /locus_tag="Rahaq2_0026"
                     /note="Anticodon-binding domain of class Ia aminoacyl tRNA
                     synthetases and similar domains; Region:
                     Anticodon_Ia_like; cl12020"
                     /db_xref="CDD:264512"
     gene            30253..30975
                     /locus_tag="Rahaq2_0027"
                     /note="IMG reference gene:2506707052"
                     /db_xref="GeneID:11789779"
     CDS             30253..30975
                     /locus_tag="Rahaq2_0027"
                     /note="PFAM: Protein of unknown function (DUF3053)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198121.1"
                     /db_xref="GI:383187993"
                     /db_xref="InterPro:IPR021413"
                     /db_xref="GeneID:11789779"
                     /translation="MAVGIRSGAFSRWLAPFIALLVVFQLTACGDKEPEQRKAFIDYL
                     QNTVMRSGQNLPSLSEDQKQRFGNYANDYGIILSFSRQMKGAVEGSLVPVVSAIGQVR
                     TPQDYMTQRSALQQAASTLSLLNAQLRDSKVKADTAMAALKQPDDLKAVYSQVYNSVV
                     TQPANVLTPLVPALQSFTQDIVSVGDFLQQQGTQVAFANGGVQFPTQQQATQYNTMMS
                     NLVGKQQTLLQAQKVAQGDFSN"
     misc_feature    30283..30960
                     /locus_tag="Rahaq2_0027"
                     /note="Protein of unknown function (DUF3053); Region:
                     DUF3053; pfam11254"
                     /db_xref="CDD:151696"
     gene            31391..31750
                     /locus_tag="Rahaq2_0028"
                     /note="IMG reference gene:2506707053"
                     /db_xref="GeneID:11789780"
     CDS             31391..31750
                     /locus_tag="Rahaq2_0028"
                     /note="PFAM: Phosphoenolpyruvate-dependent sugar
                     phosphotransferase system, EIIA 2"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system
                     mannitol/fructose-specifc IIA component (Ntr-type)"
                     /protein_id="YP_005198122.1"
                     /db_xref="GI:383187994"
                     /db_xref="InterPro:IPR002178"
                     /db_xref="InterPro:IPR016152"
                     /db_xref="GeneID:11789780"
                     /translation="MRNLLERKCITQDYIQAIKDTTCEIGPYYLLAPGIAMPHARPEC
                     GALHTALSLTLLREAVSFSADSQPVKLLIGLAAKDSDSHIEAIQSLSEMLCEDDVIDE
                     LLNAKDTRELINIIQRY"
     misc_feature    31400..31738
                     /locus_tag="Rahaq2_0028"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    order(31451..31453,31505..31507)
                     /locus_tag="Rahaq2_0028"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    31505..31507
                     /locus_tag="Rahaq2_0028"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            31781..33184
                     /locus_tag="Rahaq2_0029"
                     /note="IMG reference gene:2506707054"
                     /db_xref="GeneID:11789781"
     CDS             31781..33184
                     /locus_tag="Rahaq2_0029"
                     /note="PFAM: Phosphotransferase system, EIIC; PTS system,
                     Lactose/Cellobiose specific IIB subunit;
                     TIGRFAM: PTS system, mannitol-specific IIC component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannitol-specific transporter subunit
                     IIC"
                     /protein_id="YP_005198123.1"
                     /db_xref="GI:383187995"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR003501"
                     /db_xref="InterPro:IPR013011"
                     /db_xref="InterPro:IPR013014"
                     /db_xref="GeneID:11789781"
                     /translation="MANKSIRARVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWT
                     PNSHFGQLVSPMITYLLPLMIGSTGGHLMGGKRGAVMGGIGTMGVIVGADIPMFIGAM
                     VMGPLGGYLIKVVDKALEKRIPAGFEMVINNFSLGILGMLLCLLAYEVIGPAVMEANN
                     FVKQGIEALVATGYLPLLSVINEPAKVLFLNNAIDQGVYYPLGMQDTAVAGKSIYFMV
                     ASNPGPGLGILLAFSLFGKGLSKKSAPGAMIIHFLGGIHELYFPYVLMKPLMIIAMIA
                     GGMTGIYVFELFGAGLVAGPSPGSIFAYLALTPRGGFIGTCAGVLAGTVVSFVVASAI
                     LKFDKSPAEDSFADSQAASKKRKAEGKSGIQPVAASIRLIAFVCDAGMGSSAMGATTF
                     RKKLQKAGYEIEVKHYSIENIPADADIIVTHASLEGRAQRVTDRPLILIKNYLGDPAL
                     DVLFTDITSPAQQGATA"
     misc_feature    31781..33169
                     /locus_tag="Rahaq2_0029"
                     /note="Phosphotransferase system, mannitol-specific IIBC
                     component [Carbohydrate transport and metabolism]; Region:
                     MtlA; COG2213"
                     /db_xref="CDD:225123"
     misc_feature    31805..32812
                     /locus_tag="Rahaq2_0029"
                     /note="PTS system, mannitol-specific IIC component;
                     Region: mtlA; TIGR00851"
                     /db_xref="CDD:129930"
     misc_feature    32900..33142
                     /locus_tag="Rahaq2_0029"
                     /note="PTS_IIB_mannitol: subunit IIB of enzyme II (EII) of
                     the mannitol-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In this system, EII is a
                     mannitol-specific permease with two cytoplasmic domains
                     (IIA and IIB) and a transmembrane...; Region:
                     PTS_IIB_mannitol; cd05567"
                     /db_xref="CDD:99909"
     misc_feature    32909..32935
                     /locus_tag="Rahaq2_0029"
                     /note="active site"
                     /db_xref="CDD:99909"
     misc_feature    order(32912..32923,32927..32935)
                     /locus_tag="Rahaq2_0029"
                     /note="P-loop; other site"
                     /db_xref="CDD:99909"
     misc_feature    32912..32914
                     /locus_tag="Rahaq2_0029"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99909"
     gene            33181..34449
                     /locus_tag="Rahaq2_0030"
                     /note="IMG reference gene:2506707055"
                     /db_xref="GeneID:11789782"
     CDS             33181..34449
                     /locus_tag="Rahaq2_0030"
                     /note="PFAM: Alcohol dehydrogenase GroES-like domain;
                     Zinc-binding dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="theronine dehydrogenase-like Zn-dependent
                     dehydrogenase"
                     /protein_id="YP_005198124.1"
                     /db_xref="GI:383187996"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11789782"
                     /translation="MKTKVAAIYGKKDVRIREFELPDITDDELLVNVVSDSVCLSTYK
                     AALLGEEHKRVPENTADHPAITGHECAGVIVQVGKNLTGRFEAGKRFVLQPAMGLPSG
                     YSAGYSYETFGGNATYMIIPKQAIDLGCVLPYEGRYFAAASLAEPMCCIIGAYHASYH
                     TTQYVYEHQMGIKAGGNLALLACAGPMGIGAIDYAINGDVRPARIVVVDIDQQRLARA
                     EQLLPVAMAAEKGIELVYINSKTLSDPATALRDMTGGAGFDDVFVYAAVAEVIELGDA
                     LLGEDGCLNFFAGPVDKNFRVPFNFYNVHYASTHIVGTSGGSTGDMEEALALTAAGRI
                     QPSYMITHIGGLDAVPETVLNLPDISGGKKLIYNGISLPLTAIDDFAELGKTDPLFAL
                     LAERVAPTHGVWNEQAEQALLNHFGVSTGL"
     misc_feature    33181..34425
                     /locus_tag="Rahaq2_0030"
                     /note="L-sorbose-1-phosphate reductase; Region:
                     sorbose_phosphate_red; cd08238"
                     /db_xref="CDD:176200"
     misc_feature    33181..34233
                     /locus_tag="Rahaq2_0030"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    order(33295..33303,33310..33312,33616..33618,33628..33630,
                     33727..33744,33805..33810,33820..33822,33895..33897,
                     33970..33975,33979..33981,34039..34044,34120..34128)
                     /locus_tag="Rahaq2_0030"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176200"
     misc_feature    order(33295..33297,33301..33303,33382..33384,33616..33618)
                     /locus_tag="Rahaq2_0030"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176200"
     gene            34492..35019
                     /locus_tag="Rahaq2_0031"
                     /note="IMG reference gene:2506707056"
                     /db_xref="GeneID:11789783"
     CDS             34492..35019
                     /locus_tag="Rahaq2_0031"
                     /note="PFAM: Mannitol repressor"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198125.1"
                     /db_xref="GI:383187997"
                     /db_xref="InterPro:IPR007761"
                     /db_xref="GeneID:11789783"
                     /translation="MTVLTEDQVLETLSGQTNLNDFLHAANAILLSGIKQFLPHLFIN
                     NDEDIREFAVKPLLAKSGPLDSIDVSLRLIYALGKIQKPVYADILLFSQLDEHLKAGS
                     DIVEFHEETAYEFIQNLSCVSHNTLMFQSVEKMKFAGFDIFNNARYGNLVRTALSLAV
                     TDLLKELTNERDADH"
     misc_feature    34501..34995
                     /locus_tag="Rahaq2_0031"
                     /note="Mannitol repressor; Region: MtlR; cl11450"
                     /db_xref="CDD:264373"
     gene            34997..35704
                     /locus_tag="Rahaq2_0032"
                     /note="IMG reference gene:2506707057"
                     /db_xref="GeneID:11789784"
     CDS             34997..35704
                     /locus_tag="Rahaq2_0032"
                     /codon_start=1
                     /transl_table=11
                     /product="panthothenate kinase"
                     /protein_id="YP_005198126.1"
                     /db_xref="GI:383187998"
                     /db_xref="InterPro:IPR004566"
                     /db_xref="GeneID:11789784"
                     /translation="MNVTLTINGLTTQAFFPDSDIEQLHLPLLRRFSRQQRLLNQPLI
                     VFLVAPPGTGKSTLSAFWQKLSNETPDLVPLQTLPMDGFHQRNAWLDAHNLRHRKGAP
                     ETFDVAKLRHALMALREPGSNWPEYSRMLHEPVDGAIRVTAPLLIVEGNWLLLEDDGW
                     RQLVEYCDVSVFIHASPDILRDRLTERKIRGGLTPAQAGEFYDVTDGPNVTRVLAHSL
                     RADINLHMRDDGSYHSE"
     misc_feature    35024..35698
                     /locus_tag="Rahaq2_0032"
                     /note="nucleoside triphosphate hydrolase domain-containing
                     protein; Reviewed; Region: PRK09270"
                     /db_xref="CDD:236442"
     misc_feature    35156..35167
                     /locus_tag="Rahaq2_0032"
                     /note="active site"
                     /db_xref="CDD:238977"
     gene            35819..36613
                     /locus_tag="Rahaq2_0033"
                     /note="IMG reference gene:2506707058"
                     /db_xref="GeneID:11789785"
     CDS             35819..36613
                     /locus_tag="Rahaq2_0033"
                     /note="PFAM: DSBA-like thioredoxin domain"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-disulfide isomerase"
                     /protein_id="YP_005198127.1"
                     /db_xref="GI:383187999"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017936"
                     /db_xref="GeneID:11789785"
                     /translation="MKRQMMTLLASLVLAPTLAAAADSATADFTPAQQEAIGKIAADY
                     MLQHPEILVQVSQKLQAQQADQQQQQTLSAVLANSKALVNDPATPSYGPKDANVAFVE
                     FFDYQCLYCSHMAPVVEQTVKANPNVRFVFKEWPIFGDRWKASITAAETGMAIWKEKG
                     SQAYFDYHNSIYRSGHDEGKLTDADIAGAVKAAKATAPTDAQRKATHEAIAANDELAR
                     TLGFSGTPGFVVMPTRGATAENTSVLPGAVSAEELQAAIVKAQGGK"
     misc_feature    35831..36604
                     /locus_tag="Rahaq2_0033"
                     /note="Protein-disulfide isomerase [Posttranslational
                     modification, protein turnover, chaperones]; Region: DsbG;
                     COG1651"
                     /db_xref="CDD:224565"
     misc_feature    36092..36589
                     /locus_tag="Rahaq2_0033"
                     /note="DsbA family, Com1-like subfamily; composed of
                     proteins similar to Com1, a 27-kDa outer
                     membrane-associated immunoreactive protein originally
                     found in both acute and chronic disease strains of the
                     pathogenic bacteria Coxiella burnetti. It contains a
                     CXXC...; Region: DsbA_Com1_like; cd03023"
                     /db_xref="CDD:239321"
     misc_feature    order(36140..36142,36149..36151)
                     /locus_tag="Rahaq2_0033"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239321"
     gene            36847..37026
                     /locus_tag="Rahaq2_0034"
                     /note="IMG reference gene:2506707059"
                     /db_xref="GeneID:11789786"
     CDS             36847..37026
                     /locus_tag="Rahaq2_0034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198128.1"
                     /db_xref="GI:383188000"
                     /db_xref="GeneID:11789786"
                     /translation="MIVQFADYAALKKNERRENRSVKEATGLHKVIDLSAWQEFAEYE
                     KAKARVQEAAAKLDW"
     gene            37060..38619
                     /locus_tag="Rahaq2_0035"
                     /note="IMG reference gene:2506707060"
                     /db_xref="GeneID:11789787"
     CDS             37060..38619
                     /locus_tag="Rahaq2_0035"
                     /note="PFAM: Cytidine and deoxycytidylate deaminase
                     zinc-binding region"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxycytidylate deaminase"
                     /protein_id="YP_005198129.1"
                     /db_xref="GI:383188001"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR015517"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="GeneID:11789787"
                     /translation="MTVPAQKIIPIEKLNRSTEHDSIDALQRHRSQELIIGLCGASGS
                     GVNTLKEKLIEQLTAGSYHVEHIRLSTLMANTKPHDIASELISLKGYEHYVQLQDLGD
                     ALRKEHGAMIAAQMAIRNISSLRNKLLELRQAEGAHGKTTSKVAYIIDQFKHPSEIEL
                     LREVYRNNFYLLGVLRTLKERRSNLRRDGISRDDIDKLVERDRRSPLKYGQQVEETLQ
                     CSDYFIKNISDIRIENAVQRFVNLIHGAKNLTPTRDETGLFNASTAALRSACLSRQVG
                     AAIMDDNNNILATGCNDVPTAGGGLYSCENVDNDKRCFADGGCQNDQHKNLVRKEIDV
                     VLQKFDCTRTQFTTISEEIMKTTKLKSLIEYSRAIHAEMDAITTMARIAQVSTVGKTL
                     YCTTYPCHNCARHIIAAGIKRVVYIEPYEKSLAEDLHGDSISHGEPAGDDISKVVFDN
                     FEGTAPRRYAKFFGYNRPRKNQQGKSITYDIRTSHHVDSQQLYSYTDFELKIVKDVTT
                     KIGKEISLPPA"
     misc_feature    37159..37806
                     /locus_tag="Rahaq2_0035"
                     /note="Dephospho-CoA kinase [Coenzyme metabolism]; Region:
                     CoaE; COG0237"
                     /db_xref="CDD:223315"
     misc_feature    37159..>37251
                     /locus_tag="Rahaq2_0035"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    37819..38328
                     /locus_tag="Rahaq2_0035"
                     /note="Deoxycytidylate deaminase domain. Deoxycytidylate
                     deaminase catalyzes the deamination of dCMP to dUMP,
                     providing the nucleotide substrate for thymidylate
                     synthase. The enzyme binds Zn++, which is required for
                     catalytic activity. The activity of the...; Region:
                     deoxycytidylate_deaminase; cd01286"
                     /db_xref="CDD:238613"
     misc_feature    order(37936..37938,38167..38169,38173..38175,38251..38256,
                     38263..38265)
                     /locus_tag="Rahaq2_0035"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238613"
     misc_feature    order(38167..38169,38173..38175,38254..38256,38263..38265)
                     /locus_tag="Rahaq2_0035"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238613"
     gene            39121..41034
                     /locus_tag="Rahaq2_0036"
                     /note="IMG reference gene:2506707061"
                     /db_xref="GeneID:11789788"
     CDS             39121..41034
                     /locus_tag="Rahaq2_0036"
                     /note="PFAM: Phosphotransferase system, EIIC; PTS system,
                     Lactose/Cellobiose specific IIB subunit;
                     Phosphoenolpyruvate-dependent sugar phosphotransferase
                     system, EIIA 2;
                     TIGRFAM: PTS system, mannitol-specific IIC component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannitol-specific transporter subunit
                     IIC"
                     /protein_id="YP_005198130.1"
                     /db_xref="GI:383188002"
                     /db_xref="InterPro:IPR002178"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR003501"
                     /db_xref="InterPro:IPR013011"
                     /db_xref="InterPro:IPR013014"
                     /db_xref="InterPro:IPR016152"
                     /db_xref="GeneID:11789788"
                     /translation="MFSPDVKIKVQNFGRFLSNMVMPNIGAFIAWGIITALFIPTGWI
                     PNETLAKLVGPMITYLLPLLIGFTGGRLVGGDRGGVVGAITVMGVIVGADMPMFLGAM
                     IAGPLGGWCIKRFDRWVDGKIKSGFEMLVNNFSAGIIGMLLAILAFLAIGPLVEALSK
                     VLAAGVHIMVIHNLLPLASIFVEPAKILFLNNAINHGIFSPLGIQQATETGKSIFFLI
                     EANPGPGMGVLMAYMFFGRGSAKQSAGGAAIIHFLGGIHEIYFPYVLMNPRLLLAVIL
                     GGMTGVFTLTLLNGGLVSPASPGSILAVLAMTPKGAYFANIAAIVAAFAVSFVISALL
                     LKTTKAKDGDDLDEATRRMQDMKAQSKGGKPAVAGVAGDLSTVRKIIVACDAGMGSSA
                     MGAGVLRKKVQDAGLTNISVTNSAINNLPDDVDLVITHRDLTERAMRQVPHAQHISLT
                     NFLDSGLYTDLTSRLVEVNKASQYKEKVTTTLGDSIVADNENENLFRISESNIFLGLN
                     AATKEDAIRFAGEQLVKGGYVQAEYVEAMLAREQLTSTYLGESIAVPHGTIEAKDRVL
                     KTGIVFCQYPAGIRWGDDEDDRARLVVGIAARNNEHINVITKLTTALDEDGVIERLAN
                     TTSVEEVLTILRG"
     misc_feature    39121..41031
                     /locus_tag="Rahaq2_0036"
                     /note="PTS system mannitol-specific transporter subunit
                     IICBA; Provisional; Region: PRK15083"
                     /db_xref="CDD:237905"
     misc_feature    39145..40158
                     /locus_tag="Rahaq2_0036"
                     /note="PTS system, mannitol-specific IIC component;
                     Region: mtlA; TIGR00851"
                     /db_xref="CDD:129930"
     misc_feature    40252..40515
                     /locus_tag="Rahaq2_0036"
                     /note="PTS_IIB_mannitol: subunit IIB of enzyme II (EII) of
                     the mannitol-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In this system, EII is a
                     mannitol-specific permease with two cytoplasmic domains
                     (IIA and IIB) and a transmembrane...; Region:
                     PTS_IIB_mannitol; cd05567"
                     /db_xref="CDD:99909"
     misc_feature    40267..40293
                     /locus_tag="Rahaq2_0036"
                     /note="active site"
                     /db_xref="CDD:99909"
     misc_feature    order(40270..40281,40285..40293)
                     /locus_tag="Rahaq2_0036"
                     /note="P-loop; other site"
                     /db_xref="CDD:99909"
     misc_feature    40270..40272
                     /locus_tag="Rahaq2_0036"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99909"
     misc_feature    40612..41025
                     /locus_tag="Rahaq2_0036"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    order(40738..40740,40786..40788)
                     /locus_tag="Rahaq2_0036"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    40786..40788
                     /locus_tag="Rahaq2_0036"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            41177..42325
                     /locus_tag="Rahaq2_0037"
                     /note="IMG reference gene:2506707062"
                     /db_xref="GeneID:11789789"
     CDS             41177..42325
                     /locus_tag="Rahaq2_0037"
                     /note="PFAM: Mannitol dehydrogenase C-terminal domain;
                     Mannitol dehydrogenase Rossmann domain"
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol-1-phosphate/altronate dehydrogenase"
                     /protein_id="YP_005198131.1"
                     /db_xref="GI:383188003"
                     /db_xref="InterPro:IPR000669"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013118"
                     /db_xref="InterPro:IPR013131"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023027"
                     /db_xref="InterPro:IPR023028"
                     /db_xref="GeneID:11789789"
                     /translation="MKALHFGAGNIGRGFIGKLLADAGIELTFADVSPALLDALNSRK
                     GYDVHVVGEQATIEPVSNVNAVNSAGQEAINLIAEVDLVTTAVGPTVLEKIAPNVAKG
                     LVLRHQQGNEKPLNIIACENMVRGTSQFKQHVFNALPEEEKAWVEAHIGFVDSAVDRI
                     VPPAAAGTTDPLEVTVETFSEWIVDKTQFKGDLPQIAGMELTDNLMAFVERKLFTLNT
                     GHAITAYLGQQAGHATIRDAILDEKVRLVVRGAMEESGEVLIRRYGFDPEKHFAYIEK
                     ILTRFENPYLHDDVERVGRQPLRKLSAGDRLIKPLLGTQEYRLPNDNLVRGIAAAMHY
                     RSEQDPQAKELVELLDKVGPKAALAQISGLPEDGEVVAKAVALYESMH"
     misc_feature    41177..42319
                     /locus_tag="Rahaq2_0037"
                     /note="mannitol-1-phosphate 5-dehydrogenase; Provisional;
                     Region: PRK02318"
                     /db_xref="CDD:235031"
     misc_feature    41177..41545
                     /locus_tag="Rahaq2_0037"
                     /note="Mannitol dehydrogenase Rossmann domain; Region:
                     Mannitol_dh; pfam01232"
                     /db_xref="CDD:144722"
     misc_feature    41618..42295
                     /locus_tag="Rahaq2_0037"
                     /note="Mannitol dehydrogenase C-terminal domain; Region:
                     Mannitol_dh_C; pfam08125"
                     /db_xref="CDD:149275"
     gene            42276..43010
                     /locus_tag="Rahaq2_0038"
                     /note="IMG reference gene:2506707063"
                     /db_xref="GeneID:11793740"
     CDS             42276..43010
                     /locus_tag="Rahaq2_0038"
                     /note="PFAM: Mannitol repressor"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198132.1"
                     /db_xref="GI:383188004"
                     /db_xref="InterPro:IPR007761"
                     /db_xref="GeneID:11793740"
                     /translation="MAKLWRKPSLSTNRCTDTAFILISPIPGKESPVGQDVSARHARI
                     MDDARGAVSTGSLMQVSPMEKAQAFENRVLEKLNAGKTVRSFLMTAVELLAEALDILV
                     VQVFRKDDYAVKYAVEPLLTGTGPLGDLSVRLKLIYALGVISRHEYEDAELLMALREE
                     LNYDGEEYRFTDDEILGPFGELHCVAELPPAPTFLKPGEADESLIAMQRQRYQQIVRS
                     TMVLSVTGLIAHISNQQPSRLSPVQK"
     misc_feature    42474..42983
                     /locus_tag="Rahaq2_0038"
                     /note="mannitol repressor protein; Provisional; Region:
                     mtlR; PRK11001"
                     /db_xref="CDD:236817"
     gene            43037..43150
                     /locus_tag="Rahaq2_0039"
                     /note="IMG reference gene:2506707064"
                     /db_xref="GeneID:11789790"
     CDS             43037..43150
                     /locus_tag="Rahaq2_0039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198133.1"
                     /db_xref="GI:383188005"
                     /db_xref="GeneID:11789790"
                     /translation="MRWLRSVTRITYLCKLIGTPSLAAFLQPELFWGIRFS"
     gene            complement(43143..43751)
                     /locus_tag="Rahaq2_0040"
                     /note="IMG reference gene:2506707065"
                     /db_xref="GeneID:11789791"
     CDS             complement(43143..43751)
                     /locus_tag="Rahaq2_0040"
                     /note="PFAM: LysE type translocator"
                     /codon_start=1
                     /transl_table=11
                     /product="putative threonine efflux protein"
                     /protein_id="YP_005198134.1"
                     /db_xref="GI:383188006"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="GeneID:11789791"
                     /translation="MIDTAFVSYVTVMSITPGPNNLLLAASGVNFGLRRSVPMMLGIT
                     LGCVVQCALMTSMLAILLSWMTVVRLPMAAVGCAYLFWLSWKIYRSGSPKEGAKQQPM
                     NMINGALFQAVNPKAWLMATNVAILFTPPDGNMLHHTLLICIGFALINLPCILVWVVM
                     GDRLRQALRVEWKLKMFNTIMGGMMALTALWLLVGEVRHALN"
     misc_feature    complement(43173..43739)
                     /locus_tag="Rahaq2_0040"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            43896..45389
                     /locus_tag="Rahaq2_0041"
                     /note="IMG reference gene:2506707066"
                     /db_xref="GeneID:11793741"
     CDS             43896..45389
                     /locus_tag="Rahaq2_0041"
                     /note="PFAM: Aminotransferase class I and II; Bacterial
                     regulatory proteins, gntR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator with HTH domain and
                     aminotransferase domain"
                     /protein_id="YP_005198135.1"
                     /db_xref="GI:383188007"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11793741"
                     /translation="MTDTADFSDTRYNQLAEQLADAIRRGTLAPGSRLPSVRRSAQTW
                     SVSINTVVAAYRRLEDRGFIEARPQSGFYVRAALPALHHQPQEQPQTPAAEPADEVLD
                     LIDKVFASQIDPTYTNLSLACPQSNDFYPTGKLGRIMSSLLRRQPNLIGQYALPPGSP
                     ALRQQIARRALALGMILEPADITITHGCMEALQLALRVTTKPGDSVGLETPTYFYLLP
                     MLASLGLKAVEIPTDPQTGLSLDVLEMLLTEKRLNAVIAMPTAQNPLGFTMPLAAKKR
                     LARLMNDHQVPLIEDGLYAEIQFGATLSPAVKAFDRDGWILFCTSFTKTLAPDFRIGW
                     VDGGRFADKLHKLKAVSSMAESALLSQTLTLFLESGGYDHHLRVLRRRYASQVEQARA
                     LIARHFPQGTRATQPAGGFVIWVDFPPGVDCVTLFRQLLKDKICMTPGQLYSPSGRYS
                     NGLRLSCCYVFDTRYISAMIRIGERACEMCGLPPGLEATGTDYFPDK"
     misc_feature    43923..45332
                     /locus_tag="Rahaq2_0041"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    43923..44120
                     /locus_tag="Rahaq2_0041"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(43923..43925,43929..43931,43998..44000,44004..44009,
                     44031..44045,44049..44054,44061..44063,44091..44096,
                     44100..44111)
                     /locus_tag="Rahaq2_0041"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    44274..45284
                     /locus_tag="Rahaq2_0041"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(44454..44462,44532..44534,44682..44684,44775..44777,
                     44856..44858,44862..44867,44886..44888)
                     /locus_tag="Rahaq2_0041"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(44463..44465,44562..44564,44754..44756,44880..44888,
                     44973..44975,44982..44984)
                     /locus_tag="Rahaq2_0041"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    44865..44867
                     /locus_tag="Rahaq2_0041"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(45358..45780)
                     /locus_tag="Rahaq2_0042"
                     /note="IMG reference gene:2506707067"
                     /db_xref="GeneID:11789792"
     CDS             complement(45358..45780)
                     /locus_tag="Rahaq2_0042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198136.1"
                     /db_xref="GI:383188008"
                     /db_xref="GeneID:11789792"
                     /translation="MKPTFSRDHRIEMHLNNGMFNGKPLYIHYTSAETFPKIIASRCF
                     MARPNYDRRGAAAKSGIYMVRGRHAFNALQAFQQLFLGEPKYRDSAKYCFLFTFNSEP
                     YLTGNLISAGSTVEELIHPGNLSFSKINIIYQGSNPFL"
     gene            45947..46306
                     /locus_tag="Rahaq2_0043"
                     /note="IMG reference gene:2506707068"
                     /db_xref="GeneID:11789793"
     CDS             45947..46306
                     /locus_tag="Rahaq2_0043"
                     /note="PFAM: Protein of unknown function (DUF2810)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198137.1"
                     /db_xref="GI:383188009"
                     /db_xref="InterPro:IPR021230"
                     /db_xref="GeneID:11789793"
                     /translation="MKEVEKAEIKRLSDMLDALNHKDATVIQAGNAELIASHEEEKEK
                     LAAEIARLKEVRVKKLSTEAQKLEKLFSREITKKEQADMGTLKKTVRGIVVVHPMTAL
                     GREMGLKAVTGFAKKAF"
     misc_feature    45953..46303
                     /locus_tag="Rahaq2_0043"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11020"
                     /db_xref="CDD:182904"
     gene            complement(46390..47328)
                     /locus_tag="Rahaq2_0044"
                     /note="IMG reference gene:2506707069"
                     /db_xref="GeneID:11789794"
     CDS             complement(46390..47328)
                     /locus_tag="Rahaq2_0044"
                     /note="PFAM: Transposase IS116/IS110/IS902 family;
                     Transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005198138.1"
                     /db_xref="GI:383188010"
                     /db_xref="InterPro:IPR002525"
                     /db_xref="InterPro:IPR003346"
                     /db_xref="GeneID:11789794"
                     /translation="MNQSPKAFVGVDISKETFDVFINVGNFYQKFTNNQTGHVDFINL
                     LKNYEVAQIVMEATGRYHCVLAANLSVENYPVSVVNPRQVKHFSLSLGNLAKTDKLDA
                     MVLSRFAQVVLPPLTVASDEQTQRLAQMVTRRRQLIDMRTMEKNRLDGVHLDVAELIH
                     HHIEWLNSQIKDLDDDIGRQLRVMPLWQEKAKILSSVKGVGPTTTATLLALLPELGTL
                     SRRKISALVGVCPYSHDSGKLKGKRAIWGGRSAVRAALYMAALVAKKNNKEIKRFYDG
                     LIARGKLKKVALTACIRKLVTILNAMVRDGREWAAN"
     misc_feature    complement(46888..47307)
                     /locus_tag="Rahaq2_0044"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    complement(46396..47304)
                     /locus_tag="Rahaq2_0044"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(46504..46758)
                     /locus_tag="Rahaq2_0044"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(47659..48339)
                     /locus_tag="Rahaq2_0045"
                     /note="IMG reference gene:2506707070"
                     /db_xref="GeneID:11789795"
     CDS             complement(47659..48339)
                     /locus_tag="Rahaq2_0045"
                     /note="PFAM: MOSC domain; 3-alpha domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198139.1"
                     /db_xref="GI:383188011"
                     /db_xref="InterPro:IPR005163"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015808"
                     /db_xref="GeneID:11789795"
                     /translation="MHYPDVYIGTIEQYPDFSPSAIAKRQVDGGVALTPCGLEGDQQA
                     EKAYHGGADRALCHFPREHYAWLRQQFPEEEDRFHPPAFGENLSTLGMTEDNVFIGDI
                     FRWGDALIQVTQPRAPCYKLNHFLDCKNLSPLLQQSGRCGWLYRVVSTGNVSGDRPLE
                     LLTRNSEVSVAQAISIAFNMPFDEEQYRRLMSAAGISASWSKTMQMRLVNRKIEDFGR
                     RLFGAEGK"
     misc_feature    complement(47674..48339)
                     /locus_tag="Rahaq2_0045"
                     /note="6-N-hydroxylaminopurine resistance protein;
                     Provisional; Region: PRK11536"
                     /db_xref="CDD:183182"
     misc_feature    complement(47857..48231)
                     /locus_tag="Rahaq2_0045"
                     /note="MOSC domain; Region: MOSC; pfam03473"
                     /db_xref="CDD:251984"
     misc_feature    complement(47701..47841)
                     /locus_tag="Rahaq2_0045"
                     /note="3-alpha domain; Region: 3-alpha; pfam03475"
                     /db_xref="CDD:251985"
     gene            complement(48446..50392)
                     /locus_tag="Rahaq2_0046"
                     /note="IMG reference gene:2506707071"
                     /db_xref="GeneID:11789796"
     CDS             complement(48446..50392)
                     /locus_tag="Rahaq2_0046"
                     /note="PFAM: HAMP domain; Methyl-accepting chemotaxis
                     protein (MCP) signaling domain"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_005198140.1"
                     /db_xref="GI:383188012"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:11789796"
                     /translation="MSNGSGLSQWMNNLKVGTKLGLGFGLVLLIAAIITTAGMIKFND
                     ISQRAEKVDFSNQMNALLNDARLSRTLYQLNYNPVYLKQNQDNIDALSQLISQSKDKL
                     EWDAAGQTELDQVPVKIHEYQQAQTAFKQAVDRKDAVRASWNLSETEAIVKRLQDQLR
                     VEDADPSIRLSLAEVIQKLINVRYDVRGLLLNISKESEAKLLKSIDDTQANAKKLNAL
                     LLPDQQATLAPLMSALATYKDHVMAYMPAYEDEQKNSQLLSVKAAEMNALVAKIFKNE
                     LDNTHKDISNAQMLMMVITLIVMLAGIIIAWRITRQIAQPLRDTLKTAEAIARGDLTV
                     AQPTTRRDELGMLMNAVSAMSQNLSTMIYEIRSGVSQVSHAAAEIAAGNTDLSSRTEQ
                     QAAAVEETAASMEQLSATVKQNADNAHHASKLASEASGTATLGGKQVGEVVDTMQQIS
                     GSSKRIAEITSVINSIAFQTNILALNAAVEAARAGEQGRGFSVVASEVRILAQRSAQA
                     AKEIEGLIAESVERVNTGAKLVENTGRTMQDIVKSVSHVRDIMGEIASASDEQSRGIS
                     QISQAIVEMDSTTQQNAALVEQSSAAADSLEDQAATLTQAVSVFRLADNGDMLAAPAS
                     AALRRPALPLPVQGKTSQDNWETF"
     misc_feature    complement(48557..49615)
                     /locus_tag="Rahaq2_0046"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    complement(49313..49456)
                     /locus_tag="Rahaq2_0046"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(49319..49324,49331..49336,49340..49345,
                     49352..49357,49361..49366,49412..49414,49418..49423,
                     49430..49435,49439..49444,49451..49456))
                     /locus_tag="Rahaq2_0046"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(48623..49222)
                     /locus_tag="Rahaq2_0046"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(48626..48631,48638..48640,48647..48652,
                     48659..48661,48668..48673,48677..48682,48689..48694,
                     48698..48703,48710..48712,48719..48724,48731..48733,
                     48740..48745,48752..48757,48761..48766,48773..48775,
                     48782..48787,48794..48796,48803..48808,48845..48850,
                     48857..48862,48866..48871,48878..48883,48890..48892,
                     48899..48904,48911..48913,48920..48922,48932..48934,
                     48953..48955,48962..48964,48974..48976,48983..48988,
                     48995..48997,49004..49006,49013..49018,49025..49030,
                     49037..49039,49046..49051,49055..49057,49067..49072,
                     49076..49081,49088..49090,49097..49102,49109..49114,
                     49121..49123,49130..49135,49142..49144,49151..49156,
                     49160..49165,49172..49174,49181..49186,49193..49198))
                     /locus_tag="Rahaq2_0046"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(48887..48988)
                     /locus_tag="Rahaq2_0046"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(50664..51284)
                     /locus_tag="Rahaq2_0047"
                     /note="IMG reference gene:2506707072"
                     /db_xref="GeneID:11789797"
     CDS             complement(50664..51284)
                     /locus_tag="Rahaq2_0047"
                     /note="PFAM: Iron/manganese superoxide dismutases,
                     alpha-hairpin domain; Iron/manganese superoxide
                     dismutases, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="YP_005198141.1"
                     /db_xref="GI:383188013"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="GeneID:11789797"
                     /translation="MSYSLPSLPYAYDALEPHFDKETMEIHHTKHHQTYVNNANAALE
                     SLPELAALPVEELITKLDQVPADKKVVLRNNAGGHANHSLFWKGLKTGTTLQGELKSA
                     IERDFGSVDAFKEAFEKAAATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAISGAS
                     GYPLLGLDVWEHAYYLKYQNKRPDYIKAFWAVVNWDEAAKRLAEAK"
     misc_feature    complement(50667..51284)
                     /locus_tag="Rahaq2_0047"
                     /note="superoxide dismutase; Provisional; Region:
                     PRK10925"
                     /db_xref="CDD:182843"
     misc_feature    complement(51015..51281)
                     /locus_tag="Rahaq2_0047"
                     /note="Iron/manganese superoxide dismutases, alpha-hairpin
                     domain; Region: Sod_Fe_N; pfam00081"
                     /db_xref="CDD:249570"
     misc_feature    complement(50679..50996)
                     /locus_tag="Rahaq2_0047"
                     /note="Iron/manganese superoxide dismutases, C-terminal
                     domain; Region: Sod_Fe_C; pfam02777"
                     /db_xref="CDD:251524"
     gene            complement(51525..53066)
                     /locus_tag="Rahaq2_0048"
                     /note="IMG reference gene:2506707073"
                     /db_xref="GeneID:11789798"
     CDS             complement(51525..53066)
                     /locus_tag="Rahaq2_0048"
                     /note="PFAM: Fibronectin type III domain"
                     /codon_start=1
                     /transl_table=11
                     /product="chitin-binding domain-containing protein"
                     /protein_id="YP_005198142.1"
                     /db_xref="GI:383188014"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR008957"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11789798"
                     /translation="MSNYNITAKWVRYNDWYWHLYFNLTNNSSASLLLPDVKVQLAKN
                     QACAPYIAYTFVQNDVYLEGSLLQEVLPVDIGETVEFAVGVSILEMNAPGDLPVMYWV
                     NGEAVSPAAADTQAPTAPGKPVVSSVTASTVSLSWNAATDNVGVDDYVVYYYPTATDV
                     SFALTTATKTTNITLKNLSSETNYSIQIKARDAQGNESPFTSVVSVTTIQGTDASAGY
                     AAYLDVSINATWYPEISVNTQYTQWAVDHNVDKLYLAFLAYSVTKGGLVWVNDNFDYD
                     YAKPLTDMINTSNTQAVIAFGGAKGIDPSYHVSVDTLVGMYQKVLSDFHSNHIDLNFE
                     GGTKYNSTVALTAAARVQASNPDVKFSLTMQINDQGLRPEALAMVELAKSLNVVLDVQ
                     IMTMCFARSNVGQASIDVAEKVYEQLAAVYKDKTPAQIYAMIVMVEEIGQNGGGTGMG
                     IFTFADTDLVSNYVKERGMHTLAIWALNRDFPGDVGMETPTASGDPEQTQPYEFSNRF
                     LSNLH"
     misc_feature    complement(52443..52718)
                     /locus_tag="Rahaq2_0048"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(52482..52484,52527..52529,52716..52718))
                     /locus_tag="Rahaq2_0048"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(52464..52469,52473..52478))
                     /locus_tag="Rahaq2_0048"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(51543..52415)
                     /locus_tag="Rahaq2_0048"
                     /note="The GH18 (glycosyl hydrolase, family 18) type II
                     chitinases hydrolyze chitin, an abundant polymer of
                     beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a
                     major component of the cell wall of fungi and the
                     exoskeleton of arthropods.  Chitinases have...; Region:
                     GH18_chitinase-like; cl10447"
                     /db_xref="CDD:263970"
     misc_feature    complement(order(51642..51644,51738..51740,51876..51881,
                     52065..52067,52071..52073,52077..52079,52299..52301,
                     52407..52409))
                     /locus_tag="Rahaq2_0048"
                     /note="active site"
                     /db_xref="CDD:119349"
     gene            complement(53269..54111)
                     /locus_tag="Rahaq2_0049"
                     /note="IMG reference gene:2506707074"
                     /db_xref="GeneID:11789799"
     CDS             complement(53269..54111)
                     /locus_tag="Rahaq2_0049"
                     /note="PFAM: FdhD/NarQ family;
                     TIGRFAM: formate dehydrogenase family accessory protein
                     FdhD"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase family accessory protein
                     FdhD"
                     /protein_id="YP_005198143.1"
                     /db_xref="GI:383188015"
                     /db_xref="InterPro:IPR003786"
                     /db_xref="GeneID:11789799"
                     /translation="MDVHQVNELGEKDDKKVTQIIGASQKPVMQRAHLNEPQDDWIAQ
                     EVPVALVYNGISHVVMMASPKDLQAFALGFSLSEGIIESVSDIYGMEVTPNCHGIEVN
                     IELSSRRFAGLKERRRAMAGRTGCGVCGIEQLGDLFRPLAPLPFTQTFELANLDNALH
                     QLKSVQEIGQLTGCTHAAAWITPQGELTGGCEDVGRHVALDKMLGMRAKQRDWQNGAA
                     LVSSRASYEMVQKAAMCGIEILFAVSAATTLAVDVAEKCNLTLVGFSKPGRATVYTHP
                     QRLR"
     misc_feature    complement(53278..54063)
                     /locus_tag="Rahaq2_0049"
                     /note="formate dehydrogenase accessory protein; Reviewed;
                     Region: PRK00724"
                     /db_xref="CDD:234823"
     gene            54257..57304
                     /locus_tag="Rahaq2_0050"
                     /note="IMG reference gene:2506707075"
                     /db_xref="GeneID:11789800"
     CDS             54257..57304
                     /locus_tag="Rahaq2_0050"
                     /note="PFAM: Molybdopterin oxidoreductase; Molydopterin
                     dinucleotide binding domain; Molybdopterin oxidoreductase
                     Fe4S4 domain;
                     TIGRFAM: formate dehydrogenase, alpha subunit,
                     proteobacterial-type"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit alpha"
                     /protein_id="YP_005198144.1"
                     /db_xref="GI:383188016"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR006655"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="GeneID:11789800"
                     /translation="MQVSRRQLFKICAGGMAGTTAALLGFTPTMALAETRQYKLLRSR
                     ETRNNCTYCSVGCGMLIYSQGDGAKNVTENIFHVEGDADHPVSRGSLCPKGAGVLDYI
                     HSEGRLTHPEYRAPGTDKWQRISWDEAISRIARLMKDDRDANFVEKNENNVTVNRWLT
                     TGMLCSSAASNETGLLDQKFTRALGMVAIDCQARLCHGPTVAALAPTFGRGAMTNNWV
                     DIKNANVILIMGGNAAEAHPVGFKWVIEAKTKNNAKVIVVDPRFNRSAAVADIYAPIR
                     AGSDTAFLLGMINYLIIHNKIQTEYVLEYTNASLLVREDYEFNDGLFSGFDAAKKSYN
                     KESWHYQLDEKGFAKQDKTLQDPRCVWNLLKEHVSRYTPELVERLCGTPKEDFLLISS
                     ILAETCARDKTSTILYALGWTHHTGGAQIIRCAAMIQLLLGNIGMPGGGVNALRGHSN
                     IQGYTDLGLLSLNLPGYMPLPSEKQTNFTDYLHQITPAPLVDGQVNFWKNTPNFFVSM
                     MKSFWGEHATAENDWGFDWLPKWDKSYDVLQQAELMTEGKLNGYIVQGFNPLAAFPDK
                     NKSSRALSKLKYMVVIDPLVTESSNFWQNHGAMNDVQTADIQTEVFRLPSSCFAEENG
                     SIVNSGRWLQWHFQASEPPGEALHDGKIIARLFMKLRELYQKEGGANPLPVMNMAWDY
                     QDPLDPLPEEIAREANGKALADIHDEQGNLLAKKGQQLSTFAHLKNDGSTASFCWIYT
                     GSWTEAGNQMARRDNADPSGLGCTSGWAWCWPLNRRILYNRASADPQGQPWDPKREII
                     RWDGAKWTGFDVPDYSAAAPGSGVGPFIMQQEGVGRLFATDKMADGPFPEHYEPIESP
                     IGTNPLHPAVISNPVARIFASDLPNMGTAKDFPYVATTYSITELFRHWTKHALLNAIA
                     QPEQFIEIGEGLAASKGIAQGDEVKVSSKRGFIVAKAVVTKRIRPLTIDGKHVDTIGI
                     PCHWGFEGATRKGYLANTLTPSVGDANSQTPEFKAFLVNVEKV"
     misc_feature    54260..57298
                     /locus_tag="Rahaq2_0050"
                     /note="formate dehydrogenase, alpha subunit,
                     proteobacterial-type; Region: formate-DH-alph; TIGR01553"
                     /db_xref="CDD:233466"
     misc_feature    54395..56875
                     /locus_tag="Rahaq2_0050"
                     /note="Formate dehydrogenase N, alpha subunit
                     (Formate-Dh-Na) is a major component of nitrate
                     respiration in bacteria such as in the E. coli formate
                     dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that
                     is a complex of three different subunits and is the...;
                     Region: MopB_Formate-Dh-Na-like; cd02752"
                     /db_xref="CDD:239153"
     misc_feature    order(54404..54406,54410..54415,54425..54427,54530..54532,
                     54968..54973)
                     /locus_tag="Rahaq2_0050"
                     /note="[4Fe-4S] binding site [ion binding]; other site"
                     /db_xref="CDD:239153"
     misc_feature    order(54536..54538,54830..54832,54842..54844,54944..54946,
                     54950..54952,54959..54964,55031..55039,55088..55090,
                     55094..55096,55481..55489,55496..55501,55595..55600,
                     55922..55930,55940..55942,56000..56008,56015..56017,
                     56105..56107,56201..56203)
                     /locus_tag="Rahaq2_0050"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239153"
     misc_feature    56912..57298
                     /locus_tag="Rahaq2_0050"
                     /note="Formate dehydrogenase N, alpha subunit
                     (Formate-Dh-Na) is a major component of nitrate
                     respiration in bacteria such as in the E. coli formate
                     dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that
                     is a complex of three different subunits and is the...;
                     Region: MopB_CT_Formate-Dh-Na-like; cd02792"
                     /db_xref="CDD:239193"
     misc_feature    order(56936..56950,56954..56965,57176..57178,57221..57223,
                     57269..57274)
                     /locus_tag="Rahaq2_0050"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239193"
     gene            57317..58228
                     /locus_tag="Rahaq2_0051"
                     /note="IMG reference gene:2506707076"
                     /db_xref="GeneID:11789801"
     CDS             57317..58228
                     /locus_tag="Rahaq2_0051"
                     /note="PFAM: Formate dehydrogenase N, transmembrane;
                     TIGRFAM: formate dehydrogenase, beta subunit, Fe-S
                     containing"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase, beta subunit, Fe-S
                     containing"
                     /protein_id="YP_005198145.1"
                     /db_xref="GI:383188017"
                     /db_xref="InterPro:IPR014603"
                     /db_xref="InterPro:IPR015246"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="GeneID:11789801"
                     /translation="MAMQSQDILRKSATNGFTPAPRARDHQQEVAKLIDVTTCIGCKG
                     CQVACSEWNDLRDEVGINTGVYDNPMDLSAKSWTVMRFSEVEENGKLEWLIRKDGCMH
                     CADPGCLKACPAEGAILQYTNGIVDFQSEHCIGCGYCIAGCPFNIPRINKQDNRAYKC
                     TLCVDRVSVGQEPACVKTCPTGAIHFGTKTAMQDLAAERVSELKGRGFEHAGLYDPQG
                     VGGTHVMYVLHHADNPELYHGLPKDPAISAAVTLWKGVWKPLAAVGFAVTFAAAAFHF
                     LGVGPNYVKEEEHAEEEGKHDDEEKRP"
     misc_feature    57335..58168
                     /locus_tag="Rahaq2_0051"
                     /note="formate dehydrogenase, beta subunit, Fe-S
                     containing; Region: FDH-beta; TIGR01582"
                     /db_xref="CDD:233481"
     misc_feature    57593..57877
                     /locus_tag="Rahaq2_0051"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     misc_feature    58052..58168
                     /locus_tag="Rahaq2_0051"
                     /note="Formate dehydrogenase N, transmembrane; Region:
                     Form-deh_trans; pfam09163"
                     /db_xref="CDD:255210"
     gene            58225..58878
                     /locus_tag="Rahaq2_0052"
                     /note="IMG reference gene:2506707077"
                     /db_xref="GeneID:11789802"
     CDS             58225..58878
                     /locus_tag="Rahaq2_0052"
                     /note="PFAM: Cytochrome b(N-terminal)/b6/petB;
                     TIGRFAM: formate dehydrogenase, gamma subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit gamma"
                     /protein_id="YP_005198146.1"
                     /db_xref="GI:383188018"
                     /db_xref="InterPro:IPR005797"
                     /db_xref="InterPro:IPR016174"
                     /db_xref="GeneID:11789802"
                     /translation="MKKEKLIQRYNLAERLNHWIVAFCFVTLALSGIGFFFPSFNWLM
                     NVYGTPQLARILHPFFGVVMFVSFLGMFFRYWKHNLPEKDDIVWAKNIGKVLTNHEVG
                     DTGRYNFGQKCVFWAAISCLVLLMASGVMIWRPWFADYFPIPLIRLALLVHSLAGIGL
                     ILVIIMHVYAATWAKGSIAAMTGGKVPASWAKYHHPRWYRQVREEEQKKEQDERKAG"
     misc_feature    58225..58833
                     /locus_tag="Rahaq2_0052"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:260663"
     gene            58875..59789
                     /locus_tag="Rahaq2_0053"
                     /note="IMG reference gene:2506707078"
                     /db_xref="GeneID:11789803"
     CDS             58875..59789
                     /locus_tag="Rahaq2_0053"
                     /note="PFAM: Protein involved in formate dehydrogenase
                     formation;
                     TIGRFAM: formate dehydrogenase accessory protein FdhE"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase accessory protein FdhE"
                     /protein_id="YP_005198147.1"
                     /db_xref="GI:383188019"
                     /db_xref="InterPro:IPR006452"
                     /db_xref="GeneID:11789803"
                     /translation="MSIQIVSQDELADGKTTAGNIPPVLFANLKTLYQRRADRLRALA
                     EDSPLDGYLNFAAAICDAQQRVLKEFPLSIDLSQELEKAAGKPPLDCRLFPRTPHWLT
                     LLDALILVLKHGASEPVPGVLERLEQSPSLQREMMATQLLNQDFKHVPADKAPFIWAA
                     LSLYWAQMAAQLRGVGRADYGENRQFCPVCGSVPVSAVVAFGAHSGLRYLHCNLCESE
                     WHVVRAKCSNCDEMEHVNLWSIDDEQATVKAEACDDCGAYLKVIYQDKDPQADAVADD
                     LATLLLDDRMEDKGFSGSGINPFLFPAE"
     misc_feature    58875..59786
                     /locus_tag="Rahaq2_0053"
                     /note="Protein involved in formate dehydrogenase
                     formation; Region: FdhE; cl19312"
                     /db_xref="CDD:267665"
     gene            59875..60516
                     /locus_tag="Rahaq2_0054"
                     /note="IMG reference gene:2506707079"
                     /db_xref="GeneID:11793742"
     CDS             59875..60516
                     /locus_tag="Rahaq2_0054"
                     /note="PFAM: Glutathione S-transferase, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_005198148.1"
                     /db_xref="GI:383188020"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017933"
                     /db_xref="GeneID:11793742"
                     /translation="MKLIGSYTSPYVRKISVMLLEKGIPFDFINDTPHEPGCKIIQYN
                     PLGKVPALVADDGEVFYDSPIIVQFIELMNVAPTLLPWQPLDALRVRQIEALADGVTD
                     AAVALVLEGRRDADKRNEAWILRQREKLLRGLDALEKHAENRTLLNSESLNVADIAVA
                     CCLGYLNFRRIAPGWCVEHPELIKLVERLFQRESFACTTPPGSGNASFAAKKV"
     misc_feature    59875..60483
                     /locus_tag="Rahaq2_0054"
                     /note="putative glutathione S-transferase; Provisional;
                     Region: PRK10357"
                     /db_xref="CDD:182405"
     misc_feature    59875..60087
                     /locus_tag="Rahaq2_0054"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     misc_feature    60142..60474
                     /locus_tag="Rahaq2_0054"
                     /note="C-terminal, alpha helical domain of an unknown
                     subfamily 6 of Glutathione S-transferases; Region:
                     GST_C_6; cd03205"
                     /db_xref="CDD:198314"
     misc_feature    order(60145..60150,60154..60162,60166..60171,60178..60180,
                     60199..60204,60214..60216,60220..60231,60238..60240,
                     60247..60249,60259..60261,60268..60273,60280..60282)
                     /locus_tag="Rahaq2_0054"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198314"
     misc_feature    order(60154..60156,60166..60168,60175..60180,60199..60201,
                     60334..60336,60343..60348,60355..60357,60367..60369,
                     60442..60444,60454..60459,60463..60474)
                     /locus_tag="Rahaq2_0054"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198314"
     misc_feature    order(60166..60168,60178..60183,60190..60195,60358..60360,
                     60367..60369)
                     /locus_tag="Rahaq2_0054"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198314"
     gene            60618..62156
                     /locus_tag="Rahaq2_0055"
                     /note="IMG reference gene:2506707080"
                     /db_xref="GeneID:11793743"
     CDS             60618..62156
                     /locus_tag="Rahaq2_0055"
                     /note="PFAM: Aldehyde dehydrogenase family"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent aldehyde dehydrogenase"
                     /protein_id="YP_005198149.1"
                     /db_xref="GI:383188021"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="GeneID:11793743"
                     /translation="MAYDKNPHAVKPEEYGFPLKLKKQYDNFIGGEWVAPVKKQYYDN
                     LTPVTGEVLCQVASSSTDDVDLALDAAHQAKDAWGKMPVQQRANLLLKVADRMEQNLE
                     LLANAETWDNGKPIRETSGADVPLAIDHFRYFASCVRAQEGGISEIDSETVAYHFHEP
                     LGVVAQIIPWNFPLLMACWKMAPALAAGNCIVLKPAKLTPLSVLLLMELVQDILPAGV
                     INVVNGAGGEIGEYLATSKRIAKVAFTGSTEVGQRIAGYAAQNLIPATLELGGKSPNI
                     FFADVMDKEDEFFDKALEGFALFAFNQGEVCTCPSRALVQESIYERFMERAIKRVEAI
                     KTGNPLDMETQMGAQVSAGQMKTILDYIEIGKKEGAEVLTGGAKKKLEGSLNEGYYLQ
                     PTILLGKNNMRVFQEEIFGPVLAVTTFKDMDDALQIANDTAYGLGAGVWSRDGNVAYH
                     MGRNIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKCLLVSYSSKP
                     LGLF"
     misc_feature    60690..62129
                     /locus_tag="Rahaq2_0055"
                     /note="Ralstonia eutrophus NAD+-dependent acetaldehyde
                     dehydrogenase II and Staphylococcus aureus AldA1
                     (SACOL0154)-like; Region: ALDH_ACDHII_AcoD-like; cd07559"
                     /db_xref="CDD:143471"
     misc_feature    order(61116..61130,61152..61154,61197..61199,61203..61208,
                     61347..61358,61365..61367,61374..61379,61419..61427,
                     61536..61538,61839..61841,61845..61847,61923..61925,
                     62037..62039)
                     /locus_tag="Rahaq2_0055"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143471"
     misc_feature    order(61128..61130,61419..61421,61527..61529,61536..61538)
                     /locus_tag="Rahaq2_0055"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143471"
     gene            62433..63095
                     /locus_tag="Rahaq2_0056"
                     /note="IMG reference gene:2506707081"
                     /db_xref="GeneID:11789804"
     CDS             62433..63095
                     /locus_tag="Rahaq2_0056"
                     /note="PFAM: DSBA-like thioredoxin domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative dithiol-disulfide isomerase involved in
                     polyketide biosynthesis"
                     /protein_id="YP_005198150.1"
                     /db_xref="GI:383188022"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="GeneID:11789804"
                     /translation="MSRKLLYFFIYTLFICLLSIGCTVAYYQYVVLDSGAESLIQMDE
                     GKVSNSPLKDSDVLVEIMSYGCHFCAINDKAITELETRLPQGVRVVRLHLENTGSRGL
                     ARYARLFATLQVMGIEPQYREKVYAAIIDDNKDLSDNIILNRWLSTNSIDVEKYHAVE
                     ASQETTDLIKYMNDVSHYYDVSATPAFIVNKRWVAFQDRDFDKFGDHLLSLLKNNKPL
                     EQ"
     misc_feature    62514..63071
                     /locus_tag="Rahaq2_0056"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            63095..64042
                     /locus_tag="Rahaq2_0057"
                     /note="IMG reference gene:2506707082"
                     /db_xref="GeneID:11793744"
     CDS             63095..64042
                     /locus_tag="Rahaq2_0057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198151.1"
                     /db_xref="GI:383188023"
                     /db_xref="GeneID:11793744"
                     /translation="MRFLPVWIYMQSLFLLSKIERQGLIFLLRGLKQTRWVLNKIPLG
                     VIFAGLHTVRLLRLTGKDQNARSLVASENKRCLTGDDGKVDFTWTAQRRKALDYAATY
                     GKNKKVISQLDACAAELDKIVVPLHQAKKPVMLAPLHMVSDILAGIVASKTCPGKGTV
                     IVSSNAEHYIEQDRMKGGINLDYCSIHNKSQDVAKNMISACMEAAENKSNIIIFPDIT
                     PDYTIATDSAYSSKLKCRLFDRPAKLHNGVVRLAKMLSADVVFYYLYYDRGLKIRIFP
                     AVSAKNVAEKMPEIIEHSIRSHPQDWLLWHLHSLYFINE"
     misc_feature    63470..64012
                     /locus_tag="Rahaq2_0057"
                     /note="Lysophospholipid acyltransferases (LPLATs) of
                     glycerophospholipid biosynthesis; Region: LPLAT; cl17185"
                     /db_xref="CDD:266537"
     misc_feature    order(63509..63511,63518..63520,63521..63523,63578..63583,
                     63743..63751)
                     /locus_tag="Rahaq2_0057"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153244"
     gene            64061..66199
                     /locus_tag="Rahaq2_0058"
                     /note="IMG reference gene:2506707083"
                     /db_xref="GeneID:11789805"
     CDS             64061..66199
                     /locus_tag="Rahaq2_0058"
                     /note="PFAM: ABC transporter transmembrane region; ABC
                     transporter; Peptidase C39 family"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin/lantibiotic ABC transporter"
                     /protein_id="YP_005198152.1"
                     /db_xref="GI:383188024"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR005074"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017940"
                     /db_xref="GeneID:11789805"
                     /translation="MSRIIPEMVSQSEINECGLACIAMLADTQGVSVTLPQLRDAYPI
                     SVHGTSLDTLATILSDYAIPVYPVLFSPDEIQDLPLPAILHYGAGHYVVLAYRKGERV
                     CVMNPAIGQQFLTFDALKKDISGYALIIDEEAEPKETKSAPDPAAPNKSFFACLSLEQ
                     TSKIKGIYFLMTLAFLVSLTLFIMPAMVGQAINDVLSAAGKEDFPYLLFLLAFVISTA
                     LALWVRSVTEQCVKRFAVLNSTAGFSRLLSNSLRFFERRAPGEVFSRFSAWETAALQK
                     IELDNGLRTDWIIGLLAFIVMAYMSFSLALVSLAGVTLMGLVSVWAIYRDRFYAQQMQ
                     ERIAEQNEYILESIHGFTTIKSAGLYEQRKSMFATYTLALFNCIQKKQIYEQVKNSIY
                     QMAGSLEMVLFMFLALPLLKNGVISLGSFFAYSFIRQIFSSYITKIFFAVLQKNQLHI
                     IDQRAADLFPATDVSGKAPARQAQVCEPFSFTGQLKFEDIAFRYDSAKPTLHSMTFAV
                     EQGHTVAIVGESGAGKSTLIKIIAGLLIPDEGQISLQGNEITSHQIEKLCFLQSQEDI
                     LFNTSVLENITLFDPHYDDSQQNRISALLEGLGLTGVIGQLPGGMNARIRESHTGLSL
                     GQRQRLLLARAMYSNRPVLVLDEPTANLDDEMASQVMMSVMAHCHEQGKTLIVVTHSK
                     TILNQFDHVYHLDHGHLLPHDSRVIQGCVA"
     misc_feature    64082..66157
                     /locus_tag="Rahaq2_0058"
                     /note="ABC-type bacteriocin/lantibiotic exporters, contain
                     an N-terminal double-glycine peptidase domain [Defense
                     mechanisms]; Region: SunT; COG2274"
                     /db_xref="CDD:225183"
     misc_feature    64082..64444
                     /locus_tag="Rahaq2_0058"
                     /note="Peptidase family C39 mostly contains
                     bacteriocin-processing endopeptidases from bacteria. The
                     cysteine peptidases in family C39 cleave the
                     'double-glycine' leader peptides from the precursors of
                     various bacteriocins (mostly non-lantibiotic); Region:
                     Peptidase_C39_like; cl00296"
                     /db_xref="CDD:260333"
     misc_feature    order(64091..64093,64109..64111,64328..64330,64376..64378)
                     /locus_tag="Rahaq2_0058"
                     /note="putative active site [active]"
                     /db_xref="CDD:239073"
     misc_feature    64577..65356
                     /locus_tag="Rahaq2_0058"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    65513..66154
                     /locus_tag="Rahaq2_0058"
                     /note="ATP-binding cassette domain of multidrug resistance
                     protein-like transporters; Region: ABCC_MRP_Like; cd03228"
                     /db_xref="CDD:213195"
     misc_feature    65612..65635
                     /locus_tag="Rahaq2_0058"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213195"
     misc_feature    order(65621..65626,65630..65638,65747..65749,65996..66001,
                     66098..66100)
                     /locus_tag="Rahaq2_0058"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213195"
     misc_feature    65924..65953
                     /locus_tag="Rahaq2_0058"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213195"
     misc_feature    65984..66001
                     /locus_tag="Rahaq2_0058"
                     /note="Walker B; other site"
                     /db_xref="CDD:213195"
     misc_feature    66008..66019
                     /locus_tag="Rahaq2_0058"
                     /note="D-loop; other site"
                     /db_xref="CDD:213195"
     misc_feature    66086..66106
                     /locus_tag="Rahaq2_0058"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213195"
     gene            66196..67368
                     /locus_tag="Rahaq2_0059"
                     /note="IMG reference gene:2506707084"
                     /db_xref="GeneID:11789806"
     CDS             66196..67368
                     /locus_tag="Rahaq2_0059"
                     /note="PFAM: HlyD family secretion protein;
                     TIGRFAM: RND family efflux transporter, MFP subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter, MFP subunit"
                     /protein_id="YP_005198153.1"
                     /db_xref="GI:383188025"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:11789806"
                     /translation="MNVLRRYRVFSIASLTLCVFIAATALLIAHRTDNSATRHHIDVI
                     GRGDIQTTVMTTGVLQPLKKISVGAQVNGQLKKLHVKQGDRVKKGQLLAEIDPVIQQN
                     ELRNAQAELHSNRAQMQSDKALLKQYQLALTRQNKMARDSAGVQSDLESAQAQYDVQR
                     EQLNMDAARVVQAEISVETAKANLGYTRIIAPIDGEVLGIITQEGQTIVSSQTAPTIM
                     VLADMSVMRIQTRISETDILKTHPGQSVWFYVMADPTRRYESVMGAIQDAPEEALRES
                     NESSGNTQQSTAVYYNGEFTISNEQRRLKTSMTAEAYIIIGEVKNALLVPLTAVGERS
                     PEGRYHVQVREKDKITDRLIELGIRDNKFAEVKSGLAQGDRVVSTTSAPGDADASQ"
     misc_feature    66238..67353
                     /locus_tag="Rahaq2_0059"
                     /note="macrolide transporter subunit MacA; Provisional;
                     Region: PRK11578"
                     /db_xref="CDD:183211"
     misc_feature    66388..66528
                     /locus_tag="Rahaq2_0059"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    66757..67110
                     /locus_tag="Rahaq2_0059"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            67355..69307
                     /locus_tag="Rahaq2_0060"
                     /note="IMG reference gene:2506707085"
                     /db_xref="GeneID:11789807"
     CDS             67355..69307
                     /locus_tag="Rahaq2_0060"
                     /note="PFAM: ABC transporter; Predicted permease"
                     /codon_start=1
                     /transl_table=11
                     /product="antimicrobial peptide ABC transporter ATPase"
                     /protein_id="YP_005198154.1"
                     /db_xref="GI:383188026"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11789807"
                     /translation="MPASEPLILLHHVSRVFSSGDQQVSVLDDVSLSVQAGEMLAIVG
                     PSGSGKSTLMNILGGLDIPDSGEVRIAGIDTLNASHEQLAALRSSNIGFIFQRYHLMP
                     YLTAAENVAVPAQYTAMPENVQEQRAAYLLEHLGLKERMQHKPSQLSGGQQQRVSIAR
                     ALMNGAPIILADEPTGALDAQSGQEMMAILHGLHQSGHTIILVTHDRNVASQAERIIE
                     ISDGKIIADTPNPSVHQASVPVVLLPAVNTGRSSWRQSLHDAIKMAWRALNGHRVRAL
                     LSMLGIIIGVTSVITSMAVGEGAKLKIIRDISALGTSTVAVRPGLGWDNPRPDLSDSL
                     TLGDVSTLSELPFAVHVSPVFTRNLEAQVGGRQMFFNLTGVSSDYFAVHDLALKEGRK
                     LNEHDVDAREPVLLIDSASAETLFHEDKNPLGETIYLNNVPLRVVGITAPKGLKNMGG
                     GLNAWMAYTTLQERLTGRMPVGAIEIQVAKGMTLKEAQRRIEYVLEKSHGRRDFFIET
                     DDMMLETLQKTSDSLTLLIATIAGISLVVGGVGVMNIMLVSVAERMHEIGIRLAVGAR
                     AVDIMRQFLIESVVVCLFGCVVGVIVTFVAGTLFSVLTNRFEMVFTPLPIFYSCCFSA
                     LIGLGFGFFPARFAARMKPTEALARE"
     misc_feature    67370..69304
                     /locus_tag="Rahaq2_0060"
                     /note="macrolide transporter ATP-binding /permease
                     protein; Provisional; Region: PRK10535"
                     /db_xref="CDD:182528"
     misc_feature    67376..68026
                     /locus_tag="Rahaq2_0060"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    67484..67507
                     /locus_tag="Rahaq2_0060"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    order(67493..67498,67502..67510,67640..67642,67868..67873,
                     67967..67969)
                     /locus_tag="Rahaq2_0060"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    67631..67642
                     /locus_tag="Rahaq2_0060"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    67796..67825
                     /locus_tag="Rahaq2_0060"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    67856..67873
                     /locus_tag="Rahaq2_0060"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    67880..67891
                     /locus_tag="Rahaq2_0060"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    67955..67975
                     /locus_tag="Rahaq2_0060"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     misc_feature    68144..68830
                     /locus_tag="Rahaq2_0060"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    68942..69283
                     /locus_tag="Rahaq2_0060"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            69304..70734
                     /locus_tag="Rahaq2_0061"
                     /note="IMG reference gene:2506707086"
                     /db_xref="GeneID:11789808"
     CDS             69304..70734
                     /locus_tag="Rahaq2_0061"
                     /note="PFAM: Outer membrane efflux protein;
                     TIGRFAM: efflux transporter, outer membrane factor (OMF)
                     lipoprotein, NodT family"
                     /codon_start=1
                     /transl_table=11
                     /product="NodT family efflux transporter outer membrane
                     lipoprotein"
                     /protein_id="YP_005198155.1"
                     /db_xref="GI:383188027"
                     /db_xref="InterPro:IPR003423"
                     /db_xref="GeneID:11789808"
                     /translation="MKILFTAILACCLAGCGAFLKTPYQQPELNLPQDWQNKQTGTAW
                     LTHTPQWWRVFNDPQFSQMISDVLIHNDDLAIAGYRLRQAALDAGLSNTNLTPDVSAG
                     GEASNSKNTRRNTAAHENYNASVTTSYELDLWGKLARTREQAQWQMNATALDRQNTAL
                     MLIGTTGQYYWQIAALNEQIGNTEKSIQLAMETERITRSGYEAGAINQLDVLQARQSV
                     IDQTNSLRELNQQREEARNALAILFGRAPSARAPEKMFLDPRQTIGLTPDLPLSVISR
                     RPDVQSAEWKLRASLAASDVARLNFYPSLSLGATLGAGSAVFSEWFSNPARTLSSGLT
                     LPFVQWNTVQLTVERSELDVRQAAATFRQSVYSALSDVENTTSQRNTYQAQREDLLVS
                     LGLGEQRLRLAKSQYLAGAVSLQTWLDAQSSLLSAENQLADAQARYLNATLQLWLALG
                     GEVNLDEIIASAHVNTPPGKENKRNG"
     misc_feature    69340..70656
                     /locus_tag="Rahaq2_0061"
                     /note="efflux transporter, outer membrane factor (OMF)
                     lipoprotein, NodT family; Region: outer_NodT; TIGR01845"
                     /db_xref="CDD:233595"
     misc_feature    69481..70035
                     /locus_tag="Rahaq2_0061"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    70117..70653
                     /locus_tag="Rahaq2_0061"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            70727..71980
                     /locus_tag="Rahaq2_0062"
                     /note="IMG reference gene:2506707087"
                     /db_xref="GeneID:11789809"
     CDS             70727..71980
                     /locus_tag="Rahaq2_0062"
                     /note="PFAM: Beta-ketoacyl synthase, N-terminal domain;
                     Beta-ketoacyl synthase, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="YP_005198156.1"
                     /db_xref="GI:383188028"
                     /db_xref="InterPro:IPR000794"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="GeneID:11789809"
                     /translation="MDKSHSLKRVVVTGYGAITPLGMNAHQSWDAIMAYETGYRYIDR
                     RSGGIKSRFFGLIEGELNLKFLPAGIRRRLPRFAHLALIAAREAMEMAFGDTSLTQYH
                     AELDRGAIIGTGWGGLDETVSNHDKYRASGLGSTFGCFYSMPSIATAACSQHWMLRGY
                     QNTPSAACATGTIAIGDAFNAIQTGRATMMLAGGAESLRTDTAVWNIDVLSALTREEQ
                     DITKASCPFSLERNGFVLSEGAAVLCLEDREIALARGATILGEITGYGNFSDAVDFTA
                     PAEDKLARVNTIQAALSQAGLSAGELDYINAHGTSTQLNDRNETESVKLALGEKAYDI
                     PVSSTKGYSGHLIAAAGSFESIVCLQALEHQIMPATHHLRLADPACDLDFIREGHRPA
                     SLQNTLNLSFGFGGANAALVISRGE"
     misc_feature    70748..71965
                     /locus_tag="Rahaq2_0062"
                     /note="Beta-ketoacyl-acyl carrier protein (ACP) synthase
                     (KAS), type I and II. KASs are responsible for the
                     elongation steps in fatty acid biosynthesis. KASIII
                     catalyses the initial condensation and KAS I and II
                     catalyze further elongation steps by Claisen...; Region:
                     KAS_I_II; cd00834"
                     /db_xref="CDD:238430"
     misc_feature    70748..71962
                     /locus_tag="Rahaq2_0062"
                     /note="beta-ketoacyl-acyl-carrier-protein synthase II;
                     Region: fabF; TIGR03150"
                     /db_xref="CDD:200247"
     misc_feature    order(71066..71068,71087..71092,71102..71104,71108..71113,
                     71159..71161,71171..71173,71183..71185,71201..71203,
                     71207..71209,71213..71221,71255..71257,71264..71269,
                     71276..71278,71339..71344,71351..71356,71528..71542,
                     71582..71584,71939..71941,71945..71947)
                     /locus_tag="Rahaq2_0062"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238430"
     misc_feature    order(71228..71230,71648..71650,71759..71761)
                     /locus_tag="Rahaq2_0062"
                     /note="active site"
                     /db_xref="CDD:238430"
     gene            71980..72780
                     /locus_tag="Rahaq2_0063"
                     /note="IMG reference gene:2506707088"
                     /db_xref="GeneID:11789810"
     CDS             71980..72780
                     /locus_tag="Rahaq2_0063"
                     /note="PFAM: MaoC like domain"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC-like protein"
                     /protein_id="YP_005198157.1"
                     /db_xref="GI:383188029"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="GeneID:11789810"
                     /translation="MNLFYGEQDAQAWAKFSGDYNPIHFDLQHAQAMGLESLTVHGMR
                     ALLDMKNHLSHAVAPMNSDYYQFSARLRQAVKCQTPYRLISALNVAGSAASSQLTELD
                     SGLCCFSGKLNGTLKRPDVDIPLKQTLTEEELAVLIAAYPSEKSETMSWEVLDAVLFE
                     RIVNIPETLDCVREAIPHLSAMSLADVFKLIPVVQTHHDVFFNHQHLITPAREAVGRP
                     FRYGLLPVLIIGNAEQGFVIRMTIQGGYDAHPSIMTAITLKTWPVQTH"
     misc_feature    72001..>72108
                     /locus_tag="Rahaq2_0063"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     gene            72798..73049
                     /locus_tag="Rahaq2_0064"
                     /note="IMG reference gene:2506707089"
                     /db_xref="GeneID:11789811"
     CDS             72798..73049
                     /locus_tag="Rahaq2_0064"
                     /note="PFAM: Phosphopantetheine attachment site;
                     TIGRFAM: acyl carrier protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-containing protein"
                     /protein_id="YP_005198158.1"
                     /db_xref="GI:383188030"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="GeneID:11789811"
                     /translation="MSEVIKSEIYSIVCEMLCDAKDLEPETLSEDLPLKSLKLDSLDY
                     VELMVLVKREFDISLSADMFIEHPDMTLGEMCQMLEALR"
     misc_feature    72834..73034
                     /locus_tag="Rahaq2_0064"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            73049..73786
                     /locus_tag="Rahaq2_0065"
                     /note="IMG reference gene:2506707090"
                     /db_xref="GeneID:11789812"
     CDS             73049..73786
                     /locus_tag="Rahaq2_0065"
                     /note="PFAM: short chain dehydrogenase;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005198159.1"
                     /db_xref="GI:383188031"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11789812"
                     /translation="MNTRKWILITGGSRGIGKAMVIRLSKKYDIVFTWNTNADQAQSV
                     EKDCADTFGEVRGYCCDGRNEEQVSLLARLLLTERGAPYCIIHNAGITRDALHIKQTS
                     ADWHDVINTNLNAIFHWNQHLLPPMLARGEGSVIMMSSVSAQKGNVGQVAYSATKAAM
                     TGITRSLALEVARFGIRVNSLLPGVIETEMTAALRDEERKALRSHIPLRRLGKADEIA
                     LMADFLLSESGSYITGQSIIIDGGLSA"
     misc_feature    73061..73777
                     /locus_tag="Rahaq2_0065"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    73067..73780
                     /locus_tag="Rahaq2_0065"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    order(73079..73081,73085..73090,73094..73096,73151..73159,
                     73310..73318,73460..73468,73505..73507,73517..73519,
                     73595..73606)
                     /locus_tag="Rahaq2_0065"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(73382..73384,73466..73468,73505..73507,73517..73519)
                     /locus_tag="Rahaq2_0065"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            74142..74324
                     /locus_tag="Rahaq2_0066"
                     /note="IMG reference gene:2506707091"
                     /db_xref="GeneID:11793745"
     CDS             74142..74324
                     /locus_tag="Rahaq2_0066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198160.1"
                     /db_xref="GI:383188032"
                     /db_xref="GeneID:11793745"
                     /translation="MKKITTEVAKEIIGGKDSCESSYQWNGNRCEYQTRCYDKHGNLS
                     SKSATQAGSTYYCQPK"
     gene            complement(74394..75599)
                     /locus_tag="Rahaq2_0067"
                     /note="IMG reference gene:2506707092"
                     /db_xref="GeneID:11793746"
     CDS             complement(74394..75599)
                     /locus_tag="Rahaq2_0067"
                     /note="PFAM: Major Facilitator Superfamily;
                     manually curated;
                     non-canonical start codon"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005198161.1"
                     /db_xref="GI:383188033"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11793746"
                     /translation="MGRQALLFPLCLVLFEFATYIGNDMIQPGMLAVVANFNAGEEWV
                     PTSMTAYLAGGMFLQWLLGPLSDRRGRRPVMLAGVSFFIITCLAILFAQNIEQFMVMR
                     FLQGISLCFIGAVGYAAIQESFEESVCIKITAMMANVALIAPLLGPLAGAALIHVAPW
                     QSMFVIFAVLAAIALWGLWKSMPETASRLGEPFSMPSLLRDYKHVLKNRQFLCGALAI
                     GFASLPLLTWIAQSPVILISGESLAAYDYGLLQVPIFGALIIGNVTLARLSGKRTVEY
                     LIKLGAGPMVVGLLIAAVATLFSAHAYLWMTAGLSLYAFGIGVANAGLYRLTLFSSDM
                     SKGTVSAAMGVISMMIFTLGIELAKVAYVEGGTGMFNLFNLISGLAWLALVVVFLRSR
                     QIVITGASA"
     misc_feature    complement(74421..75599)
                     /locus_tag="Rahaq2_0067"
                     /note="multidrug efflux system translocase MdfA;
                     Provisional; Region: PRK15402"
                     /db_xref="CDD:185300"
     misc_feature    complement(74436..75572)
                     /locus_tag="Rahaq2_0067"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(74547..74549,74556..74561,74568..74573,
                     74580..74585,74613..74615,74622..74627,74637..74639,
                     74646..74651,74658..74660,74814..74816,74826..74828,
                     74835..74837,74847..74849,74859..74861,74901..74903,
                     74910..74915,74922..74927,74934..74936,75168..75170,
                     75186..75191,75198..75203,75237..75239,75246..75251,
                     75258..75263,75270..75275,75411..75416,75420..75425,
                     75435..75437,75444..75449,75456..75458,75507..75512,
                     75516..75524,75531..75533))
                     /locus_tag="Rahaq2_0067"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            75868..76863
                     /locus_tag="Rahaq2_0068"
                     /note="IMG reference gene:2506707093"
                     /db_xref="GeneID:11789813"
     CDS             75868..76863
                     /locus_tag="Rahaq2_0068"
                     /note="PFAM: Acyltransferase family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198162.1"
                     /db_xref="GI:383188034"
                     /db_xref="InterPro:IPR002656"
                     /db_xref="GeneID:11789813"
                     /translation="MSQKISWIDNLRALACMMVVMIHASTSLVVNFAAVHTAEWTVAN
                     LLNSASRVCVPLFFMISGALFLGEKSAQKRHFLRVTLCLLFYSAVSLIYILTMTKIGF
                     WPSLRLIVEKPVFYHLWFFYAIIVIYLLSPLINVKAVSGRYLLIAGMLLGVLANPQLP
                     AVTWQKIHLLPLDLYISGDTFYYVLYALMGRAISQLNTEKTAITLAASGTFILSTLAI
                     ATGTYRQMQINQNFADTFYVYSGPLVFISAIALFVVFKNTLAHRILPGFALISRHSLA
                     IYGFHALIIIGLRNQHLDFPQFPLLNLVFLFICGLGGGLLLAMGLGKIDRRNWVS"
     misc_feature    75868..76860
                     /locus_tag="Rahaq2_0068"
                     /note="Predicted O-acyltransferase [General function
                     prediction only]; Region: COG3274"
                     /db_xref="CDD:225813"
     gene            complement(76883..78874)
                     /locus_tag="Rahaq2_0069"
                     /note="IMG reference gene:2506707094"
                     /db_xref="GeneID:11793747"
     CDS             complement(76883..78874)
                     /locus_tag="Rahaq2_0069"
                     /note="PFAM: Divergent AAA domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator with HTH
                     domain"
                     /protein_id="YP_005198163.1"
                     /db_xref="GI:383188035"
                     /db_xref="InterPro:IPR007421"
                     /db_xref="GeneID:11793747"
                     /translation="MFKITDLIDLQTLAESVELEFKQAQGQDGQGKLPQDFWPTYSAM
                     ANTRGGYVVLGVKEKKGEFIPVGINDPEKIKKELFNNLNNPNLVNINLLTDADVQTTL
                     LDSKLILVIHIPIATRHQKPIFLKKNPLEFTYIRLHEGDRHCSQEQVKRMLAEQVEDS
                     RDDKILTGFDLNDIEQESLNAYKQLLAIAKPQHLWLELNNFDLMAKIGGWRKDRQSGQ
                     EGITLAGILMFGTWQAIQDAVPHYFVDYQERPEAKTELRWVDRLCPDGTWSGNIFDFY
                     RRTYRKLTTDLKIPFKIKDGVRQDDTLIHVALREALVNTLVHSDYTGRASILIVKRPD
                     MFGFRNPGLMRIPPEIAIKGGETDCRNRRMHQMFLNIGAGERAGSGIPKIYSGWQSAN
                     WRAPKLYEKTEHTEQTLLELSTASLIPEYISAQLQKLFGTRFSTLDDFERMIVTTAAI
                     EGWINHQRACQLTSKHTRDVTLALPRLEAKGFLVSSGERKDKSYSLPGMEQPPSPEEV
                     FSNALSLISDFTHSEGDLTHSEGDSTHSKSNPISHDAMIPRIDEHRDPHGRFISPLLD
                     RPFVDQLDVLELSFKNNLLSLAKPARVKRRLTNEEMRDVISTLCNEHYIAISVLSDFT
                     NRTSQNIRQSHLKPMVEKGELKLAFPNKPNTPKQGYTVT"
     misc_feature    complement(<77675..78868)
                     /locus_tag="Rahaq2_0069"
                     /note="Predicted transcriptional regulator containing an
                     HTH domain and an uncharacterized domain shared with the
                     mammalian protein Schlafen [Transcription]; Region:
                     COG2865"
                     /db_xref="CDD:225420"
     misc_feature    complement(78440..78832)
                     /locus_tag="Rahaq2_0069"
                     /note="Divergent AAA domain; Region: AAA_4; pfam04326"
                     /db_xref="CDD:252528"
     misc_feature    complement(77648..77863)
                     /locus_tag="Rahaq2_0069"
                     /note="ATP-dependent DNA helicase recG C-terminal; Region:
                     HATPase_c_4; pfam13749"
                     /db_xref="CDD:258042"
     gene            complement(78975..79889)
                     /locus_tag="Rahaq2_0070"
                     /note="IMG reference gene:2506707095"
                     /db_xref="GeneID:11789814"
     CDS             complement(78975..79889)
                     /locus_tag="Rahaq2_0070"
                     /note="PFAM: DJ-1/PfpI family; Bacterial regulatory
                     helix-turn-helix proteins, AraC family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator containing an amidase
                     domain and an AraC-type DNA-binding HTH domain"
                     /protein_id="YP_005198164.1"
                     /db_xref="GI:383188036"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="GeneID:11789814"
                     /translation="MQRNVYFVTLPGVMSLDLTGPAEALRLSGQFRLHYIGPQPEVMM
                     STGLMVSHLQPLPQSLPEGSILIMPGVAESAENFSSMVAQTTCDWLHQQKSVIDAGDL
                     TLVCICSGSLLAGKAGLLDGYQCTTHHDVIGQLRQQVPAAQVKDNRIFVEDRSVLTSA
                     GISAGIDLALHLIATHLGPQAALDVAREMVVYFRRGGDDPQLSPWLRYRNHLHPAVHR
                     AQNLMAAEPESAWQVEEVAARAHISARHLTRLFRQHLGISVRDYHEQLRIAVAQQRLQ
                     QGAGIEKAALAAGFSSARQLRRAQERWA"
     misc_feature    complement(79320..79889)
                     /locus_tag="Rahaq2_0070"
                     /note="Putative intracellular protease/amidase [General
                     function prediction only]; Region: ThiJ; COG0693"
                     /db_xref="CDD:223765"
     misc_feature    complement(79314..79877)
                     /locus_tag="Rahaq2_0070"
                     /note="AraC transcriptional regulators having a Type 1
                     glutamine amidotransferase (GATase1)-like domain; Region:
                     GATase1_AraC_1; cd03137"
                     /db_xref="CDD:153231"
     misc_feature    complement(79566..79568)
                     /locus_tag="Rahaq2_0070"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153231"
     misc_feature    complement(79104..79223)
                     /locus_tag="Rahaq2_0070"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(79925..80479)
                     /locus_tag="Rahaq2_0071"
                     /note="IMG reference gene:2506707096"
                     /db_xref="GeneID:11789815"
     CDS             complement(79925..80479)
                     /locus_tag="Rahaq2_0071"
                     /note="PFAM: Isochorismatase family"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamidase-like amidase"
                     /protein_id="YP_005198165.1"
                     /db_xref="GI:383188037"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="GeneID:11789815"
                     /translation="MTQSALLNIDVQRSFEHKDFWQQDDLPAFSEALIRLIDGCQTRN
                     VPVIDVFHVNPDGDFSLASGLVTPMTFLTHQPQHVVHKHVHNALTESGLDGWLRENGI
                     THLIIAGMRTEQCCETTARVASDLGYSVTFVTEATLTFPMTHASGVTLSAQDIKLRTE
                     LVLADRFATLTDVTGALAELDRAV"
     misc_feature    complement(80012..80467)
                     /locus_tag="Rahaq2_0071"
                     /note="Cysteine hydrolases; This family contains
                     amidohydrolases, like CSHase (N-carbamoylsarcosine
                     amidohydrolase), involved in creatine metabolism and
                     nicotinamidase, converting nicotinamide to nicotinic acid
                     and ammonia in the pyridine nucleotide cycle. It...;
                     Region: cysteine_hydrolases; cl00220"
                     /db_xref="CDD:260273"
     misc_feature    complement(order(80135..80137,80234..80236,80450..80452))
                     /locus_tag="Rahaq2_0071"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238245"
     misc_feature    complement(80147..80152)
                     /locus_tag="Rahaq2_0071"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238245"
     gene            complement(80611..81207)
                     /locus_tag="Rahaq2_0072"
                     /note="IMG reference gene:2506707097"
                     /db_xref="GeneID:11789816"
     CDS             complement(80611..81207)
                     /locus_tag="Rahaq2_0072"
                     /note="PFAM: DJ-1/PfpI family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative intracellular protease/amidase"
                     /protein_id="YP_005198166.1"
                     /db_xref="GI:383188038"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="GeneID:11789816"
                     /translation="MVKDNAKKQVALLLADGFEEGEAVIVLDILERLEIQVTTLACQK
                     SLTLRTYHGIQMQANELLSAQGDRLFDAVVMPGGPEGSVALAASKEVVEFVRRHDEAG
                     KLICPLCSAAARVLGGNGLLKGRRYVCSGDLYKDVKDGVYVNQSFVEDGNLLSGKGLG
                     LAFDFAFQLAYRLTGDAETTNFQADHIDYHHWRADQKF"
     misc_feature    complement(80680..81180)
                     /locus_tag="Rahaq2_0072"
                     /note="DJ-1 family protein; Region: not_thiJ; TIGR01383"
                     /db_xref="CDD:213612"
     misc_feature    complement(80689..81180)
                     /locus_tag="Rahaq2_0072"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in Human DJ-1; Region: GATase1_DJ-1; cd03135"
                     /db_xref="CDD:153229"
     misc_feature    complement(80881..80883)
                     /locus_tag="Rahaq2_0072"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153229"
     gene            complement(81295..82326)
                     /locus_tag="Rahaq2_0073"
                     /note="IMG reference gene:2506707098"
                     /db_xref="GeneID:11793748"
     CDS             complement(81295..82326)
                     /locus_tag="Rahaq2_0073"
                     /note="PFAM: Alcohol dehydrogenase GroES-like domain;
                     Zinc-binding dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="theronine dehydrogenase-like Zn-dependent
                     dehydrogenase"
                     /protein_id="YP_005198167.1"
                     /db_xref="GI:383188039"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11793748"
                     /translation="MTIATQSCVVTGKKDVSVIHQTLDYTGQGTLVKITRGGICGSDL
                     HYYEHGAVGDFRVREAMVLGHEVVGVVEKSDNPRLQPGQKVALNPSKPCKACKYCLSG
                     DENQCTTMKFFGSAMYFPHINGAFTQYKIVDSDQCIAYDNQVSDRLMVFAEPLAVAIH
                     AVNQAGDIHGKTVFVSGVGPIGCLIVLAAKAKGAAQIVVTDPSERCRTLALAVGASKA
                     LDAAQGDFSEYQAEKGFFNVSFDASGHPSSIHRCLEVTRARGTLVQVGMGPVVNEFPL
                     MMLIAKEINWVGSFRFTEEFNTAVEWLANKTVDPMPLLSAEFPQESLVEALEYALDKS
                     KASKVQLVF"
     misc_feature    complement(81298..82326)
                     /locus_tag="Rahaq2_0073"
                     /note="L-idonate 5-dehydrogenase; Provisional; Region:
                     PRK09880"
                     /db_xref="CDD:182130"
     misc_feature    complement(81298..82305)
                     /locus_tag="Rahaq2_0073"
                     /note="L-idonate 5-dehydrogenase; Region: idonate-5-DH;
                     cd08232"
                     /db_xref="CDD:176194"
     misc_feature    complement(order(81454..81462,81529..81534,81592..81594,
                     81598..81603,81664..81666,81709..81711,81721..81726,
                     81781..81798,81856..81858,81868..81870,82192..82194,
                     82201..82209))
                     /locus_tag="Rahaq2_0073"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176194"
     misc_feature    complement(order(81868..81870,82132..82134,82201..82203,
                     82207..82209))
                     /locus_tag="Rahaq2_0073"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176194"
     gene            complement(82449..83651)
                     /locus_tag="Rahaq2_0074"
                     /note="IMG reference gene:2506707099"
                     /db_xref="GeneID:11789817"
     CDS             complement(82449..83651)
                     /locus_tag="Rahaq2_0074"
                     /note="PFAM: Benzoate membrane transport protein;
                     TIGRFAM: benzoate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="benzoate transporter"
                     /protein_id="YP_005198168.1"
                     /db_xref="GI:383188040"
                     /db_xref="InterPro:IPR004711"
                     /db_xref="GeneID:11789817"
                     /translation="MASRLSLQNLTFSAVIAGFVAVLVGYTSSAAIIFQAAEAAGASV
                     AQIGGWLSMLGLGMGVTSIGLSLYYRTPVVTAWSTPGAALLVTSLPGTSLNEAIGVFV
                     FATGLILLCGVTGLFARLMHYIPQALSAAMLGGILLRFGLNAFTSLQSNFALAGTMCL
                     VYLLAKRALPRYAVVLALVAGLTVAGLQGDIALHGQTLTFAAPAFVMPHFTLSSIIGI
                     GIPFFVVTMASQNAPGIATLKAHGYHLPVSPLISWTALTALILAPFGGFTICIAAITA
                     AICMGEDIHPDPKKRYMAAVAAGIFYLIAGVFGGSIGMVFTALPQALIHTIAGLALLG
                     TIAGSLYRALENERQRDAAIITFLITASGVTLLGVGSAFWGLAGGVATHLILSIPARN
                     RDKSAGKS"
     misc_feature    complement(82497..83630)
                     /locus_tag="Rahaq2_0074"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     misc_feature    complement(82479..83615)
                     /locus_tag="Rahaq2_0074"
                     /note="Uncharacterized protein involved in benzoate
                     metabolism [Secondary metabolites biosynthesis, transport,
                     and catabolism]; Region: BenE; COG3135"
                     /db_xref="CDD:225677"
     gene            83790..84356
                     /locus_tag="Rahaq2_0075"
                     /note="IMG reference gene:2506707100"
                     /db_xref="GeneID:11789818"
     CDS             83790..84356
                     /locus_tag="Rahaq2_0075"
                     /note="PFAM: Cupin domain; Helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005198169.1"
                     /db_xref="GI:383188041"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="GeneID:11789818"
                     /translation="MQELTDHIGSQLKAVRSERGWSLSQTAEHTGVSKAMLGQIERGE
                     SSPTVATLWKIASGLNVSFSEFLETPPAQSAALHRHGLLTTFNSDTSGMRVVPLFPFD
                     TTLRMDMFVIDLEPGGCSESTPHEAGVIEHVIVIEGELMLTVDGVTRVLQAGEGLRFA
                     ADCPHAYRNESGHSVRFHDLIHYPQSRP"
     misc_feature    83790..84317
                     /locus_tag="Rahaq2_0075"
                     /note="DNA-binding transcriptional repressor PuuR;
                     Provisional; Region: PRK09943"
                     /db_xref="CDD:182158"
     misc_feature    83814..83987
                     /locus_tag="Rahaq2_0075"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(83826..83828,83838..83840,83913..83915)
                     /locus_tag="Rahaq2_0075"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(83835..83837,83910..83912)
                     /locus_tag="Rahaq2_0075"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(83856..83861,83892..83894,83901..83903,83913..83918)
                     /locus_tag="Rahaq2_0075"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    84117..84332
                     /locus_tag="Rahaq2_0075"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     gene            84385..84837
                     /locus_tag="Rahaq2_0076"
                     /note="IMG reference gene:2506707101"
                     /db_xref="GeneID:11793749"
     CDS             84385..84837
                     /locus_tag="Rahaq2_0076"
                     /note="PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_005198170.1"
                     /db_xref="GI:383188042"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11793749"
                     /translation="MSQPHDVIIRPLAPADREGWEVLWRDYLDFYQSTLDPAQFDYTF
                     RRLSQPDYASMFGYVAVHEGKLVGLVNCINHDHGWHMQQVVYLQDLYVDDGARKLGIG
                     QKLIEAVYAYADENNKANVYWTTQTSNHTARKLYDRVGRLTDFIKYAR"
     misc_feature    84403..84804
                     /locus_tag="Rahaq2_0076"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    84556..84756
                     /locus_tag="Rahaq2_0076"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(84652..84660,84688..84693)
                     /locus_tag="Rahaq2_0076"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(84834..85304)
                     /locus_tag="Rahaq2_0077"
                     /note="IMG reference gene:2506707102"
                     /db_xref="GeneID:11789819"
     CDS             complement(84834..85304)
                     /locus_tag="Rahaq2_0077"
                     /note="PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_005198171.1"
                     /db_xref="GI:383188043"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11789819"
                     /translation="MTVLVPMSTAFYAEFAEQLARDYAEENVTAGLWQADTALERARS
                     STQSALPQGIDTPDHYLYEIRAQEHSETAGYLWFANIERYGVRSAFVYELTVYPQFRR
                     QGHAAAAFRLMEERLRALGSVAIELNVFASNPGAQALYASLGYVTTKMNMRKPL"
     misc_feature    complement(84921..85109)
                     /locus_tag="Rahaq2_0077"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(84984..84989,85017..85025))
                     /locus_tag="Rahaq2_0077"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(85319..85858)
                     /locus_tag="Rahaq2_0078"
                     /note="IMG reference gene:2506707103"
                     /db_xref="GeneID:11789820"
     CDS             complement(85319..85858)
                     /locus_tag="Rahaq2_0078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198172.1"
                     /db_xref="GI:383188044"
                     /db_xref="GeneID:11789820"
                     /translation="MKSWLLPLLLLAPLCSQAASTPKEIKARFSQFKVGDKTICLDDV
                     TYANNSKMKVIENGFVVSKRKNVLVYQSNSLFLLGNDVTVNIKAVIESKAGKTGFSNQ
                     FKQAMIRVDGMDDPTRASEKAKIIQSFEEVISDKNNETPYSSVALTDKGYIITQMESH
                     STTISECYVTPYKKVETRQ"
     gene            complement(86074..86553)
                     /locus_tag="Rahaq2_0079"
                     /note="IMG reference gene:2506707104"
                     /db_xref="GeneID:11789821"
     CDS             complement(86074..86553)
                     /locus_tag="Rahaq2_0079"
                     /note="PFAM: Protein of unknown function (DUF796);
                     TIGRFAM: type VI secretion system effector, Hcp1 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="YP_005198173.1"
                     /db_xref="GI:383188045"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="GeneID:11789821"
                     /translation="MSNPAYLFLTGVEGSPIVGGSLVSGREGAIELKSVTHNMHIPAD
                     RNTGKLTGTRIHSPITLQKEFDRTTPLLYRALSEGQTLKSATIKMYHILEAGIEAEYF
                     NIILENVKVTSIAPNLYPGNQTGTHFETIQLRYESITWKYVNGNIIYKDTWNERITA"
     misc_feature    complement(86086..86547)
                     /locus_tag="Rahaq2_0079"
                     /note="Protein of unknown function (DUF796); Region:
                     DUF796; cl01226"
                     /db_xref="CDD:260845"
     gene            complement(86576..86788)
                     /locus_tag="Rahaq2_0080"
                     /note="IMG reference gene:2506707105"
                     /db_xref="GeneID:11789822"
     CDS             complement(86576..86788)
                     /locus_tag="Rahaq2_0080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198174.1"
                     /db_xref="GI:383188046"
                     /db_xref="GeneID:11789822"
                     /translation="MDKKPSFMKKAANAAVGQIGAILGGASVWFSLFFVFYFDTWLER
                     LLAISAMVFVIWIIGKLIDKYYPQDN"
     gene            complement(86789..87439)
                     /locus_tag="Rahaq2_0081"
                     /note="IMG reference gene:2506707106"
                     /db_xref="GeneID:11789823"
     CDS             complement(86789..87439)
                     /locus_tag="Rahaq2_0081"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198175.1"
                     /db_xref="GI:383188047"
                     /db_xref="GeneID:11789823"
                     /translation="MDNSEEIAQRIADIIISPDSAIGLVHGILSVPVDLGYLAYGFFD
                     TDSYHAHETETIRIIEAIKRGILEHDRITDAIQTILNDFDKYVSESEQNKTYSRSFFS
                     VVGRTVTNTVIAGKVAIAIAQGTSFFVKVRGGVIGNILLVGGMKERCIRASEKLSVEV
                     PELYATLRLKDYDLLYFLFEPALSPFVDALSVRHQQGSPAFDKILKIVDSKVGARG"
     gene            87735..88364
                     /locus_tag="Rahaq2_0082"
                     /note="IMG reference gene:2506707107"
                     /db_xref="GeneID:11789824"
     CDS             87735..88364
                     /locus_tag="Rahaq2_0082"
                     /note="PFAM: Glutathione S-transferase, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_005198176.1"
                     /db_xref="GI:383188048"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017933"
                     /db_xref="GeneID:11789824"
                     /translation="MSQPSLILYSDANFFSPYVMSAFVALTEKGIPFELEKVDLANAE
                     NLKENYSAISVTRRVPTLTNGDFVLSESSAIDEYVEELFPAPTFPAIYPADPENRAKA
                     REVQAWLRSDLMPIREERSTEVVFAGAKRPALSANGQQAAEKLYAAAAFLLGDKEHLF
                     GEWCIADVDLALMINRLHLNGDPVPEKLAAYADAQWQRPSVKEWLALSA"
     misc_feature    87735..88361
                     /locus_tag="Rahaq2_0082"
                     /note="glutathione S-transferase; Provisional; Region:
                     PRK15113"
                     /db_xref="CDD:185068"
     misc_feature    87750..87974
                     /locus_tag="Rahaq2_0082"
                     /note="Glutathione S-transferase (GST) family, N-terminal
                     domain; a large, diverse group of cytosolic dimeric
                     proteins involved in cellular detoxification by catalyzing
                     the conjugation of  glutathione (GSH) with a wide range of
                     endogenous and xenobiotic...; Region: GST_N_family;
                     cd00570"
                     /db_xref="CDD:238319"
     misc_feature    order(87786..87788,87792..87797,87801..87806,87813..87818,
                     87951..87953,87960..87965)
                     /locus_tag="Rahaq2_0082"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238319"
     misc_feature    order(87786..87788,87906..87914,87945..87950)
                     /locus_tag="Rahaq2_0082"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:238319"
     misc_feature    order(87906..87908,87942..87947,87951..87956,87963..87965)
                     /locus_tag="Rahaq2_0082"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238319"
     misc_feature    88020..88358
                     /locus_tag="Rahaq2_0082"
                     /note="C-terminal, alpha helical domain of an unknown
                     subfamily 4 of Glutathione S-transferases; Region:
                     GST_C_4; cd03195"
                     /db_xref="CDD:198304"
     misc_feature    order(88041..88043,88050..88052,88062..88064,88083..88085,
                     88098..88103,88110..88115,88221..88223,88227..88229,
                     88236..88241,88248..88250,88260..88262,88320..88322,
                     88326..88328,88332..88337,88341..88346,88353..88358)
                     /locus_tag="Rahaq2_0082"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198304"
     misc_feature    order(88041..88046,88053..88058,88065..88067,88176..88178)
                     /locus_tag="Rahaq2_0082"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198304"
     misc_feature    order(88062..88064,88074..88079,88086..88091,88251..88253,
                     88260..88262)
                     /locus_tag="Rahaq2_0082"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198304"
     gene            complement(88356..88802)
                     /locus_tag="Rahaq2_0083"
                     /note="IMG reference gene:2506707108"
                     /db_xref="GeneID:11789825"
     CDS             complement(88356..88802)
                     /locus_tag="Rahaq2_0083"
                     /note="PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_005198177.1"
                     /db_xref="GI:383188049"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11789825"
                     /translation="MKTRLSHAPTESDLEEIKTALRDFNRNFIPKPTFRELGIFVEDE
                     SGKKLAGIVAETVGHWMYIKMLWVDESLRGKDVGTQLITEAEEEAKARGCRYSLVDTF
                     SFQARPFYERMGYSMQMALEDYIPDSRAPDDAPSTHTRFFLTKTLS"
     misc_feature    complement(88515..88673)
                     /locus_tag="Rahaq2_0083"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(88566..88571,88599..88607))
                     /locus_tag="Rahaq2_0083"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(88822..89457)
                     /locus_tag="Rahaq2_0084"
                     /note="IMG reference gene:2506707109"
                     /db_xref="GeneID:11789826"
     CDS             complement(88822..89457)
                     /locus_tag="Rahaq2_0084"
                     /note="PFAM: LysE type translocator"
                     /codon_start=1
                     /transl_table=11
                     /product="putative threonine efflux protein"
                     /protein_id="YP_005198178.1"
                     /db_xref="GI:383188050"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="GeneID:11789826"
                     /translation="MTVTESLLSYALAAGILTLTPGLDTALVLRTAASQGSKKALSTA
                     FGISSGCLVWGAMVALGLGAVLAASEIAFNVLKWIGAAYLAWLGLQMLFKPRSKMNMD
                     APESRHKALRIGNSPFVKGLFGNVLNPKVGVFYVSFLPQFVATGYPVGPYIFGLAAMH
                     AVIGTLWSVTMISATRPLSRWLRRPAVVRTLDRLTGTVFIAFAVRLATTKR"
     misc_feature    complement(88825..89445)
                     /locus_tag="Rahaq2_0084"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            complement(89614..89871)
                     /locus_tag="Rahaq2_0085"
                     /note="IMG reference gene:2506707110"
                     /db_xref="GeneID:11789827"
     CDS             complement(89614..89871)
                     /locus_tag="Rahaq2_0085"
                     /note="PFAM: Protein of unknown function (DUF1471)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198179.1"
                     /db_xref="GI:383188051"
                     /db_xref="InterPro:IPR010854"
                     /db_xref="GeneID:11789827"
                     /translation="MKNVKIFAVAATLSLISFGSFAAQQINQPTSDMQKIGVISAANS
                     TSISGLEAKLSQQAQEAGASSYRIISVTGNNKLHADAEIYK"
     misc_feature    complement(89617..89871)
                     /locus_tag="Rahaq2_0085"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; cl11507"
                     /db_xref="CDD:264403"
     gene            90276..90524
                     /locus_tag="Rahaq2_0086"
                     /note="IMG reference gene:2506707111"
                     /db_xref="GeneID:11789828"
     CDS             90276..90524
                     /locus_tag="Rahaq2_0086"
                     /note="PFAM: Transglycosylase associated protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198180.1"
                     /db_xref="GI:383188052"
                     /db_xref="InterPro:IPR007341"
                     /db_xref="GeneID:11789828"
                     /translation="MGILSWIIFGLIAGILAKWIMPGKDGGGFILTIVLGVVGAVVGG
                     YISTFFGFGRVDGFNFGSFVVAVIGAIVVLFIYRKIRN"
     misc_feature    90276..90521
                     /locus_tag="Rahaq2_0086"
                     /note="Transglycosylase associated protein; Region:
                     Transgly_assoc; cl00978"
                     /db_xref="CDD:260728"
     gene            complement(90585..90923)
                     /locus_tag="Rahaq2_0087"
                     /note="IMG reference gene:2506707112"
                     /db_xref="GeneID:11789829"
     CDS             complement(90585..90923)
                     /locus_tag="Rahaq2_0087"
                     /note="PFAM: Plasmid stabilisation system protein"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization system protein"
                     /protein_id="YP_005198181.1"
                     /db_xref="GI:383188053"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="GeneID:11789829"
                     /translation="MSRYKIAREAQDDLFDIQRYSQAHWGKAQSDKYLSELSDLFSLL
                     ATHPDMGRPVSFHKDLFRFPHQHHVAYFLTTPAGLIFIAIMHKSRSPADTLSMRLHEP
                     EASYQVMLQD"
     misc_feature    complement(90657..90923)
                     /locus_tag="Rahaq2_0087"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     gene            complement(90925..91185)
                     /locus_tag="Rahaq2_0088"
                     /note="IMG reference gene:2506707113"
                     /db_xref="GeneID:11789830"
     CDS             complement(90925..91185)
                     /locus_tag="Rahaq2_0088"
                     /note="PFAM: Phd_YefM;
                     TIGRFAM: prevent-host-death family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="YP_005198182.1"
                     /db_xref="GI:383188054"
                     /db_xref="InterPro:IPR006442"
                     /db_xref="GeneID:11789830"
                     /translation="MKSLSANEVKTQFGDVLLRVQREPVQINRNGKPVAVMLSIEDYQ
                     MLEEIKMRLLKEKVARAEADIAHGDVMDGETFFAQLMSGKRD"
     misc_feature    complement(90982..91185)
                     /locus_tag="Rahaq2_0088"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; pfam02604"
                     /db_xref="CDD:251410"
     gene            complement(91275..91628)
                     /locus_tag="Rahaq2_0089"
                     /note="IMG reference gene:2506707114"
                     /db_xref="GeneID:11789831"
     CDS             complement(91275..91628)
                     /locus_tag="Rahaq2_0089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198183.1"
                     /db_xref="GI:383188055"
                     /db_xref="GeneID:11789831"
                     /translation="MRQRKRWIMLAVLVAVIAGCHQWWKQGKLVSEEWSPNKQYVVRE
                     YKTFEFIPRMTMPGDGGHYSGYMRVYNRDGKQFYEEYSDLLDFIEGPFWAKEGVYWMG
                     NENQDIVRLPTSPVE"
     gene            complement(91744..92442)
                     /locus_tag="Rahaq2_0090"
                     /note="IMG reference gene:2506707115"
                     /db_xref="GeneID:11789832"
     CDS             complement(91744..92442)
                     /locus_tag="Rahaq2_0090"
                     /note="PFAM: ABC transporter;
                     TIGRFAM: urea ABC transporter, ATP-binding protein UrtE"
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter ATP-binding protein UrtE"
                     /protein_id="YP_005198184.1"
                     /db_xref="GI:383188056"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="GeneID:11789832"
                     /translation="MLQVNELNQFYGGSHILRGLSFEAKIGEVTCLLGRNGVGKTTLL
                     KCLMGLIPAKSGTIRWQDQVINSRKPHQRVQAGIAYVPQGREIFPRLTVEENLLMGLS
                     RFSGSHAKQVPDEIYHLFPILLEMKHRRGGDLSGGQQQQLAIGRALACKPSLLILDEP
                     TEGIQPSVIKEIGAVIKQLAARGDMAILLVEQFYDFAAELADSYLVMSRGSIVKRGRG
                     DEMEAEGVRGLVAI"
     misc_feature    complement(91747..92439)
                     /locus_tag="Rahaq2_0090"
                     /note="urea ABC transporter, ATP-binding protein UrtE;
                     Region: urea_trans_UrtE; TIGR03410"
                     /db_xref="CDD:234199"
     misc_feature    complement(91771..92439)
                     /locus_tag="Rahaq2_0090"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    complement(92320..92343)
                     /locus_tag="Rahaq2_0090"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(order(91867..91869,91966..91971,92194..92196,
                     92317..92325,92329..92334))
                     /locus_tag="Rahaq2_0090"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(92194..92205)
                     /locus_tag="Rahaq2_0090"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(92014..92043)
                     /locus_tag="Rahaq2_0090"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(91966..91983)
                     /locus_tag="Rahaq2_0090"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(91948..91959)
                     /locus_tag="Rahaq2_0090"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(91861..91881)
                     /locus_tag="Rahaq2_0090"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            complement(92454..93260)
                     /locus_tag="Rahaq2_0091"
                     /note="IMG reference gene:2506707116"
                     /db_xref="GeneID:11789833"
     CDS             complement(92454..93260)
                     /locus_tag="Rahaq2_0091"
                     /note="PFAM: ABC transporter; Branched-chain amino acid
                     ATP-binding cassette transporter;
                     TIGRFAM: urea ABC transporter, ATP-binding protein UrtD"
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter ATP-binding protein UrtD"
                     /protein_id="YP_005198185.1"
                     /db_xref="GI:383188057"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="GeneID:11789833"
                     /translation="MSPMTMTEDLFTQPQLADRHREQTDPILQLENINVSFDGFKALT
                     NLSLNISVGELRCVIGPNGAGKTTLMDVITGKTKPQSGRVFYDQRTDLTKLDPVQIAQ
                     SGIGRKFQKPTVFEALTVFENLEIAQKTNKSVWACLRAKMNSEQRDRIDEMLGTLRLA
                     AERHRPAGLLSHGQKQFLEIGMLLVQEPHLLLLDEPAAGMTDAETEYTAELFKQLAGR
                     HSLMVVEHDMGFVETIADHVTVLHQGQVLAEGSLRDVQANEQVIDVYLGR"
     misc_feature    complement(92457..93191)
                     /locus_tag="Rahaq2_0091"
                     /note="Uncharacterized ABC-type transport system, ATPase
                     component [General function prediction only]; Region:
                     COG4674"
                     /db_xref="CDD:227019"
     misc_feature    complement(92478..93179)
                     /locus_tag="Rahaq2_0091"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    complement(93060..93083)
                     /locus_tag="Rahaq2_0091"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(order(92583..92585,92676..92681,92931..92933,
                     93057..93065,93069..93074))
                     /locus_tag="Rahaq2_0091"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92931..92942)
                     /locus_tag="Rahaq2_0091"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92724..92753)
                     /locus_tag="Rahaq2_0091"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92676..92693)
                     /locus_tag="Rahaq2_0091"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92658..92669)
                     /locus_tag="Rahaq2_0091"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92577..92597)
                     /locus_tag="Rahaq2_0091"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            complement(93260..94333)
                     /locus_tag="Rahaq2_0092"
                     /note="IMG reference gene:2506707117"
                     /db_xref="GeneID:11789834"
     CDS             complement(93260..94333)
                     /locus_tag="Rahaq2_0092"
                     /note="PFAM: Branched-chain amino acid transport system /
                     permease component;
                     TIGRFAM: urea ABC transporter, permease protein UrtC"
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter permease UrtC"
                     /protein_id="YP_005198186.1"
                     /db_xref="GI:383188058"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:11789834"
                     /translation="MSQPLTITGVQKAPKIAISVGTLVLIILIVMPFLALLPATNPLA
                     ISTYTLTLIGKILCYAIVAIALDLVWGYAGLLSLGHGLFFALGGYAMGMYLMRQAAGS
                     GLPDFMSFLSWTELPWFWAGTQHFAWALCLIVLVPGALAFVFGYFAFRSKIKGVYFSI
                     MTQALTYAGMLLFFRNETGFGGNNGFTGFTTLLGFPVTATGTRVGLFLATVLVLVASL
                     ALGFALARSKYGRVLTAVRDAENRLIFCGYDPKGFKLFVWTISAMLCGLAGALYVPQV
                     GIINPSEMSPTNSIEAAIWVALGGRGTLIGPIIGAGIVNGAKSWFTVAIPEYWQFVLG
                     GMFILVTLFLPQGVIGLLRKRKS"
     misc_feature    complement(93284..94168)
                     /locus_tag="Rahaq2_0092"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    complement(93557..93613)
                     /locus_tag="Rahaq2_0092"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            complement(94333..95901)
                     /locus_tag="Rahaq2_0093"
                     /note="IMG reference gene:2506707118"
                     /db_xref="GeneID:11793750"
     CDS             complement(94333..95901)
                     /locus_tag="Rahaq2_0093"
                     /note="PFAM: Branched-chain amino acid transport system /
                     permease component;
                     TIGRFAM: urea ABC transporter, permease protein UrtB"
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter permease UrtB"
                     /protein_id="YP_005198187.1"
                     /db_xref="GI:383188059"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="GeneID:11793750"
                     /translation="MRILIRSLLFLLCCLPLLAEAGAANDFAAASRSQQATLLQQWAA
                     DPQPERLPLLEALKQENVVTDEAKHAFTQNGDQLTPLEGDVKPQGEVKKVWLNNRLRI
                     LIANALSAHRLVSTDSAVRLQAAKSLQREAQADQLPLLTHRLEQEKDSTVHDALSIAL
                     ANLQLADTRPQVRLKAVELLGTSGDPDTQGRLQSLTDPKTEPDATVRNAALASLKAVQ
                     HRLMMGDLLGQAFTGLSLGSILLLAALGLAITYGLLGVINMAHGEMLMLGSYSTYMVQ
                     SLFQHYAPGLLALYPLVALPVAFFITAGTGMALERTVIRHLYGRPLETLLATWGISLI
                     LIQGVRVLFGAQNVEVANPGWLSGGIQLLPNLVLPYNRIAVIIFVLLVLGLTWLLLNK
                     TRLGMNVRAVTQNRAMAACCGVPTGRVDMLAFGLGSGIAGLGGVALSQLSNVGPELGQ
                     GYIIDSFLVVVLGGVGQLAGTVVAAFGLGIVNKILEPEIGAVLGKILILALIILFIQK
                     RPQGLFAFKGRVID"
     misc_feature    complement(95257..95493)
                     /locus_tag="Rahaq2_0093"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    complement(94459..95157)
                     /locus_tag="Rahaq2_0093"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    complement(94627..94683)
                     /locus_tag="Rahaq2_0093"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            complement(96092..97360)
                     /locus_tag="Rahaq2_0094"
                     /note="IMG reference gene:2506707119"
                     /db_xref="GeneID:11789835"
     CDS             complement(96092..97360)
                     /locus_tag="Rahaq2_0094"
                     /note="TIGRFAM: urea ABC transporter, urea binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter, urea binding protein"
                     /protein_id="YP_005198188.1"
                     /db_xref="GI:383188060"
                     /db_xref="InterPro:IPR000709"
                     /db_xref="GeneID:11789835"
                     /translation="MQRRRFIKAFALSASVVSMGLAWSAQAAETIKVGIMHSLSGTMA
                     ISETPLKDIALMTIDDINAKGGVLGKKLEPVVVDPASNWPLFAEKARQLLTQDKVAVV
                     FGCWTSVSRKSVLPVFEELNGLLFYPVQYEGEEMSPNVFYTGAAPNQQAIPAVEYLMS
                     EDGGAAKRFFLLGTDYVYPRTTNKILRAFLHSKGVKDSDIEEVYTPFGYSDYQTIVSN
                     IKKFSAGGKTAVISTINGDSNVPFYKELANQGVKATDVPVVAFSVGEEELRGIDTKPL
                     VGDLAAWNYFQSVDNPTNKKFVAEWKAYAKAHKLPNADNAVTNDPMEATYVGIHMWAQ
                     AVEKAGTTDVDKVRAAMAGQTFAAPSGFTLTMDKTNHHLHKPVMIGEIESNGQFNVVW
                     QTDKPIRAQPWSPYIAGNDKKPDTPVKTVN"
     misc_feature    complement(96179..97267)
                     /locus_tag="Rahaq2_0094"
                     /note="Periplasmic component (FmdD) of an active transport
                     system for short-chain amides and urea (FmdDEF); Region:
                     PBP1_FmdD_like; cd06355"
                     /db_xref="CDD:107350"
     misc_feature    complement(order(96833..96835,96968..96973,96980..96982,
                     97043..97045))
                     /locus_tag="Rahaq2_0094"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107350"
     gene            complement(97446..98168)
                     /locus_tag="Rahaq2_0095"
                     /note="IMG reference gene:2506707120"
                     /db_xref="GeneID:11789836"
     CDS             complement(97446..98168)
                     /locus_tag="Rahaq2_0095"
                     /note="PFAM: Bacterial regulatory proteins, gntR family;
                     FCD domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198189.1"
                     /db_xref="GI:383188061"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789836"
                     /translation="MQLTGSKSSRSKSRPEGLAERIYQQLKDDIFSFRLLPGDRFSEN
                     DIADRMEVSRTPVRQALFWLEHEGYVEVFFRSGWQVRPFDFDFFEQLYDLRIVLELEA
                     VKRLCALPPAAQPLQLAELKAFWVDQPQLAEGQLVSRYDEEFHMTLVAAAGNAEMARI
                     HRELTEKIRIIRRLDFTKGERVNATYKEHASILLAIIQQHTEEAQRQLHDHIAVSKAE
                     VRKITLHMLHRARAESDEGNPS"
     misc_feature    complement(97518..98117)
                     /locus_tag="Rahaq2_0095"
                     /note="phosphonate utilization associated transcriptional
                     regulator; Region: phnR_burk; TIGR03338"
                     /db_xref="CDD:132381"
     misc_feature    complement(97926..98117)
                     /locus_tag="Rahaq2_0095"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(97935..97946,97950..97955,97983..97985,
                     97992..97997,98001..98015,98037..98042,98112..98114))
                     /locus_tag="Rahaq2_0095"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(97530..97901)
                     /locus_tag="Rahaq2_0095"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(98197..101829)
                     /locus_tag="Rahaq2_0096"
                     /note="IMG reference gene:2506707121"
                     /db_xref="GeneID:11789837"
     CDS             complement(98197..101829)
                     /locus_tag="Rahaq2_0096"
                     /note="PFAM: Carbamoyl-phosphate synthase L chain, ATP
                     binding domain; Biotin carboxylase C-terminal domain;
                     Allophanate hydrolase subunit 2; Carbamoyl-phosphate
                     synthase L chain, N-terminal domain; Allophanate hydrolase
                     subunit 1; Biotin-requiring enzyme;
                     TIGRFAM: urea carboxylase; biotin-dependent carboxylase
                     uncharacterized domain"
                     /codon_start=1
                     /transl_table=11
                     /product="urea carboxylase"
                     /protein_id="YP_005198190.1"
                     /db_xref="GI:383188062"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR003778"
                     /db_xref="InterPro:IPR003833"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR013817"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR020899"
                     /db_xref="GeneID:11789837"
                     /translation="MFNTVLIANRGEIACRAIRTLKRLGITSVAVYSDADRNAPHVTQ
                     ADIAIALGGEKASESYLMIDKILAAAKETGAQAIYPGYGFLSESAEFADACEAAGIAF
                     IGPTAGQIREFGLKHRARELAGAANVPMTPGTGLLDSMDDAVKAAAEIGYPIMLKSTA
                     GGGGIGLTRCDDEEALRAAWDSVKRLGEQFFRDAGVFLERFVDRARHVEVQIFGDGKG
                     HVVALGERDCSLQRRNQKVVEETPAPNLPQASREALHRAAVQLGQSVNYRSAGTVEFI
                     YDAARDEFYFLEVNTRLQVEHPVTEMVTGLDLIECMLNVAANEPADWPAMAKAPQGAS
                     MEVRIYAEDPLKNFQPSPGVLTEVFFPDDVRVDGWVSTGSEVSAFYDPMIAKLIVHGT
                     DRQDALAKMSAALAATRLHGIATNIDYLRQVVATPVFRDGEMWTRMLDSFVYAPHAIE
                     VIAPGTYSSVQDYPGRLGYWDIGVPPSGPMDDFAFRLANRIVGNHPDAAGLEFTLQGP
                     TLRFHCDAVIALTGARCPATLDGEPVSYWQPVEVKAGQTLTLGRATQGCRTCLAVRNG
                     FDVPVYLGSRSTFALGQFGGHAGRTLRVADMLTVSQPELAACTTPAPVSLPQAAAENI
                     VPPYGELWNIGVLYGPHGAPDFFTKESIDTFFAAEWQVHYNSNRLGVRLVGPKPQWAR
                     QDGGEAGLHPSNVHDCEYAIGAINFTGDFPVILTRDGPSLGGFVCPVTIAKAELWKVG
                     QVKPGDKIRFHPISFEQAQALERAQQGTLDSLMPVNAMALPVPSLLPDTTASATVLAA
                     LPATADRPSVEYRQAGDGYVLIEYGDNVLDLAVRMRIYLLMNAIRAAGQQGIEELSPG
                     VRSLQIRYDSRVLHQTALLQHLLTLEHNLDDVSQLKIPTRIVHMPMAFEDAATLGAVE
                     RYQQTVRADAPWLPNNVDFIQRTNGLSSRDEVKNIIFDASYLILGLGDVYLGAPCAVP
                     VDPRHRLLSSKYNPARTFTAEGTVGIGGMYMCIYGMDSPGGYQLVGRTLPIWNKFLKN
                     EQFKNGEPWLLHFFDQVRFYEVTEAELDIQREAFREGRAQIHIEETEFDFAQYTQFLA
                     DNAADIADFRARQADAFTREVAHWHEAESVAVEAAANAVQLVEDDADQDGHLVSADLN
                     GNVWKILVQPGQQVEEGQPLIVVEAMKMELSVNAPCAGTVLKISCQQGRPVGPGDALL
                     WLDAAV"
     misc_feature    complement(98209..101826)
                     /locus_tag="Rahaq2_0096"
                     /note="urea carboxylase; Region: urea_carbox; TIGR02712"
                     /db_xref="CDD:233980"
     misc_feature    complement(101509..101826)
                     /locus_tag="Rahaq2_0096"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(100870..101484)
                     /locus_tag="Rahaq2_0096"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    complement(100510..100824)
                     /locus_tag="Rahaq2_0096"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     misc_feature    complement(99532..100419)
                     /locus_tag="Rahaq2_0096"
                     /note="Allophanate hydrolase subunit 2; Region: AHS2;
                     smart00797"
                     /db_xref="CDD:214821"
     misc_feature    complement(98755..99402)
                     /locus_tag="Rahaq2_0096"
                     /note="Allophanate hydrolase subunit 1; Region: AHS1;
                     smart00796"
                     /db_xref="CDD:214820"
     misc_feature    complement(98212..98409)
                     /locus_tag="Rahaq2_0096"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(98287..98289,98308..98316,98341..98343))
                     /locus_tag="Rahaq2_0096"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(98311..98313)
                     /locus_tag="Rahaq2_0096"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            complement(101840..103687)
                     /locus_tag="Rahaq2_0097"
                     /note="IMG reference gene:2506707122"
                     /db_xref="GeneID:11789838"
     CDS             complement(101840..103687)
                     /locus_tag="Rahaq2_0097"
                     /note="PFAM: Amidase;
                     TIGRFAM: allophanate hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase"
                     /protein_id="YP_005198191.1"
                     /db_xref="GI:383188063"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="GeneID:11789838"
                     /translation="MASASDTVASPFHGFTLREWQQHYRNAPDSLRSTLSLVLGSLSE
                     TDNAWIYLATAEQLEAQITRLETLRDQAEGSLSALPLFGVPFAVKDNMDIAGWPTTAA
                     CPAFAYTAQADATVIANLKAKGAVVIGKTNLDQFATGLVGTRSPYGAVRNTFNPDYVS
                     GGSSSGSASVLARGLVAFSLGTDTAGSGRVPAGFNNIVGLKPTKGWLSNTGVVPACRL
                     NDAVSIFALTVADAQTVAHAAGGYDAADAYSRKNPHTAPVAFSAQPRIAMPDRLEFCG
                     DDLAQAAFSEALDRMRHHGVTLEPIDFTPFRELAEQLYYGAWVAERTVAVGEIFEESP
                     EAMDPVVRGIVANGLNYSACDAWRAEYLRAELARKINLALEGFDALVVPTSPTIRTQE
                     ELVREPVLYNSQFGIYTNFTNLADLSALALPSGLRADGLPAGITLIAPAWHDDALASF
                     GRQWQRSLSLPLGATGLTMKPEEFMSAAPVSTASVRVAVVGAHLTGMPLNFQLTRRHA
                     VRVEQTTTAAAYKLYALANTTPPKPGLVRAEGGSAIVVELWDIPLARLGEFVAEIPAP
                     LGIGTLELADGRTVKGFICEPWAISGATDITAFGGWRSYIQNLNSPVKS"
     misc_feature    complement(101852..103648)
                     /locus_tag="Rahaq2_0097"
                     /note="allophanate hydrolase; Provisional; Region:
                     PRK08186"
                     /db_xref="CDD:236177"
     gene            103973..105418
                     /locus_tag="Rahaq2_0098"
                     /note="IMG reference gene:2506707123"
                     /db_xref="GeneID:11789839"
     CDS             103973..105418
                     /locus_tag="Rahaq2_0098"
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase"
                     /protein_id="YP_005198192.1"
                     /db_xref="GI:383188064"
                     /db_xref="GeneID:11789839"
                     /translation="MQLRHLSERLKKLLLALVLVIITLLAVRTYDALQGPPLEPWHKL
                     VPDELSVEQLDKSDWSAYLRAEQQAFVEVKQQVTDKLDREDRIPLNRYYDRSPIYPEH
                     FAQDWNRSYELMPDGKPAGAVVLLHGLTDSPYSLRHIAQDYRRRGFVVVGIRLPGHGT
                     VPGGLTRVDWEQWLAATRLAVREARRTAGAEVPLQLVGFSNGGALAMKYTLDSLDDPA
                     LARPSRVVLISPMIGVTSFARFAGYAGWPAIFPAFAKTAWLNLMPEFNPFKYNSFPVK
                     AARQSYLLTHILQQQISKDAQSGKLAQLPPLLAFQSVVDSTVSSRAVVTALFNQLPAN
                     GSQLVLFDINRSAYVGPLLRPSSETAAERLLPAPPRTYQTTVVTNASPDDAAAVAKTT
                     AAGESAATVSPLGLNYPPEFYSLSHVSLPFPTDDSLYGRNPQGPAQFGIRLGTLAARG
                     ENGALVVSMDQLMRVSSNPFYPYMLQRIEGF"
     misc_feature    104315..104491
                     /locus_tag="Rahaq2_0098"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    104339..104998
                     /locus_tag="Rahaq2_0098"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            105485..105949
                     /locus_tag="Rahaq2_0099"
                     /note="IMG reference gene:2506707124"
                     /db_xref="GeneID:11789840"
     CDS             105485..105949
                     /locus_tag="Rahaq2_0099"
                     /note="PFAM: MarR family;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198193.1"
                     /db_xref="GI:383188065"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789840"
                     /translation="MNMTTDTDSTPNSMLHLDQQMCFALYSANLALHKVYRKLLGQLE
                     LTYPQYLVMLVLWQRDEVTVSEIGEKLFLDSATLTPLLKRLEAAGLLVRQRAKADERQ
                     VIISLTEAGKTLREKAQGIPEAILCATECDIGEIVALKQQLEVLRAKLQDKA"
     misc_feature    105566..105940
                     /locus_tag="Rahaq2_0099"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    105602..105841
                     /locus_tag="Rahaq2_0099"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    order(105671..105679,105704..105715,105719..105724,
                     105731..105736,105740..105745,105761..105769,
                     105791..105799)
                     /locus_tag="Rahaq2_0099"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(105671..105673,105680..105682)
                     /locus_tag="Rahaq2_0099"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            106084..106506
                     /locus_tag="Rahaq2_0100"
                     /note="IMG reference gene:2506707125"
                     /db_xref="GeneID:11789841"
     CDS             106084..106506
                     /locus_tag="Rahaq2_0100"
                     /note="PFAM: OsmC-like protein;
                     TIGRFAM: peroxiredoxin, Ohr subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Ohr subfamily peroxiredoxin"
                     /protein_id="YP_005198194.1"
                     /db_xref="GI:383188066"
                     /db_xref="InterPro:IPR003718"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="GeneID:11789841"
                     /translation="MSIEKVVYRAHASATGGRDGRATSDDGVLDVKLGVPKEMGGMGG
                     GTNPEQLFAAGYSACFLGALKAVAAQEKIKIPADAKIEGAVGIGAIPGGYGIEVQLDI
                     TLPGFERSEAEALVAKAHQVCPYSNATRGNIDVTLNVK"
     misc_feature    106102..106500
                     /locus_tag="Rahaq2_0100"
                     /note="peroxiredoxin, Ohr subfamily; Region:
                     organ_hyd_perox; TIGR03561"
                     /db_xref="CDD:234259"
     gene            106778..108457
                     /locus_tag="Rahaq2_0101"
                     /note="IMG reference gene:2506707126"
                     /db_xref="GeneID:11789842"
     CDS             106778..108457
                     /locus_tag="Rahaq2_0101"
                     /note="PFAM: Sulfatase; Domain of unknown function
                     (DUF1705)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane-associated, metal-dependent
                     hydrolase"
                     /protein_id="YP_005198195.1"
                     /db_xref="GI:383188067"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR012549"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="GeneID:11789842"
                     /translation="MNRVKTLSQQNISLLLAIYIGIFLNVSVFQRRFAALVNHFTSAE
                     LVQAVTEVCAIVLFTFFVLRLLSLGGRLFFRIIASLLVLISVAASYYMVMFNVVIGYG
                     IVVSVMTTDIDLSKEIIGYHLFIWMALVSAIPLFLIWKNNLRLTLIEQMKTPGQRVLP
                     LGVLLAAALLVWLPLRTLDHAQSVNEKKTNVDLPSYGGVVAHSYLPSNWLAALGLYAY
                     TQVDESQDASHYFDPAKEFTYVPPADIDDTYVVFIIGETTRWDHLGILGYERDTTPRL
                     SKEKNLVAFRGTSCDTATKLSLRCMFVREGGTVDNPQRTLKEQNIFAVMKSLGFTSEL
                     FAMQSELWFYNNADTNNFSFREIIASEKRNDGKPVDDMLLVNELAQSLKTHPKGKHLV
                     ILHTKGSHYLYSQRYPRSYARYTPECKSNTCTKAELINAFDNSVLYTDTFIDNVIDQL
                     RDKKALVFYASDHGESIDENSHLHGTPREMAPPEQFRVPMMVWASDSFLEQPDHKLAF
                     EQLQAQQRVGAKKRHVELFDSILGCLGYTSPDGGINPANNWCAKPQTEQKL"
     misc_feature    106778..108439
                     /locus_tag="Rahaq2_0101"
                     /note="phosphoethanolamine transferase; Provisional;
                     Region: PRK11560"
                     /db_xref="CDD:183198"
     misc_feature    106994..>107209
                     /locus_tag="Rahaq2_0101"
                     /note="Domain of unknown function (DUF1705); Region:
                     DUF1705; pfam08019"
                     /db_xref="CDD:149223"
     misc_feature    107525..108385
                     /locus_tag="Rahaq2_0101"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     gene            108558..108634
                     /locus_tag="Rahaq2_0102"
                     /note="IMG reference gene:2506707127"
                     /db_xref="GeneID:11789843"
     tRNA            108558..108634
                     /locus_tag="Rahaq2_0102"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:11789843"
     gene            108670..108799
                     /locus_tag="Rahaq2_0103"
                     /note="IMG reference gene:2506707128"
                     /db_xref="GeneID:11789844"
     ncRNA           108670..108799
                     /locus_tag="Rahaq2_0103"
                     /ncRNA_class="other"
                     /product="RtT RNA"
                     /db_xref="GeneID:11789844"
     gene            108835..108964
                     /locus_tag="Rahaq2_0104"
                     /note="IMG reference gene:2506707129"
                     /db_xref="GeneID:11789845"
     ncRNA           108835..108964
                     /locus_tag="Rahaq2_0104"
                     /ncRNA_class="other"
                     /product="RtT RNA"
                     /db_xref="GeneID:11789845"
     gene            complement(109029..109508)
                     /locus_tag="Rahaq2_0105"
                     /note="IMG reference gene:2506707130"
                     /db_xref="GeneID:11789846"
     CDS             complement(109029..109508)
                     /locus_tag="Rahaq2_0105"
                     /note="PFAM: Toxin with endonuclease activity YhaV"
                     /codon_start=1
                     /transl_table=11
                     /product="Toxin with endonuclease activity YhaV"
                     /protein_id="YP_005198196.1"
                     /db_xref="GI:383188068"
                     /db_xref="InterPro:IPR021679"
                     /db_xref="GeneID:11789846"
                     /translation="MHNQAMEINGWTLLAHPLILQQIQALTDQVVLLRRKDPAGYKSK
                     NATKRLAAINKLMFDVIPQDPARVEFRQGDTLGGEFSHWFRAKFFQQYRLFFRYNLKS
                     RIIIYAWVNDDKELRAYESKTDAYRMFRKMLKSGEPPDNWQALVESCSHELAEQKLP"
     misc_feature    complement(109068..109475)
                     /locus_tag="Rahaq2_0105"
                     /note="Toxin with endonuclease activity YhaV; Region:
                     Toxin_YhaV; pfam11663"
                     /db_xref="CDD:204705"
     gene            complement(109515..109859)
                     /locus_tag="Rahaq2_0106"
                     /note="IMG reference gene:2506707131"
                     /db_xref="GeneID:11789847"
     CDS             complement(109515..109859)
                     /locus_tag="Rahaq2_0106"
                     /note="PFAM: SpoVT / AbrB like domain;
                     TIGRFAM: looped-hinge helix DNA binding domain, AbrB
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB family DNA-binding protein"
                     /protein_id="YP_005198197.1"
                     /db_xref="GI:383188069"
                     /db_xref="InterPro:IPR007159"
                     /db_xref="GeneID:11789847"
                     /translation="MSASAVWGIKFEAESKVTRRFQTTIPATIRKALNLTENDRIQYK
                     ILPDGQVVISRQLEEAEDPVISAFLGFVAKDMLNNPENMQPVTLSLHEKINVLTAGMA
                     IDLESPLSDDDE"
     misc_feature    complement(109518..109829)
                     /locus_tag="Rahaq2_0106"
                     /note="Antidote-toxin recognition MazE; Region:
                     Antitoxin-MazE; cl00877"
                     /db_xref="CDD:260674"
     gene            complement(109941..110270)
                     /locus_tag="Rahaq2_0107"
                     /note="IMG reference gene:2506707132"
                     /db_xref="GeneID:11789848"
     CDS             complement(109941..110270)
                     /locus_tag="Rahaq2_0107"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198198.1"
                     /db_xref="GI:383188070"
                     /db_xref="GeneID:11789848"
                     /translation="MSEGLSGQRIDTFESHRFTKAFGRLPLSQQVIVEDEIERIQDDP
                     RLGELKKGDLSYLRVHKFPLEKQQALLGYCWREEKIELYLLSLDSQENFYQDHKNHRK
                     GDLKMMK"
     gene            complement(110239..110475)
                     /locus_tag="Rahaq2_0108"
                     /note="IMG reference gene:2506707133"
                     /db_xref="GeneID:11789849"
     CDS             complement(110239..110475)
                     /locus_tag="Rahaq2_0108"
                     /note="PFAM: Protein of unknown function (DUF3423)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198199.1"
                     /db_xref="GI:383188071"
                     /db_xref="InterPro:IPR021831"
                     /db_xref="GeneID:11789849"
                     /translation="MATSIRLDDDFVSDVKIHAEASHRSIPKQIEHWAKIGRIAEDNP
                     DLTYRFIVETLLAKSETDNNKVTRYVRRTERSKD"
     misc_feature    complement(<110296..110472)
                     /locus_tag="Rahaq2_0108"
                     /note="Protein of unknown function (DUF3423); Region:
                     DUF3423; pfam11903"
                     /db_xref="CDD:152339"
     gene            complement(110687..112066)
                     /locus_tag="Rahaq2_0109"
                     /note="IMG reference gene:2506707134"
                     /db_xref="GeneID:11789850"
     CDS             complement(110687..112066)
                     /locus_tag="Rahaq2_0109"
                     /note="PFAM: MmgE/PrpD family"
                     /codon_start=1
                     /transl_table=11
                     /product="propionate catabolism protein"
                     /protein_id="YP_005198200.1"
                     /db_xref="GI:383188072"
                     /db_xref="InterPro:IPR005656"
                     /db_xref="GeneID:11789850"
                     /translation="MNVIEAIARWCCSQPDFSPAARRKAREAITDTLACLYAGQDDFS
                     SRAVRAASETYFTPHASSRLAGGGRAPAAIAALVNGTAAHAIDYDDNFAPGMSHASAV
                     LVPALLAVADDIRASGEQLVKAYLIGLQAQAFVGSGVAPSHYTAGWHGTSTVGCIGSA
                     AGVAWLMGLDQAGIARALSNAVSFASGTKGQFGTPVKPLHAGWAARNAVDAANFARQQ
                     MQGRIDILEAPQGFLEMFGGLTPPGWDIPAILGTHLHIIETTGVMPKRHPCCGSTHMV
                     IDALDDLRAQHDFSDDDVLTVDTLVGIANLRNLAYPQPVNEMQARFSMQYCVDTWLRH
                     GSLGVSDFTPARVAELAEPARLARISMRCYTPEQEAETPPGDRLTHEVTLTLRDGRTL
                     QAGRKLAKGSNREPFSDADRLRKFTDCCAAMHDASDLFRQLNRLEEQEDLAFLAPLLG
                     EPLRDGAQA"
     misc_feature    complement(110735..112024)
                     /locus_tag="Rahaq2_0109"
                     /note="Uncharacterized protein involved in propionate
                     catabolism [General function prediction only]; Region:
                     PrpD; COG2079"
                     /db_xref="CDD:224990"
     gene            complement(112086..112868)
                     /locus_tag="Rahaq2_0110"
                     /note="IMG reference gene:2506707135"
                     /db_xref="GeneID:11789851"
     CDS             complement(112086..112868)
                     /locus_tag="Rahaq2_0110"
                     /note="PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     ATPase"
                     /protein_id="YP_005198201.1"
                     /db_xref="GI:383188073"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11789851"
                     /translation="MTTFMNPAPPLTADRMIETVDLSIAFGKGTHSKTVVDSVTMHIA
                     RGESYGLIGESGCGKSTILRTLTGQNTRYSGAILYQNREQHPVRDKDYYRQVQMVFQD
                     PYASLHPRKMVYHTLLEPLVIHGMDRREARISDVLNALGLSDAFRYRYPHQLSGGQRQ
                     RVALARALIIEPQVLLLDEPTSALDVSVQAEILNLLKKLRRERNLTYLMVTHDLAVVA
                     HLCDRVAIMHQGKLLEELTAAEIRSGAAREPYTQQFLAASRH"
     misc_feature    complement(112092..112829)
                     /locus_tag="Rahaq2_0110"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    complement(112164..112823)
                     /locus_tag="Rahaq2_0110"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(112689..112712)
                     /locus_tag="Rahaq2_0110"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(112233..112235,112332..112337,
                     112566..112568,112686..112694,112698..112703))
                     /locus_tag="Rahaq2_0110"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(112566..112577)
                     /locus_tag="Rahaq2_0110"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(112380..112409)
                     /locus_tag="Rahaq2_0110"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(112332..112349)
                     /locus_tag="Rahaq2_0110"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(112314..112325)
                     /locus_tag="Rahaq2_0110"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(112227..112247)
                     /locus_tag="Rahaq2_0110"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     gene            complement(112868..113734)
                     /locus_tag="Rahaq2_0111"
                     /note="IMG reference gene:2506707136"
                     /db_xref="GeneID:11793751"
     CDS             complement(112868..113734)
                     /locus_tag="Rahaq2_0111"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     ATPase"
                     /protein_id="YP_005198202.1"
                     /db_xref="GI:383188074"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="GeneID:11793751"
                     /translation="MTETLLDVQNLNIRFKGHRQENHAVRGISFSVGREKVAIVGESG
                     SGKSLTGRSLLKLTPQGASVSADRMQLGDIDLLSTGERQMRKIRGKRISMIMQDPKFS
                     LNPLMRVGHQINEAYRIHFHVSEREARVKALAMLEAVNIRDPERVFDLYPHEISGGMG
                     QRIMIAMMLIPEPDLIIADEPTSALDVTVRQQVLSVLDALLARRKTGLLFITHDLSLV
                     SGFCDRALVMYAGRILEEIAADQLHNARHPYTRALLASQPDLQHPVDMLAIPARDPAW
                     LTGPVYRYGETC"
     misc_feature    complement(112943..113725)
                     /locus_tag="Rahaq2_0111"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    complement(113027..113722)
                     /locus_tag="Rahaq2_0111"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(113591..113614)
                     /locus_tag="Rahaq2_0111"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(113096..113098,113195..113200,
                     113444..113446,113588..113596,113600..113605))
                     /locus_tag="Rahaq2_0111"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(113444..113455)
                     /locus_tag="Rahaq2_0111"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(113243..113272)
                     /locus_tag="Rahaq2_0111"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(113195..113212)
                     /locus_tag="Rahaq2_0111"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(113177..113188)
                     /locus_tag="Rahaq2_0111"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(113090..113110)
                     /locus_tag="Rahaq2_0111"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<112895..113023)
                     /locus_tag="Rahaq2_0111"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(113727..114662)
                     /locus_tag="Rahaq2_0112"
                     /note="IMG reference gene:2506707137"
                     /db_xref="GeneID:11793752"
     CDS             complement(113727..114662)
                     /locus_tag="Rahaq2_0112"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005198203.1"
                     /db_xref="GI:383188075"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11793752"
                     /translation="MTDSAKPHLTARPAFSLRAWLDAPVPATPWQARVQQSLNQWRRF
                     RRNTSARFGLIVILFIVAVAIFAPWLATHDIYAQNLHLRLAPPDREYWLGTDELGRDI
                     YSRLIYGARITLYITGLTALIVGPLGLLVGTLAGTVGGWTDTILMRIVDIFLAFPSLI
                     LALGFVAALGPGIENAIIAISLSAWPPIARLARAEALSIRKMDYVAAVRLQGASQMRI
                     ILRHIIPMCLPSVVVRLTLNMAGIILTASGLGFLGLGAQAPSPEWGAMLSSGRQFMMT
                     HWTIAAIPGLSILFTSLAFNLFGDGLRDVLDLRHD"
     misc_feature    complement(113742..114542)
                     /locus_tag="Rahaq2_0112"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(114402..114542)
                     /locus_tag="Rahaq2_0112"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    complement(113784..114335)
                     /locus_tag="Rahaq2_0112"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(113784..113789,113796..113801,
                     113808..113813,113817..113822,113829..113831,
                     113835..113837,113865..113870,113910..113915,
                     113922..113933,113952..113954,113961..113966,
                     114006..114008,114057..114059,114066..114071,
                     114081..114083,114087..114092,114099..114101,
                     114105..114107,114111..114116,114165..114167,
                     114171..114176,114183..114212,114216..114227,
                     114255..114257,114270..114275,114282..114287))
                     /locus_tag="Rahaq2_0112"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(113916..113933,114165..114209))
                     /locus_tag="Rahaq2_0112"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(113835..113837,113865..113867,
                     113874..113876,113913..113915,114129..114131,
                     114165..114167))
                     /locus_tag="Rahaq2_0112"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(113985..113987,113997..114002,
                     114018..114056))
                     /locus_tag="Rahaq2_0112"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(114659..115744)
                     /locus_tag="Rahaq2_0113"
                     /note="IMG reference gene:2506707138"
                     /db_xref="GeneID:11789852"
     CDS             complement(114659..115744)
                     /locus_tag="Rahaq2_0113"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005198204.1"
                     /db_xref="GI:383188076"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11789852"
                     /translation="MSQLDPTAAGMSPAEPLWLRLRESAARLGKLLVSVFCTLLGLAA
                     LTFFIGRLLPIDPVVSVLGDNASQEAYQKMYHLLGLDKPLWEQFLMYLKNVAMLDFGN
                     ALTTGNPVTTDIARVFPATLELATLAALIATCLGIPAGVLSAMYRNTWFDHCIRFIGL
                     LGHSAPNFWLGLMGLVLFYAGLGWIGGPGRIDFMYEFDVQKVTGFYLIDTALTGNWEA
                     FRNVFSHLILPASILGLSGLSYISRMTRSFMIEQLGQEYVITARVKGLSWARSVWIHA
                     FRNVAVQVVTVVALSYAFLLEGAVLTETVFAWPGFGRYLTNAMLAGDMNAVVGCSLLI
                     GVIFVALNLICDLLYRIFDPRTRQEQS"
     misc_feature    complement(114668..115663)
                     /locus_tag="Rahaq2_0113"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(114728..115393)
                     /locus_tag="Rahaq2_0113"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(114728..114730,114737..114742,
                     114749..114754,114758..114763,114770..114775,
                     114803..114808,114833..114838,114845..114856,
                     114875..114877,114884..114889,114929..114931,
                     114980..114982,114989..114994,115004..115006,
                     115010..115015,115022..115024,115028..115030,
                     115034..115039,115220..115222,115226..115231,
                     115238..115267,115271..115282,115313..115315,
                     115328..115333,115340..115345))
                     /locus_tag="Rahaq2_0113"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(114839..114856,115220..115264))
                     /locus_tag="Rahaq2_0113"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(114773..114775,114803..114805,
                     114812..114814,114836..114838,115052..115054,
                     115220..115222))
                     /locus_tag="Rahaq2_0113"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(114908..114910,114920..114925,
                     114941..114979))
                     /locus_tag="Rahaq2_0113"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(115773..117371)
                     /locus_tag="Rahaq2_0114"
                     /note="IMG reference gene:2506707139"
                     /db_xref="GeneID:11789853"
     CDS             complement(115773..117371)
                     /locus_tag="Rahaq2_0114"
                     /note="PFAM: Bacterial extracellular solute-binding
                     proteins, family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005198205.1"
                     /db_xref="GI:383188077"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="GeneID:11789853"
                     /translation="MLNTRIKMLATLTGLTLGCSAAQAATPADSLVMAWNIDAISTFD
                     PAQIGEVVTNEIIKNTCDTLVDFDPQDESKVIPRLAKSWDISPDRKQITFHLNTGMTF
                     PSGNKATAKDVAWSLQRVVLLGFGNSATLTEYGFTKENVKERITAPDDDTLVMTFDQP
                     YPTNLVLQAIAANNVSTTLDKALVEKNAVGDDMGNKYLTTHTACVGAYQLMRWNAGEG
                     VVLQANKDYWGEKPKLQRILIRHVAETGTQRLLLTQGDVDIARDLAPDDLRDLDKGGQ
                     VNVVKVLKPQLFFWTFNSEDPIFKNPKVRLAMRYLIDYQGLASTVMPYLGVPRASFAQ
                     LGAFGALDKDAGQPFKLDLAKARQLLTEAGYPDGFSARLIIGTLPHSAPIAQSTQENA
                     SKIGVKLSIESMANAQLFSRVRGREFQSAMMAWQTSVPDAHGNASRLVYNPDNSKEAK
                     KTQYPSWRASYFDPAMNKKVTEALLEPDEQKRIALYHSLQEEQMQQGPMAIMFQMYNT
                     AGLTRQVKDWTWNGFRVYYALASK"
     misc_feature    complement(115791..117350)
                     /locus_tag="Rahaq2_0114"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(115818..117293)
                     /locus_tag="Rahaq2_0114"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_7; cd08512"
                     /db_xref="CDD:173877"
     gene            complement(117585..119024)
                     /locus_tag="Rahaq2_0115"
                     /note="IMG reference gene:2506707140"
                     /db_xref="GeneID:11789854"
     CDS             complement(117585..119024)
                     /locus_tag="Rahaq2_0115"
                     /note="PFAM: Peptidase family M20/M25/M40;
                     TIGRFAM: amidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_005198206.1"
                     /db_xref="GI:383188078"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017145"
                     /db_xref="GeneID:11789854"
                     /translation="MNNASAQNKESVWSLVDAKKALFTALSDRVWGMPEICYTEYRSV
                     AEHTAMLKEQGFRVTENVADIPTAVMGEAGEGGPIIAILGEYDALPGLSQVAGIARPE
                     PLPGNGQGHGCGHNLLGSAAMLAATALKDWLAQTGTPGRVRYYGCPAEEGGAAKSFMA
                     RAGAFDGVDIAITWHPNAFSEVARAESLANTRMDFVFHGRSSHAAASPHLGRSALDAV
                     ELMNVGVNYLREHVPQDSRIHYAMLDSGGIAPNVVQARAAVRYAIRSRDVHAMFELNE
                     RVKKVAQGAAMMTETTVDISIMSAVANLLGNRPLEEAMQRNFALLGPLEFDAADKAFA
                     AEIQATLSPQDLQSAYRRIGLKKPQDASPLCEFIVPLETSGELMLGSTDVGDISWKMP
                     TVQAHVPTYAIGTPGHSWQLTAQGKMPAAHKGLAYVAKIMAATAIDTLTDSALMAAAK
                     QAHQELTAETPYVCPIPPEVKPPVQPRPE"
     misc_feature    complement(117666..118979)
                     /locus_tag="Rahaq2_0115"
                     /note="M20 Peptidase Aminoacylase 1-like protein 2
                     aminobenzoyl-glutamate utilization protein B subfamily;
                     Region: M20_Acy1L2_AbgB; cd05673"
                     /db_xref="CDD:193548"
     misc_feature    complement(117672..118973)
                     /locus_tag="Rahaq2_0115"
                     /note="Metal-dependent
                     amidase/aminoacylase/carboxypeptidase [General function
                     prediction only]; Region: AbgB; COG1473"
                     /db_xref="CDD:224390"
     misc_feature    complement(order(117801..117803,118500..118502,
                     118572..118574,118680..118682,118686..118688))
                     /locus_tag="Rahaq2_0115"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:193548"
     gene            complement(119282..120208)
                     /locus_tag="Rahaq2_0116"
                     /note="IMG reference gene:2506707141"
                     /db_xref="GeneID:11789855"
     CDS             complement(119282..120208)
                     /locus_tag="Rahaq2_0116"
                     /note="PFAM: Bacterial regulatory helix-turn-helix
                     protein, lysR family; LysR substrate binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198207.1"
                     /db_xref="GI:383188079"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789855"
                     /translation="MELKWFEDFLSVSQCYSFTRAASERNITQSALSRRIKQLEEWLG
                     VPLFDRKTYPIRLTPQGQDFLHTAAELVFSMTQLRSDLRERHAQKHTIVHFAALNTLS
                     LTFFPDWINQIDPSHQYGYIRLCDQQPSFSGNISLLLDGETDFLLTYAHDSVPLMKQL
                     ERFPYIELGKESALAVCAPDEDGNPLFALNTSGGTRVQLPYLSYGNRSFFAHALSALF
                     ASRPLPLKPIYENPMCSGLKAMTISGCGVAWLPASLISEELANGSLIRAGERSWDIQA
                     SIRLYRLEKFRTPQAERLWNKASQLHQTRAVA"
     misc_feature    complement(119306..120208)
                     /locus_tag="Rahaq2_0116"
                     /note="cell density-dependent motility repressor;
                     Provisional; Region: PRK10082"
                     /db_xref="CDD:182228"
     misc_feature    complement(120023..120202)
                     /locus_tag="Rahaq2_0116"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(119321..119932)
                     /locus_tag="Rahaq2_0116"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(119480..119485,119489..119494,
                     119510..119527,119828..119836,119837..119845,
                     119849..119851,119861..119863,119876..119881,
                     119885..119890))
                     /locus_tag="Rahaq2_0116"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            120937..122544
                     /locus_tag="Rahaq2_0117"
                     /note="IMG reference gene:2506707142"
                     /db_xref="GeneID:11789856"
     CDS             120937..122544
                     /locus_tag="Rahaq2_0117"
                     /note="PFAM: Bacterial extracellular solute-binding
                     proteins, family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005198208.1"
                     /db_xref="GI:383188080"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="GeneID:11789856"
                     /translation="MTISLGKSGLLKFSMGLIALTVAASVQAKTLVYCSEGSPEGFNP
                     QLFTSGTTYDASSVPIYNRLVEFKIGTTEIQPGLAEKWDVSADGKTYTFHLRKGVKWQ
                     DNKEFKPTRDFNADDVVYSFERQLDKNNPYHGVSGGSYEYFEGMGMGDLINKIVKVDD
                     NTVQFVLNRPESPFLADLAMDFASILSAEYADNMLKAKTPEKVDLDPIGTGPFQLVQY
                     QKDSRILYKAFPGFWGTKPQIDRLVFSITPDASVRYAKLQKNECQVMPYPNPADIAAM
                     KKDKSINLMQQPGLNVGYLSFNVEKKPLDEVKVRQALTMAVNKKAIIDAVYQGAGQPA
                     KNLIPPTMWGYNKDVVDYEYNPEKAKELLKEAGHADGFAIDLWAMPVQRPYNPNARRM
                     AEMIQADWAKIGVKANIVTYEWGEYLKRAKNGEHQSVMMGWTGDNGDPDNFFATLFSC
                     AAAKDGSNYSRWCYKPFEDLIQPARAESDHAKRAALYQQAQVVMHDQAPALIIAHSTV
                     YEPVRKEVKGYVVDPLGKHHFENVSME"
     misc_feature    120937..122541
                     /locus_tag="Rahaq2_0117"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    121024..122493
                     /locus_tag="Rahaq2_0117"
                     /note="The substrate-binding component of an ABC-type
                     dipeptide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_DppA_like; cd08493"
                     /db_xref="CDD:173858"
     misc_feature    order(122176..122178,122188..122190,122227..122238,
                     122242..122244)
                     /locus_tag="Rahaq2_0117"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173858"
     gene            122752..123771
                     /locus_tag="Rahaq2_0118"
                     /note="IMG reference gene:2506707143"
                     /db_xref="GeneID:11789857"
     CDS             122752..123771
                     /locus_tag="Rahaq2_0118"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005198209.1"
                     /db_xref="GI:383188081"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11789857"
                     /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVTIMAGERGV
                     SPERHAQLMADMGLDKPLYQQYFHYVNGVLHGDLGTSLKSRTPVWQEFVPRFKATVEL
                     GICAMIFAIIVGIPVGVLAAVKRGSIFDHTAVGISLTGYSMPIFWWGIMLVMLVSVQL
                     NLTPVSGRISDTVFLDDSLPLTGFMLIDTLFWGEPGDFVDAVMHMILPAIVLGTIPLA
                     VIVRMTRSSMLEVLGEDYIRTARAKGVSRMRVIVVHALRNALLPVVTIIGLQVGTLLG
                     GAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATLIIVVNLLVDVLYGVVNPR
                     IRHKK"
     misc_feature    122752..123768
                     /locus_tag="Rahaq2_0118"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    123037..123729
                     /locus_tag="Rahaq2_0118"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(123085..123090,123097..123102,123115..123117,
                     123148..123159,123163..123192,123199..123204,
                     123208..123210,123394..123399,123403..123405,
                     123409..123411,123418..123423,123427..123429,
                     123439..123444,123451..123453,123502..123504,
                     123544..123549,123556..123558,123577..123588,
                     123595..123600,123625..123630,123679..123684,
                     123691..123696,123700..123705,123712..123717,
                     123724..123729)
                     /locus_tag="Rahaq2_0118"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(123166..123210,123577..123594)
                     /locus_tag="Rahaq2_0118"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(123208..123210,123379..123381,123595..123597,
                     123619..123621,123628..123630,123679..123681)
                     /locus_tag="Rahaq2_0118"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(123454..123492,123508..123513,123523..123525)
                     /locus_tag="Rahaq2_0118"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            123782..124696
                     /locus_tag="Rahaq2_0119"
                     /note="IMG reference gene:2506707144"
                     /db_xref="GeneID:11789858"
     CDS             123782..124696
                     /locus_tag="Rahaq2_0119"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005198210.1"
                     /db_xref="GI:383188082"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11789858"
                     /translation="MSQTTEPVANELVTAAPVPMPPMREFWHYFKRNKGAVVGLVYII
                     IMLVIAIGANVIAPHLPAEQFRDALLRPPVWMEGGSWKFLLGTDDVGRDILSRLMYGA
                     RLSLLVGCLVVVLSLILGVVFGLFAGYYGGVVDAIIMRVVDIMLALPSLLLALVLVAI
                     FGPSIVNASLALTFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGSARQMFVNILPN
                     CLAPLIVQASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFP
                     GVIILLTVLAFNLMGDGLRDALDPKLKQ"
     misc_feature    123782..124693
                     /locus_tag="Rahaq2_0119"
                     /note="dipeptide transporter; Provisional; Region:
                     PRK10913"
                     /db_xref="CDD:182833"
     misc_feature    123845..124000
                     /locus_tag="Rahaq2_0119"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    124133..124633
                     /locus_tag="Rahaq2_0119"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(124133..124138,124145..124150,124163..124165,
                     124193..124204,124208..124222,124223..124225,
                     124229..124231,124304..124309,124313..124315,
                     124319..124321,124328..124333,124337..124339,
                     124349..124354,124361..124363,124412..124414,
                     124454..124459,124466..124468,124487..124498,
                     124505..124510,124550..124555,124589..124594,
                     124601..124606,124610..124615,124622..124627)
                     /locus_tag="Rahaq2_0119"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(124211..124222,124223..124231,124487..124504)
                     /locus_tag="Rahaq2_0119"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(124229..124231,124289..124291,124505..124507,
                     124544..124546,124553..124555,124589..124591)
                     /locus_tag="Rahaq2_0119"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(124364..124402,124418..124423,124433..124435)
                     /locus_tag="Rahaq2_0119"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            124707..125732
                     /locus_tag="Rahaq2_0120"
                     /note="IMG reference gene:2506707145"
                     /db_xref="GeneID:11789859"
     CDS             124707..125732
                     /locus_tag="Rahaq2_0120"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter,
                     ATP-binding protein, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_005198211.1"
                     /db_xref="GI:383188083"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11789859"
                     /translation="METTLTNDVQVGKTLLTVDKLSVHFGDEGTPFRAVDRISYSVKQ
                     GEVVGIVGESGSGKSVSSLALMGLIDFPGKVMAEKLEFGGRSLQGISEKERRQIVGAE
                     VAMIFQDPMTSLNPCYTVGFQIMEAIKVHQGGNKKTRRQRTIDLLNLVGIPDPASRLD
                     VYPHQLSGGMSQRVMIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLDLQQRENMA
                     LMLITHDLALVAEAAQHIIVMYAGQVVESAKATEIFRAPRHPYTQALLRSLPEFAADK
                     ARLQSLPGVVPGKYDRPAGCLLNPRCPYATDLCRKEEPALRDLANGRQSKCHYPLDDA
                     GRPTYES"
     misc_feature    124749..125723
                     /locus_tag="Rahaq2_0120"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppD; PRK11022"
                     /db_xref="CDD:182906"
     misc_feature    124749..125450
                     /locus_tag="Rahaq2_0120"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    124860..124883
                     /locus_tag="Rahaq2_0120"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(124869..124874,124878..124886,125028..125030,
                     125274..125279,125376..125378)
                     /locus_tag="Rahaq2_0120"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    125019..125030
                     /locus_tag="Rahaq2_0120"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    125202..125231
                     /locus_tag="Rahaq2_0120"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    125262..125279
                     /locus_tag="Rahaq2_0120"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    125286..125297
                     /locus_tag="Rahaq2_0120"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    125364..125384
                     /locus_tag="Rahaq2_0120"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    125433..125693
                     /locus_tag="Rahaq2_0120"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            125722..126744
                     /locus_tag="Rahaq2_0121"
                     /note="IMG reference gene:2506707146"
                     /db_xref="GeneID:11789860"
     CDS             125722..126744
                     /locus_tag="Rahaq2_0121"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter,
                     ATP-binding protein, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_005198212.1"
                     /db_xref="GI:383188084"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11789860"
                     /translation="MSPDNTQPQPLLHAIDLKKHYPVKKGIFGQERTVKALDGVSFTL
                     ERGKTLAVVGESGCGKSTLGRLLTMIEVPTGGELYYRGQDLLKPDATAEKLRRQKIQI
                     VFQNPYGSLNPRKKVGQILEEPLLINTKLSREERREKALAMMAKVGLKTEHYDRYPHM
                     FSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLSYVFIS
                     HDLSVVEHIADEVMVMYLGRCVEKGPKDAIFSNPRHPYTQALLSATPRLNPDERRERI
                     KLTGELPSPLNPPAGCAFNARCRRAFGTCKQFQPQLKQYGDQLVACFAVDQDETGTTQ
                     TVAVNQ"
     misc_feature    125740..126720
                     /locus_tag="Rahaq2_0121"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppF; PRK11308"
                     /db_xref="CDD:236898"
     misc_feature    125752..126450
                     /locus_tag="Rahaq2_0121"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    125881..125904
                     /locus_tag="Rahaq2_0121"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(125890..125895,125899..125907,126034..126036,
                     126274..126279,126376..126378)
                     /locus_tag="Rahaq2_0121"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    126025..126036
                     /locus_tag="Rahaq2_0121"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    126202..126231
                     /locus_tag="Rahaq2_0121"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    126262..126279
                     /locus_tag="Rahaq2_0121"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    126286..126297
                     /locus_tag="Rahaq2_0121"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    126364..126384
                     /locus_tag="Rahaq2_0121"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    126439..126693
                     /locus_tag="Rahaq2_0121"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(126808..127416)
                     /locus_tag="Rahaq2_0122"
                     /note="IMG reference gene:2506707147"
                     /db_xref="GeneID:11789861"
     CDS             complement(126808..127416)
                     /locus_tag="Rahaq2_0122"
                     /note="PFAM: Fic/DOC family;
                     TIGRFAM: mobile mystery protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="mobile mystery protein B"
                     /protein_id="YP_005198213.1"
                     /db_xref="GI:383188085"
                     /db_xref="InterPro:IPR003812"
                     /db_xref="GeneID:11789861"
                     /translation="MSETINNGLPEGATELSPDDLAGLIPDYIFTREDLNQFEKTNIQ
                     QALAHLSRQKLSYTEILTVDFCLRLHRNMFNKTWEWAGQLRRREVNIGNTPPHMISMR
                     VRDTLDNAVFWIENETYPPDEICLRLHRDIVWIHPFPNGNGRHSRIFCDVLRRALGRG
                     FFPWGISAGELVSADAHRAEYILALREADNGDYRRLIRFASD"
     misc_feature    complement(126817..127380)
                     /locus_tag="Rahaq2_0122"
                     /note="mobile mystery protein B; Region: mob_myst_B;
                     TIGR02613"
                     /db_xref="CDD:131662"
     misc_feature    complement(126817..127332)
                     /locus_tag="Rahaq2_0122"
                     /note="Fic/DOC family; Region: Fic; cl00960"
                     /db_xref="CDD:260722"
     gene            complement(127413..127880)
                     /locus_tag="Rahaq2_0123"
                     /note="IMG reference gene:2506707148"
                     /db_xref="GeneID:11789862"
     CDS             complement(127413..127880)
                     /locus_tag="Rahaq2_0123"
                     /note="PFAM: Helix-turn-helix;
                     TIGRFAM: mobile mystery protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="mobile mystery protein A"
                     /protein_id="YP_005198214.1"
                     /db_xref="GI:383188086"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11789862"
                     /translation="MWDKELKIKQVDNLLNEMKPRRKARRPKKGWIQLLRSALGMSTR
                     SLAERCGLSQSRISLIEKGEIEGSLTLNTLEKIAEGLDCELVYFLQPKQGRTLQELRE
                     QQAGKKAKFLNQYTEIHMSLEQQPTSSAFQKSTQDKLKSDLLQKWPRDFWDEK"
     misc_feature    complement(<127572..127790)
                     /locus_tag="Rahaq2_0123"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(127617..127790)
                     /locus_tag="Rahaq2_0123"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(127695..127697,127770..127772,
                     127782..127784))
                     /locus_tag="Rahaq2_0123"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(127698..127700,127773..127775))
                     /locus_tag="Rahaq2_0123"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(127692..127697,127707..127709,
                     127716..127718,127749..127754))
                     /locus_tag="Rahaq2_0123"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(128074..129087)
                     /locus_tag="Rahaq2_0124"
                     /note="IMG reference gene:2506707149"
                     /db_xref="GeneID:11789863"
     CDS             complement(128074..129087)
                     /locus_tag="Rahaq2_0124"
                     /note="PFAM: Glycosyl hydrolases family 8"
                     /codon_start=1
                     /transl_table=11
                     /product="endoglucanase Y"
                     /protein_id="YP_005198215.1"
                     /db_xref="GI:383188087"
                     /db_xref="InterPro:IPR002037"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR019834"
                     /db_xref="GeneID:11789863"
                     /translation="MLAFRRYGLVLWFSLIFAFFSSAVMAQDPGWSAYKSRFLMPDGR
                     IIDTANKNVSHTEGQGFSMLLAVFNDDQATFDKLWQWANNTLYRKDIGLYSWRYDPNS
                     TPHVADINNASDGDTLMAWALLLAGDKWNDPRYTKASEKLQAALITYNVIDYAGYKVM
                     LPGVKGFNQTSNVTVNPSYFIFPAWQAFYAHSHLKVWKDLDESSTAMLSKMAFGDFRL
                     PTDWVDMQADGTLKPASRWPTRFSYDAVRIPLYLGWAHPGSPQLAPFILWWQKSPRDA
                     TPAWIDVMTGTKAGYNMSPGLLAVRDFTMANAGAISPNLAPKDDYYSSTLQLLSWWAS
                     HKG"
     misc_feature    complement(128098..129024)
                     /locus_tag="Rahaq2_0124"
                     /note="Glycosyl hydrolases family 8; Region:
                     Glyco_hydro_8; cl01351"
                     /db_xref="CDD:242450"
     gene            complement(129097..129576)
                     /locus_tag="Rahaq2_0125"
                     /note="IMG reference gene:2506707150"
                     /db_xref="GeneID:11789864"
     CDS             complement(129097..129576)
                     /locus_tag="Rahaq2_0125"
                     /note="PFAM: Cellulose synthase subunit D"
                     /codon_start=1
                     /transl_table=11
                     /product="Cellulose synthase subunit D"
                     /protein_id="YP_005198216.1"
                     /db_xref="GI:383188088"
                     /db_xref="InterPro:IPR022798"
                     /db_xref="GeneID:11789864"
                     /translation="MQEHNYTQVAQEYYRQRHTTPGWQSLVQVLFSGILASADDEDGR
                     RFLTLMGNNLARQHPLPGSATLGELEDNINQLLSRFDWGVVKLEATQQQLALVHIAWP
                     VSPQGQDDELWPIALISLFEGLYAEWLLSQGGQPYVPLRWQESTPEGAFVFRYQNGL"
     misc_feature    complement(<129175..129462)
                     /locus_tag="Rahaq2_0125"
                     /note="Cellulose synthase subunit D; Region: Cellsynth_D;
                     pfam03500"
                     /db_xref="CDD:252002"
     gene            complement(129595..133644)
                     /locus_tag="Rahaq2_0126"
                     /note="IMG reference gene:2506707151"
                     /db_xref="GeneID:11789865"
     CDS             complement(129595..133644)
                     /locus_tag="Rahaq2_0126"
                     /note="PFAM: Cellulose synthase operon protein C
                     C-terminus (BCSC_C)"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis factor"
                     /protein_id="YP_005198217.1"
                     /db_xref="GI:383188089"
                     /db_xref="InterPro:IPR003921"
                     /db_xref="InterPro:IPR008410"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="GeneID:11789865"
                     /translation="MKKHKLSLAVIRAIYLVGIAGVASFSAATFAADTDNPAMKALFD
                     QAAYWHERAHDDLAKDALQKVLLVEPDNAQALYLMSLYSLQGGDKTAANQWREKLTAV
                     SPDDPRLASLNSAKAMQAIPPAQLASARQMAAQGNVSGALSAYRTIFNGNQPPDSLAT
                     EYYLTMAGDKSLQPQAIAGLQQRVASRPDDTQARLGLGKVLTYQESTRRDGIKLLSTL
                     AGSSSEADRSLRQALLWMTPQEADRDLYQGYQARHPNDTGVMAYFQKNIGGAAKGQGF
                     TALNSGDVTSAKAKFESVLADNPNDADALAGLGYIAQRSGNFEQASEYLSKAAAQGGP
                     NSVQLSNQAQDSAFYAQLAKAKDAAGSGSYDAALAAVTPLTQVGGEKGQSASLLRADI
                     LRRKGDLAGAEQQYSAMGDNADARAGLYYVLRQQNKTAEANQVLKTLPAGIQAKMNPP
                     TVADVIEPMRRQAAQAVANNDPQRALNILQQARERQPSNVWVKLDMARILQSQGQTAQ
                     AQSIMAPSARPGASSADLYAAALFASETKNWSTANALLSRIPRSSQNQGMRELAQRVS
                     FNAQMADAESYLQQGNTAAASNTLRALAQNPPTAPADVGALAKNLAASGQLPLAVQLV
                     RQNMRQGVNGNAGDYADQVSVLNQAGLSNEAQAFLQSPQIQSGTSPTALASLRNGFVI
                     TQADQLREQGQYAAAYDKLVVALQADPQNRDLMLAMARLYQSGKLNKQAGQVYNYLMS
                     NDTPTQDARVGAINIALGEGDNQRAKTLMEGLRGPRTPDRLLLEARVAEAQGDHQQAL
                     ALLRSAKGKMIGLEGTDSQAQVAGLQISDNPFINRSTRTSASRPATQSSYGTVLPWQV
                     SDQVSTPGNIPVATTEPTAVTQRNATEKQIDDMLDDLQGKTATWAQGDMSIRGRDGES
                     GLSQLTEAKAPMTFAFVPFDTSRLSIGVTPVSLSAGSPSGTGNTRFGQGALSRGYSSA
                     AAAYNAATGASITSKDVQTYLSDPNNPITTTVNGQSVATFDQYRTQLAAQYTDQCSSV
                     SSNSNAADIAACSALNSSLTRLNGVDPTTYPATEAGNQSATGVEINAALTGDSYKADV
                     GSTPLGQDLNSLVGGVQWAPKLTDFTTLRVTAERRAVTDSILSYVGTKDTYSGKEWGQ
                     VTKNGGSVNLSYDDGDAGFYAEAGYYSYLGNNVKSNKSVNANAGLYVRPFRYDDRELK
                     TGINVGYMDFDKNLSYYSFGQGGYFSPQNYVSVSFPVEYTQKYDDWDLKLSGAVGYQS
                     YSQDKSAYFPNNPDLQKQLEELVDAGFGTESYYAGKTENGIGWNAGVGGNYHLNKSMQ
                     IGGQVGYDTFGDYNESKAQVYFRYLMGQN"
     misc_feature    complement(129604..133482)
                     /locus_tag="Rahaq2_0126"
                     /note="cellulose synthase subunit BcsC; Provisional;
                     Region: PRK11447"
                     /db_xref="CDD:183140"
     misc_feature    complement(132538..132837)
                     /locus_tag="Rahaq2_0126"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(132589..132594,132601..132603,
                     132613..132615,132622..132627,132703..132708,
                     132715..132720,132724..132729,132814..132819,
                     132826..132831,132835..132837))
                     /locus_tag="Rahaq2_0126"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(132544..132546,132553..132555,
                     132571..132573,132616..132618,132661..132663,
                     132670..132672,132682..132684,132718..132720,
                     132763..132765,132772..132774,132784..132786,
                     132820..132822))
                     /locus_tag="Rahaq2_0126"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(129607..130506)
                     /locus_tag="Rahaq2_0126"
                     /note="Cellulose synthase operon protein C C-terminus
                     (BCSC_C); Region: BCSC_C; pfam05420"
                     /db_xref="CDD:253187"
     gene            complement(133727..136204)
                     /locus_tag="Rahaq2_0127"
                     /note="IMG reference gene:2506707152"
                     /db_xref="GeneID:11789866"
     CDS             complement(133727..136204)
                     /locus_tag="Rahaq2_0127"
                     /note="PFAM: Bacterial cellulose synthase subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase subunit"
                     /protein_id="YP_005198218.1"
                     /db_xref="GI:383188090"
                     /db_xref="InterPro:IPR003920"
                     /db_xref="InterPro:IPR018513"
                     /db_xref="GeneID:11789866"
                     /translation="MNRPDNLMIKRRLSAARSASLFRKITTGLLLTFSSLPVSQAEDA
                     PAQAVDPATSLPAAPSWLPPVTPMPGETAPAGDTTPAPAVGAPQTDSTPADNSAAMPE
                     APAASAPVMPLVQPVTSNITVAEMGQPNGLTLSGGQLQSGIMFTLPADEVVTNAHLSL
                     ALKISPALIARDTTLELMLNGQPLGNLPLNQSSNGGDVYDLDIPAAMVVSSNNLSFRV
                     HDSNTMTCEKEQSDKYWVTILPTTSIGLEGQQLNIGRNLGNFPRPFFDGLQMQESKIT
                     MGFSAAMKPGDVSAAAMVSSYLGMLSDYRSIDFPVILNDLPDQNGILFGKPGDKIGSL
                     TLPASHGASVQIIDNPINPVYKLLLVLGNDDNELRQAAYRLISGGMPNNTDHLDVAQQ
                     TIPSSKPYDAPRWIDTSRRVTLGELAGKDQGSLISNGIYHDGIQVAFRAAPDLFMWDG
                     HNIPVRIDYRFPTENWIDEDSSRLNVSINSNFLRSLTVNKVGLVENIWRRLGGDSRQE
                     RYTLQLAPYLIYGDNQLQFYFDIKPKKDAPCSILTSDNIKSRIDPKSFIDLSGSYHFT
                     QLPNLSYFVGASYPYSKLADFSDTLMLLPQAPGADEIHTLLNLASRAGKATGVPVNHV
                     QVAFGLKGDEQNNPLFDRDILAVTTLGDTPFTRQLLAGSPFSINGGSMGVKTPTGMQR
                     VVAWLTGDWYRQPVDADRYLSSTGAWRGFVSYRSRWSADHVVVLATGTDDQQLLKIHH
                     DLKSPKINANVRGDLAIITDENGIRSFSVGQQFPTGQMPWYMMVLWYASNHIVILSLI
                     AILLSLVMGLSLFVVLRRHAAKRLGQK"
     misc_feature    complement(133733..136018)
                     /locus_tag="Rahaq2_0127"
                     /note="cellulose synthase regulator protein; Provisional;
                     Region: PRK11114"
                     /db_xref="CDD:236851"
     gene            complement(136201..138300)
                     /locus_tag="Rahaq2_0128"
                     /note="IMG reference gene:2506707153"
                     /db_xref="GeneID:11789867"
     CDS             complement(136201..138300)
                     /locus_tag="Rahaq2_0128"
                     /note="PFAM: Glycosyl transferase family 2; PilZ domain;
                     Cellulose synthase;
                     TIGRFAM: cellulose synthase catalytic subunit
                     (UDP-forming)"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase catalytic subunit"
                     /protein_id="YP_005198219.1"
                     /db_xref="GI:383188091"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR003919"
                     /db_xref="InterPro:IPR005150"
                     /db_xref="InterPro:IPR009875"
                     /db_xref="GeneID:11789867"
                     /translation="MNKFLFSLLVLLLLPVAAVIIITPMDSQKQYIFGLISIGLLFLL
                     GISKSRRISVVMVIMSVMMSTRYIYWRATETLHFNSTIEAILGVGLFLAELYVWLILL
                     LGYLQTTWPLKRTIEPLPDDTTLWPTVDVYIPSYNESLDVVRDTVLAAQCIDYPKDKI
                     KIYVLDDGKRDEFAVFSADAGVGYITRNDNSHAKAGNLNHAMKLTKGELICVFDCDHV
                     ATRAFLQATVGSFLKDPRLALIQTPHYFYSPDPFERNLSAGRTMPNEGALFYGPVQQG
                     NDNWNATFFCGSCAVIRRVALEEVGGFAVETVTEDAHSALKMQRRGWNTAFLDIPLAA
                     GLATERLGLHVIQRTRWARGMTQIFRVDNPLLGRGLKWQQRLCYLNAMLHFQFGLPRV
                     VFLTAPLAFLLFNLNIISSSASLIFAYALPHLVMSLYINSRMNGRFRYTFWGEIYETV
                     MAFHLILPTLVTMFAPKRGKFNVTDKGGLLDVGFFDFHIVKPHLIVAILMIIGIGYGI
                     VRAVFHDYFAIDPSVVALNIAWGSFSVLILLAAIAVAKETRQVRKTIRIDVAIPAIIH
                     YANGISLRTTTVDMSMGGVQLVTPDVRYLDEEIEEVEIQLSSGAESFPVTQISGDKER
                     LRLQFENLPLSKRRELVRVVLCRADAWIGEEYPPDNPFRSLLSIIRCVFELFYNTWKE
                     RRAKNKPADATGKSEAV"
     misc_feature    complement(136297..138258)
                     /locus_tag="Rahaq2_0128"
                     /note="cellulose synthase catalytic subunit (UDP-forming);
                     Region: CelA; TIGR03030"
                     /db_xref="CDD:234095"
     misc_feature    complement(137224..137922)
                     /locus_tag="Rahaq2_0128"
                     /note="CESA_CelA_like are involved in the elongation of
                     the glucan chain of cellulose; Region: CESA_CelA_like;
                     cd06421"
                     /db_xref="CDD:133043"
     misc_feature    complement(137653..137661)
                     /locus_tag="Rahaq2_0128"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133043"
     misc_feature    complement(136375..136653)
                     /locus_tag="Rahaq2_0128"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     gene            complement(138331..139134)
                     /locus_tag="Rahaq2_0129"
                     /note="IMG reference gene:2506707154"
                     /db_xref="GeneID:11793753"
     CDS             complement(138331..139134)
                     /locus_tag="Rahaq2_0129"
                     /note="PFAM: YhjQ protein;
                     TIGRFAM: cellulose synthase operon protein YhjQ"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase operon protein YhjQ"
                     /protein_id="YP_005198220.1"
                     /db_xref="GI:383188092"
                     /db_xref="InterPro:IPR017746"
                     /db_xref="GeneID:11793753"
                     /translation="MPLVCVCSPKGGVGKTTVASNLAYSLARSGSKVLVIDFDVQNAL
                     RLHFGVPIADTRGFVAGSGNESDWSQFILKAGSNTFVLPYGEVTEDQRLEFEHQLASD
                     PHFLQRGLNTVLNYPGLIIIADFPPGPSPALKAVQAIADLHVVVMLADTASLSLLPLM
                     EKNKLIGTPLNNKLGEYYVVNQSDTRRTLSRDVTQFFEQRLNERLLGTIHRDECVPEA
                     NASQRSIIDFSPVSASAFDIELISKKVAAILGIKVGDGELHAAPKSGSY"
     misc_feature    complement(138418..139134)
                     /locus_tag="Rahaq2_0129"
                     /note="cellulose synthase operon protein YhjQ; Region:
                     cellulose_yhjQ; TIGR03371"
                     /db_xref="CDD:234188"
     misc_feature    complement(<139012..139125)
                     /locus_tag="Rahaq2_0129"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(139087..139107)
                     /locus_tag="Rahaq2_0129"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(139087..139089)
                     /locus_tag="Rahaq2_0129"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            complement(139125..139904)
                     /locus_tag="Rahaq2_0130"
                     /note="IMG reference gene:2506707155"
                     /db_xref="GeneID:11789868"
     CDS             complement(139125..139904)
                     /locus_tag="Rahaq2_0130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198221.1"
                     /db_xref="GI:383188093"
                     /db_xref="GeneID:11789868"
                     /translation="MNKYDDIKRFMDKAKLENLDYKELNEKSTGESITGSMNQWTLIK
                     QVSASEEPAGPLDNGRTTQPTPQSISADEFLLSDAQPVAGHQEPHFSAAGPVPPRQAT
                     PMSSQVPPPPAGFGLLDALRETLPPAPAQPVPLSVPPAQHPSVHAAPTLHAQSVVPDS
                     GSGLLDSLRKAMPEVPSKPASAPLHTPQPVQYAAAPVYYPPPGQNPTPVRSPVSASPA
                     SADANQRFKQMFKQRAPQPASAYLHRDTPLQPLLEMIASCR"
     misc_feature    complement(<139155..139718)
                     /locus_tag="Rahaq2_0130"
                     /note="Topoisomerase II-associated protein PAT1; Region:
                     PAT1; pfam09770"
                     /db_xref="CDD:255543"
     gene            140464..142446
                     /locus_tag="Rahaq2_0131"
                     /note="IMG reference gene:2506707156"
                     /db_xref="GeneID:11793754"
     CDS             140464..142446
                     /locus_tag="Rahaq2_0131"
                     /note="PFAM: EAL domain; HAMP domain; GGDEF domain"
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="YP_005198222.1"
                     /db_xref="GI:383188094"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="GeneID:11793754"
                     /translation="MRVRRSLTIKQMAAVSSIAAITICIFIVIQLFHFVQQRRDDYAQ
                     QLENIAHSVRVPLSQAVLDVDLEETQDILNTLQPVGILSRADVVMPNQIAALHTHFPP
                     GRPVPQWVTRGFNLPVTISVPLYSAAASPKAPKPLAYLVLQADSYRMYQFIISALSTM
                     LTTYLLLALILTISVSWVINRLIVKPLRAIASDLESLSESDVPGHQLTLPQRHEDDEI
                     GMLVRSYNRNQQQREKPQDKATEALLPSQTLLNNEEQFMQCLQHRLHSAEPEKSFHLL
                     LIGIESLRDDGRVGCPLVSSIMNVLPENCLMARLSYNEFAVLAADIPRPFMAMRLARQ
                     IMERINAPQESHAGNMSLHPTGSIGIVQYTGEFPVSAQQLLVNGRAARVSAYQQGKNQ
                     ILFFEPELTAKIQKRLLQENEILHAMEQNDFTLFIQPQVNMETGAVVGAEALLRRKMA
                     DGSYGLESDFIVLAEEIGVMSQLGYKILELGCQILADWQQRGIALPLSVNLSGAQVQQ
                     RNFLPELRSLLSRYKINPGQLVLEITETARIDDLDRALLLLSELRALGVSIELDDFGL
                     GYSGLEYLNRLRTLPIDVIKIDRSFVSVLPQDEVMVNIVASIARAMNIQLVAEGVETQ
                     AQRQWLLKENIQLGQGYLFSAPLSKTDFERKFCQPS"
     misc_feature    140497..142440
                     /locus_tag="Rahaq2_0131"
                     /note="putative diguanylate cyclase; Provisional; Region:
                     PRK13561"
                     /db_xref="CDD:184143"
     misc_feature    140944..141156
                     /locus_tag="Rahaq2_0131"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    141205..141651
                     /locus_tag="Rahaq2_0131"
                     /note="c-di-GMP synthetase (diguanylate cyclase, GGDEF
                     domain) [Signal    transduction mechanisms]; Region:
                     COG2199"
                     /db_xref="CDD:225109"
     misc_feature    order(141298..141303,141319..141324,141400..141402,
                     141598..141600)
                     /locus_tag="Rahaq2_0131"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143637"
     misc_feature    order(141298..141300,141400..141402)
                     /locus_tag="Rahaq2_0131"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143637"
     misc_feature    141697..142407
                     /locus_tag="Rahaq2_0131"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            142683..143966
                     /locus_tag="Rahaq2_0132"
                     /note="IMG reference gene:2506707157"
                     /db_xref="GeneID:11793755"
     CDS             142683..143966
                     /locus_tag="Rahaq2_0132"
                     /note="PFAM: Sodium:dicarboxylate symporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ dicarboxylate symporter"
                     /protein_id="YP_005198223.1"
                     /db_xref="GI:383188095"
                     /db_xref="InterPro:IPR001991"
                     /db_xref="InterPro:IPR018107"
                     /db_xref="GeneID:11793755"
                     /translation="MKKSLFKSLYFQVLLAITVGVLLGHFYPEIGAQMKPLGDGFVKL
                     IKMIIAPVIFCTVVTGIAGMESMKAVGRTGAIALLYFEIVSTLALIIGLVIVNIVQPG
                     AGMNVDPAALDAKAVAVYAEQAQSQGIIPFLLDVIPSSVIGAFASGNILQVLLFAVLF
                     GFALHRLGHKGQLIFNVIESFSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQ
                     LGQLILCFYLTCILFVVVVLGLIARFTGFSIFKFVNYIKEELLIVLGTSSSESALPRM
                     LDKMERLGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNTHMDIWHQITLIV
                     VLLLSSKGAAGVTGSGFIVLAATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNG
                     VATIVVAKWCDQLDEGQLKATLNGQKGLTEAEKSA"
     misc_feature    142683..143963
                     /locus_tag="Rahaq2_0132"
                     /note="C4-dicarboxylate transporter DctA; Reviewed;
                     Region: PRK01663"
                     /db_xref="CDD:234968"
     gene            144293..145810
                     /locus_tag="Rahaq2_0133"
                     /note="IMG reference gene:2506707158"
                     /db_xref="GeneID:11789869"
     CDS             144293..145810
                     /locus_tag="Rahaq2_0133"
                     /note="PFAM: Peptidase M16 inactive domain; Insulinase
                     (Peptidase family M16)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Zn-dependent peptidase"
                     /protein_id="YP_005198224.1"
                     /db_xref="GI:383188096"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="GeneID:11789869"
                     /translation="MQGTKIRLLIGGLLLAAAASHVQAEALQPDPAWQQGKLDNGFTW
                     QLLTTPQRPSDRIELRLVVRTGSLAESAQQTGYAHFLPRLALMHSEGFSTAQLQSLWQ
                     QSINPQRPLPPAVSSYDFTMYNLSLPNNRPELLKDALNWLANTAGKVSVTPALVSAAR
                     QESQDPVGSLPQNTQDAWWRARMAGSTLVGHNPHQLPTKPVNIDALIKFYHQWYTPDA
                     MTLFVVGNVDSRGLSEQINRTFSSLKGSRQTPQTLPTLSAVTTKSMTVMDENLTQDRV
                     SLMWDNAWQPIQDSQALAAYWRSDLAREALFWHLQQQLKSAFETKKDTPAPGPGLGFD
                     CNVQYQRAQCAIRIEAPQAKLTELFKRLSEELLSVRDKGISQAEFDALIAQKNDQLSK
                     LFATYARTDTDVLMSQRLRSQQNGVVDIAPEQYQQLRQQFLSTLTLPVLNQELKQQLS
                     RDPALLVAQPKGEPEMNAGELRAVYDKIMAPAETAPAVDAPAGDVPAASAATSAQ"
     misc_feature    144356..145759
                     /locus_tag="Rahaq2_0133"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    144449..144862
                     /locus_tag="Rahaq2_0133"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    144893..145447
                     /locus_tag="Rahaq2_0133"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            complement(145982..146920)
                     /locus_tag="Rahaq2_0134"
                     /note="IMG reference gene:2506707159"
                     /db_xref="GeneID:11789870"
     CDS             complement(145982..146920)
                     /locus_tag="Rahaq2_0134"
                     /note="PFAM: pfkB family carbohydrate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="YP_005198225.1"
                     /db_xref="GI:383188097"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="GeneID:11789870"
                     /translation="MTSKNIAVIGECMIELSQKGDALHRGFGGDTLNTSVYISRQVSP
                     DALNVHYVTALGNDSFSNEMLQAWQQEGVHTDLTQRLENKLPGLYVIETDSTGERTFY
                     YWRNDAAARYWLDSPQSEEICQKLAEFDYLYLSGISLAILSDESRDRLMTLLKACRSR
                     GGKVIFDNNYRPRLWASKEQTQAAYNAMLSCTDIAFLTLDDEDMLWGQKPYDDVIART
                     HALGVSEVVVKRGADSCIVSSAEGEMHDVPAVKLPKEKVIDTTAAGDSFSAGYLAVRL
                     TGGSAVEAAVRGHETASTVIQHRGAIIPMEFMPDRA"
     misc_feature    complement(146015..146905)
                     /locus_tag="Rahaq2_0134"
                     /note="2-keto-3-deoxygluconate kinase (KdgK)
                     phosphorylates 2-keto-3-deoxygluconate (KDG) to form
                     2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the
                     common intermediate product, that allows organisms to
                     channel D-glucuronate and/or D-galacturinate into the...;
                     Region: KdgK; cd01166"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(146018..146020,146126..146128,
                     146135..146137,146408..146410,146510..146512,
                     146606..146608,146612..146614,146654..146656,
                     146822..146824,146831..146836))
                     /locus_tag="Rahaq2_0134"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(146042..146044,146054..146056,
                     146120..146122,146129..146137,146162..146164,
                     146219..146221,146234..146236))
                     /locus_tag="Rahaq2_0134"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238571"
     gene            complement(147115..147318)
                     /locus_tag="Rahaq2_0135"
                     /note="IMG reference gene:2506707160"
                     /db_xref="GeneID:11793756"
     CDS             complement(147115..147318)
                     /locus_tag="Rahaq2_0135"
                     /note="PFAM: Tautomerase enzyme;
                     TIGRFAM: 4-oxalocrotonate tautomerase family enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="4-oxalocrotonate tautomerase"
                     /protein_id="YP_005198226.1"
                     /db_xref="GI:383188098"
                     /db_xref="InterPro:IPR004370"
                     /db_xref="InterPro:IPR014347"
                     /db_xref="GeneID:11793756"
                     /translation="MPYVNIKITREGATAKQKKALIAGVTQLLVDTLGKNPATTVVVI
                     DEVDTDNWGVGGRPVTELRQENK"
     misc_feature    complement(147139..147315)
                     /locus_tag="Rahaq2_0135"
                     /note="4-Oxalocrotonate Tautomerase:  Catalyzes the
                     isomerization of unsaturated ketones. The structure is a
                     homohexamer that is arranged as a trimer of dimers. The
                     hexamer contains six active sites, each formed by residues
                     from three monomers, two from one...; Region:
                     4Oxalocrotonate_Tautomerase; cd00491"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(147202..147204,147310..147315))
                     /locus_tag="Rahaq2_0135"
                     /note="active site 1 [active]"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(147220..147225,147235..147237,
                     147244..147249,147256..147258,147295..147315))
                     /locus_tag="Rahaq2_0135"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(147145..147171,147178..147183,
                     147187..147201,147205..147210,147241..147243,
                     147250..147255,147262..147267,147298..147300,
                     147304..147306))
                     /locus_tag="Rahaq2_0135"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(147163..147165,147298..147300))
                     /locus_tag="Rahaq2_0135"
                     /note="active site 2 [active]"
                     /db_xref="CDD:238274"
     gene            147656..148417
                     /locus_tag="Rahaq2_0136"
                     /note="IMG reference gene:2506707161"
                     /db_xref="GeneID:11793757"
     CDS             147656..148417
                     /locus_tag="Rahaq2_0136"
                     /note="PFAM: EAL domain"
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="YP_005198227.1"
                     /db_xref="GI:383188099"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="GeneID:11793757"
                     /translation="MLGLITPSFTAIERVKAQSYWRQCQRVYRFQPIYRTTGKLLGIE
                     LLTGVFHPANPHKFISPEEYFVAIAVGKRLQIVQEQLDLLQRWQHLFTEHELLASINV
                     DGQVLEMLQSDLALRAQISAMPYVRFELVESAENALSIPLSQIEQSDRLWLDDFGQGI
                     ANFSSFTTWHYEYIKIARDLFILLGQSEEGSRLFYTLVTLMNRYSKGVIIEGVETASE
                     WSMVCNSDALAAQGYYLARPTVFDNLDNLPIHFKG"
     misc_feature    147743..148369
                     /locus_tag="Rahaq2_0136"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            148631..150685
                     /locus_tag="Rahaq2_0137"
                     /note="IMG reference gene:2506707162"
                     /db_xref="GeneID:11789871"
     CDS             148631..150685
                     /locus_tag="Rahaq2_0137"
                     /note="PFAM: AsmA family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198228.1"
                     /db_xref="GI:383188100"
                     /db_xref="InterPro:IPR007844"
                     /db_xref="GeneID:11789871"
                     /translation="MTRTGKVISWVVGAIIILLIAIVIFIATFNWNRLKPTINQKVST
                     ELNRAFAIRGDLGVDWSRQKDEAGWRAWVPWPHIHAEDIVLGNPSDVQTGEKDAQMVK
                     LARVDASIAPLALLHKEVLIPRIWLKQPDTSLLRLDNGKNNWTFNLANSDTQDPAQPP
                     SAWSFTINDIVFDRGQIDYKDAKLKADFRAVIDPLGKPLPFTEVVGDKKDAPKTKTPP
                     YVFGWKVEGKYNGESLSGSGKIGGMLAMKDPDALFPLQADVRSGNTRVAVEGTLQDPM
                     NLGGLDLRLKFSGQTLSDLYGLTGVLLPQTPPYSTDGHLSATLHDKDGAVYRYQNFNG
                     EIGDSDIHGSLNYQASKPRPELTGEVVSKQLRFADLAPLIGADSNTDKAKRGETTRQP
                     ADKVLPVEKFDTKSWRVMDADVKFSAKRIEHGESLPLSDLSTHLKLNDGVILLDPLRF
                     GVAGGNLNSTIRLEGDKSPMQARADIHARKLKLKQLLPRVQSMERSLGDLNGDATLTG
                     TGNSVAALLGTSDGDMKILINDGVISRGLMELAGLNVGNYVVSKLFGDDEVAINCAAA
                     NVNVRNGVVTPRLFVFDTENAVINITGNTNMATERLDLSVNPESKGVRVLTLRSPLYV
                     RGTYKNPDAGVKPGPLIARGAAAVALGAVVAPAAALLALISPSDNEENHCGPILQQMK
                     QK"
     misc_feature    148631..150553
                     /locus_tag="Rahaq2_0137"
                     /note="Uncharacterized protein involved in outer membrane
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: AsmA; COG2982"
                     /db_xref="CDD:225529"
     misc_feature    149915..150451
                     /locus_tag="Rahaq2_0137"
                     /note="AsmA-like C-terminal region; Region: AsmA_2;
                     pfam13502"
                     /db_xref="CDD:257822"
     gene            complement(150755..151522)
                     /locus_tag="Rahaq2_0138"
                     /note="IMG reference gene:2506707163"
                     /db_xref="GeneID:11789872"
     CDS             complement(150755..151522)
                     /locus_tag="Rahaq2_0138"
                     /note="PFAM: CDP-diacylglycerol pyrophosphatase;
                     TIGRFAM: CDP-diacylglycerol pyrophosphatase, bacterial
                     type"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol pyrophosphatase"
                     /protein_id="YP_005198229.1"
                     /db_xref="GI:383188101"
                     /db_xref="InterPro:IPR003763"
                     /db_xref="GeneID:11789872"
                     /translation="MRLRRFILPLLLLLIVIAAAFWYFWPHSSNPNALWNIVSTKCVP
                     NQRSNGKPDPCAQVDEQQGFVVLKDLNGPLQYLLMPTARITGMESPALLEPSTPNFFS
                     QAWNARHFMADKYGKPIDDSNVSLAINSQYGRSQNQLHIHISCLLPQVKTTLSKDGGQ
                     MGYNWQELPDKLLGHTYLARKVTQAELNEKGAFRLLAEGVPDAQKKMGHFGMAMVSLP
                     GGDFLLLASERDLLKLNNASTEEIQDHKCAVLDPLPQ"
     misc_feature    complement(150767..151459)
                     /locus_tag="Rahaq2_0138"
                     /note="CDP-diacylglycerol pyrophosphatase; Provisional;
                     Region: PRK05471"
                     /db_xref="CDD:235485"
     gene            complement(151582..152904)
                     /locus_tag="Rahaq2_0139"
                     /note="IMG reference gene:2506707164"
                     /db_xref="GeneID:11789873"
     CDS             complement(151582..152904)
                     /locus_tag="Rahaq2_0139"
                     /note="PFAM: Sugar (and other) transporter; Major
                     Facilitator Superfamily;
                     TIGRFAM: metabolite-proton symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="metabolite-proton symporter"
                     /protein_id="YP_005198230.1"
                     /db_xref="GI:383188102"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11789873"
                     /translation="MQATITPELEADAQLVSQNSRSKVIVASLIGTAIEFFDFYIYAT
                     AAVIVFPHIFFPQGDPTAATLQSLATFAIAFVARPIGSALFGHFGDRVGRKVTLVASL
                     LTMGVSTVVIGLLPTYATIGVFAPMLLALARFGQGLGLGGEWGGAALLATENAPAKKR
                     ALYGSFPQLGAPIGFFFANGMFLLLSWLLTDEQFISWGWRVPFLLSAVLVIVGLYVRV
                     SLHETPVFAKIAKAGKQVKVPIGTLFTKYKKATILGTFIMVATYTLFYIMTVYSLGYG
                     TAAKPVGLGIPRNEFLLMLMIGVVGFGVMVPVAGQLADKFGRRKTMICITLLMIVFAL
                     CFPTILGAGSQALVMVFLLCGFMVMGLTFGPMGALLPELFPTEVRYTGASFSYNVSSI
                     LGASVAPYIATWLATHYGLFYVGVYLASMATLTLIALLLSKETAHQSL"
     misc_feature    complement(151642..152832)
                     /locus_tag="Rahaq2_0139"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(151642..152814)
                     /locus_tag="Rahaq2_0139"
                     /note="metabolite-proton symporter; Region: 2A0106;
                     TIGR00883"
                     /db_xref="CDD:233168"
     misc_feature    complement(order(151720..151722,151732..151737,
                     151744..151749,151756..151761,151792..151794,
                     151801..151806,151816..151818,151825..151830,
                     151837..151839,151987..151989,151999..152001,
                     152008..152010,152020..152022,152032..152034,
                     152086..152088,152095..152100,152107..152112,
                     152119..152121,152380..152382,152398..152403,
                     152410..152415,152449..152451,152458..152463,
                     152470..152475,152482..152487,152647..152652,
                     152656..152661,152671..152673,152680..152685,
                     152692..152694,152764..152769,152773..152781,
                     152788..152790))
                     /locus_tag="Rahaq2_0139"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            152973..153128
                     /locus_tag="Rahaq2_0140"
                     /note="IMG reference gene:2506707165"
                     /db_xref="GeneID:11789874"
     CDS             152973..153128
                     /locus_tag="Rahaq2_0140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198231.1"
                     /db_xref="GI:383188103"
                     /db_xref="GeneID:11789874"
                     /translation="MQSAAVFQRSGSREKKRLTPDRGIILSGQEFASHKFGEWMKGRV
                     TDCKTAK"
     gene            complement(153192..154316)
                     /locus_tag="Rahaq2_0141"
                     /note="IMG reference gene:2506707166"
                     /db_xref="GeneID:11789875"
     CDS             complement(153192..154316)
                     /locus_tag="Rahaq2_0141"
                     /note="PFAM: Ribonuclease BN-like family;
                     TIGRFAM: YihY family protein (not ribonuclease BN);
                     ribonuclease, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease, putative"
                     /protein_id="YP_005198232.1"
                     /db_xref="GI:383188104"
                     /db_xref="InterPro:IPR004664"
                     /db_xref="GeneID:11789875"
                     /translation="MPIISKQAPATQEKPTPLINIKTGNQTVDKNIGRFSRLVEYVQS
                     WGWVAHLLRATERFNDRLGSQFGAAITYFSFLSLIPILMVSFAAVGFVLASNPDLLAE
                     LINKIVNSISDPNLANTLKSTVNTAIQQRTAVGLSGLLIALYSGVSWMGNLREAIRAQ
                     SRDVWERNPQDQEKIYRRYLRDFISLTGLVLALIITLSLTSIAGAAQKTIVDALGLGG
                     IDWLRPVMTSITLVISIAANYLLFLWIFWMLPRHKPRKKALLRGTLLAAIGFEVIKFV
                     MTMTLPKLATSPSGAAFGSVIGLMAFFYFFARLTLFVAAWIATAKYKDDPRMPDRRQK
                     TAEAQKMATGNDSEYTPDNLIVPDEMHIAEFNSDNERKKQ"
     misc_feature    complement(153348..154172)
                     /locus_tag="Rahaq2_0141"
                     /note="inner membrane protein YhjD; Region: TIGR00766"
                     /db_xref="CDD:188082"
     gene            complement(154401..155342)
                     /locus_tag="Rahaq2_0142"
                     /note="IMG reference gene:2506707167"
                     /db_xref="GeneID:11789876"
     CDS             complement(154401..155342)
                     /locus_tag="Rahaq2_0142"
                     /note="PFAM: Bacterial regulatory helix-turn-helix
                     protein, lysR family; LysR substrate binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198233.1"
                     /db_xref="GI:383188105"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789876"
                     /translation="MIFTVSFSTTIGQNVDKIQSMQVFVRVAELNNFTRAAESLGLPK
                     GSVSRLVQQLETRMSARLLHRSTRRVQLTQDGQVFYQRCKELLASMDELESMFQSNPA
                     SVSGRLRVDMTTGMATHLVLPRLAEFLNRYPALEIELSCTDHRVDVVREGFDCVIRSG
                     TLKDSGLIARPLGQLSMINCASPGYLRRYGTPDHPDQLAQHAMVHYEQILGSHTSAFE
                     YLDGKQLKTVKSGGAVTVNSTETYVSACINGLGIIQVPLIGVRDALAGGQLVSILPQF
                     RAPPMPVTLVYPHRLNLSRRVKVFMDWLTELTQTFIA"
     misc_feature    complement(154425..155291)
                     /locus_tag="Rahaq2_0142"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(155112..155291)
                     /locus_tag="Rahaq2_0142"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(154422..155027)
                     /locus_tag="Rahaq2_0142"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_3; cd08472"
                     /db_xref="CDD:176161"
     misc_feature    complement(order(154494..154496,154575..154577,
                     154626..154628,154818..154820,154824..154826,
                     154866..154868,154983..154985,154995..154997))
                     /locus_tag="Rahaq2_0142"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176161"
     misc_feature    complement(order(154599..154601,154608..154613,
                     154632..154646,154737..154739,154920..154940,
                     154944..154946,154956..154958,154965..154970,
                     154974..154979,154989..154994))
                     /locus_tag="Rahaq2_0142"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176161"
     gene            155427..156185
                     /locus_tag="Rahaq2_0143"
                     /note="IMG reference gene:2506707168"
                     /db_xref="GeneID:11789877"
     CDS             155427..156185
                     /locus_tag="Rahaq2_0143"
                     /note="PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005198234.1"
                     /db_xref="GI:383188106"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11789877"
                     /translation="MNRKIAIVTGGSRGLGRNAIEKLAKKGVDVILTYHNQAGAAQEV
                     VASVEAQGGKAVALQLNTGESGSFAAFVVQVKAQLQRVWQRDTFDFLVNNAGVGLHQS
                     FAGTTEEQFDLMMNVHLKGPFFLTQKLLPLMADGGRILNISSGLARFALPGSSAYAMM
                     KGAIEVLTRYQAKELGARGITANVLAPGAIETDFSGGMVRDNPDVNKLVASNTALGRA
                     GLPDDIGDMVALMLSDEAGWMTAQRVEASGGMFI"
     misc_feature    155427..156176
                     /locus_tag="Rahaq2_0143"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    155436..156173
                     /locus_tag="Rahaq2_0143"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(155454..155456,155460..155465,155469..155471,
                     155526..155534,155706..155714,155850..155858,
                     155895..155897,155907..155909,155985..155996)
                     /locus_tag="Rahaq2_0143"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(155778..155780,155856..155858,155895..155897,
                     155907..155909)
                     /locus_tag="Rahaq2_0143"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(156189..156935)
                     /locus_tag="Rahaq2_0144"
                     /note="IMG reference gene:2506707169"
                     /db_xref="GeneID:11789878"
     CDS             complement(156189..156935)
                     /locus_tag="Rahaq2_0144"
                     /note="PFAM: PilZ domain; YcgR protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycosyltransferase"
                     /protein_id="YP_005198235.1"
                     /db_xref="GI:383188107"
                     /db_xref="InterPro:IPR009875"
                     /db_xref="InterPro:IPR009926"
                     /db_xref="GeneID:11789878"
                     /translation="MSEVSKESFAKRNTLAILSVLRDLKKNQTLIMISHSRGQFISKI
                     LDVDADNHQFLFDLGSSDYENTLAAEADTLTFVAEPAGAKVEFSCSKVRQISYEGLPT
                     FTCDLPPVLYFIQRREYFRVNVPRMPDYRCSGILPDTSEFAYRVRDISLGGLGLEIEG
                     ATPPEMTKGSMLKDSLIQLAELGTFTLDLQYLGAMVRKSVSNKGETVTSQRLSFKFPH
                     LSPAQERDLQRAIFELEKQQHIKAKRFQHD"
     misc_feature    complement(156594..156911)
                     /locus_tag="Rahaq2_0144"
                     /note="Flagellar regulator YcgR; Region: YcgR; pfam07317"
                     /db_xref="CDD:115941"
     misc_feature    complement(156201..156899)
                     /locus_tag="Rahaq2_0144"
                     /note="c-di-GMP-binding protein [Signal transduction
                     mechanisms]; Region: COG5581"
                     /db_xref="CDD:227868"
     misc_feature    complement(156237..156593)
                     /locus_tag="Rahaq2_0144"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     gene            157193..157771
                     /locus_tag="Rahaq2_0145"
                     /note="IMG reference gene:2506707170"
                     /db_xref="GeneID:11789879"
     CDS             157193..157771
                     /locus_tag="Rahaq2_0145"
                     /note="PFAM: Cytochrome b(N-terminal)/b6/petB"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="YP_005198236.1"
                     /db_xref="GI:383188108"
                     /db_xref="InterPro:IPR005797"
                     /db_xref="InterPro:IPR016174"
                     /db_xref="GeneID:11789879"
                     /translation="MQTSSVVLRNRYDGLTILLHWLTALAVIFLFASAHIWEVLERGT
                     PLRKGLQSVHISVGILLAAIITGRLLWRLFTVSTGRSKQQPVAMPTLMKAAAHLTHLA
                     LYLLLVAQIILGFLFRWSQAEPFYFFGLFPIPDVFNFDSVMTQTFGSLHNNVAWALII
                     IAGVHALAALFHHYVLRDGILRRMLPGSKSRP"
     misc_feature    157217..157759
                     /locus_tag="Rahaq2_0145"
                     /note="Cytochrome B561 [Energy production and conversion];
                     Region: CybB; COG3038"
                     /db_xref="CDD:225580"
     gene            157803..158345
                     /locus_tag="Rahaq2_0146"
                     /note="IMG reference gene:2506707171"
                     /db_xref="GeneID:11789880"
     CDS             157803..158345
                     /locus_tag="Rahaq2_0146"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198237.1"
                     /db_xref="GI:383188109"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="GeneID:11789880"
                     /translation="MKTKKVLQALPVVCLAANLLFFSAAASAMGDDSDAKKTPDCPKG
                     QIYDSKTKSCMVDKGSMISDQDKTQYAYHLAKTGRYQEALTVLDTLKDQNTKEAWNYR
                     GYATRKLGRTDEGIGYYQKSIAIDANYAKVREYLGEAYMIKGRPDLAKAQLATIKGLC
                     GTGCEEYRDLSAAIDGHPES"
     misc_feature    158007..158267
                     /locus_tag="Rahaq2_0146"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(158007..158009,158016..158021,158100..158105,
                     158109..158114,158121..158126,158202..158207,
                     158214..158219,158226..158231)
                     /locus_tag="Rahaq2_0146"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    158007..158180
                     /locus_tag="Rahaq2_0146"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    order(158013..158015,158049..158051,158061..158063,
                     158070..158072,158109..158111,158145..158147,
                     158157..158159,158166..158168,158211..158213,
                     158247..158249,158259..158261)
                     /locus_tag="Rahaq2_0146"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    158130..158324
                     /locus_tag="Rahaq2_0146"
                     /note="Tetratricopeptide repeat; Region: TPR_19;
                     pfam14559"
                     /db_xref="CDD:258697"
     gene            158426..158881
                     /locus_tag="Rahaq2_0147"
                     /note="IMG reference gene:2506707172"
                     /db_xref="GeneID:11789881"
     CDS             158426..158881
                     /locus_tag="Rahaq2_0147"
                     /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
                     TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="YP_005198238.1"
                     /db_xref="GI:383188110"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR013324"
                     /db_xref="InterPro:IPR013325"
                     /db_xref="GeneID:11789881"
                     /translation="MVLSRKHDVADDLVQSTCVRALERCAQIKDSTGVDRWLFSILHS
                     IWVNELRAQRVRQGQGFADVGETDTPADTPSFEERHWHTQVMQRVNRLPEAQRNAVFL
                     VYVEGFTYQEAAMTLSVPVGTIMSRLATARLTLAKDAGTATQPQQGEKK"
     misc_feature    <158453..158587
                     /locus_tag="Rahaq2_0147"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    158669..158830
                     /locus_tag="Rahaq2_0147"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(158702..158704,158732..158734,158750..158755,
                     158783..158785,158789..158794,158798..158806,
                     158810..158815,158819..158821)
                     /locus_tag="Rahaq2_0147"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            158878..159654
                     /locus_tag="Rahaq2_0148"
                     /note="IMG reference gene:2506707173"
                     /db_xref="GeneID:11789882"
     CDS             158878..159654
                     /locus_tag="Rahaq2_0148"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198239.1"
                     /db_xref="GI:383188111"
                     /db_xref="GeneID:11789882"
                     /translation="MTREIPSAPYADDVLVAYLDNQLSESQRAKFDAQLAQDDVLAQR
                     LVQMSRSNLPFHDAFGAMLQEAPVGKLQAALDAIPDARAAGSSGSSRRALLAASLSFL
                     AVGLLAGRYSTLFTSDDNWRARVADYMSLYTAQTLADVYDSASQQKIQLARVQNTLGI
                     ALNPAALAVQGADLKDARMLHYDDYDIAQITYLDAQYGPMALCITRSEHRDNTALQRE
                     IRRGMNVVYWRNAGYNFMLIGHSPAPALTAHAAALQANLA"
     misc_feature    158908..159594
                     /locus_tag="Rahaq2_0148"
                     /note="Predicted transmembrane transcriptional regulator
                     (anti-sigma factor) [Transcription]; Region: COG5662"
                     /db_xref="CDD:227949"
     gene            complement(159697..159822)
                     /locus_tag="Rahaq2_0149"
                     /note="IMG reference gene:2506707174"
                     /db_xref="GeneID:11789883"
     CDS             complement(159697..159822)
                     /locus_tag="Rahaq2_0149"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198240.1"
                     /db_xref="GI:383188112"
                     /db_xref="GeneID:11789883"
                     /translation="MGSNENRGEERQISHTNVAEYSYYRDFVNNLTLSLRALKIV"
     gene            159958..161607
                     /locus_tag="Rahaq2_0150"
                     /note="IMG reference gene:2506707175"
                     /db_xref="GeneID:11789884"
     CDS             159958..161607
                     /locus_tag="Rahaq2_0150"
                     /note="PFAM: Malate:quinone oxidoreductase (Mqo);
                     TIGRFAM: malate:quinone-oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="malate:quinone-oxidoreductase"
                     /protein_id="YP_005198241.1"
                     /db_xref="GI:383188113"
                     /db_xref="InterPro:IPR006231"
                     /db_xref="GeneID:11789884"
                     /translation="MRKILAMILCLNVVAFSQSALAEDEKPVDVLLIGGGIMSATLGT
                     YLQELEPDWSINMVERLDGVALESSNGWNNAGTGHSALAEMNYTPEKADGSIDISKAV
                     EINESFQISRQFWTYQVENGVLHNPRSFINSTPHMSFVWGDDNINFLRKRFAALQQST
                     LFRGMEYSEDPAQIKQWIPLVMEGRDPAQKVAATRIPIGTDVNFGEITRQLVASLQKK
                     PNFSLSLGHEVRDIKRNPDNTWNVTVADLKNGDKESVIKAKFVFIGAGGASLTLLQKS
                     GIPEADNYGGFPVGGEFLVTENPDVVKRHLAKVYGKASVGSPPMSVPHLDTRILDGKQ
                     VLLFGPFATFSSKFLKNGSLWDLFGSVNFSNIMPMTHVGIDNFDLVKYLVSQVMLSDD
                     DRFDALREYFPDAKKEDWRLWEAGQRVQIIKKDEKEGGVLRLGTEVVSSKDGSITALL
                     GASPGASTAAPIMLHLMEKVFKDKVATPEWQAKLKQIIPSYGTELNGNVAATEKELGD
                     TSRVLMLDNPQPKAAEPAPSADNSSAPKPGQEQKQVADVAL"
     misc_feature    160024..161508
                     /locus_tag="Rahaq2_0150"
                     /note="malate:quinone oxidoreductase; Validated; Region:
                     PRK05257"
                     /db_xref="CDD:179979"
     misc_feature    160030..161451
                     /locus_tag="Rahaq2_0150"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: COG0579"
                     /db_xref="CDD:223652"
     gene            161793..164120
                     /locus_tag="Rahaq2_0151"
                     /note="IMG reference gene:2506707176"
                     /db_xref="GeneID:11789885"
     CDS             161793..164120
                     /locus_tag="Rahaq2_0151"
                     /note="PFAM: Phage-related baseplate assembly protein;
                     Uncharacterized protein conserved in bacteria (DUF2345);
                     TIGRFAM: Rhs element Vgr protein; type VI secretion system
                     Vgr family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhs element Vgr protein"
                     /protein_id="YP_005198242.1"
                     /db_xref="GI:383188114"
                     /db_xref="InterPro:IPR006531"
                     /db_xref="InterPro:IPR018769"
                     /db_xref="GeneID:11789885"
                     /translation="MDTLSRYSLAIWNSPYALDVLNFRGEEQLSETFSYTVDVTCPAP
                     DIGAAQMLRQFASFTMGTPFQPERAVYGVIRDFQRLSTSADETLYRLELVPRLRLLEN
                     STNSFIFQNQSVPEVVEFILRKHGLEGQDFEFRLSHTYPDRELITQWGETDLQFIKRI
                     LAEVGIWFRFEADTRLTCEKVLFGDGPEQYRFGVTLPYCEPSGMSDAHAESVWGLKIH
                     WNAVTGKIFKRDYNYREATTPLDTSAQVRSAAPVTGESYLYARPYREAGEDMDAAAET
                     GAFYARIRHERQLNHQCRIFARTTGSGLAPGQVLEPQAYPFSDLPDGILITRIVAKGS
                     RTDHFRLNIWGMAYRETIGFRPEPPARPVLSGTIPARVESPAKGDTYAWLDNQGRYRV
                     RIDGDRASADAGYAYLWVRLAKPYGGDGYGWHMPLTDGTDVAIAFDGGDPDRPYIAAA
                     LHDSEHPDHVTERNHTRNVLRTPSNNKLRMEDRRGEEHIKLATEYGKTQLNSGHIVDA
                     QNAPRGEGFELRTDEHGALRGGKGVFLSADAQPQAQGQVPDNLAAMTEIEYLQGQVKA
                     LSQAAAEAKALEADIAAQIAMFSERLKPINQVVLASAPEGMALTSGEHMQLAATQNMI
                     LNAGKNADIGVIKNLTVNTGQEMGIFALKGEMSLKAGEGKVDVQAQNNQLSLAAGKKV
                     SITAVDGDILFSAKKRITLIGGGSYLILQDGKIEYGTAGEYFRKTPHTVLTVANPVRL
                     NMPYLPGQYPELKNKICIECLLNAIKANDAIVQGA"
     misc_feature    161844..163280
                     /locus_tag="Rahaq2_0151"
                     /note="Rhs element Vgr protein; Region: vgr_GE; TIGR01646"
                     /db_xref="CDD:233505"
     misc_feature    161868..162797
                     /locus_tag="Rahaq2_0151"
                     /note="Phage late control gene D protein (GPD); Region:
                     Phage_GPD; pfam05954"
                     /db_xref="CDD:253474"
     misc_feature    162936..163175
                     /locus_tag="Rahaq2_0151"
                     /note="Phage-related baseplate assembly protein; Region:
                     Phage_base_V; pfam04717"
                     /db_xref="CDD:252757"
     misc_feature    163188..163499
                     /locus_tag="Rahaq2_0151"
                     /note="Putative type VI secretion system Rhs element Vgr;
                     Region: T6SS_Vgr; pfam13296"
                     /db_xref="CDD:205476"
     misc_feature    163584..163961
                     /locus_tag="Rahaq2_0151"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2345); Region: DUF2345; pfam10106"
                     /db_xref="CDD:255759"
     gene            164121..164960
                     /locus_tag="Rahaq2_0152"
                     /note="IMG reference gene:2506707177"
                     /db_xref="GeneID:11789886"
     CDS             164121..164960
                     /locus_tag="Rahaq2_0152"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198243.1"
                     /db_xref="GI:383188115"
                     /db_xref="GeneID:11789886"
                     /translation="MIESTALAESAVETENGYFYLLLEGGAQETQAFEAFYTVNASEM
                     YSLYLHPQLAEFKNYGPWLLAVKNNNELTQKIKDTPGVVGVIATKSCLSGALAAQLSY
                     ACTVIGPDDTTALIRFYTRQVISLLAQCGEQEWHTFLFRNITRWWAPLEGSWQPVPLL
                     ASTAENPRDHAVRLNEEIWQQIMDEPEVGAILTQWQKMPASQHFPPCSQGDMVIKALE
                     KARLAGMPAGVDSKLYALYYLNGGKKILESEGMQVSLGKVSQGEVSLKEILSNALASK
                     WQS"
     misc_feature    164178..164537
                     /locus_tag="Rahaq2_0152"
                     /note="Domain of unknown function (DUF4123); Region:
                     DUF4123; pfam13503"
                     /db_xref="CDD:257823"
     gene            164989..165498
                     /locus_tag="Rahaq2_0153"
                     /note="IMG reference gene:2506707178"
                     /db_xref="GeneID:11789887"
     CDS             164989..165498
                     /locus_tag="Rahaq2_0153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198244.1"
                     /db_xref="GI:383188116"
                     /db_xref="GeneID:11789887"
                     /translation="MKEEHQDGEISLTPCVCCTVFRQGKYSRLGGGLIIIALNLMLEI
                     IFKAISLITLPLYGINSLIFEEKIRVVKFLIFCVMDFLIIGFAIYALVFLIRKCERFK
                     RVFKIFIVILISSSFFEVILINMEEIFLYGYIPWTFFFDSASYPIVLACLAYPYLKCS
                     KRVRMTLVH"
     misc_feature    165064..165492
                     /locus_tag="Rahaq2_0153"
                     /note="Protein of unknown function (DUF2569); Region:
                     DUF2569; pfam10754"
                     /db_xref="CDD:256153"
     gene            165511..166005
                     /locus_tag="Rahaq2_0154"
                     /note="IMG reference gene:2506707179"
                     /db_xref="GeneID:11789888"
     CDS             165511..166005
                     /locus_tag="Rahaq2_0154"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198245.1"
                     /db_xref="GI:383188117"
                     /db_xref="GeneID:11789888"
                     /translation="MNSEQEIKICTCCSEQDRQKLTGIGGWLIVVVLHLSSMLVFNAS
                     LFIEFIYDLNIPITDGSDVKLIPLVLNSFVDVIVFLMAAFSLNALFRKKYQFRKYYRL
                     FILSCLLHPLLFASLCFWYQNITMYSIPWKIIGLMFLYPLGMIFICLPYLDESKRVRL
                     TLVN"
     gene            166049..166579
                     /locus_tag="Rahaq2_0155"
                     /note="IMG reference gene:2506707180"
                     /db_xref="GeneID:11789889"
     CDS             166049..166579
                     /locus_tag="Rahaq2_0155"
                     /note="PFAM: Protein of unknown function (DUF3304)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198246.1"
                     /db_xref="GI:383188118"
                     /db_xref="InterPro:IPR021733"
                     /db_xref="GeneID:11789889"
                     /translation="MDFFRRLEKIDGAVNRGYARWGKWLGAGLLLFILGWGGWLVWAS
                     IWGPPTGPVTLIIHSEIDRPILGFSVNGVAGANSSAHDKENPYASGSGKSTCCGSISG
                     QEADVMWTLDITHEQYLKGMRLEKRRVVMPIPERKWGENYLHVYFLPGDKVRLWWGGG
                     FISPKAEEIPDTVNRK"
     misc_feature    166163..166513
                     /locus_tag="Rahaq2_0155"
                     /note="Protein of unknown function (DUF3304); Region:
                     DUF3304; pfam11745"
                     /db_xref="CDD:256591"
     gene            166600..167118
                     /locus_tag="Rahaq2_0156"
                     /note="IMG reference gene:2506707181"
                     /db_xref="GeneID:11789890"
     CDS             166600..167118
                     /locus_tag="Rahaq2_0156"
                     /note="PFAM: Protein of unknown function (DUF3304)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198247.1"
                     /db_xref="GI:383188119"
                     /db_xref="InterPro:IPR021733"
                     /db_xref="GeneID:11789890"
                     /translation="MDFFNRLEKIGGTVNRGYVRWGKWLGAGLLLFILGWGGWLIWAS
                     LWGPPTGPVTLIIHSEIDRPIRGFSVNGVAGPNAFAHGGGKTTCCGSISGKTAEVIWT
                     VDYTLAQYQAGTRTEIHKVIMPLPERKWGEDDLHVHFLPGDKVLLGWSDNVWSPYEKH
                     PDKVDKLSAAGI"
     misc_feature    166723..167040
                     /locus_tag="Rahaq2_0156"
                     /note="Protein of unknown function (DUF3304); Region:
                     DUF3304; pfam11745"
                     /db_xref="CDD:256591"
     gene            167156..167674
                     /locus_tag="Rahaq2_0157"
                     /note="IMG reference gene:2506707182"
                     /db_xref="GeneID:11789891"
     CDS             167156..167674
                     /locus_tag="Rahaq2_0157"
                     /note="PFAM: Protein of unknown function (DUF3304)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198248.1"
                     /db_xref="GI:383188120"
                     /db_xref="InterPro:IPR021733"
                     /db_xref="GeneID:11789891"
                     /translation="MDFFKRLEKIDGAVNRGYARWGKWLGAGLLLFILGWGGWLVWAS
                     LWGPPTGPVTLIIHSEIDRPILGFSVNGVAGSNAFAYGGGGATCCGSISGKTAEVVWT
                     LSTTRAQYNAGLRTENRRIVMPLPERKWGEDDLHVHFLPGDKVLLGWSDNAWSPYEKH
                     PGKDNKLPAAGI"
     misc_feature    167270..167596
                     /locus_tag="Rahaq2_0157"
                     /note="Protein of unknown function (DUF3304); Region:
                     DUF3304; pfam11745"
                     /db_xref="CDD:256591"
     gene            167710..168231
                     /locus_tag="Rahaq2_0158"
                     /note="IMG reference gene:2506707183"
                     /db_xref="GeneID:11789892"
     CDS             167710..168231
                     /locus_tag="Rahaq2_0158"
                     /note="PFAM: Protein of unknown function (DUF3304)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198249.1"
                     /db_xref="GI:383188121"
                     /db_xref="InterPro:IPR021733"
                     /db_xref="GeneID:11789892"
                     /translation="MNFFNRLEKIDGAVNRGYARWGKWLVAGLLVFILGWGGWLVWAS
                     IWGPPTGPVTLIIHSEIDRPIRGFSVNGVAGSNAFAYGGGGATCCGSISGKTAEVVWT
                     VDYTLAQYQAGTRTEIHKVIMPLPERKWGEDDLHVHFLPGDKVLLGWSDNAWSPYEKH
                     PEISPKSVVRGDH"
     misc_feature    167824..168150
                     /locus_tag="Rahaq2_0158"
                     /note="Protein of unknown function (DUF3304); Region:
                     DUF3304; pfam11745"
                     /db_xref="CDD:256591"
     gene            168231..170021
                     /locus_tag="Rahaq2_0159"
                     /note="IMG reference gene:2506707184"
                     /db_xref="GeneID:11793758"
     CDS             168231..170021
                     /locus_tag="Rahaq2_0159"
                     /note="PFAM: Uncharacterized conserved protein (DUF2235)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198250.1"
                     /db_xref="GI:383188122"
                     /db_xref="InterPro:IPR018712"
                     /db_xref="GeneID:11793758"
                     /translation="MDIESLVAAANRAQQENDAGIGNCSRALHVGYFFDGIHRNIEQD
                     ATEDRLSNIARLYRAFPDELQNSTKCSYAKFYVSGLGTPFNEDLTTKLHAIMDGAQGS
                     ALDDLKDQPWDIAKEAGIEFFKTGKWWEVLKDVGKKLIKPTEFLKLTGDITKSVVKKV
                     SIEATPWLRDNPVIADMLVTGVDTRITAAKLRFERFFERAVTSSQVPIKLISVSLFGY
                     DLGATLARKFLDTLLDDICQKQGDKYVYQGIPVEIIFAGLFDCARHTPASNNNGVDWF
                     VGAFGGPIRGISILLGDKYVDQDTPLPAAVKSALHLVAAHETRVWRSLYRLGGDKQKY
                     REELLPGCSEDVGGGLKPDEQKPSAELCRVALHRMYREAMLAGVPFPDFQTLHQSNPV
                     IAEYFIMENSVKENSVAQWTALYQQAVPFKNLSVAAQNLHLDSYIDWLGRQFYLYRSQ
                     CIKYAEQRGQVMASAGASAGLLGISPKAQETASDIRNEMDILRKHWGWLDDVHRAALS
                     MQNVMEMPNSHDTRRQLVPDVYIPALRRAKKFLAYGHAAYEGLPPPWPEDSAPSEIYA
                     WFVHDVQKVDKGAGISEDFLVIRSMEMPDS"
     misc_feature    168327..169349
                     /locus_tag="Rahaq2_0159"
                     /note="Uncharacterized alpha/beta hydrolase domain
                     (DUF2235); Region: DUF2235; cl01480"
                     /db_xref="CDD:260954"
     STS             169605..170643
                     /standard_name="D1S3693"
                     /db_xref="UniSTS:474271"
     gene            170394..172046
                     /locus_tag="Rahaq2_0160"
                     /note="IMG reference gene:2506707185"
                     /db_xref="GeneID:11789893"
     CDS             170394..172046
                     /locus_tag="Rahaq2_0160"
                     /note="PFAM: Malate:quinone oxidoreductase (Mqo);
                     TIGRFAM: malate:quinone-oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="malate:quinone-oxidoreductase"
                     /protein_id="YP_005198251.1"
                     /db_xref="GI:383188123"
                     /db_xref="InterPro:IPR006231"
                     /db_xref="GeneID:11789893"
                     /translation="MRKILGMLLNRDSLGASEPAAAEDEKSVDVLLVGGGIMSATLGT
                     YLQELEPDWSVHMIERMDSVAQESSNGWNNAGTGHSALAEMNYTPLMPDGSVDITKAV
                     AINEAFQVSRQFMAYQVQKGVLNNPRSFINSVPHMSFVWGDENIDFLRKRFAALQEST
                     LFRGMEYSEDPEQIRQWIPAVMDGRDPKQKVAATRTTAGTDVNFGEVTRQLVEALQKK
                     SNFTLANGQEVRDIQRNPDKSWRVTITDLKHSHKHRVVNAKFVFIGAGGASLTLLQKS
                     GIPEAREYGGFPVGGEFLVTENQDVVKRHLAKVYGKAAVGAPPMSVPHLDTRIIDGKQ
                     VLLFGPFATFSSKFLKNGSLWDLFGSVNSSNLLPMTHVGMGNFDLVKYLVGQVMLSDE
                     DRHAALKEFFPEAEQKDWKRWVAGQRVQVIKKDGKHGGVLRLGTEVVSAKDGSIAALL
                     GASPGASTAAPIMMKLLETVFKERAASAEWQAKFREIIPSYGTKLNGNIEATEKELLE
                     TSRILQLETPSMITTPVADVVQLRPLDVQAKQEPKHPADIAL"
     misc_feature    170460..171944
                     /locus_tag="Rahaq2_0160"
                     /note="malate:quinone oxidoreductase; Validated; Region:
                     PRK05257"
                     /db_xref="CDD:179979"
     misc_feature    170466..171890
                     /locus_tag="Rahaq2_0160"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: COG0579"
                     /db_xref="CDD:223652"
     gene            complement(172560..173813)
                     /locus_tag="Rahaq2_0161"
                     /note="IMG reference gene:2506707186"
                     /db_xref="GeneID:11789894"
     CDS             complement(172560..173813)
                     /locus_tag="Rahaq2_0161"
                     /note="PFAM: Permease for cytosine/purines, uracil,
                     thiamine, allantoin;
                     TIGRFAM: NCS1 nucleoside transporter family; probable
                     hydroxymethylpyrimidine transporter CytX"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydroxymethylpyrimidine transporter
                     CytX"
                     /protein_id="YP_005198252.1"
                     /db_xref="GI:383188124"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="GeneID:11789894"
                     /translation="MKDNSIYSPQVSVPEKSRVLGWSDLFSLWFSLGMGLMVLQAGAI
                     LAPGLGLAGSLAAIVLGSAVGVALLALVGVTGGQTGMSSMASLKLSLGKRGVALPVLF
                     NLIQLIGWGAFEIVVMRDAASLLAKRVWGDGSFWANPTLWTFTFGVVATLLAASGPLA
                     FIRLVLRRWGIWLLLASCAWLTGYLFLHAGLSTLWHKAGDGSMPFALACDIVVSMAFS
                     WLPLVSDYTRFGKSARQNFWGTACGYFLGSVWMMSLGVAYTLAFVSTSADANALLLAL
                     SGVALGIPLLLILVEEHENAFADIHSAAVSAGTSLPVSVGKLTLGIGLLCTLIAWAVP
                     LTQYENFLLLIGSVFAPLFGVVLTHHFVLRRQSHENLNIRSVAAWFTGIAVYHLMANL
                     LPDIGATIPSLLVAGLVCWGLGRKA"
     misc_feature    complement(172587..173747)
                     /locus_tag="Rahaq2_0161"
                     /note="Solute carrier families 5 and 6-like; solute
                     binding domain; Region: SLC5-6-like_sbd; cl00456"
                     /db_xref="CDD:260433"
     misc_feature    complement(order(172917..172922,172929..172931,
                     173712..173714,173721..173723))
                     /locus_tag="Rahaq2_0161"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212031"
     gene            173872..174033
                     /locus_tag="Rahaq2_0162"
                     /note="IMG reference gene:2506707187"
                     /db_xref="GeneID:11789895"
     CDS             173872..174033
                     /locus_tag="Rahaq2_0162"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198253.1"
                     /db_xref="GI:383188125"
                     /db_xref="GeneID:11789895"
                     /translation="MKGGGEAHFSAGREDFRHKKTASESGYFVEEVQLALSFLNFHLL
                     KISGTSSPD"
     gene            174238..175275
                     /locus_tag="Rahaq2_0163"
                     /note="IMG reference gene:2506707188"
                     /db_xref="GeneID:11789896"
     CDS             174238..175275
                     /locus_tag="Rahaq2_0163"
                     /codon_start=1
                     /transl_table=11
                     /product="virulence protein"
                     /protein_id="YP_005198254.1"
                     /db_xref="GI:383188126"
                     /db_xref="InterPro:IPR011204"
                     /db_xref="GeneID:11789896"
                     /translation="MDEHITPLAPEGEFVLFRTKDGQFQVECRFESETLWLSQAAMSV
                     LYQVTPQAITQHIKAIYAEGELIQSSTCKDYLQVQTEGKREINRQIRHYNLSVILAVG
                     YRVRSARGTQFRQWATQTLQEYVIKGFVMDDPRLKNPPVGQSVVPDYFDEMLERIRDI
                     RASERRIYLRIKDIFAMAADYRPTDKDTARFFQAIQNKLHFACTGLTAAEIIAQRADA
                     SQPDMGLTSFKYDQVRKTDTTIAKNYLREEEIDQLNRIISMWLDYAEDQTKRRQQIFL
                     KSWEDKLEQFLNFNEFDVLQGSGKTSKKEADEKACQQYEKFAEQRRKLKEAEGEKSNI
                     EALCTLAQKKR"
     misc_feature    174271..175233
                     /locus_tag="Rahaq2_0163"
                     /note="Virulence protein [General function prediction
                     only]; Region: COG3943"
                     /db_xref="CDD:226452"
     gene            complement(175294..175950)
                     /locus_tag="Rahaq2_0164"
                     /note="IMG reference gene:2506707189"
                     /db_xref="GeneID:11789897"
     CDS             complement(175294..175950)
                     /locus_tag="Rahaq2_0164"
                     /note="PFAM: Pentapeptide repeats (8 copies)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative low-complexity protein"
                     /protein_id="YP_005198255.1"
                     /db_xref="GI:383188127"
                     /db_xref="InterPro:IPR001646"
                     /db_xref="GeneID:11789897"
                     /translation="MFTNQLFTDQRFSARQFTGETLENCRFYRCRFDSTDLSETAFVD
                     CLFYDDEEQKGCSFQHAKLQDASFKRCDLTMADFKNVQALGCEIRECKATGADFSGAS
                     FMNMITARTWFCSAFMTKNNFSYANFSKVILEKCELWENRWTGANVQGANFSGSDLSG
                     GEFTEFDWNNLNITHCDLTNSDLGELNIRKVDLDGVKIDDWQQSHLLEKLGVIVIHSK
                     "
     misc_feature    complement(175657..175890)
                     /locus_tag="Rahaq2_0164"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_4; pfam13599"
                     /db_xref="CDD:257914"
     misc_feature    complement(175456..175587)
                     /locus_tag="Rahaq2_0164"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     misc_feature    complement(175366..175515)
                     /locus_tag="Rahaq2_0164"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     gene            176146..177075
                     /locus_tag="Rahaq2_0165"
                     /note="IMG reference gene:2506707190"
                     /db_xref="GeneID:11789898"
     CDS             176146..177075
                     /locus_tag="Rahaq2_0165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198256.1"
                     /db_xref="GI:383188128"
                     /db_xref="GeneID:11789898"
                     /translation="MFEPNKKVLTKNEAGKRILHNMRNKWATQVNDIMTAKGIIWDPG
                     KKKIDDYSLHNYHVLRIALGKLTRQEQNFFNVLTQAPFYAVHCTDSFDVVNKGSDLTL
                     YSRKNLISKGIRFNEDNTQPVDISMLGNDGYVFFSLEIGLPLLKTSSRFGSIFYKVAY
                     SHSVFRNSSMVLTDQVALVIPRCHIPELSREAVRILETREFNRHAIIFNGKMFSVLGL
                     AYSIILANRSLPPADQQVILSARNDTQLSNIVNSFYRPEIRVPKMVSLKSDEYSINMD
                     HYKPRVMSSGESDDGWSGMDSSGSGSDYSDTED"
     gene            177234..179393
                     /locus_tag="Rahaq2_0166"
                     /note="IMG reference gene:2506707191"
                     /db_xref="GeneID:11789899"
     CDS             177234..179393
                     /locus_tag="Rahaq2_0166"
                     /note="PFAM: Peptidase family M3"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent oligopeptidase"
                     /protein_id="YP_005198257.1"
                     /db_xref="GI:383188129"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="GeneID:11789899"
                     /translation="MRISPLFLAITLACSQYAVGAEPTSAPALTQEHVMNHAINADNP
                     FLKPSPLEYQAPQFNLYKDSDYEPAILEGIRQKLAEVDKIASDSAPPTFENTYVALEK
                     SGVMLQRVQNVFGAMTGANTNDTLQKIDEDTSPKLAAMDDSIHLNSKLFARLKAVYDQ
                     RSSLKISPESQRLIEVTFKDFELAGANLSDADKDKLRALNQQAATLSTQFTNKLLAAT
                     KAGGLTVKDKAQLAGLSDAELSAAAQAAKDRKLDNAWLLVLQNTTQQPLLQSLDDREA
                     RKALYEASINRAEKGDANDTRELIAKLAKVRAEQARVLGFPSYAAWKLEDQMAKTPKA
                     ALDFMHKIVPAATARAGREAADIQAEIDKQNGGFKVAAWDWQHYAQQVRKEKYDLDDA
                     QIKPYFELNNVLENGVFYAANLLYGITFKERKDLPVYNPDVRVFEVFDKDGKSMALFY
                     ADYYQRDNKGGGAWMSNYVDQSKLLGNKPVIYNVANFQKPAAGQPALLSWDDVITLFH
                     EFGHTLHGLFADQEYPGLSGTATPRDFVEFPSQFNEHWASDPKVFTHFAKHYKTGEVM
                     PQALQDKIEKASKFNKGYDMTELLAAALLDMHWHSLGADAPQQDVDKFEAESLAKDKV
                     NLAYVPPRYRSSYFQHIWGNGYAAGYYAYLWTEMLADDAFAGITEQGGLTRENGQKFR
                     DQILSRGNSEDLEKLYETWRGKAPSIEPMLKNRGLEE"
     misc_feature    177333..179387
                     /locus_tag="Rahaq2_0166"
                     /note="Zn-dependent oligopeptidases [Amino acid transport
                     and metabolism]; Region: Dcp; COG0339"
                     /db_xref="CDD:223416"
     misc_feature    177423..179384
                     /locus_tag="Rahaq2_0166"
                     /note="Peptidase family M3 dipeptidyl carboxypeptidase
                     (DCP); Region: M3A_DCP; cd06456"
                     /db_xref="CDD:188995"
     misc_feature    order(178620..178628,178755..178760,178767..178769,
                     178842..178844,178851..178853,178998..179000,
                     179127..179132,179148..179153,179163..179171,
                     179181..179183,179190..179192)
                     /locus_tag="Rahaq2_0166"
                     /note="active site"
                     /db_xref="CDD:188995"
     misc_feature    order(178755..178757,178767..178769,178842..178844)
                     /locus_tag="Rahaq2_0166"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188995"
     gene            179544..180602
                     /locus_tag="Rahaq2_0167"
                     /note="IMG reference gene:2506707192"
                     /db_xref="GeneID:11789900"
     CDS             179544..180602
                     /locus_tag="Rahaq2_0167"
                     /note="PFAM: Metal binding domain of Ada;
                     6-O-methylguanine DNA methyltransferase, DNA binding
                     domain;
                     TIGRFAM: O-6-methylguanine DNA methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="O-6-methylguanine DNA methyltransferase"
                     /protein_id="YP_005198258.1"
                     /db_xref="GI:383188130"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR004026"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="InterPro:IPR016221"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="GeneID:11789900"
                     /translation="MLFDLPDDDVLYAALIARDPAYDGFAFVGVKSTGIFCRLTCPAR
                     KPKRENSVFYPSIVSAMEAGFRPCKRCQPLMQGGEKDPLVLKLLAALENEPGRKWSEG
                     DVQAMNVDPSTVRRAFKRQFGITFLEMARLRRIGKGIDALAKGEAVIEAQLDASFESG
                     SGFRAALTRQIGSNPSQVRKHQFLKADWLDTPIGSMLAIASRDALYLLEFIDRPALPN
                     EIERLKLLTSSEIIFGRTPLIDQVEQELTAYFAGEKHTFATPLAEFGSLFTRKVWDAL
                     RAIPAGELRSYSALAADIGQATASRAVARANGANQISILIPCHRVIGADGSLTGYGGG
                     LWRKRWLIEHERRMALSR"
     misc_feature    179544..180104
                     /locus_tag="Rahaq2_0167"
                     /note="Adenosine deaminase [Nucleotide transport and
                     metabolism]; Region: Ada; COG2169"
                     /db_xref="CDD:225080"
     misc_feature    179568..179765
                     /locus_tag="Rahaq2_0167"
                     /note="Metal binding domain of Ada; Region:
                     Ada_Zn_binding; pfam02805"
                     /db_xref="CDD:251541"
     misc_feature    179814..179936
                     /locus_tag="Rahaq2_0167"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    180102..180584
                     /locus_tag="Rahaq2_0167"
                     /note="Methylated DNA-protein cysteine methyltransferase
                     [DNA replication, recombination, and repair]; Region: Ada;
                     COG0350"
                     /db_xref="CDD:223427"
     misc_feature    180345..180581
                     /locus_tag="Rahaq2_0167"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    order(180345..180350,180402..180407,180429..180431,
                     180438..180440,180444..180449,180453..180455,
                     180462..180467,180471..180473,180495..180497,
                     180510..180512,180531..180533)
                     /locus_tag="Rahaq2_0167"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     misc_feature    order(180402..180404,180495..180500,180504..180506,
                     180576..180578)
                     /locus_tag="Rahaq2_0167"
                     /note="active site"
                     /db_xref="CDD:119438"
     gene            180608..180776
                     /locus_tag="Rahaq2_0168"
                     /note="IMG reference gene:2506707193"
                     /pseudo
                     /db_xref="GeneID:11789901"
     gene            complement(180772..181986)
                     /locus_tag="Rahaq2_0169"
                     /note="IMG reference gene:2506707194"
                     /db_xref="GeneID:11789902"
     CDS             complement(180772..181986)
                     /locus_tag="Rahaq2_0169"
                     /note="PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005198259.1"
                     /db_xref="GI:383188131"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11789902"
                     /translation="MKGMPPLILALLASSLVLTIGRGVTLPFITIYLTEHYHLLPKSV
                     GIILGASLAIGILSSLYGGYLVDKFHHRTLITVSISLFGLSFLLLPFLPNVTGVLLVL
                     ALLNASYALLSITLKACIASWLPVEKRVKAFSMNYTLVNVGWAVGSSLGVWLAGFSPL
                     LPFMISGMLALSTVISLTWGLRNIPHQPPQTEQEQKPLPKPNLRQTLSILAHDRRLIY
                     FTLGSTLGSVVFGQFAGYLSQYLILVSNADFAYKIIGAVMITNAVIVIAFQYVLSSRM
                     KQNSLLKWLLLGTIFFIIGLIGFMTAGQSVLFWVIAMAIFSFGELIVIPVEYMFIDFI
                     APENMKGSYYGMQNLSNLGGAINPVMCGFLLSYTAPPVMFIALIAASVGGLVFFWMGH
                     RLAANTTRPPAI"
     misc_feature    complement(180817..181929)
                     /locus_tag="Rahaq2_0169"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(180913..181929)
                     /locus_tag="Rahaq2_0169"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(180925..180927,180934..180936,
                     180943..180948,180955..180960,180991..180993,
                     181000..181005,181015..181017,181024..181029,
                     181036..181038,181180..181182,181192..181194,
                     181201..181203,181213..181215,181225..181227,
                     181273..181275,181282..181287,181294..181299,
                     181306..181308,181555..181557,181573..181578,
                     181585..181590,181624..181626,181633..181638,
                     181645..181650,181657..181662,181798..181803,
                     181807..181812,181822..181824,181831..181836,
                     181843..181845,181897..181902,181906..181914,
                     181921..181923))
                     /locus_tag="Rahaq2_0169"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(182119..182820)
                     /locus_tag="Rahaq2_0170"
                     /note="IMG reference gene:2506707195"
                     /db_xref="GeneID:11789903"
     CDS             complement(182119..182820)
                     /locus_tag="Rahaq2_0170"
                     /note="PFAM: Bacterial regulatory proteins, tetR family;
                     YcdC-like protein, C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198260.1"
                     /db_xref="GI:383188132"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011075"
                     /db_xref="InterPro:IPR013573"
                     /db_xref="InterPro:IPR015893"
                     /db_xref="GeneID:11789903"
                     /translation="MADRKISDMAGSAQKDQTQATTPARRPGRPHSAKKGADKRELLL
                     DTALKLFAQYGIAETPLSMIAKEAGVTTAMLHYYFRTREHLLDVMIDERFQPVRAGFT
                     DIFQTHADDPLMAITNMAQCMIDAAEKYPWVAPLWVREVISESGMLKKRMEERNGDRN
                     RKIVQECITRWQAEGKLNPDLNPALLFISLFGLTLFPMASMKMRQEGASPISPDMLRK
                     HVALLLFHGVAPQKP"
     misc_feature    complement(182128..182742)
                     /locus_tag="Rahaq2_0170"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(182560..182694)
                     /locus_tag="Rahaq2_0170"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            182905..184404
                     /locus_tag="Rahaq2_0171"
                     /note="IMG reference gene:2506707196"
                     /db_xref="GeneID:11789904"
     CDS             182905..184404
                     /locus_tag="Rahaq2_0171"
                     /note="PFAM: Major Facilitator Superfamily;
                     TIGRFAM: drug resistance transporter, EmrB/QacA subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="EmrB/QacA subfamily drug resistance transporter"
                     /protein_id="YP_005198261.1"
                     /db_xref="GI:383188133"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11789904"
                     /translation="MTTINSAQSDAAEHKPSIKLLFSALLLVMLLAALDQTIVATALP
                     TIVSELGGLDQLSWVVTSYLLASTIVVPLYGKFGDLLGRKIVLQTAIIVFLLGSVLCG
                     LAQNMTQLILMRALQGLGGGGLMVVSMAAVGDVIPPSERGKYQGLFGGVFGLATVIGP
                     LIGGFLVEHISWRWIFYINLPLGIFALLVIGVALKSQTARIRHEIDFLGAGYLAAALT
                     CIILFTSEGGTVYQWSDPQLWCILAFGLVTLGGFIYEETLAAEPIIPLGLFRDRTFLL
                     SCAISFIIGMSLMGSMTFLPLYLQVVKGSSPSEAGMQLLPLMGALLVSSIISGRLISH
                     FGRYRIFPIIGTLLSFAGMVLLGFLKVSTPVHMLYLYIGVLGLGLGMVMQVLVLAVQN
                     AVSMKQMGVATSGVTLFRSIGGSIGVAMFGAIFTHVLHDQLVVLIPEGTVLPRSLGAQ
                     AVQELPADIRTDYLQAFGSALHSVYLIAACVMLLAFVLSLLQKDAVLKK"
     misc_feature    183007..184356
                     /locus_tag="Rahaq2_0171"
                     /note="methyl viologen resistance protein SmvA;
                     Provisional; Region: PRK14995"
                     /db_xref="CDD:184957"
     misc_feature    183007..184188
                     /locus_tag="Rahaq2_0171"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(183010..183012,183019..183027,183031..183036,
                     183082..183084,183091..183096,183103..183105,
                     183115..183120,183124..183129,183265..183270,
                     183277..183282,183289..183294,183301..183303,
                     183337..183342,183349..183354,183370..183372,
                     183757..183759,183766..183771,183778..183783,
                     183790..183792,183832..183834,183844..183846,
                     183856..183858,183865..183867,183877..183879,
                     184030..184032,184039..184044,184051..184053,
                     184063..184068,184075..184077,184108..184113,
                     184120..184125,184132..184137,184144..184146)
                     /locus_tag="Rahaq2_0171"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            184507..186360
                     /locus_tag="Rahaq2_0172"
                     /note="IMG reference gene:2506707197"
                     /db_xref="GeneID:11789905"
     CDS             184507..186360
                     /locus_tag="Rahaq2_0172"
                     /note="PFAM: ABC transporter; ABC transporter
                     transmembrane region"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase/permease"
                     /protein_id="YP_005198262.1"
                     /db_xref="GI:383188134"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017940"
                     /db_xref="GeneID:11789905"
                     /translation="MLFRRFERMIDIFREAPAAEPPDQVLPFYLYYLRQVWPSFAILL
                     VVGLIGALIEVSLFSYLSQIIDLTKDTPPGSFFTDHRGELLWMAAVAMILRPVFIGLH
                     DLLVHQTISPGMTSMIRWQNHKYVLKQSLNFFQSDFAGRIAQRIMQTGSSLRDSAVQA
                     VDAIWHVVIYAASALFLFAEADWRLMIPLIIWIFGYGICLRYFVPRVKQRSVQSSEAR
                     SKLMGCIVDGYTNITTLKLFAHTDLEQKYAREAITEQTEKTQLAGRLVTGMDVSVTTL
                     NGLLIVSTTGLALWLWTQSLISVGAIALATGLVIRIVNMSGWIMWVVNGIFENIGMVQ
                     DGLHTIARPLTVTDIPQAKALKVDQGAIHFDHIDFNYGKENHGKENGGRVIPNLDLAI
                     RPGEKIGLIGPSGAGKSTLVNLLLRLYDIDGGRILIDQQNIAEVTQESLRAQIGMITQ
                     DTSLLHRSIRDNLLYGRPGATEEELQLAIRQARADEFIPQLYDSLGRTGLDAHVGERG
                     VKLSGGQRQRIAIARVLLKNAPVLIMDEATSALDSEVEAAIQESLETLMGGKTVIAIA
                     HRLSTIAKMDRLVVLEKGQIVETGNHAELLAHGGLYARLWQHQTGGFVGMD"
     misc_feature    184576..186342
                     /locus_tag="Rahaq2_0172"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    184630..185379
                     /locus_tag="Rahaq2_0172"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    185590..186324
                     /locus_tag="Rahaq2_0172"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    185710..185733
                     /locus_tag="Rahaq2_0172"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(185719..185724,185728..185736,185854..185856,
                     186109..186114,186205..186207)
                     /locus_tag="Rahaq2_0172"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    185845..185856
                     /locus_tag="Rahaq2_0172"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    186037..186066
                     /locus_tag="Rahaq2_0172"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    186097..186114
                     /locus_tag="Rahaq2_0172"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    186121..186132
                     /locus_tag="Rahaq2_0172"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    186193..186213
                     /locus_tag="Rahaq2_0172"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(186370..187497)
                     /locus_tag="Rahaq2_0173"
                     /note="IMG reference gene:2506707198"
                     /db_xref="GeneID:11789906"
     CDS             complement(186370..187497)
                     /locus_tag="Rahaq2_0173"
                     /note="PFAM: Protein of unknown function, DUF482"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198263.1"
                     /db_xref="GI:383188135"
                     /db_xref="InterPro:IPR007434"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11789906"
                     /translation="MPVITLNRLADCPAAQWDALVPAQQPFLSYAFLSALEDSGSLGP
                     HSGWRPQHLLWQENGEIRAAIPGYRKRHSYGEYVFDQGWADACQRSGIAYYPKWLGAV
                     PFSPVTGARLLGEESAAIRLLQALPDYLQENGLTGAHINFTDERANRLMGHEAVWQHR
                     QGLQYHWQNRGYRDFQDYLDALTSRKRKQFRKEREQVAAQGIDFVWLEGAQLTEAQWD
                     FVYACYSNTYHIRGQSPYLTRAFFSLLAERMPEAIRVVFAQLNGRDVAMAFSLISGDT
                     FYGRYWGCVAEFDRLHFETCFYQGMAYAIASGLARFDAGAQGEHKLLRGFEPVITDSW
                     HYLRHPGLRDAVEDFLVEERAAVQRWADEARQVLPYRHDVC"
     misc_feature    complement(186382..187476)
                     /locus_tag="Rahaq2_0173"
                     /note="Protein of unknown function, DUF482; Region:
                     DUF482; pfam04339"
                     /db_xref="CDD:252534"
     gene            complement(187681..188316)
                     /locus_tag="Rahaq2_0174"
                     /note="IMG reference gene:2506707199"
                     /db_xref="GeneID:11789907"
     CDS             complement(187681..188316)
                     /locus_tag="Rahaq2_0174"
                     /note="PFAM: Carbonic anhydrase"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="YP_005198264.1"
                     /db_xref="GI:383188136"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="GeneID:11789907"
                     /translation="MKDVIEGFLRFQKEAFPQRSKLFKKLALNQNPKTLFISCSDSRL
                     VPELVTQREPGELFVIRNAGNIVPPFGPEPGGVSATVEYAVMALGVKDIVICGHSNCG
                     AMSAIANCTCLDHMPAVAHWLRYSDAAKAINESIEHENPEARVNGMVHQNVVAQLSNL
                     RTHPCVAVALAKGEITLHGWVYDIESGCIEAFDAKSGAFISLSDNPEVRAS"
     misc_feature    complement(187741..188298)
                     /locus_tag="Rahaq2_0174"
                     /note="Carbonic anhydrases (CA) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism in which the nucleophilic
                     attack of a zinc-bound hydroxide ion on carbon dioxide is
                     followed by the regeneration of an...; Region:
                     beta_CA_cladeB; cd00884"
                     /db_xref="CDD:238449"
     misc_feature    complement(order(187771..187773,188014..188016,
                     188023..188025,188053..188055,188068..188070,
                     188143..188145,188152..188154,188188..188196,
                     188200..188202,188221..188223,188227..188229))
                     /locus_tag="Rahaq2_0174"
                     /note="active site clefts [active]"
                     /db_xref="CDD:238449"
     misc_feature    complement(order(188014..188016,188023..188025,
                     188194..188196,188200..188202))
                     /locus_tag="Rahaq2_0174"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238449"
     misc_feature    complement(order(187750..187752,187756..187758,
                     187762..187767,187771..187773,187951..187953,
                     188068..188073,188080..188085,188134..188136,
                     188140..188142,188146..188154,188167..188178,
                     188182..188184,188188..188199))
                     /locus_tag="Rahaq2_0174"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238449"
     gene            188537..189079
                     /locus_tag="Rahaq2_0175"
                     /note="IMG reference gene:2506707200"
                     /db_xref="GeneID:11789908"
     CDS             188537..189079
                     /locus_tag="Rahaq2_0175"
                     /note="PFAM: Peptide methionine sulfoxide reductase;
                     TIGRFAM: methionine-S-sulfoxide reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine-S-sulfoxide reductase"
                     /protein_id="YP_005198265.1"
                     /db_xref="GI:383188137"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="GeneID:11789908"
                     /translation="MTIEYAIFGGGCFWCTEAVFKDVIGVESVESVYTGGRRPNPNYE
                     QVCTGTTGHAEAIRVGFDPEKLTYGDLLDIHFVTHDPTQLNRQGNDVGTQYRSAIFPA
                     NEQQKAEAEAAILRAQHDHSDPIVTSIEPLGEVYVAEGYHQNYWDGAGQQNRYCMAVI
                     PPKLQKLRKSFAQRTKSLQQ"
     misc_feature    188537..189049
                     /locus_tag="Rahaq2_0175"
                     /note="methionine sulfoxide reductase A; Provisional;
                     Region: PRK14054"
                     /db_xref="CDD:237597"
     gene            complement(189150..189332)
                     /locus_tag="Rahaq2_0176"
                     /note="IMG reference gene:2506707201"
                     /db_xref="GeneID:11789909"
     CDS             complement(189150..189332)
                     /locus_tag="Rahaq2_0176"
                     /note="PFAM: Tautomerase enzyme;
                     TIGRFAM: 4-oxalocrotonate tautomerase family enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="4-oxalocrotonate tautomerase"
                     /protein_id="YP_005198266.1"
                     /db_xref="GI:383188138"
                     /db_xref="InterPro:IPR004370"
                     /db_xref="InterPro:IPR014347"
                     /db_xref="GeneID:11789909"
                     /translation="MPMIRLEMFPGRTPEQKRDFVREVTRLAAETLKCKPESVDVVIT
                     EIPKSHWAKGGVLPEE"
     misc_feature    complement(189162..189332)
                     /locus_tag="Rahaq2_0176"
                     /note="4-Oxalocrotonate Tautomerase:  Catalyzes the
                     isomerization of unsaturated ketones. The structure is a
                     homohexamer that is arranged as a trimer of dimers. The
                     hexamer contains six active sites, each formed by residues
                     from three monomers, two from one...; Region:
                     4Oxalocrotonate_Tautomerase; cl00235"
                     /db_xref="CDD:260287"
     misc_feature    complement(order(189219..189221,189324..189329))
                     /locus_tag="Rahaq2_0176"
                     /note="active site 1 [active]"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(189237..189242,189252..189254,
                     189261..189266,189273..189275,189309..189329))
                     /locus_tag="Rahaq2_0176"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(189162..189188,189195..189200,
                     189204..189218,189222..189227,189258..189260,
                     189267..189272,189279..189284,189312..189314,
                     189318..189320))
                     /locus_tag="Rahaq2_0176"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(189180..189182,189312..189314))
                     /locus_tag="Rahaq2_0176"
                     /note="active site 2 [active]"
                     /db_xref="CDD:238274"
     gene            complement(189452..189769)
                     /locus_tag="Rahaq2_0177"
                     /note="IMG reference gene:2506707202"
                     /db_xref="GeneID:11789910"
     CDS             complement(189452..189769)
                     /locus_tag="Rahaq2_0177"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198267.1"
                     /db_xref="GI:383188139"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="GeneID:11789910"
                     /translation="MDKSLDTRIGQILAQQLPPQASAKALNELGKQYQEQQDLDAAIA
                     CWEQSMACYGKPGFAQAQLMKAYNARRRQCSEAGDGKGLEQYSEKIDALMQQSKDAIR
                     YGF"
     gene            complement(189791..191056)
                     /locus_tag="Rahaq2_0178"
                     /note="IMG reference gene:2506707203"
                     /db_xref="GeneID:11789911"
     CDS             complement(189791..191056)
                     /locus_tag="Rahaq2_0178"
                     /note="PFAM: PTS system sugar-specific permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198268.1"
                     /db_xref="GI:383188140"
                     /db_xref="InterPro:IPR004703"
                     /db_xref="GeneID:11789911"
                     /translation="MSFLHFIVNDVLGQASILISLIAMIGLIALKKSTGQIITGTLKT
                     LLGFLVLLSGASIIVNALTFLGEIFQKGFHMRGIVTDVGSIAGIAQQTLGRETALIMV
                     LAFIVNILIARLTRFKYIFLTGQASLWMATVCSVIGYMGGLRGTELILTGGIIAGIMA
                     VGMPVLAQPIVRKITGSDDIALGHFCTIGYIVQAGVAKITGDVSKSTEDFELPQSFSF
                     LQDTYLSMMVVMIPIYLIPAIAAGPEVVAPYASNVNYLVYSFLQSIQFVVGVYVLLSG
                     VRLLLAEIVPAFRGIALRIVPNAIPALDCPVLFPYAPNAVIIGFISTTIGSVIGMFLF
                     PSLGLAMILPGMLTNFFAGGTAGIFGNAVGGRRGAIIGGIFHGLFITLLPALLLPLLG
                     KFGFSNVTFSDSDVISVGLVFGHILNFFH"
     misc_feature    complement(189797..191056)
                     /locus_tag="Rahaq2_0178"
                     /note="PTS system ascorbate-specific transporter subunit
                     IIC; Reviewed; Region: ulaA; PRK09410"
                     /db_xref="CDD:236502"
     gene            complement(191129..191431)
                     /locus_tag="Rahaq2_0179"
                     /note="IMG reference gene:2506707204"
                     /db_xref="GeneID:11789912"
     CDS             complement(191129..191431)
                     /locus_tag="Rahaq2_0179"
                     /note="PFAM: PTS system, Lactose/Cellobiose specific IIB
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system galactitol-specific transporter
                     subunit IIB"
                     /protein_id="YP_005198269.1"
                     /db_xref="GI:383188141"
                     /db_xref="InterPro:IPR003501"
                     /db_xref="InterPro:IPR013011"
                     /db_xref="GeneID:11789912"
                     /translation="MKKLSILAVCGAGLGSSFACEMSIEAALKDLGVEADLSHCDISS
                     ATSSRADIIMTGENFRSQFQHYSINANIIYLKRLVDKNEIKTKLTPILQEMGHLAT"
     misc_feature    complement(191156..191416)
                     /locus_tag="Rahaq2_0179"
                     /note="PTS_IIB_ascorbate: subunit IIB of enzyme II (EII)
                     of the L-ascorbate-specific
                     phosphoenolpyruvate:carbohydrate phosphotransferase system
                     (PTS). In this system, EII is an L-ascorbate-specific
                     permease with two cytoplasmic subunits (IIA and IIB) and
                     a...; Region: PTS_IIB_ascorbate; cd05563"
                     /db_xref="CDD:99905"
     misc_feature    complement(order(191381..191389,191393..191404))
                     /locus_tag="Rahaq2_0179"
                     /note="P-loop; other site"
                     /db_xref="CDD:99905"
     misc_feature    complement(order(191381..191386,191393..191398,
                     191402..191404))
                     /locus_tag="Rahaq2_0179"
                     /note="active site"
                     /db_xref="CDD:99905"
     misc_feature    complement(191402..191404)
                     /locus_tag="Rahaq2_0179"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99905"
     gene            complement(191497..191940)
                     /locus_tag="Rahaq2_0180"
                     /note="IMG reference gene:2506707205"
                     /db_xref="GeneID:11789913"
     CDS             complement(191497..191940)
                     /locus_tag="Rahaq2_0180"
                     /note="PFAM: Phosphoenolpyruvate-dependent sugar
                     phosphotransferase system, EIIA 2"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system
                     mannitol/fructose-specifc IIA component (Ntr-type)"
                     /protein_id="YP_005198270.1"
                     /db_xref="GI:383188142"
                     /db_xref="InterPro:IPR002178"
                     /db_xref="InterPro:IPR016152"
                     /db_xref="GeneID:11789913"
                     /translation="MLSDWINENNTQIISKTDDWKSAVAFAVQPLIDSGAAESRYLQA
                     IYDMHREIGPYYVLGEGIAMPHARPEEGVNRTALSLVIVSEGVEFGSEGNDPVYVIFA
                     LAAVDSHSHIEMIASLSHLFCDDEAAERLKRSKNKQEALEIIRQF"
     misc_feature    complement(191509..191925)
                     /locus_tag="Rahaq2_0180"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    complement(order(191743..191745,191791..191793))
                     /locus_tag="Rahaq2_0180"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    complement(191743..191745)
                     /locus_tag="Rahaq2_0180"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            complement(192147..192743)
                     /locus_tag="Rahaq2_0181"
                     /note="IMG reference gene:2506707206"
                     /db_xref="GeneID:11793759"
     CDS             complement(192147..192743)
                     /locus_tag="Rahaq2_0181"
                     /codon_start=1
                     /transl_table=11
                     /product="putative kinase"
                     /protein_id="YP_005198271.1"
                     /db_xref="GI:383188143"
                     /db_xref="GeneID:11793759"
                     /translation="MSENRSTSRNGFTSKRVILVNGIPASGKSRLAVELSAYSGWLQL
                     SLDGIKNPFLQRLENVDRPFNRVLGLASYQVIWDIIGGAPQGSTFIVDAWFGFQPQEV
                     LQDYLQRAGVTQVVEIWCQIDAELAAERFSSRLGERLPGHVGAEYIPELKILAGNARP
                     ITSGPVYSVDQNVIGQNKPVNIVDIHTWIMNSFNTQIQ"
     misc_feature    complement(192414..192695)
                     /locus_tag="Rahaq2_0181"
                     /note="AAA domain; Region: AAA_17; pfam13207"
                     /db_xref="CDD:257574"
     gene            complement(192736..193671)
                     /locus_tag="Rahaq2_0182"
                     /note="IMG reference gene:2506707207"
                     /db_xref="GeneID:11789914"
     CDS             complement(192736..193671)
                     /locus_tag="Rahaq2_0182"
                     /note="PFAM: DeoC/LacD family aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="tagatose-1,6-bisphosphate aldolase"
                     /protein_id="YP_005198272.1"
                     /db_xref="GI:383188144"
                     /db_xref="InterPro:IPR002915"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:11789914"
                     /translation="MSKMSTSELRSYQQICGKNGAMMVIACDQRGAMRSLLASDPQQQ
                     SAISEHELGLIKADITQYLASKASCVLVDPVCAVPQLVDNGIIARDTALLIGLDASGW
                     DTSPEGYRLSRLVENVDARRVRELGATGGKIMVYLRSDQEAANRHNMDILRQCIEDFA
                     REDLLLVVEFLTYQLDNETGEEYKEKVPSLIYGGTKICLECGAKVLKLPYPGSKQACA
                     DITKLAGDVPWAVLSAGVDHSTFLKQVADAMSEGASGVIAGRSLWKDCISLDRNATKS
                     RLESLAVPRLNELQAVIEQHFHAPSHNQTQQVEHV"
     misc_feature    complement(192787..193665)
                     /locus_tag="Rahaq2_0182"
                     /note="Class I aldolases; Region: Aldolase_Class_I;
                     cl17187"
                     /db_xref="CDD:266539"
     misc_feature    complement(193051..193053)
                     /locus_tag="Rahaq2_0182"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188634"
     gene            193905..194840
                     /locus_tag="Rahaq2_0183"
                     /note="IMG reference gene:2506707208"
                     /db_xref="GeneID:11789915"
     CDS             193905..194840
                     /locus_tag="Rahaq2_0183"
                     /note="PFAM: Sigma-70, region 4; Putative sugar-binding
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator with sigma
                     factor-related N-terminal domain"
                     /protein_id="YP_005198273.1"
                     /db_xref="GI:383188145"
                     /db_xref="InterPro:IPR007324"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="GeneID:11789915"
                     /translation="MQDIAATRAMMHLVAKLHYESDMSQVEIARKLDVSTATISRLLN
                     KARAAGIVRIEVVGLSSPEDMTADLIKRLGLKHAYVVDAPPGNVLGALATPLASLLQE
                     AGLGAGSVLGIGWGRAVREVTLAGMPRLPGIMTVALNGGMQQSAPHFQITEFVRRAAE
                     QMEGTPYFLHAPYLSSAELRDAFLSDPSVQEIISLWDRLDAAIVGVGLTHTPKPSEST
                     TATPGEQALSDAAGDVLRHYFTGTGELLHWEGEERMIAASVEQLRKTPLTIGVAATPE
                     KAAGIIGAVRSGMINSLVTDVNTAQAILDKLPVVV"
     misc_feature    193923..>194096
                     /locus_tag="Rahaq2_0183"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     misc_feature    193932..194816
                     /locus_tag="Rahaq2_0183"
                     /note="Transcriptional regulator, contains sigma
                     factor-related N-terminal domain [Transcription]; Region:
                     DeoR; COG2390"
                     /db_xref="CDD:225263"
     misc_feature    194094..194819
                     /locus_tag="Rahaq2_0183"
                     /note="Putative sugar-binding domain; Region: Sugar-bind;
                     pfam04198"
                     /db_xref="CDD:252446"
     gene            complement(194935..195765)
                     /locus_tag="Rahaq2_0184"
                     /note="IMG reference gene:2506707209"
                     /db_xref="GeneID:11793760"
     CDS             complement(194935..195765)
                     /locus_tag="Rahaq2_0184"
                     /note="PFAM: alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="YP_005198274.1"
                     /db_xref="GI:383188146"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="GeneID:11793760"
                     /translation="MSTFNTQDGTQIYYKDWGKGKPVLFSHGWPLDADMWDSQMNFLA
                     DRGYRVIAFDRRGFGRSEQPWEGYNYDTFASDINDLIEHLDLHDVTLVGFSMGGGDVT
                     RYISRYGSERVTSLVLLGAVTPLFIKTDDHPQGVDKSVFDGIRAGLLKDRAQFISDFA
                     TPFYGTHQGMTVSDGVMTQTLNIALMASLKGTVDCVTAFSETDFRPDMAKITVPTLVI
                     HGSADQIVPFEATGKLAAEMIKNAELKIYEGAPHGFAVTHQDQLNDDLLAFLTGIAHA
                     "
     misc_feature    complement(194947..195765)
                     /locus_tag="Rahaq2_0184"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    complement(<195406..195753)
                     /locus_tag="Rahaq2_0184"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(<195214..>195537)
                     /locus_tag="Rahaq2_0184"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(194956..>195138)
                     /locus_tag="Rahaq2_0184"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            196093..196734
                     /locus_tag="Rahaq2_0185"
                     /note="IMG reference gene:2506707210"
                     /db_xref="GeneID:11789916"
     CDS             196093..196734
                     /locus_tag="Rahaq2_0185"
                     /note="PFAM: Isochorismatase family"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamidase-like amidase"
                     /protein_id="YP_005198275.1"
                     /db_xref="GI:383188147"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="GeneID:11789916"
                     /translation="MSKFDLLDPQNSTLIFIDHQPQMSFGVANIDRQQLKNNTVALAK
                     AGKVFNVPVIYTSVETESFSGYIWPELLAVHPDVKPIERTSMNSWEDAAFVKAVEATG
                     RKKLIISALWTEVCLTFPALMALKEGYEVYVVTDTSGGTSVDAHERSIDRMVQAGAVP
                     VTWQQVLLEYQRDWSRKETYDDVMSLVREHSGAYGMGVDYAYTMVHKAPQRKA"
     misc_feature    196129..196608
                     /locus_tag="Rahaq2_0185"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    order(196144..196146,196339..196341,196438..196440)
                     /locus_tag="Rahaq2_0185"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    order(196153..196155,196162..196164,196300..196302)
                     /locus_tag="Rahaq2_0185"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    196423..196428
                     /locus_tag="Rahaq2_0185"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            196797..197216
                     /locus_tag="Rahaq2_0186"
                     /note="IMG reference gene:2506707211"
                     /db_xref="GeneID:11789917"
     CDS             196797..197216
                     /locus_tag="Rahaq2_0186"
                     /note="PFAM: DoxX"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198276.1"
                     /db_xref="GI:383188148"
                     /db_xref="InterPro:IPR011637"
                     /db_xref="GeneID:11789917"
                     /translation="MHHAPVSRLSAPVVPFAVIRWFALLALCAAYLQGGIVKLFDFPG
                     AIAEMQHFGLSPAAPMAAAVIVLELGASALILSGRFRWAGALALALFTFSANFMANAF
                     WQVSGQERAMMMNGFFEHIGLVGAFIYVAWDDIKGRV"
     misc_feature    <196899..197192
                     /locus_tag="Rahaq2_0186"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            197213..198799
                     /locus_tag="Rahaq2_0187"
                     /note="IMG reference gene:2506707212"
                     /db_xref="GeneID:11789918"
     CDS             197213..198799
                     /locus_tag="Rahaq2_0187"
                     /note="PFAM: Bacterial protein of unknown function
                     (DUF894)"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005198277.1"
                     /db_xref="GI:383188149"
                     /db_xref="InterPro:IPR010290"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11789918"
                     /translation="MSQNNVTNGGAFSPLKQGLFATIWVATILGNTGSFMRDVASSWL
                     VTGLSSNPAAVALMQTAATLPIFLLAIPAGVLSDILDRRRLLIFVQLLLASVSATLLL
                     LSHNNLLTVEYLVALTFIGGIGAALMGPAWQAIVPELVPRSDLRNAVALNSLGINIAR
                     AVGPAGGGLLLASLGAGAAYGADVMSYVFVIGALLWWKRPVKAKNELSEHFLGAFRAG
                     LRYVKASQELHRVLLRAAIYFAFASAIWAMLPLIARNMLHGTAGFYGILLGAVGVGAI
                     FGALLLPRLRQKLSADGLVLLSALLSAAVMLLLATSPAKWLAVVLMVILGIGWIIALT
                     SMNGVAQAVLPDWVRGRGLAVYLMVFNGAMAAGSLFWGLIAREIGLVGALLLAGSGLV
                     IAALVCWRLKLPAGEADLQPAGHWDNPVVEGDVQGDRGPVMIQIEYRIAQEDRPAFLT
                     EIRKLSLARRRDGAYAWGITEHSDDPSRLVEWFLVESWHEHLRQHQRVSHADADLQSD
                     VTRYHRGENKPQVHHYLSVR"
     misc_feature    197240..198793
                     /locus_tag="Rahaq2_0187"
                     /note="Transmembrane secretion effector; Region: MFS_3;
                     pfam05977"
                     /db_xref="CDD:253487"
     misc_feature    197270..198418
                     /locus_tag="Rahaq2_0187"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(197312..197314,197321..197329,197333..197338,
                     197387..197389,197396..197401,197408..197410,
                     197420..197425,197429..197434,197585..197590,
                     197597..197602,197609..197614,197621..197623,
                     197657..197662,197669..197674,197690..197692,
                     197927..197929,197936..197941,197948..197953,
                     197960..197962,198002..198004,198014..198016,
                     198026..198028,198035..198037,198047..198049,
                     198188..198190,198197..198202,198209..198211,
                     198221..198226,198233..198235,198266..198271,
                     198278..198283,198290..198295,198302..198304)
                     /locus_tag="Rahaq2_0187"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(198839..199747)
                     /locus_tag="Rahaq2_0188"
                     /note="IMG reference gene:2506707213"
                     /db_xref="GeneID:11789919"
     CDS             complement(198839..199747)
                     /locus_tag="Rahaq2_0188"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198278.1"
                     /db_xref="GI:383188150"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789919"
                     /translation="MRLSLEALLILDALDRHGTFAAAAARLFKTASALSYTVQKMESD
                     LNIKLLDRSGHRATFTPTGRLMLEKGRVLLRAVSELEQQAQYVESGWESKLTISVDAS
                     VPFALLAPLIDRFYAEHQHTQLLFRHDVLAGCWEALSYGEADIVFGAVQEPVTRSGIE
                     YRPIGWLEYVFAVAPHHPLASLPEPLVREQIRQYRAVVVHDTSRHGTGADLRVLDEQK
                     MLSVHDFNAKVHAQIAGLGCGYLPRYLAAPHLASGALVERRLDTETRRDQAFMAWNEN
                     DTGNAAMWWRENLQDFDGIAAVYSHK"
     misc_feature    complement(198875..199741)
                     /locus_tag="Rahaq2_0188"
                     /note="putative DNA-binding transcriptional regulator;
                     Provisional; Region: PRK11074"
                     /db_xref="CDD:182948"
     misc_feature    complement(199556..199735)
                     /locus_tag="Rahaq2_0188"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(198881..199468)
                     /locus_tag="Rahaq2_0188"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(199046..199051,199055..199060,
                     199076..199093,199364..199384,199388..199390,
                     199400..199402,199409..199414,199418..199423))
                     /locus_tag="Rahaq2_0188"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            199887..200195
                     /locus_tag="Rahaq2_0189"
                     /note="IMG reference gene:2506707214"
                     /db_xref="GeneID:11793761"
     CDS             199887..200195
                     /locus_tag="Rahaq2_0189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198279.1"
                     /db_xref="GI:383188151"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="GeneID:11793761"
                     /translation="MTYPHQPDHITLVITHGVQRDKLTEYEHWLEKLMADAAGFAGYQ
                     SVKILRPVHGETIYTVLVRFDNIDNLYQWIQSGQRESREKALASLLSGQEYIELRTQA
                     "
     misc_feature    199902..>200126
                     /locus_tag="Rahaq2_0189"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3224"
                     /db_xref="CDD:225765"
     gene            200317..201168
                     /locus_tag="Rahaq2_0190"
                     /note="IMG reference gene:2506707215"
                     /db_xref="GeneID:11793762"
     CDS             200317..201168
                     /locus_tag="Rahaq2_0190"
                     /note="PFAM: GIY-YIG catalytic domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative endonuclease"
                     /protein_id="YP_005198280.1"
                     /db_xref="GI:383188152"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="GeneID:11793762"
                     /translation="MWNPEKELFTGLYQYPEHLRHTLENLPNGSGVYIFYGDDNAFPL
                     YIGKSVNIRSRVMSHFRNPAEAKLLHMTRDIEFIETIGEVGALLLESDLIKTRRPLFN
                     KRLRTARKLCSVRLQGLTASIVFSDDVDFSHSEDLFGLFKTRMSAVEKIREIADQEKL
                     CYGALGLEKLAKNRACFRFSLGKCAGVCCGKESPEAHQARLRDALSTLKIRSWPYPGR
                     IAIAEEANGLTDYHVINHWFYLGTVNTLEAAKAFDTAVPHFDRDSYKILCKPLFEADS
                     PKVILLD"
     misc_feature    200350..201162
                     /locus_tag="Rahaq2_0190"
                     /note="nucleotide excision repair endonuclease;
                     Provisional; Region: PRK10545"
                     /db_xref="CDD:182535"
     misc_feature    200392..200625
                     /locus_tag="Rahaq2_0190"
                     /note="Catalytic GIY-YIG domain of nucleotide excision
                     repair endonucleases UvrC, Cho, and similar proteins;
                     Region: GIY-YIG_UvrC_Cho; cd10434"
                     /db_xref="CDD:198381"
     misc_feature    order(200407..200415,200449..200457)
                     /locus_tag="Rahaq2_0190"
                     /note="GIY-YIG motif/motif A; other site"
                     /db_xref="CDD:198381"
     misc_feature    order(200413..200415,200449..200451,200455..200460,
                     200479..200481,200491..200493,200584..200586,
                     200620..200622)
                     /locus_tag="Rahaq2_0190"
                     /note="active site"
                     /db_xref="CDD:198381"
     misc_feature    order(200449..200451,200479..200481,200584..200586)
                     /locus_tag="Rahaq2_0190"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198381"
     misc_feature    order(200449..200451,200479..200481,200584..200586)
                     /locus_tag="Rahaq2_0190"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:198381"
     misc_feature    200584..200586
                     /locus_tag="Rahaq2_0190"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198381"
     gene            complement(201180..201827)
                     /locus_tag="Rahaq2_0191"
                     /note="IMG reference gene:2506707216"
                     /db_xref="GeneID:11789920"
     CDS             complement(201180..201827)
                     /locus_tag="Rahaq2_0191"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198281.1"
                     /db_xref="GI:383188153"
                     /db_xref="GeneID:11789920"
                     /translation="MKRKIIAGLLLAGLTGNAYSTPLQEDSESILLTLGDTNSARVTT
                     CEEFIALRRSGETVAGYPDMPDRFMTAARDSLIDCYLTHYALDHRLTEITPAPKTPTL
                     KDVVDHFPATAAIAISDEEVAKVKTQYQGKTISQKDDDLKPDGDNRLVSAKNAEGYRI
                     SGMRVFKDKAGNLTQFITLGSFVTEGSWGTTTTYRIIAQDKPVWEIEEITENSPL"
     gene            complement(201997..203349)
                     /locus_tag="Rahaq2_0192"
                     /note="IMG reference gene:2506707217"
                     /db_xref="GeneID:11793763"
     CDS             complement(201997..203349)
                     /locus_tag="Rahaq2_0192"
                     /note="PFAM: Pyridine nucleotide-disulphide
                     oxidoreductase; Pyridine nucleotide-disulphide
                     oxidoreductase, dimerisation domain;
                     TIGRFAM: glutathione-disulfide reductase,
                     animal/bacterial"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-disulfide reductase"
                     /protein_id="YP_005198282.1"
                     /db_xref="GI:383188154"
                     /db_xref="InterPro:IPR000815"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="GeneID:11793763"
                     /translation="MTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKELGGTCVN
                     VGCVPKKVMWHAAQIAEAIRNYGPDYGFDTTVNSFNWKTLVANRTAYIDRIHTSYDNV
                     LGKNNVDVIKGFARFVDDHTVEVNGEKITADHILIATGGRPSHPDIPGAEYGIDSDGF
                     FDLTEMPKRVAVVGAGYIAVEIAGVMNALGAETHLFVRKHAPLRTFDPLIVETLVEVM
                     ETEGPVLHKESIPKEVVKNADGSLTLKLENGQEFEVDSLVWAIGREPETDNFNLKATG
                     VKTNEKGYIVVDKFQNTSVEGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHL
                     DYSNIATVVFSHPPIGTVGLTEPQAKEQFGEDNVKVYKSAFTAMYTAVTQHRQPCRMK
                     LVCVGKEEKIVGIHGIGYGMDEMLQGFAVALKMGATKKDFDNTVAIHPTGAEEFVTMR
                     "
     misc_feature    complement(202000..203349)
                     /locus_tag="Rahaq2_0192"
                     /note="glutathione reductase; Validated; Region: PRK06116"
                     /db_xref="CDD:235701"
     misc_feature    complement(202753..>202974)
                     /locus_tag="Rahaq2_0192"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(202603..202845)
                     /locus_tag="Rahaq2_0192"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    complement(202000..202335)
                     /locus_tag="Rahaq2_0192"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            complement(203514..204356)
                     /locus_tag="Rahaq2_0193"
                     /note="IMG reference gene:2506707218"
                     /db_xref="GeneID:11789921"
     CDS             complement(203514..204356)
                     /locus_tag="Rahaq2_0193"
                     /note="PFAM: Protein of unknown function (DUF519)"
                     /codon_start=1
                     /transl_table=11
                     /product="protein involved in catabolism of external DNA"
                     /protein_id="YP_005198283.1"
                     /db_xref="GI:383188155"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR007473"
                     /db_xref="GeneID:11789921"
                     /translation="MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKEKPFLYLDTHAG
                     AGRYQLSGEHAERTGEYLEGIARIWQRDDIPEELAAYMSVVNHFNRNENLRYYPGSPL
                     IARQLLREDDKLHLTELHPSDFPLLRSEFQKDDRTRVARADGYQQLKAQLPPPSRRGL
                     ILMDPPYEMKTDYQDVVKGIQEGYKRFATGTYALWYPVVMRQQIKKMLRDLEATGIRR
                     ILQIELGVRPDSDQRGMTASGMIVINPPWKLEQQMNNVLPWLLKVLVPSGTGHTTVNW
                     VVPE"
     misc_feature    complement(203517..204353)
                     /locus_tag="Rahaq2_0193"
                     /note="Protein involved in catabolism of external DNA
                     [General function prediction only]; Region: ComJ; COG2961"
                     /db_xref="CDD:225509"
     gene            204538..206598
                     /locus_tag="Rahaq2_0194"
                     /note="IMG reference gene:2506707219"
                     /db_xref="GeneID:11789922"
     CDS             204538..206598
                     /locus_tag="Rahaq2_0194"
                     /note="PFAM: Peptidase family M3"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent oligopeptidase"
                     /protein_id="YP_005198284.1"
                     /db_xref="GI:383188156"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="GeneID:11789922"
                     /translation="MTEQQNASNPLLTPFSLPPFSAIKPEHIVPAMKSAIEESRQTIE
                     RVVAQGAPYTWENLCQPLAESDDRLSRIWSPVGHLNAVKNSPELREAYEQCLPILSEF
                     STWTGQHAGLYQAYRDLKDSEHFSTLSVAQKKAIDNALRDFELSGIGLPMEKQKRYGE
                     ISARLSELGSTYSNNVLDATMGWSKLITDVNDLKGLPESALAAAKALAESKEQEGWLL
                     TLDIPSYLPVITYGENRELREEMYRAFATRASDQGPNAGKWDNSEVMAEELALRHELA
                     QLLGFDSFADMSLATKMAESPKQVIDFLSGLATRARPQGEQELAQLRAFAKEHFGVDE
                     MEAWDLPFYGEKQKQHLFSINDEQLRPYFPEQRALEGLFEVVKRIYGITAKERKDVET
                     WHKDVRFFDLFDETGDLRGSFYLDLYARENKRGGAWMNDCVGSMRKADGELQKPVAYL
                     TCNFNGPVGNKPALFTHNEVTTLFHEFGHGLHHMLTRIDTPGVAGIAGVPWDAVELPS
                     QFMENWCWEPDALAFISGHFETGEPLPKEMLDKMLAAKNYQAALFILRQLEFGLFDFR
                     MHAEYDPAKGAQILQTLAEIKKQVAVVPSPSWGRFPHAFSHIFAGGYAAGYYSYLWAE
                     VLSADAYSRFEEEGIFNRETGQSFLDNILSRGGSEEPMELFKRFRGREPQLDAMLRHY
                     GIKG"
     misc_feature    204553..206595
                     /locus_tag="Rahaq2_0194"
                     /note="Zn-dependent oligopeptidases [Amino acid transport
                     and metabolism]; Region: Dcp; COG0339"
                     /db_xref="CDD:223416"
     misc_feature    204613..206589
                     /locus_tag="Rahaq2_0194"
                     /note="Peptidase family M3 dipeptidyl carboxypeptidase
                     (DCP); Region: M3A_DCP; cd06456"
                     /db_xref="CDD:188995"
     misc_feature    order(205816..205824,205960..205965,205972..205974,
                     206050..206052,206059..206061,206206..206208,
                     206332..206337,206353..206358,206368..206376,
                     206386..206388,206395..206397)
                     /locus_tag="Rahaq2_0194"
                     /note="active site"
                     /db_xref="CDD:188995"
     misc_feature    order(205960..205962,205972..205974,206050..206052)
                     /locus_tag="Rahaq2_0194"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188995"
     gene            206608..207354
                     /locus_tag="Rahaq2_0195"
                     /note="IMG reference gene:2506707220"
                     /db_xref="GeneID:11789923"
     CDS             206608..207354
                     /locus_tag="Rahaq2_0195"
                     /note="PFAM: Protein of unknown function (DUF548)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198285.1"
                     /db_xref="GI:383188157"
                     /db_xref="InterPro:IPR007536"
                     /db_xref="GeneID:11789923"
                     /translation="MSVCLLCEEGADEGALSVLAQRWNLTSDPDAVMALVLTPERLEL
                     RKRDEPKLGAIYVDFVGGTMAHRRKFGGGRGEAVAKAVGIKGRYLPDVVDATAGLGRD
                     AFVLASLGCKVRMLERNPVVAALLDDGLARGYRDAEIGPWLRERMTLLHVSSLTALAE
                     LSPKPEVVYLDPMYPHKQKSALVKKEMRVFQGLVGPDEDADGLLEPARRLATKRIVVK
                     RPDYAPPMADIAAQAAVVTKSHRFDIYTPL"
     misc_feature    206608..207351
                     /locus_tag="Rahaq2_0195"
                     /note="putative methyltransferase; Provisional; Region:
                     PRK10742"
                     /db_xref="CDD:236749"
     misc_feature    206878..>207135
                     /locus_tag="Rahaq2_0195"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(206890..206910,206956..206961,207061..207069,
                     207118..207120)
                     /locus_tag="Rahaq2_0195"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(207433..207795)
                     /locus_tag="Rahaq2_0196"
                     /note="IMG reference gene:2506707221"
                     /db_xref="GeneID:11789924"
     CDS             complement(207433..207795)
                     /locus_tag="Rahaq2_0196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198286.1"
                     /db_xref="GI:383188158"
                     /db_xref="GeneID:11789924"
                     /translation="MTTRHDAQDNADMWDNRDLGASEEHAEAISPSLAAEFDDMMELQ
                     AISIRLQKSLLSNLKTIAAHHQIGYQPMVRDLLTRFAEAEMKKILIDQLNKIDEAQRD
                     REKTVPVTEFIEDLRNQA"
     gene            complement(208075..208515)
                     /locus_tag="Rahaq2_0197"
                     /note="IMG reference gene:2506707222"
                     /db_xref="GeneID:11789925"
     CDS             complement(208075..208515)
                     /locus_tag="Rahaq2_0197"
                     /note="PFAM: Universal stress protein family"
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein UspA-like protein"
                     /protein_id="YP_005198287.1"
                     /db_xref="GI:383188159"
                     /db_xref="InterPro:IPR006016"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="GeneID:11789925"
                     /translation="MAYKHILIAVDLSPESKVLVEKAVSMARPYNAKVSLIHVDVNYS
                     DLYTGLIDVNLGDMQKRISEETHHALNELSQNAGYPISETLSGSGDLAQVLVDAINKY
                     GVDLVLCGHHQDFWSKLMSSARQLINTVHIDMLIVPLRDEEEEA"
     misc_feature    complement(208105..208503)
                     /locus_tag="Rahaq2_0197"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    complement(order(208147..208155,208180..208185,
                     208186..208191,208399..208401,208483..208491))
                     /locus_tag="Rahaq2_0197"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            208853..209188
                     /locus_tag="Rahaq2_0198"
                     /note="IMG reference gene:2506707223"
                     /db_xref="GeneID:11789926"
     CDS             208853..209188
                     /locus_tag="Rahaq2_0198"
                     /note="PFAM: Universal stress protein B (UspB)"
                     /codon_start=1
                     /transl_table=11
                     /product="Universal stress protein B (UspB)"
                     /protein_id="YP_005198288.1"
                     /db_xref="GI:383188160"
                     /db_xref="InterPro:IPR019598"
                     /db_xref="GeneID:11789926"
                     /translation="MISPVALFWALCFVCVVNMLRYYSSLRALLVVLRGCDPLLYQYV
                     DGGGFFTSHGQPSKQIRLVRYIYAQRYVEHHDPEFIRRCERVRGQFILTTALVGLILI
                     SMLAMLIWY"
     misc_feature    208853..209185
                     /locus_tag="Rahaq2_0198"
                     /note="universal stress protein UspB; Provisional; Region:
                     PRK04960"
                     /db_xref="CDD:235323"
     gene            209189..209410
                     /locus_tag="Rahaq2_0199"
                     /note="IMG reference gene:2506707224"
                     /pseudo
                     /db_xref="GeneID:11789927"
     gene            complement(209403..210908)
                     /locus_tag="Rahaq2_0200"
                     /note="IMG reference gene:2506707225"
                     /db_xref="GeneID:11789928"
     CDS             complement(209403..210908)
                     /locus_tag="Rahaq2_0200"
                     /note="PFAM: Phosphate transporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate/sulfate permease"
                     /protein_id="YP_005198289.1"
                     /db_xref="GI:383188161"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="GeneID:11789928"
                     /translation="MLHLFAGLDIHTGSLLILALLFVLFYEAINGFHDTANAVATVIY
                     TRAMRSQLAVVMAGVFNFLGVLLGGLSVAYAIVHLLPTDLLLNVGSAHGLAMVFSMLL
                     AAIIWNLGTWYFGLPASSSHTLIGAIIGVGLTNALMTHTSVVEALNIPKMIGIFASLI
                     VSPLVGMMMAGTMIFLLRRYWSGNKKHARIHLTPAEREKKDGKKKPPFWTRIGLILSA
                     IGVSFSHGANDGQKGIGLIMLVLIGVAPAGFVLNMSATGYDITRTRDAVTHLGQYYQQ
                     HADAVPHVVALTPLVPAPDVNIAPTDEPKVFHCDSSHALDAIGRAQTLLTNLQSYNDL
                     APDERSHMRRLLMCVSDTADKVAKLPETSAADKRFLGKLKTDILQTVEYAPIWIIIAV
                     ALALALGTMIGWKRVATTIGEKIGKKGMTYAQGLSAQLTAAVSIGVASYTGMPVSTTH
                     VLSSAVAGTMIVDGGGVQSKTVKNIAMAWILTLPVSIVLSGVLYWIALKLI"
     misc_feature    complement(209406..210836)
                     /locus_tag="Rahaq2_0200"
                     /note="Phosphate/sulphate permeases [Inorganic ion
                     transport and metabolism]; Region: PitA; COG0306"
                     /db_xref="CDD:223383"
     gene            211220..212443
                     /locus_tag="Rahaq2_0201"
                     /note="IMG reference gene:2506707226"
                     /db_xref="GeneID:11789929"
     CDS             211220..212443
                     /locus_tag="Rahaq2_0201"
                     /note="PFAM: HI0933-like protein;
                     TIGRFAM: flavoprotein, HI0933 family"
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="YP_005198290.1"
                     /db_xref="GI:383188162"
                     /db_xref="InterPro:IPR004792"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023166"
                     /db_xref="GeneID:11789929"
                     /translation="MEQVDVVVIGAGAAGMFCAAQAGQGGCRVLLLDNGKKTGRKILM
                     SGGGRCNFTNLYAEPAAYLSENPHFCKSALARYTQWDFIDMVNRYGIAWHEKTLGQLF
                     CDDSAQQIVSMLDKECEQGNVDVRLRSEISDVQKTENGFVIQVNGSTVSTHSLVIASG
                     GLSMPGLGATPFGYRLAEQFGLKVLPTRAGLVPFTLHKPLLDHLQTLSGVSVPAVLTA
                     QDGTVFRESILFTHRGLSGPAVLQLSSYWQPGEFVSVNLLPDVDLAAFLNTQRQEHPN
                     QSLKNTLAMQLPKRLVECLQTLGQLPDVTLKQLNVPQQAELVEQLQNWQVQPNGTEGY
                     RTAEVTLGGVDTKALSSKTMAAAKVPGLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQ
                     DLVMFWNNKNGDLNK"
     misc_feature    211220..212401
                     /locus_tag="Rahaq2_0201"
                     /note="Predicted flavoproteins [General function
                     prediction only]; Region: COG2081"
                     /db_xref="CDD:224992"
     misc_feature    211232..>211627
                     /locus_tag="Rahaq2_0201"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            212574..212750
                     /locus_tag="Rahaq2_0202"
                     /note="IMG reference gene:2506707227"
                     /db_xref="GeneID:11789930"
     CDS             212574..212750
                     /locus_tag="Rahaq2_0202"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198291.1"
                     /db_xref="GI:383188163"
                     /db_xref="GeneID:11789930"
                     /translation="MGFIKGSLGAFAGSMAVWLSFYFIFHFETWTMRLISIFTLNAFV
                     YLVAKFLDKKFPCD"
     gene            212780..213050
                     /locus_tag="Rahaq2_0203"
                     /note="IMG reference gene:2506707228"
                     /pseudo
                     /db_xref="GeneID:11789931"
     gene            213359..214570
                     /locus_tag="Rahaq2_0204"
                     /note="IMG reference gene:2506707229"
                     /db_xref="GeneID:11793764"
     CDS             213359..214570
                     /locus_tag="Rahaq2_0204"
                     /note="PFAM: Beta-lactamase"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein, beta-lactamase class
                     C"
                     /protein_id="YP_005198292.1"
                     /db_xref="GI:383188164"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="GeneID:11793764"
                     /translation="MLPLLLTSCGTLSEMQVEENPHEVKQFACSQNPDDMVDSVAQRY
                     LHKEKSSGMAVGIIRNNGPARTWGYGYTNAVNGYKIDGETLFALGSVSKGVTGEVVAG
                     LVDKGQLKWDDKLTDLLPKNIPLSEDAKNITLLQLATHTSGLPRQNMTKNMLESFLRY
                     LYTGDNFYHELDSDAVVGDLSSFKRPLLHVPQYSNLGYALLGYILKLKTGEDIQQLSY
                     AFIFDSLKMGNTSFHASQLKAYPYRAIGHAGDQPKLIRRGEVVPDWHFSNNMVAAASL
                     YSNADDLLKYLRAHIDDSQPGDLNAAIQVTEKIYFQRKIEAANIAWVTDYKDDQVITY
                     QVGYIGGYSSYIGFDKKHKNAVVVLQNSFNWSNYMGHDLLLKMAMADDYKGTCGKETL
                     FFSPVKWGEAR"
     misc_feature    213467..214453
                     /locus_tag="Rahaq2_0204"
                     /note="Beta-lactamase; Region: Beta-lactamase; pfam00144"
                     /db_xref="CDD:249626"
     gene            complement(214572..216278)
                     /locus_tag="Rahaq2_0205"
                     /note="IMG reference gene:2506707230"
                     /db_xref="GeneID:11789932"
     CDS             complement(214572..216278)
                     /locus_tag="Rahaq2_0205"
                     /note="PFAM: Acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hemolysin"
                     /protein_id="YP_005198293.1"
                     /db_xref="GI:383188165"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11789932"
                     /translation="MFSMDTLFQDLDPQQKTPSWQRRLLKILFREKEFHRFADQYPHL
                     KGIDMAEQVLEHFNIRCELTERDREQIPSYGPVVIVANHPIGTLDGLAILHAVASVRP
                     DVKVVANQLLSLVSSLGSLMIPVDNMGNRTRRNQVTQMQEHLENQGVLIVFPAGEVSR
                     MSSKGVRDGKWHTGFIRLAAKARAPVVPVHISGSNSVLFYLSSMIYRPLSTLLLVHEM
                     FGQRGNSLTLKIGARIPYTSWHDGQMQAGDLAARFRKHLYRLGAGKPGLFHTETSIAR
                     AENRAVLKHALEASEVLGKTPDGKMIYLYRRHGEDTVPILRELGRLREIAFRAVGEGS
                     GRRRDLDGYDDDYYHLVLWDPQALEIVGAYRFIPTAEQVASKGLNGIYSQSLFQYGHQ
                     MDPILAQGIELGRSFIQPAYWGKRGLDYLWLGIGAYLAKYPQTRYLFGPVSISGGMPL
                     PARDLLVAFYRLYFSPALPLATSRRPYPASLPDVLAQFCGDDYQEDLQRLKRLLANLG
                     CSIPALYKQYSELCETGGVQFIDFGSDPDFNHCIDGLVLVDLSQLKPAKFERYIAVHQ
                     AE"
     misc_feature    complement(215505..216119)
                     /locus_tag="Rahaq2_0205"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: Unknown ACT14924;
                     Region: LPLAT_ACT14924-like; cd07986"
                     /db_xref="CDD:153248"
     misc_feature    complement(order(215805..215813,215946..215957,
                     216012..216014,216021..216023,216030..216032))
                     /locus_tag="Rahaq2_0205"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153248"
     misc_feature    complement(215013..215315)
                     /locus_tag="Rahaq2_0205"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_5; pfam13444"
                     /db_xref="CDD:257769"
     gene            216477..217703
                     /locus_tag="Rahaq2_0206"
                     /note="IMG reference gene:2506707231"
                     /db_xref="GeneID:11789933"
     CDS             216477..217703
                     /locus_tag="Rahaq2_0206"
                     /note="PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005198294.1"
                     /db_xref="GI:383188166"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11789933"
                     /translation="MPEPAAPDLASASPSKTTLRILSILVFNFANYLTIGLPLAILPG
                     YVHEHLGYSAFWAGLVISLQYFATLMSRPYAGRYADKVGPKKVVMFGLSGCLLSGVFY
                     LLALGFDAAPALSLAWLCLGRVMLGVGQSFAGTGSTLWGISVVGSLHIGKVISWSGVV
                     TYGAMAIGAPLGVLIFSVGGLTLLSVCIILVALTSLLTAWRKPPVVTKSPAQIPFRQV
                     LGKILPYGMMLALASTGFGVIATFITLFYAAKGWSGAAFSLTFFSLAFVGMRLLLPDS
                     ISRFGGLRVALACFVVEIAGLIMVFFAPAAWAAMAGAFITGVGFSLVYPALGVVAVKK
                     LPQENQGSALATYSAFLDLSLGITGPLAGVLMAQAGIDAIYLGSALLVLIAMALVVRL
                     LLRQPSSETSASVSAD"
     misc_feature    216504..217685
                     /locus_tag="Rahaq2_0206"
                     /note="major facilitator superfamily transporter;
                     Provisional; Region: PRK05122"
                     /db_xref="CDD:235348"
     misc_feature    216537..217652
                     /locus_tag="Rahaq2_0206"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(216579..216581,216588..216596,216600..216605,
                     216657..216659,216666..216671,216678..216680,
                     216690..216695,216699..216704,216864..216869,
                     216876..216881,216888..216893,216900..216902,
                     216936..216941,216948..216953,216969..216971,
                     217173..217175,217182..217187,217194..217199,
                     217206..217208,217248..217250,217260..217262,
                     217272..217274,217281..217283,217284..217286,
                     217425..217427,217434..217439,217446..217448,
                     217458..217463,217470..217472,217503..217508,
                     217515..217520,217527..217532,217539..217541)
                     /locus_tag="Rahaq2_0206"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(217700..218209)
                     /locus_tag="Rahaq2_0207"
                     /note="IMG reference gene:2506707232"
                     /db_xref="GeneID:11789934"
     CDS             complement(217700..218209)
                     /locus_tag="Rahaq2_0207"
                     /note="PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, ribosomal protein
                     N-acetylase"
                     /protein_id="YP_005198295.1"
                     /db_xref="GI:383188167"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11789934"
                     /translation="MSEIVIRHAEAADAEALQHLYAQVPVYSDTLQLPYPPATLWEDR
                     LANASPGRFALVACIDGKLVGNLTLMVEQPWRRRHVATFGIGVATQFQGRGVGSKLMA
                     AALELCDKWLQVIRVELTVYADNDAAIGLYKKFGFSVEGLSPSYAMRDGELVDTLHMG
                     RIRGVRQPV"
     misc_feature    complement(217721..218203)
                     /locus_tag="Rahaq2_0207"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    complement(217877..218047)
                     /locus_tag="Rahaq2_0207"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(217916..217921,217949..217957))
                     /locus_tag="Rahaq2_0207"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    complement(217778..>217939)
                     /locus_tag="Rahaq2_0207"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            218386..218452
                     /locus_tag="Rahaq2_0208"
                     /note="IMG reference gene:2506707233"
                     /db_xref="GeneID:11789935"
     ncRNA           218386..218452
                     /locus_tag="Rahaq2_0208"
                     /ncRNA_class="other"
                     /product="RyhB RNA"
                     /db_xref="GeneID:11789935"
     gene            218663..219031
                     /locus_tag="Rahaq2_0209"
                     /note="IMG reference gene:2506707234"
                     /db_xref="GeneID:11789936"
     CDS             218663..219031
                     /locus_tag="Rahaq2_0209"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198296.1"
                     /db_xref="GI:383188168"
                     /db_xref="GeneID:11789936"
                     /translation="MAWNRETAVSYARTHAGASSQSRCAEYTRRAIEAGGVDIGNTRH
                     AKDYGGNLERAGFRAVPPGSTLIAGDVAVIQPHPGGNQSGHMTIFDGTTWFSDFRQRS
                     MYPGPGYRAAQPSYKIYRKD"
     gene            219031..219516
                     /locus_tag="Rahaq2_0210"
                     /note="IMG reference gene:2506707235"
                     /db_xref="GeneID:11789937"
     CDS             219031..219516
                     /locus_tag="Rahaq2_0210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198297.1"
                     /db_xref="GI:383188169"
                     /db_xref="GeneID:11789937"
                     /translation="MRIFIILAVSLLAACSANTNQQAGQQVKEFYGFYLTTFAGDTPP
                     PKYDSAVMKKYIAGETLKQLGMIYKIPEQELLGSDYFTYTQDYDAAWIPALKVGEAHD
                     LMGGKVINVWLGGAPEEELLLLEVFVRKEAGTWKIYRVRDVTNNYEAPIFSAGRIQYG
                     W"
     misc_feature    219103..219462
                     /locus_tag="Rahaq2_0210"
                     /note="Protein of unknown function (DUF3828); Region:
                     DUF3828; pfam12883"
                     /db_xref="CDD:257374"
     gene            complement(219780..221630)
                     /locus_tag="Rahaq2_0211"
                     /note="IMG reference gene:2506707236"
                     /db_xref="GeneID:11789938"
     CDS             complement(219780..221630)
                     /locus_tag="Rahaq2_0211"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198298.1"
                     /db_xref="GI:383188170"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="GeneID:11789938"
                     /translation="MKTFNSVSALKNHKIRLDHNVFVNGYFQAGDGGGGHYHWDKNCV
                     LPANNGTVIRSDHSDTGRWLLIHQGVGDFRTFGILNADQPADDALDALVNDPAISQIF
                     AFSDLLFQRRHRFSRSDITLDFQNYRVFTAGIASAPVNDPFAAVLFFQGTVTGTPVTF
                     TLTETLQEQTDIFPVTDPSVFQVGDWYAVQVAAVKGAAERELQKLVEIIAIPDSTHIQ
                     IGYYNGWELLAGRVISWQKVEPVKFVTIKNMQFFGAGADQITGSHPVAFEYAVYANVA
                     GIHSTGSFWPVVMRRWNTHYLTQQCSLTNPPNTAFGGAGYLTQQIYCLYGHVSDCSVA
                     NARHLNDFTASAYCLVENCHASGQSAEKGPFVTHGQYEHDLTYTGNSGLMTFANSGAT
                     WGGSAKRINVRKHVCPWFVARTGVSELTLEDLVVIASDTIPQSGMLWVNADGLQMTGC
                     TADRTLIISQASQRAARPNLIRQCQFSLQEDGAPVVRSNVTADITFTDTVFNDINGHA
                     FDSTAPLNFVRCTFNATPEFAPLTLKSSTLSVQASQFNQVGFTLSGTEPKQIDILSST
                     LTQATLDFTAFTAQPAGSLMFLNNRLSGSAVIAQPPAGERVIWQQNVILA"
     gene            complement(221674..223770)
                     /locus_tag="Rahaq2_0212"
                     /note="IMG reference gene:2506707237"
                     /db_xref="GeneID:11789939"
     CDS             complement(221674..223770)
                     /locus_tag="Rahaq2_0212"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198299.1"
                     /db_xref="GI:383188171"
                     /db_xref="GeneID:11789939"
                     /translation="MINRRELIAGITGGVVSAGLFKSVEINPDKMICAGNIMALRNLS
                     APADRTCAVVFGYHFAGDGAPKLVYWDANSEREANQGTVISSLKTAKGRWLQLHNGVM
                     DFRQFGIVNRQNAADAALKAMVSDPLIHRIEAHTSLNFISRHRFNRSNITLDFNGQTV
                     TATGLEILAEPKDNYLSAIFSFRGLAEEQTSVSVLRDPLPLLSEIYPVEDSDLYPVGQ
                     WYCLASDKISGHWERKIQRLVQVTERIDETHIRLNYRSGWALEAQSQLHWRKVTPVNN
                     VCIQNMYYFAEGQLANSSSQPVAFEYAIYCDVLNVHAQGTFWSVIFRRWNTFFRTEQC
                     SLTNPPSVSWGGAGYLTQQIYCQYGAITDCTASNARHLNDFTACSSCVVHNCHSNGDS
                     SGAFVTHGQYEHDLRFTANSGILTLANSGESWGQSAARIVVSQHRCSMLTADTHVTDL
                     TLTDVCIYRNVEQENLGILRLNCDGLTVQNCSLSGELTLVQNSQGSIKMNVFENCGFV
                     LDPRHDSTISNLAPDDPFIVSHPAAEARNSINGRSLLYFSHCQFKGTDKDVSLLIKNK
                     EINFNACRLENVSLILTADHPQKIVINGDSTLAGDEAAGPLLSRTGEHPVTWRLGPLQ
                     SEVTGDNQLHIQITTGINHYHAHHVTFTHGKRLFTDKAFSRPSYFIEQNNIMINTASV
                     VPASTGPHIVVENTEI"
     gene            224009..224704
                     /locus_tag="Rahaq2_0213"
                     /note="IMG reference gene:2506707238"
                     /db_xref="GeneID:11789940"
     CDS             224009..224704
                     /locus_tag="Rahaq2_0213"
                     /note="PFAM: Pirin"
                     /codon_start=1
                     /transl_table=11
                     /product="Pirin-like protein"
                     /protein_id="YP_005198300.1"
                     /db_xref="GI:383188172"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="GeneID:11789940"
                     /translation="MIYLRQAQERGHASHGWLESWHTFSFADYYDAQFMGFSALRVIN
                     EDFIDAGQGFGKHPHKDMEILTYVLEGTVEHQDSMGNKEQIQAGEFQIMSAGTGVTHS
                     EYNGNSDRKLHLYQIWIIPNQKGLEPRYEQRMFDAPQGRQLVLSPDARDGSLKVFQDM
                     ELSRWALKKDEQSVYQIQAERRVWIQVVKGTVSINGQKAGPSDALAIWDETALSVHAD
                     EDSEILLFDLPPV"
     misc_feature    224009..224701
                     /locus_tag="Rahaq2_0213"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    224018..224365
                     /locus_tag="Rahaq2_0213"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     gene            complement(224768..226024)
                     /locus_tag="Rahaq2_0214"
                     /note="IMG reference gene:2506707239"
                     /db_xref="GeneID:11789941"
     CDS             complement(224768..226024)
                     /locus_tag="Rahaq2_0214"
                     /note="PFAM: Autotransporter beta-domain;
                     TIGRFAM: outer membrane autotransporter barrel domain"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane autotransporter barrel
                     domain-containing protein"
                     /protein_id="YP_005198301.1"
                     /db_xref="GI:383188173"
                     /db_xref="InterPro:IPR005546"
                     /db_xref="GeneID:11789941"
                     /translation="MPGFIYRHIIRFILLILCLPDIFIMSASAANYTAPLILTNDHNA
                     SSPKLLKKVSAGAFDYYLYKGGKTSPKDRYLRTYPEPVPLPEPEAVPDLNPAPEPTPQ
                     PIPKPVIAYRTDIVGYIAAPFLNRQYGFNSMGSYHERTGASVKHTQDGAWARVGGTHD
                     NYDIGHFSFDSDIRYVQIGKDLYQDATPRGNDVHAGVMITLGDQKTNTSDSARGLVGG
                     SADTGDISTDAYGIGGYYTLKTHEGAYLDFVGQYTAYRTDFHSESDASQDGYSVAFSA
                     EGGIPFAITQSWRLEPQTQVIYQYLHMKGFSDGIASVEKTTDSSVQARAGLRLSHLPQ
                     IDQPNITPYLNLDAVTTFSDAPAVTIGSTEISPDFTQSAWKAGGGITAPLSRNSSFYT
                     SVNYQRGFDGKQEGYRGNIGINVSFK"
     misc_feature    complement(225791..>225868)
                     /locus_tag="Rahaq2_0214"
                     /note="Pertactin-like passenger domains (virulence
                     factors) of autotransporter proteins of the type V
                     secretion system. Autotransporters are proteins used by
                     Gram-negative bacteria to transport proteins across their
                     outer membranes. The C-terminal (beta) domain...; Region:
                     PL_Passenger_AT; cl00185"
                     /db_xref="CDD:260243"
     misc_feature    complement(224813..225577)
                     /locus_tag="Rahaq2_0214"
                     /note="Autotransporter beta-domain; Region:
                     Autotransporter; smart00869"
                     /db_xref="CDD:214872"
     gene            226426..226749
                     /locus_tag="Rahaq2_0215"
                     /note="IMG reference gene:2506707240"
                     /db_xref="GeneID:11789942"
     CDS             226426..226749
                     /locus_tag="Rahaq2_0215"
                     /note="PFAM: PTS system, Lactose/Cellobiose specific IIB
                     subunit;
                     TIGRFAM: PTS system, lactose/cellobiose family IIB
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIB"
                     /protein_id="YP_005198302.1"
                     /db_xref="GI:383188174"
                     /db_xref="InterPro:IPR003501"
                     /db_xref="InterPro:IPR013012"
                     /db_xref="GeneID:11789942"
                     /translation="MKRIMLCCSAGMSTSLLVRKMKEVAAERGEEVQIDAFGASEFDE
                     KFRDYQVVLLGPQVRYMQADLSARAAEFNIPVETINMMDYGMQRGDNVLDFAFGLIAQ
                     EGSRV"
     misc_feature    226432..226716
                     /locus_tag="Rahaq2_0215"
                     /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
                     II (EII) of the N,N-diacetylchitobiose-specific and
                     lichenan-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In these systems, EII is
                     either a lichenan- or an N; Region:
                     PTS_IIB_chitobiose_lichenan; cd05564"
                     /db_xref="CDD:99906"
     misc_feature    order(226447..226449,226453..226458,226462..226467,
                     226594..226596,226675..226677)
                     /locus_tag="Rahaq2_0215"
                     /note="active site"
                     /db_xref="CDD:99906"
     misc_feature    226447..226467
                     /locus_tag="Rahaq2_0215"
                     /note="P-loop; other site"
                     /db_xref="CDD:99906"
     misc_feature    226447..226449
                     /locus_tag="Rahaq2_0215"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99906"
     gene            226746..228074
                     /locus_tag="Rahaq2_0216"
                     /note="IMG reference gene:2506707241"
                     /db_xref="GeneID:11789943"
     CDS             226746..228074
                     /locus_tag="Rahaq2_0216"
                     /note="PFAM: Phosphotransferase system, EIIC;
                     TIGRFAM: phosphotransferase system, cellobiose specific,
                     IIC component; PTS system, lactose/cellobiose family IIC
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, lactose/cellobiose family IIC
                     component"
                     /protein_id="YP_005198303.1"
                     /db_xref="GI:383188175"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR004501"
                     /db_xref="GeneID:11789943"
                     /translation="MSGLYQAMVNVIEKHITPLAGSVGQQRHVIAIRDGFIAALPFMI
                     IGSFMLVFIFPPFSPDTTLGFARGWLDLSLKYREQLMLPWYLSMGVMTFFISVGIGAS
                     LGKHYKLDPIMTGLLAFMAFLLVAAPYHDKQISTQYFSGEGIFTAILTAIYAAEVYAL
                     LKRRNITIRLPKEVPTGVARSFEILIPVVVIVATLHPLNLFIQSTTGMIIPEAIMHLL
                     APLVSASDSLPAILISVFICQVLWFAGIHGALIVTGIMNPFWMTNLALNQTALQAGAP
                     LPHIYLQGFWDHYLLIGGVGSTLPLAILLLCSKAVHLRTIGRMGVVPSFFNINEPILF
                     GTPIIMNPVFFLPFTLVPMLNAIFAYTATKLGWVAQVVSLTPWTTPAPIGASWAANWA
                     FSPVIMCLFCMVLSAVMYYPFLKAYERTLLKQEAEKATAQTAGNAVPANS"
     misc_feature    226767..228038
                     /locus_tag="Rahaq2_0216"
                     /note="Phosphotransferase system cellobiose-specific
                     component IIC [Carbohydrate transport and metabolism];
                     Region: CelB; COG1455"
                     /db_xref="CDD:224372"
     gene            228121..229503
                     /locus_tag="Rahaq2_0217"
                     /note="IMG reference gene:2506707242"
                     /db_xref="GeneID:11789944"
     CDS             228121..229503
                     /locus_tag="Rahaq2_0217"
                     /note="PFAM: Glycosyl hydrolase family 1"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-glucosidase/6-phospho-beta-
                     glucosidase/beta-galactosidase"
                     /protein_id="YP_005198304.1"
                     /db_xref="GI:383188176"
                     /db_xref="InterPro:IPR001360"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018120"
                     /db_xref="GeneID:11789944"
                     /translation="MKYAFPKEFWWGSASSAPQTEGETLSHGKSATVWDHWYSQQPTR
                     FHNDVGPQDTSTFYKNWREDIALLKQLNHNTFRTSISWARLIPNGRGDVNQEAVTFYN
                     QVIDEMLAQGVQPFINLFHFDMPMAMQEIGGWENREVVQAYAKYADTCFELFGDRVKH
                     WFTFNEPVVPVEGGYLYDFHYPNVVDFKRAATVAYHTMLAHSLAVKAYRARHLSGEIG
                     IILNLTPSYPRSQNPADLKAANIADLMFNRSFLDPALRGEYPQELVELLKKHHQLPAC
                     QQGDKELLQQGVVDLLGINYYQPRRIQCRDSMVNPESPFMPEWFFDNYVMPGRKMNPH
                     RGWEIYEQGIYDILTNLRENYGNPRCFISENGMGVEHELRFEKDGRIEDDYRIEFVSG
                     HLKWLHRALQEGSGCLGYHMWTFIDCWSWMNAYKNRYGFIQLDLETQKRTVKKSGEWF
                     AAVSKNNGFD"
     misc_feature    228121..229497
                     /locus_tag="Rahaq2_0217"
                     /note="Glycosyl hydrolase family 1; Region: Glyco_hydro_1;
                     pfam00232"
                     /db_xref="CDD:249702"
     misc_feature    228124..229494
                     /locus_tag="Rahaq2_0217"
                     /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta-
                     galactosidase [Carbohydrate transport and metabolism];
                     Region: BglB; COG2723"
                     /db_xref="CDD:225343"
     gene            229517..230434
                     /locus_tag="Rahaq2_0218"
                     /note="IMG reference gene:2506707243"
                     /db_xref="GeneID:11789945"
     CDS             229517..230434
                     /locus_tag="Rahaq2_0218"
                     /note="PFAM: Bacterial regulatory proteins, lacI family;
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198305.1"
                     /db_xref="GI:383188177"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11789945"
                     /translation="MANINDVSRLAKVSKATVSRVLSGSRGVKEESRLAVMQAVETLQ
                     YKPSVIAQSLSTQSTGCIGVICATENINQSTGYLHALEKELRLNQKYLLLRFATDAAS
                     LTHSVDEIGRGLCDAMIVIGARFPLPKLPDNVITIDCLDADSERSIHFDRSFAAETAC
                     QYVLKQGRRQIALINPESHETAGQILQGYHLALEKFLLPYDRRLVHSGADALTQLLAQ
                     NVPFNALLVPDDATAQDALRQLMQRGRAVPENVMVFSLDSTLPPGVSAVPAIAYPLET
                     LAQRAMALLTGQFSASVSAPVRGQLSLPS"
     misc_feature    229520..230371
                     /locus_tag="Rahaq2_0218"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    229532..229684
                     /locus_tag="Rahaq2_0218"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(229553..229567,229571..229576,229583..229585,
                     229598..229603,229610..229612,229649..229651,
                     229658..229660,229667..229672,229676..229681)
                     /locus_tag="Rahaq2_0218"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    229649..229678
                     /locus_tag="Rahaq2_0218"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    229700..230371
                     /locus_tag="Rahaq2_0218"
                     /note="Ligand binding domain of the LacI tanscriptional
                     regulator family belonging to the type I
                     periplasmic-binding fold protein superfamily; Region:
                     PBP1_LacI_sugar_binding_like; cd06267"
                     /db_xref="CDD:107262"
     misc_feature    order(229733..229738,229745..229747,229877..229879,
                     229928..229930,229964..229966,230285..230287,
                     230330..230332)
                     /locus_tag="Rahaq2_0218"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107262"
     misc_feature    order(229736..229744,229751..229756,229760..229765,
                     229784..229798,229802..229804,229832..229834,
                     229841..229843,229850..229858,230132..230134,
                     230216..230218,230228..230230,230237..230242)
                     /locus_tag="Rahaq2_0218"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107262"
     gene            230535..231536
                     /locus_tag="Rahaq2_0219"
                     /note="IMG reference gene:2506707244"
                     /db_xref="GeneID:11789946"
     CDS             230535..231536
                     /locus_tag="Rahaq2_0219"
                     /note="PFAM: Bacterial regulatory proteins, lacI family;
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198306.1"
                     /db_xref="GI:383188178"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11789946"
                     /translation="MNMKKKRPVLQDVADKVGVTKMTVSRYLRNPEQVSGALQEKISA
                     ALDELGYIPNRAPDILSNAKSRAIGVLLPSLTNQVFAEVLRGIESVTDIHGYQTMLAH
                     YGYSQEREEQRLTSLLSYNIDGLILSERHHTARTLKMIEVAGIPVVEMMDCVSPCVDL
                     AVGFNNFEAARQMTQQIIARGHRHVVYFGARQDERTIIKQQGYEQAMRESGLEPYSVM
                     TSRSSSYSGGAELLRQAQKDWPQIDSIFCTNDDLAAGAFFECQRQGLKIPSQMAIAGF
                     HGHNMGQAMEPPLASVLTPRERMGQISAERLLARLRGEEVVPRMVDVGFTISAGGSI"
     misc_feature    230541..231533
                     /locus_tag="Rahaq2_0219"
                     /note="gluconate operon transcriptional regulator;
                     Provisional; Region: PRK14987"
                     /db_xref="CDD:184949"
     misc_feature    230565..230702
                     /locus_tag="Rahaq2_0219"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(230565..230567,230589..230603,230607..230612,
                     230619..230621,230634..230639,230646..230648,
                     230685..230687,230694..230696)
                     /locus_tag="Rahaq2_0219"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    230685..230702
                     /locus_tag="Rahaq2_0219"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    230736..231530
                     /locus_tag="Rahaq2_0219"
                     /note="Ligand-binding domain of DNA transcription
                     repressor GntR specific for gluconate, a member of the
                     LacI-GalR family of bacterial transcription regulators;
                     Region: PBP1_GntR; cd01575"
                     /db_xref="CDD:107260"
     misc_feature    order(230769..230774,230781..230783,230916..230918,
                     230985..230987,231024..231026,231129..231131,
                     231201..231203,231363..231365,231414..231416)
                     /locus_tag="Rahaq2_0219"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107260"
     misc_feature    order(230772..230780,230787..230792,230796..230801,
                     230820..230834,230838..230840,230871..230873,
                     230880..230882,230889..230897,231210..231212,
                     231294..231296,231306..231308,231315..231320)
                     /locus_tag="Rahaq2_0219"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107260"
     gene            231691..232197
                     /locus_tag="Rahaq2_0220"
                     /note="IMG reference gene:2506707245"
                     /db_xref="GeneID:11789947"
     CDS             231691..232197
                     /locus_tag="Rahaq2_0220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198307.1"
                     /db_xref="GI:383188179"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="GeneID:11789947"
                     /translation="MKYDFQIKMIAVRHYLDGHDGFKITARKYQVPASSLRAWTAAYQ
                     FHGEQAFRKATRIYSEQFRAHVVDVTLREHLSMRSAAARFNIADYQTIKRWILAAKNS
                     AFPALKERNNMAQKTQKPEIKPEDMTPAELLEEVRYLRAERAYNEKLDALMKSKTERK
                     KKSTPSGH"
     misc_feature    231691..231951
                     /locus_tag="Rahaq2_0220"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    231847..232167
                     /locus_tag="Rahaq2_0220"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            232224..233024
                     /locus_tag="Rahaq2_0221"
                     /note="IMG reference gene:2506707246"
                     /db_xref="GeneID:11789948"
     CDS             232224..233024
                     /locus_tag="Rahaq2_0221"
                     /note="PFAM: Integrase core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005198308.1"
                     /db_xref="GI:383188180"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="GeneID:11789948"
                     /translation="MKSARLPRSTWYWWQSREQAGDDVTLCDAIGQLAIRHKRCYGYR
                     RVTLELRNQGVRVNHKKVFRLMREMDVQARVRPKKYRSYKDDIGMAPAPNLLRRKFNA
                     SGPGVKLVTDVTEFNVGGDKLYLSPVMDLYNAEIIAMSIGTRPTFELTEKMLNDLLTS
                     GYVRKKAILHSDQGWQYRMPSWQKRLKEAGIRQSMSRKGNCYDNAAMESFFAVLKTEM
                     FHGYKFESREKLAESIEAYVAYYNHDRIKMKLGGMSPADYRTQMFPLH"
     misc_feature    232236..232994
                     /locus_tag="Rahaq2_0221"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     misc_feature    232287..232460
                     /locus_tag="Rahaq2_0221"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    232524..232877
                     /locus_tag="Rahaq2_0221"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    232845..233012
                     /locus_tag="Rahaq2_0221"
                     /note="Integrase core domain; Region: rve_2; pfam13333"
                     /db_xref="CDD:257663"
     gene            complement(233075..233590)
                     /locus_tag="Rahaq2_0222"
                     /note="IMG reference gene:2506707247"
                     /db_xref="GeneID:11789949"
     CDS             complement(233075..233590)
                     /locus_tag="Rahaq2_0222"
                     /note="PFAM: Shikimate kinase;
                     TIGRFAM: carbohydrate kinase, thermoresistant glucokinase
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="thermoresistant glucokinase family carbohydrate
                     kinase"
                     /protein_id="YP_005198309.1"
                     /db_xref="GI:383188181"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="GeneID:11789949"
                     /translation="MAGQSIILMGVSGSGKSTVGAALAREINAKFIDGDDLHPRANIQ
                     KMASGTPLNDDDRAPWLLRLNDAAYSLRHKNETGIIVCSALKRRYRDALRKDNEGMVF
                     IYMKGSFEVIAERLKARAGHFMPTDLLRSQFDALEEPGEDEPDVLRVNIDHKFEGVVD
                     RCIAALKTVQK"
     misc_feature    complement(233138..233575)
                     /locus_tag="Rahaq2_0222"
                     /note="Gluconate kinase (GntK) catalyzes the phosphoryl
                     transfer from ATP to gluconate. The resulting product
                     gluconate-6-phoshate is an important precursor of
                     gluconate metabolism. GntK acts as a dimmer composed of
                     two identical subunits; Region: GntK; cd02021"
                     /db_xref="CDD:238979"
     misc_feature    complement(233174..233575)
                     /locus_tag="Rahaq2_0222"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     misc_feature    complement(order(233234..233236,233246..233248,
                     233486..233488,233492..233494,233540..233563))
                     /locus_tag="Rahaq2_0222"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238979"
     misc_feature    complement(order(233234..233236,233552..233557))
                     /locus_tag="Rahaq2_0222"
                     /note="Gluconate-6-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238979"
     gene            233836..235152
                     /locus_tag="Rahaq2_0223"
                     /note="IMG reference gene:2506707248"
                     /db_xref="GeneID:11789950"
     CDS             233836..235152
                     /locus_tag="Rahaq2_0223"
                     /note="PFAM: GntP family permease;
                     TIGRFAM: gluconate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate transporter"
                     /protein_id="YP_005198310.1"
                     /db_xref="GI:383188182"
                     /db_xref="InterPro:IPR003474"
                     /db_xref="GeneID:11789950"
                     /translation="MPLVIVAVGVALLLLLMIRFKLNGFIALILVALAVGIMQGMPVD
                     KVITSIKNGVGGTLGSLALIMGFGAMLGKMLADCGGAQRIATTLIEKFGREHIQWAIV
                     LTGFIVGFALFYEVGFVLMLPLVFTVAAAARLPLLYVGVPMAAALSVTHGFLPPHPGP
                     TAIATIFHADMGKTLLFGSLLAVPTVILAGPVYARFLKGIDKPVPEGLFNPKTFTEEE
                     MPGFGVSVATSLVPVILMAFRALCEMILPKGHPVLAYAEFFGDPVMATLIAVLIAIFT
                     FGLNRGRKMEDVMATVTDSIKIIAMMLLIIGGGGAFKQVLVDSGIEKYIAALMHGSTL
                     SPILLAWSIAAVLRIALGSATVAAITAGGIAAPLIATTGVSPELMVIAVGSGSVIFSH
                     VNDPGFWLFKEYFNLSIVETFKSWSVLETIISLCGLAGCLLLSMVV"
     misc_feature    233836..235149
                     /locus_tag="Rahaq2_0223"
                     /note="high-affinity gluconate transporter; Provisional;
                     Region: PRK14984"
                     /db_xref="CDD:237880"
     misc_feature    233836..235146
                     /locus_tag="Rahaq2_0223"
                     /note="GntP family permease; Region: GntP_permease;
                     pfam02447"
                     /db_xref="CDD:251299"
     gene            complement(235215..235808)
                     /locus_tag="Rahaq2_0224"
                     /note="IMG reference gene:2506707249"
                     /db_xref="GeneID:11789951"
     CDS             complement(235215..235808)
                     /locus_tag="Rahaq2_0224"
                     /note="PFAM: MarC family integral membrane protein;
                     TIGRFAM: membrane protein, MarC family"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein, MarC family"
                     /protein_id="YP_005198311.1"
                     /db_xref="GI:383188183"
                     /db_xref="InterPro:IPR002771"
                     /db_xref="GeneID:11789951"
                     /translation="MTEMISATILLFLIMDPLGNLPIFMSVLKHLDPKRRRVVLIREM
                     LIALILMLIFLFAGEKILSFLNLRTETVSISGGIILFLIAIKMIFPSEEKSSSGLPAG
                     EEPFLVPMAIPLVAGPSILATLMLLSHQYPNQMSHLTLALFIAWGMSMAILLLSNLFL
                     RLLGDKGVSALERLMGLILVMLSTQMFLDGIRAYLKI"
     misc_feature    complement(235218..235808)
                     /locus_tag="Rahaq2_0224"
                     /note="putative antibiotic transporter; Provisional;
                     Region: PRK10739"
                     /db_xref="CDD:170674"
     gene            236019..237122
                     /locus_tag="Rahaq2_0225"
                     /note="IMG reference gene:2506707250"
                     /db_xref="GeneID:11789952"
     CDS             236019..237122
                     /locus_tag="Rahaq2_0225"
                     /note="PFAM: Semialdehyde dehydrogenase, dimerisation
                     domain; Semialdehyde dehydrogenase, NAD binding domain;
                     TIGRFAM: aspartate-semialdehyde dehydrogenase,
                     gamma-proteobacterial"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="YP_005198312.1"
                     /db_xref="GI:383188184"
                     /db_xref="InterPro:IPR000319"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR012080"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11789952"
                     /translation="MKNVGFVGWRGMVGSVLMQRMIEERDFDAIRPVFFSTSQHGQAA
                     PSFTGQSGTLQDAYDLDALSALDIIITCQGGDYTNEIYPKLREIGWSGYWIDAASSLR
                     MEDDAIIILDPVNSAVIHQGIDKGIKTFVGGNCTVSLMLMSLGGLFAHDLIEWASVAT
                     YQAASGGGARHMRELLTQMGMLHNSVAKELENPASAILDIERKVTALTRSGTLPTDNF
                     GVPLAGGLIPWIDKQLDNGQTKEEWKGQAETNKILGTSSIIPVDGLCVRIGALRCHSQ
                     AFTLKLKQDVSIPEIEQMLASHNDWVRVIPNDRELSMRELTPAAVTGTMSTPVGRLRK
                     LNMGPQYLSAFTVGDQLLWGAAEPLRRMLRILL"
     misc_feature    236019..237119
                     /locus_tag="Rahaq2_0225"
                     /note="aspartate-semialdehyde dehydrogenase; Reviewed;
                     Region: PRK06598"
                     /db_xref="CDD:235839"
     misc_feature    236025..236381
                     /locus_tag="Rahaq2_0225"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; pfam01118"
                     /db_xref="CDD:250373"
     misc_feature    236448..237077
                     /locus_tag="Rahaq2_0225"
                     /note="Semialdehyde dehydrogenase, dimerization domain;
                     Region: Semialdhyde_dhC; pfam02774"
                     /db_xref="CDD:251521"
     gene            237534..239717
                     /locus_tag="Rahaq2_0226"
                     /note="IMG reference gene:2506707251"
                     /db_xref="GeneID:11789953"
     CDS             237534..239717
                     /locus_tag="Rahaq2_0226"
                     /note="PFAM: Alpha amylase, C-terminal all-beta domain;
                     Carbohydrate-binding module 48 (Isoamylase N-terminal
                     domain); Alpha amylase, catalytic domain;
                     TIGRFAM: alpha-1,4-glucan:alpha-1,4-glucan
                     6-glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-1,4-glucan:alpha-1,4-glucan
                     6-glycosyltransferase"
                     /protein_id="YP_005198313.1"
                     /db_xref="GI:383188185"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006048"
                     /db_xref="InterPro:IPR006407"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11789953"
                     /translation="MSVLPDQHVINQIISGHYADPFSLLGMHSVAAGLEVRALLPDAD
                     QVWVIDVEKGKQVAELRRYDDRGFFVGLIPRRKNAFRYKLEVRWGENLQVIDDPYRFG
                     TLLQELDIWLLAEGTHLRPYEKLGAHLQTLDDVEGVSFAVWAPNAMRVSVVGEFNFWD
                     GRRHPMRQRRENGIWELFIPAVREGQLYKFEIIDCRGQISLRADPYAFEAQMRPDTAS
                     CVRKLPDVVPHSESRKKANALNQPVSVYEVHLGSWRRHADDNFWLSYGELAEQLVSYA
                     KWMGFTHIELMPVNEHPFDGSWGYQPLGMYAPTRRFGTPMEFKAFVEAAHHAGLNVIL
                     DWVPGHFPSDTYGLAQFDGTALYEYADPREGYHQDWNTLIYNYGRHEVRNYLAGNGFY
                     WIERFGIDGLRVDAVASMIYRDYSRKAGEWIPNYYGGRENLEAISFLKYTNQTIGREL
                     GGAVTLAEESTDYPGVTMPPDANGLGFHYKWNMGWMHDSLTYMQLDPVHRKYHHNLMT
                     FGVLYAYSENFILPLSHDEVVHGKKSLLDKMPGDVWQKFANLRAYYGFMWAHPGKKLL
                     FMGNEFAQGREWNFDASLDWHLLDDPGGWHSGVQHLVRDLNLTYRANAPLYELDYNPR
                     GFEWLVVDDHENSIFAFARRDENGGEVIVISNFTPVPREHYRIGISRPGCYHEILNTD
                     SHFYRGSNVGNGGDVYSENIGHHQREHSISVTIPPLATVYLRREA"
     misc_feature    237546..239714
                     /locus_tag="Rahaq2_0226"
                     /note="glycogen branching enzyme; Provisional; Region:
                     PRK05402"
                     /db_xref="CDD:235445"
     misc_feature    237885..238187
                     /locus_tag="Rahaq2_0226"
                     /note="N-terminal Early set domain associated with the
                     catalytic domain of prokaryotic glycogen branching enzyme;
                     Region: E_set_GBE_prok_N; cd02855"
                     /db_xref="CDD:199885"
     misc_feature    238167..239369
                     /locus_tag="Rahaq2_0226"
                     /note="Alpha amylase catalytic domain found in the
                     Glycogen branching enzyme (also called 1,4-alpha-glucan
                     branching enzyme); Region: AmyAc_Glg_BE; cd11322"
                     /db_xref="CDD:200461"
     misc_feature    order(238740..238742,238746..238751,238905..238907,
                     239106..239111)
                     /locus_tag="Rahaq2_0226"
                     /note="active site"
                     /db_xref="CDD:200461"
     misc_feature    order(238746..238748,238905..238907,239109..239111)
                     /locus_tag="Rahaq2_0226"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200461"
     misc_feature    239415..239714
                     /locus_tag="Rahaq2_0226"
                     /note="Alpha amylase, C-terminal all-beta domain; Region:
                     Alpha-amylase_C; pfam02806"
                     /db_xref="CDD:251542"
     gene            239717..241741
                     /locus_tag="Rahaq2_0227"
                     /note="IMG reference gene:2506707252"
                     /db_xref="GeneID:11789954"
     CDS             239717..241741
                     /locus_tag="Rahaq2_0227"
                     /note="PFAM: Alpha amylase, catalytic domain;
                     Carbohydrate-binding module 48 (Isoamylase N-terminal
                     domain);
                     TIGRFAM: glycogen debranching enzyme GlgX"
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen debranching protein GlgX"
                     /protein_id="YP_005198314.1"
                     /db_xref="GI:383188186"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11789954"
                     /translation="MKQPAPGLPAPFGAHLRDNGVNFCLYSAHAEKVELCLFDETGSE
                     QHLPLTGRTGNLWHGFVPDLKAGQRYGYRIYGPFDPKKGHRFNPKKVLIDPSARAIDG
                     VLLDNARFTGGTDAPDDKDSAVVAPKSVVVAGNFNWGDDKPPATPWGETVIYEAHVRG
                     LTRQHPHIPAAIRGTYAGLAHPVMLEYLQHLGVTAIELLPVQHHADEPRLQRLGLSNY
                     WGYNVLAPCAVEPRYASGSGGVSALNEFKSAVKALHQAGIEVILDVVFNHSAELDIDG
                     PFISFRGIDNASYYWLNEDGSDNNMTGCGNTLRLMDDEVIAWTIDCLHYWVRECHVDG
                     FRFDLATVLGRTPEFSAQSPLFNAIKQDATLSQVKLIAEPWDIGTGGYQLGNFPAPFA
                     EWSDIWRDDMRQFWLHGDTSLGQFAGRFAASADKFNPAQREPCASVNMLTAHDGFTLR
                     DLVSFNQKHNQANGEENRDGHNENFSQNHGEEGLAASAQVLQQRRLSQRALLATLFLS
                     QGTPMLLAGDELGNSQSGNNNAYCQDNPLTWLDWENADDSLTAYTCALIALRRKIPAL
                     TQNRWWQEGGDDVQWLNQQGQPMSPGDWEQGPQQWLQICLSQRWLVIVNASLHEVDLH
                     LPPGNWQPVAPFNSVLFDEEPRRVMEGSQWRAAAKTLCVLQDFTPQSRSL"
     misc_feature    239717..241711
                     /locus_tag="Rahaq2_0227"
                     /note="glycogen debranching enzyme; Provisional; Region:
                     PRK03705"
                     /db_xref="CDD:235152"
     misc_feature    239747..240115
                     /locus_tag="Rahaq2_0227"
                     /note="N-terminal Early set domain associated with the
                     catalytic domain of Glycogen debranching enzyme and
                     bacterial isoamylase (also called glycogen
                     6-glucanohydrolase); Region: E_set_GDE_Isoamylase_N;
                     cd02856"
                     /db_xref="CDD:199886"
     misc_feature    240122..241405
                     /locus_tag="Rahaq2_0227"
                     /note="Alpha amylase catalytic domain found in glycogen
                     debranching enzymes; Region: AmyAc_Glg_debranch; cd11326"
                     /db_xref="CDD:200465"
     misc_feature    order(240722..240724,240728..240733,240833..240835,
                     241046..241051)
                     /locus_tag="Rahaq2_0227"
                     /note="active site"
                     /db_xref="CDD:200465"
     misc_feature    order(240728..240730,240833..240835,241049..241051)
                     /locus_tag="Rahaq2_0227"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200465"
     gene            241759..243036
                     /locus_tag="Rahaq2_0228"
                     /note="IMG reference gene:2506707253"
                     /db_xref="GeneID:11789955"
     CDS             241759..243036
                     /locus_tag="Rahaq2_0228"
                     /note="PFAM: Nucleotidyl transferase;
                     TIGRFAM: glucose-1-phosphate adenylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="YP_005198315.1"
                     /db_xref="GI:383188187"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR005836"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR023049"
                     /db_xref="GeneID:11789955"
                     /translation="MATLDNRDPVMLARQLPLKSVALILAGGRGSRLKDLTATRAKPA
                     VHFGGKFRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLL
                     PAQQRHSTEHWYKGTADAVYQNLDIIRRYNAEFVVILAGDHIYKMDYSRMLIDHVQKG
                     GECTVACLEVPRAEASEFGVIGVTEDYHITSFVEKPKDPPPMPGNPDMALASMGIYIF
                     NADYLFRMLEEDMASEESSHDFGKDLIPKLTRQGVARAHPFGLSCVTQNDEAPPYWRD
                     VGTLDAYWRANLDLASVTPELDMYDRDWPIRTHMEPLPPAKFVQDRSGSHGMTMNSLV
                     AGGVIVSGSVVVHSVLFPRVRVNSFCNIDSAIILPDVNVGRSCRLRKCVIDRACQIPE
                     GMVIGENADEDSRRFYRSEGGVVLVTRAMLAKL"
     misc_feature    241780..243033
                     /locus_tag="Rahaq2_0228"
                     /note="glucose-1-phosphate adenylyltransferase;
                     Provisional; Region: glgC; PRK00725"
                     /db_xref="CDD:234824"
     misc_feature    241822..242589
                     /locus_tag="Rahaq2_0228"
                     /note="ADP-glucose pyrophosphorylase is involved in the
                     biosynthesis of glycogen or starch; Region:
                     ADP_Glucose_PP; cd02508"
                     /db_xref="CDD:133002"
     misc_feature    order(241831..241833,241837..241842,242101..242103,
                     242107..242109,242179..242184,242473..242475,
                     242479..242484)
                     /locus_tag="Rahaq2_0228"
                     /note="ligand binding site; other site"
                     /db_xref="CDD:133002"
     misc_feature    order(241990..241992,241999..242001,242056..242058,
                     242065..242067,242074..242076,242128..242130,
                     242134..242136,242146..242151)
                     /locus_tag="Rahaq2_0228"
                     /note="oligomer interface; other site"
                     /db_xref="CDD:133002"
     misc_feature    <242806..243024
                     /locus_tag="Rahaq2_0228"
                     /note="Glucose-1-phosphate adenylyltransferase, C-terminal
                     Left-handed parallel beta helix (LbH) domain:
                     Glucose-1-phosphate adenylyltransferase is also known as
                     ADP-glucose synthase or ADP-glucose pyrophosphorylase. It
                     catalyzes the first committed and...; Region:
                     LbH_G1P_AT_C; cd04651"
                     /db_xref="CDD:100056"
     misc_feature    order(242911..242916,243013..243015)
                     /locus_tag="Rahaq2_0228"
                     /note="sulfate 1 binding site; other site"
                     /db_xref="CDD:100056"
     gene            243108..244544
                     /locus_tag="Rahaq2_0229"
                     /note="IMG reference gene:2506707254"
                     /db_xref="GeneID:11789956"
     CDS             243108..244544
                     /locus_tag="Rahaq2_0229"
                     /note="PFAM: Starch synthase catalytic domain; Glycosyl
                     transferases group 1;
                     TIGRFAM: glycogen/starch synthases, ADP-glucose type"
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen/starch synthase"
                     /protein_id="YP_005198316.1"
                     /db_xref="GI:383188188"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR011835"
                     /db_xref="InterPro:IPR013534"
                     /db_xref="GeneID:11789956"
                     /translation="MQVLHVCSELFPLLKTGGLADVAGALPAAQIAEGADVRVLIPAF
                     PDVKKGLGETQVIGTLATFAGHVTLSLGYFDGVGIYLIDVPGLYDRPGSPYHDQSSFA
                     YPDNHLRFALLSWMACELALNFDPHWKPDIVHSHDWHAGLCSAYIRARNAPVRTVFTV
                     HNLAFQGLFGAHHLDELYIPREFFQMHGLEFYGQISFLKAGLFYSDHVTTVSPTYAKE
                     ITRPEFGYGMESLLLEREMQGRLTGILNGVDEAIWQPRDDVLLSARYDAEDLRSKAVN
                     KAYLQRAMGLDVDDSRLVFAVVSRLTSQKGLDLVLEALPDLLERGGQLALLGAGDAVL
                     QQAFLAAAADNPGQVGVQLGYHEAFSHRIIGGADVIMVPSRFEPCGLTQLYGLKYGTL
                     PLVRRTGGLADTVVDCALENLADGTASGFVFEEATGKSLGNAIRRAFVLWSRPKHWRH
                     VQQHAMGIDFGWKVAAQEYLTLYNRLLS"
     misc_feature    243108..244541
                     /locus_tag="Rahaq2_0229"
                     /note="glycogen synthase; Provisional; Region: glgA;
                     PRK00654"
                     /db_xref="CDD:234809"
     misc_feature    243111..244532
                     /locus_tag="Rahaq2_0229"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. Glycogen synthase
                     catalyzes the formation and elongation of the
                     alpha-1,4-glucose backbone using ADP-glucose, the second
                     and key step of glycogen biosynthesis. This family...;
                     Region: GT1_Glycogen_synthase_DULL1_like; cd03791"
                     /db_xref="CDD:99965"
     misc_feature    order(243150..243152,243159..243161,243999..244007,
                     244167..244172,244185..244187,244236..244238,
                     244251..244253)
                     /locus_tag="Rahaq2_0229"
                     /note="ADP-binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99965"
     misc_feature    order(243756..243758,244296..244298,244311..244316,
                     244320..244322,244404..244406)
                     /locus_tag="Rahaq2_0229"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99965"
     gene            244582..247029
                     /locus_tag="Rahaq2_0230"
                     /note="IMG reference gene:2506707255"
                     /db_xref="GeneID:11789957"
     CDS             244582..247029
                     /locus_tag="Rahaq2_0230"
                     /note="PFAM: Carbohydrate phosphorylase;
                     TIGRFAM: glycogen/starch/alpha-glucan phosphorylases"
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen/starch/alpha-glucan phosphorylase"
                     /protein_id="YP_005198317.1"
                     /db_xref="GI:383188189"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="GeneID:11789957"
                     /translation="MTSPFNYNSPTVSVEALKHSIAYKLMFIIGKDPSIATQHDWLNA
                     TLFAVRDRMVERWLRSNRAQTSQDVRQVYYLSMEFLIGRTLSNALLAMGIYDDLKSAL
                     DEMGFDLEELIGEENDPGLGNGGLGRLAACFLDSLATLALPGRGYGIRYEYGMFAQSI
                     INGEQKEAPDYWLEYGNPWEFQRYNTRYKVRFGGRVQHEGIKTRWLETEEVIACAYDQ
                     VIPGYDTDATNTLRLWGAQASNEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTY
                     SGRELRLRQEYFLVSATVQDILNRHYTTHHTYDNLADKIAIHLNDTHPVLSIPELMRL
                     LIDEHKFEWQAAWETVCSVFSYTNHTLMSEALETWPVDMIGKILPRHLEIIFQINDHF
                     LKEVAEKIPNDNGLLSRVSIIDEGNGRKVRMAWLAVIASHKVNGVSELHSELMVQSLF
                     ADFARIYPDRFCNKTNGVTPRRWLALANKPLSAVIDDAIGQTWRSDLSQLAELKQNLD
                     YLSFLQAIRKAKLDNKKRLALYIAQKLNIVVDPKSLFDVQIKRIHEYKRQLMNVLHVI
                     TRYNRILDEPEADWVPRTVIFAGKAASAYYAAKQIIRLINDVATVINNDPRMGNKLKI
                     VFIPNYSVSLAQLIIPAADLSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEML
                     EHVGEENIFIFGNTTPQVEELRRKGYNPHTYFEQDAELHQVLTQIATGVFSPGEPKRY
                     TNLFDTLVNLGDHYQVLADYRSYVDTQDKVDELYKLPEEWTRRTLHNIANMGYFSSDR
                     TIQEYADEIWNIKPVKL"
     misc_feature    244582..247026
                     /locus_tag="Rahaq2_0230"
                     /note="glycogen phosphorylase; Provisional; Region:
                     PRK14986"
                     /db_xref="CDD:184948"
     misc_feature    244633..247011
                     /locus_tag="Rahaq2_0230"
                     /note="This is a family of oligosaccharide phosphorylases.
                     It includes yeast and mammalian glycogen phosphorylases,
                     plant starch/glucan phosphorylase, as well as the
                     maltodextrin phosphorylases of bacteria. The members of
                     this family catalyze the breakdown of...; Region:
                     GT1_Glycogen_Phosphorylase; cd04300"
                     /db_xref="CDD:99996"
     misc_feature    order(244633..244635,244639..244641,244645..244650,
                     244654..244662,244729..244737,245128..245130,
                     245395..245397,245404..245406)
                     /locus_tag="Rahaq2_0230"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99996"
     misc_feature    order(244813..244815,244819..244821,245389..245391,
                     245398..245400,245404..245406,245425..245427,
                     245542..245544,245548..245550,245656..245661,
                     245671..245673,245977..245979,245998..246000,
                     246229..246234,246238..246249,246349..246351,
                     246364..246366,246370..246372,246472..246477,
                     246541..246543,246547..246558,246565..246567)
                     /locus_tag="Rahaq2_0230"
                     /note="active site pocket [active]"
                     /db_xref="CDD:99996"
     gene            complement(247263..248774)
                     /locus_tag="Rahaq2_0231"
                     /note="IMG reference gene:2506707256"
                     /db_xref="GeneID:11789958"
     CDS             complement(247263..248774)
                     /locus_tag="Rahaq2_0231"
                     /note="PFAM: FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="YP_005198318.1"
                     /db_xref="GI:383188190"
                     /db_xref="InterPro:IPR000447"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:11789958"
                     /translation="METKDLIVIGGGINGTGIAVDAAGRGLSVLLLEAQDLACATSSA
                     SSKLIHGGLRYLEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHQPHLRPAWMIR
                     AGLFLYDHLGKRTSLPASKGLKFGSESVLKPELTKGFEYSDCWVDDARLVVVNAQEVE
                     ERGGEVRTRTRVTRAWREDGLWMVEAEDIDTGKTFTWRAKGLVNATGPWVKHFFDDGL
                     KLKSPYGIRLIKGSHIVVPRAHNQPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYH
                     GDPKDVKIDDKEVGYLLKVYNDHFKKQLTTEDIVWTYSGVRPLCDDESDSPQAVTRDY
                     TLDVHDQDGKAPLLSVFGGKLTTYRKLAEHALEKLVKYYPKAGPAWTKTAVLPGGKLN
                     GDRDTYSASLRTRFKWLPESLARRYARTYGSQTELFLNEATSLESLGEDFGHGFYEAE
                     LRYLVEKEWVSQLDDAIWRRTKLGMWLDKAQQQRIAEWLETHKQQKKHLSLAS"
     misc_feature    complement(247281..248720)
                     /locus_tag="Rahaq2_0231"
                     /note="glycerol-3-phosphate dehydrogenase; Reviewed;
                     Region: glpD; PRK12266"
                     /db_xref="CDD:237027"
     misc_feature    complement(247305..248720)
                     /locus_tag="Rahaq2_0231"
                     /note="Glycerol-3-phosphate dehydrogenase [Energy
                     production and conversion]; Region: GlpA; COG0578"
                     /db_xref="CDD:223651"
     gene            complement(249048..249806)
                     /locus_tag="Rahaq2_0232"
                     /note="IMG reference gene:2506707257"
                     /db_xref="GeneID:11789959"
     CDS             complement(249048..249806)
                     /locus_tag="Rahaq2_0232"
                     /note="PFAM: Bacterial regulatory proteins, deoR family;
                     DeoR-like helix-turn-helix domain"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar metabolism transcriptional regulator"
                     /protein_id="YP_005198319.1"
                     /db_xref="GI:383188191"
                     /db_xref="InterPro:IPR001034"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014036"
                     /db_xref="InterPro:IPR018356"
                     /db_xref="GeneID:11789959"
                     /translation="MKQTQRHDAIIDLVRQQGYVSTEELVEHFAVSPQTIRRDLNDLA
                     EQNKIHRHHGGAALPSSSVNAAYNDRKVMWSEAKARIAERVASQIPDGSTLFIDIGTT
                     PEAVAHALLNHKNLRIVTNNLNVATLLTAKEDFRLFLAGGEVRARDGGIMGEATLDFI
                     SQFRLDYGILGISGIDMDGSLLEFDYHEARTKRAIIENSRCVMLVTDHSKFGRNAMVN
                     LGKMDLIHYLFTDKQPPDSVKQIIDKYDVHLELC"
     misc_feature    complement(249051..249806)
                     /locus_tag="Rahaq2_0232"
                     /note="DNA-binding transcriptional repressor GlpR;
                     Provisional; Region: PRK10906"
                     /db_xref="CDD:182827"
     misc_feature    complement(249624..249791)
                     /locus_tag="Rahaq2_0232"
                     /note="DeoR-like helix-turn-helix domain; Region:
                     HTH_DeoR; pfam08220"
                     /db_xref="CDD:116806"
     misc_feature    complement(249111..249584)
                     /locus_tag="Rahaq2_0232"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            complement(249816..250649)
                     /locus_tag="Rahaq2_0233"
                     /note="IMG reference gene:2506707258"
                     /db_xref="GeneID:11789960"
     CDS             complement(249816..250649)
                     /locus_tag="Rahaq2_0233"
                     /note="PFAM: Protein of unknown function (DUF3582);
                     Rhomboid family"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="YP_005198320.1"
                     /db_xref="GI:383188192"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="InterPro:IPR022732"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="GeneID:11789960"
                     /translation="MVRILNLNNPRLAQAFVDYMATQGFTLTMKHESQEVQLWLEDES
                     RLEEAEKQVALFVRDPLHPRYQEASWKTGKAQPHLKMSHTPFLKTLRSRAGPLTIGMI
                     VLSLAVFILQQMVGDELVMSWLAWPDSSRVFQLWRWFTPALMNFSFIALLINLAWWWY
                     LASQIEMHLGSGKLFTVTLISALISGWGQSMVSGSWFGGLSGVVYALMGYAWLTGQLK
                     PESRLYVPGGLLVISLIFMFIGYATGGAAVSNAAHAFGLGLGLVMAFVDTRTPRNKKS
                     K"
     misc_feature    complement(249825..250649)
                     /locus_tag="Rahaq2_0233"
                     /note="intramembrane serine protease GlpG; Provisional;
                     Region: PRK10907"
                     /db_xref="CDD:182828"
     misc_feature    complement(250356..250649)
                     /locus_tag="Rahaq2_0233"
                     /note="Protein of unknown function (DUF3582); Region:
                     DUF3582; pfam12122"
                     /db_xref="CDD:256859"
     misc_feature    complement(249828..250373)
                     /locus_tag="Rahaq2_0233"
                     /note="Membrane associated serine protease [Amino acid
                     transport and metabolism]; Region: COG0705"
                     /db_xref="CDD:223777"
     gene            complement(250949..252139)
                     /locus_tag="Rahaq2_0234"
                     /note="IMG reference gene:2506707259"
                     /db_xref="GeneID:11789961"
     CDS             complement(250949..252139)
                     /locus_tag="Rahaq2_0234"
                     /note="PFAM: Cys/Met metabolism PLP-dependent enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase/cystathionine
                     gamma-synthase"
                     /protein_id="YP_005198321.1"
                     /db_xref="GI:383188193"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11789961"
                     /translation="MKNLNTSRSLGMRTLAVHGGQQPDALTGAIATPITAASAFSYPD
                     FDSGARRFSGEEPGYIYSRFANPTVAVFEQKLAALEGAETAVACASGMAAISATLFAL
                     LVPGDEIIHIGTLYGGTEGVVRNLLPRYGIKPVHVANVNELEAAFTKNTKVVLVETPA
                     NPGLDIADLAEIARLSTAAGAVSVADNTFATPYLTRPLELGIDIVLHSATKYISGHGD
                     ATGGVVAGSAALITPIRTLSLKQFGGNLGPFEASLLIRGLKTLPLRVEASSLSAQAVA
                     EFLDGHSAVDTVFYPGLKQHPGHATASRQMKLFGGIMAIELKGGLNAARTFLDKLSII
                     TQAVSLGDTDSLACHPASTTHSAVAPEVRRQSGITDGLVRISIGIEDTADLIADLQQA
                     LEGL"
     misc_feature    complement(250958..252058)
                     /locus_tag="Rahaq2_0234"
                     /note="CGS_like: Cystathionine gamma-synthase is a PLP
                     dependent enzyme and catalyzes the committed step of
                     methionine biosynthesis. This pathway is unique to
                     microorganisms and plants, rendering the enzyme an
                     attractive target for the development of...; Region:
                     CGS_like; cd00614"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(251153..251155,251390..251395,
                     251399..251401,251432..251434,251480..251482,
                     251486..251488,251510..251512,251768..251770,
                     251777..251779,251792..251794,251861..251866,
                     251870..251875,251951..251953,251957..251959,
                     252014..252019,252023..252034))
                     /locus_tag="Rahaq2_0234"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(251480..251482,251507..251512,
                     251516..251518,251582..251584,251669..251671,
                     251792..251794,251864..251872))
                     /locus_tag="Rahaq2_0234"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(251507..251512,251516..251518,
                     251573..251575,251582..251584,251792..251794,
                     251864..251872))
                     /locus_tag="Rahaq2_0234"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99738"
     misc_feature    complement(251507..251509)
                     /locus_tag="Rahaq2_0234"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99738"
     gene            complement(252282..252602)
                     /locus_tag="Rahaq2_0235"
                     /note="IMG reference gene:2506707260"
                     /db_xref="GeneID:11789962"
     CDS             complement(252282..252602)
                     /locus_tag="Rahaq2_0235"
                     /note="PFAM: Rhodanese-like domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhodanese-related sulfurtransferase"
                     /protein_id="YP_005198322.1"
                     /db_xref="GI:383188194"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:11789962"
                     /translation="MEQFEAISVEQARNRLTSGEAVMVDIRDPQSFSAAHAPGAWHLS
                     NDSLPAFIQQTDAKTPVLVMCYHGISSRGAAQFLISQGFESVYSVDGGFEAWSQTFPQ
                     DIEA"
     misc_feature    complement(252315..252587)
                     /locus_tag="Rahaq2_0235"
                     /note="GlpE sulfurtransferase (ST) and homologs are
                     members of the Rhodanese Homology Domain superfamily.
                     Unlike other rhodanese sulfurtransferases, GlpE is a
                     single domain protein but indications are that it
                     functions as a dimer. The active site contains a...;
                     Region: GlpE_ST; cd01444"
                     /db_xref="CDD:238721"
     misc_feature    complement(252408..252410)
                     /locus_tag="Rahaq2_0235"
                     /note="active site residue [active]"
                     /db_xref="CDD:238721"
     gene            complement(252687..253442)
                     /locus_tag="Rahaq2_0236"
                     /note="IMG reference gene:2506707261"
                     /db_xref="GeneID:11789963"
     CDS             complement(252687..253442)
                     /locus_tag="Rahaq2_0236"
                     /note="PFAM: Bacterial regulatory proteins, deoR family;
                     DeoR-like helix-turn-helix domain"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar metabolism transcriptional regulator"
                     /protein_id="YP_005198323.1"
                     /db_xref="GI:383188195"
                     /db_xref="InterPro:IPR001034"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014036"
                     /db_xref="InterPro:IPR018356"
                     /db_xref="GeneID:11789963"
                     /translation="MTEPQRHNAILDLLQRQGQISVADVIDNFDISPATARRDITKLN
                     ELGKLRKVRNGAEAVNQPRQNWTPLNIHQTHNLNEKMRIAKAAAGLCQPGESVVINCG
                     STAFLLGREMCGKDIQVITNYLPLANYLIEQEHDSVVIMGGQYNKSQSITLAPQDGDA
                     SLYAGHWMFTSGAGLTSDGLYKTDMLTAMAEQKMLNYVGNLAVLVDSSKIGQRAGMLF
                     SRTEQIDVLITGKEANEEIIGQLRQKGVEVILV"
     misc_feature    complement(252690..253442)
                     /locus_tag="Rahaq2_0236"
                     /note="transcriptional repressor UlaR; Provisional;
                     Region: PRK13509"
                     /db_xref="CDD:184100"
     misc_feature    complement(253272..253427)
                     /locus_tag="Rahaq2_0236"
                     /note="helix_turn_helix, Deoxyribose operon repressor;
                     Region: HTH_DEOR; smart00420"
                     /db_xref="CDD:197714"
     misc_feature    complement(252747..253217)
                     /locus_tag="Rahaq2_0236"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            complement(253671..254735)
                     /locus_tag="Rahaq2_0237"
                     /note="IMG reference gene:2506707262"
                     /db_xref="GeneID:11793765"
     CDS             complement(253671..254735)
                     /locus_tag="Rahaq2_0237"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Zn-dependent hydrolase of
                     beta-lactamase fold protein"
                     /protein_id="YP_005198324.1"
                     /db_xref="GI:383188196"
                     /db_xref="GeneID:11793765"
                     /translation="MSKVETISRESWILSTFPEWGTWLNEEIEQEKVAPGTFAMWWLG
                     CTGIWLKSEGGANICVDFWCGVGKQNHSSPLMKTGHQMQRMAGVKKLQPNLRTTPFVL
                     DPFAIREVDAVLSTHDHNDHIDVNVAAAVMQNCAADVPFIGPQTCVDLWMSWGVPASR
                     CIVMTPGKVVRIKDVEIHALDSFDRTVLITLPAGQKAAGVLPDMMDQRAVNYLFKTPG
                     GNLYHSGDSHYSNYYAKHGNEYQIDVALGSYGENPRGVTDKMTSVDMLRMAESLRTKV
                     VIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTYPDDKDNFEYHY
                     PRGFDDCFTTETDLPFKSFL"
     misc_feature    complement(253674..254735)
                     /locus_tag="Rahaq2_0237"
                     /note="putative L-ascorbate 6-phosphate lactonase;
                     Provisional; Region: PRK11709"
                     /db_xref="CDD:236958"
     gene            255160..256563
                     /locus_tag="Rahaq2_0238"
                     /note="IMG reference gene:2506707263"
                     /db_xref="GeneID:11789964"
     CDS             255160..256563
                     /locus_tag="Rahaq2_0238"
                     /note="PFAM: PTS system sugar-specific permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198325.1"
                     /db_xref="GI:383188197"
                     /db_xref="InterPro:IPR004703"
                     /db_xref="GeneID:11789964"
                     /translation="MEFLYTIFTVFFNQVMTNAPLLLGIVTMLGYILLRKSATVIIKG
                     TIKTIIGFMLLQAGSGILTGTFKPVVAKLSEVYGINGAISDTYASMMATVERMGEAYS
                     WVGYAVLIALALNILMVVFRRITGIRTIMLTGHIMFQQAGLIAVFFFIMGYPMWTTIW
                     STAILVSLYWGITSNMMYKPTQAVTENSGFSIGHQQQFASWIAYKIAPYLGKKEDSVE
                     DLKLPGWLNIFHDNIVSTAIVMTVFFGIILCSFGLDTLQQMAGKTHWTIYILQTGLMF
                     AVAIFIIIQGVRMFVAELTEAFNGISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGT
                     IGQLIAVGILFGMGSSIMIIPGFIPMFFSNATIGVFANHFGGWRAALKICLAMGMIEI
                     FGCVWAIKLTGLSAWMGMADWSILAPPMMQGFFSIGMAFMGIIAVIALLYMFFAGRAL
                     RAEEDAEKQALNQSVSH"
     misc_feature    255160..256536
                     /locus_tag="Rahaq2_0238"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: SgaT; COG3037"
                     /db_xref="CDD:225579"
     gene            256620..256928
                     /locus_tag="Rahaq2_0239"
                     /note="IMG reference gene:2506707264"
                     /db_xref="GeneID:11789965"
     CDS             256620..256928
                     /locus_tag="Rahaq2_0239"
                     /note="PFAM: PTS system, Lactose/Cellobiose specific IIB
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system galactitol-specific transporter
                     subunit IIB"
                     /protein_id="YP_005198326.1"
                     /db_xref="GI:383188198"
                     /db_xref="InterPro:IPR003501"
                     /db_xref="InterPro:IPR013011"
                     /db_xref="GeneID:11789965"
                     /translation="MTVRILAVCGCGQGSSMIMKMKIGQFLTQEGVDHSMNSCAVGEY
                     KSELGGADIIVASTHVADEITVSGNKYVVGVRNMLSAADFGPKVMEVINAHFSADLKK
                     "
     misc_feature    256629..256895
                     /locus_tag="Rahaq2_0239"
                     /note="PTS_IIB_ascorbate: subunit IIB of enzyme II (EII)
                     of the L-ascorbate-specific
                     phosphoenolpyruvate:carbohydrate phosphotransferase system
                     (PTS). In this system, EII is an L-ascorbate-specific
                     permease with two cytoplasmic subunits (IIA and IIB) and
                     a...; Region: PTS_IIB_ascorbate; cd05563"
                     /db_xref="CDD:99905"
     misc_feature    order(256644..256655,256659..256667)
                     /locus_tag="Rahaq2_0239"
                     /note="P-loop; other site"
                     /db_xref="CDD:99905"
     misc_feature    order(256644..256646,256650..256655,256662..256667)
                     /locus_tag="Rahaq2_0239"
                     /note="active site"
                     /db_xref="CDD:99905"
     misc_feature    256644..256646
                     /locus_tag="Rahaq2_0239"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99905"
     gene            256939..257409
                     /locus_tag="Rahaq2_0240"
                     /note="IMG reference gene:2506707265"
                     /db_xref="GeneID:11789966"
     CDS             256939..257409
                     /locus_tag="Rahaq2_0240"
                     /note="PFAM: Phosphoenolpyruvate-dependent sugar
                     phosphotransferase system, EIIA 2"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system
                     mannitol/fructose-specifc IIA component (Ntr-type)"
                     /protein_id="YP_005198327.1"
                     /db_xref="GI:383188199"
                     /db_xref="InterPro:IPR002178"
                     /db_xref="InterPro:IPR016152"
                     /db_xref="GeneID:11789966"
                     /translation="MKLRDSLAENNSICLNAEAETWQDAVKIGVDMLVSAGVVEPRYY
                     QAILDGVERFGPYFVIAPGLAMPHGRPEEGVIKTGFALVTLKKPQVFNHEDNDPVDIL
                     ITLAAVDANAHQEVGIMQVVNLFDDEANFDRLRACTTAQQVLDLIDLTSATAVH"
     misc_feature    256966..257379
                     /locus_tag="Rahaq2_0240"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    order(257089..257091,257140..257142)
                     /locus_tag="Rahaq2_0240"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    257140..257142
                     /locus_tag="Rahaq2_0240"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            257433..258089
                     /locus_tag="Rahaq2_0241"
                     /note="IMG reference gene:2506707266"
                     /db_xref="GeneID:11789967"
     CDS             257433..258089
                     /locus_tag="Rahaq2_0241"
                     /note="PFAM: Orotidine 5'-phosphate decarboxylase / HUMPS
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hexulose-6-phosphate synthase family protein"
                     /protein_id="YP_005198328.1"
                     /db_xref="GI:383188200"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:11789967"
                     /translation="MSHSLPMLQVALDNQSMDDAYKTTRLIAGEVDIIEVGTILCVAE
                     GVRAVRDLKALYPEKIVLADAKIADAGKILARMCFEANADWVTVICCADINTTKGALE
                     VAKEFNGDVQIELTGYWTWEQAQEWHDAGIGQVVYHRSRDAQAAGVAWSDADISAIKR
                     LSAMGFKVTITGGLALEDLPLFKDIPVHVFIAGRSIRDAKDPVDAARQFKKSIRQLWG
                     "
     misc_feature    257448..258059
                     /locus_tag="Rahaq2_0241"
                     /note="3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC)
                     and D-arabino-3-hexulose-6-phosphate synthase (HPS). KGPDC
                     catalyzes the formation of L-xylulose 5-phosphate and
                     carbon dioxide from 3-keto-L-gulonate 6-phosphate as part
                     of the anaerobic pathway for...; Region: KGPDC_HPS;
                     cd04726"
                     /db_xref="CDD:240077"
     misc_feature    order(257463..257465,257469..257471,257535..257537,
                     257622..257624,257628..257630,257844..257846,
                     257943..257945,257949..257951,258009..258014)
                     /locus_tag="Rahaq2_0241"
                     /note="active site"
                     /db_xref="CDD:240077"
     misc_feature    order(257475..257477,257556..257558,257565..257570,
                     257637..257645,257661..257663,257703..257705,
                     257718..257720,257781..257783,257799..257801,
                     257844..257846,257850..257858)
                     /locus_tag="Rahaq2_0241"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240077"
     misc_feature    order(257535..257537,257622..257624)
                     /locus_tag="Rahaq2_0241"
                     /note="magnesium binding site [ion binding]; other site"
                     /db_xref="CDD:240077"
     gene            258100..258960
                     /locus_tag="Rahaq2_0242"
                     /note="IMG reference gene:2506707267"
                     /db_xref="GeneID:11793766"
     CDS             258100..258960
                     /locus_tag="Rahaq2_0242"
                     /note="PFAM: Xylose isomerase-like TIM barrel;
                     TIGRFAM: hexulose-6-phosphate isomerase, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hexulose-6-phosphate isomerase, putative"
                     /protein_id="YP_005198329.1"
                     /db_xref="GI:383188201"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="GeneID:11793766"
                     /translation="MMHKAVPLGIYEKALPAGEDWLMRLTLAKELGFDFVEMSVDETD
                     NRLARLDWSREQRLLVVEAISHTGIRIPSMCLSAHRRFPLGAEDDETRNQGLEIMRKA
                     IVLAQDLGIRVIQLAGYDVYYQQANENTRERFRDGLQVSVEMASRAQVTLAMEIMDYP
                     LMNSISKALGYSHYLNNPWFQLYPDIGNLSAWDNDVQMELASGAGHIVAVHVKDTQPG
                     VFKNVPFGSGVVKFERCFETLQKSGYRGPYLIEMWSETAADPMQEVRNARAWVIDKMQ
                     KAGLNMEETR"
     misc_feature    258100..258942
                     /locus_tag="Rahaq2_0242"
                     /note="L-xylulose 5-phosphate 3-epimerase; Reviewed;
                     Region: PRK13209"
                     /db_xref="CDD:237307"
     misc_feature    258121..258882
                     /locus_tag="Rahaq2_0242"
                     /note="AP endonuclease family 2; These endonucleases play
                     a role in DNA repair. Cleave phosphodiester bonds at
                     apurinic or apyrimidinic sites; the alignment also
                     contains hexulose-6-phosphate isomerases, enzymes that
                     catalyze the epimerization of...; Region: AP2Ec; cd00019"
                     /db_xref="CDD:237986"
     misc_feature    order(258130..258132,258214..258216,258343..258345,
                     258850..258852)
                     /locus_tag="Rahaq2_0242"
                     /note="AP (apurinic/apyrimidinic) site pocket; other site"
                     /db_xref="CDD:237986"
     misc_feature    order(258223..258237,258343..258348,258355..258357)
                     /locus_tag="Rahaq2_0242"
                     /note="DNA interaction; other site"
                     /db_xref="CDD:237986"
     misc_feature    order(258334..258336,258457..258459,258562..258564,
                     258652..258654,258661..258663,258730..258732,
                     258757..258759,258763..258765,258850..258852)
                     /locus_tag="Rahaq2_0242"
                     /note="Metal-binding active site; metal-binding site"
                     /db_xref="CDD:237986"
     gene            258957..259646
                     /locus_tag="Rahaq2_0243"
                     /note="IMG reference gene:2506707268"
                     /db_xref="GeneID:11789968"
     CDS             258957..259646
                     /locus_tag="Rahaq2_0243"
                     /note="PFAM: Class II Aldolase and Adducin N-terminal
                     domain;
                     TIGRFAM: L-ribulose-5-phosphate 4-epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-5-phosphate 4-epimerase-like epimerase
                     or aldolase"
                     /protein_id="YP_005198330.1"
                     /db_xref="GI:383188202"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="GeneID:11789968"
                     /translation="MTDALKQRVFDANMALPAFGLVTFTWGNVSGIDRERGIVVIKPS
                     GVEYGKMQASDMVVLNLQGEVVEGRYKPSSDTATHLELYARFPQLGGIVHTHSTCATS
                     WAQAGIAIPPLGTTHADYFAGAIPCTRPLSRQEVSGDYELETGKVIATALTNIDPLHM
                     PGILVAQHGPFCWGTTPEQAVHNAVVLEEVAKMAWITGSIRRDQTPMDDYLLHKHFSR
                     KHGPDAYYGQK"
     misc_feature    258969..259616
                     /locus_tag="Rahaq2_0243"
                     /note="Class II Aldolase and Adducin head (N-terminal)
                     domain. Aldolases are ubiquitous enzymes catalyzing
                     central steps of carbohydrate metabolism. Based on
                     enzymatic mechanisms, this superfamily has been divided
                     into two distinct classes (Class I and II); Region:
                     Aldolase_II; cd00398"
                     /db_xref="CDD:238232"
     misc_feature    order(258987..258989,258999..259001,259023..259025,
                     259095..259097,259101..259106,259242..259244,
                     259248..259253,259266..259274,259293..259295,
                     259299..259304,259344..259346,259455..259457,
                     259488..259490,259509..259511,259521..259523,
                     259542..259544,259602..259604)
                     /locus_tag="Rahaq2_0243"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    order(259038..259040,259086..259091,259173..259181,
                     259236..259238,259242..259244,259458..259460)
                     /locus_tag="Rahaq2_0243"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    order(259236..259238,259242..259244,259458..259460)
                     /locus_tag="Rahaq2_0243"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            259831..262245
                     /locus_tag="Rahaq2_0244"
                     /note="IMG reference gene:2506707269"
                     /db_xref="GeneID:11789969"
     CDS             259831..262245
                     /locus_tag="Rahaq2_0244"
                     /note="PFAM: Carbohydrate phosphorylase;
                     TIGRFAM: glycogen/starch/alpha-glucan phosphorylases"
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen/starch/alpha-glucan phosphorylase"
                     /protein_id="YP_005198331.1"
                     /db_xref="GI:383188203"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="GeneID:11789969"
                     /translation="MSKITFKQDVFLAALTRQWQAFGLTSASDMTRHQWWHAVSAAVA
                     EQLPAQSESVSSKSKKITRHVNYISMEFLVGRLTGNNLINLGWYEKIAAALEPFDINL
                     TDLLEEEIDPALGNGGLGRLAACYLDAMASVGQPGIGYGLNYQYGLFRQRFVDGKQKE
                     SPDDWHRSEYPWFRHNSALAVSVGVGGKMVKNEQGVSRWEPEFILRGEAWDLPVMGYR
                     NGITQPLRLWEATHPHPFDLEKFNDGEFLKAEQQGIDAAKLTKVLYPNDNHQAGKRLR
                     LMQQYFQCACSVADILRRHHFHGRKISELPDYEVIQLNDTHPTIAIPEMLRVLIDEHQ
                     LSWNDAWHITSRTFAYTNHTLMPEALETWDERLVRSLLPRHFQIIKQINANFKKQVSK
                     EWPGDEAVWAKLAVHHDKQVRMANLCVVAGFAVNGVAALHSDLVVKDLFPEYYQLWPE
                     KFHNVTNGITPRRWLKQCNPALSALIDERLKTDTWVNNLDLLKGLEDGVKDKKFCKQY
                     RKIKHDNKVRLAEYVWQRMGIRLNPDAIFDVQIKRLHEYKRQHLNLLHILSLYRQIRD
                     NPKLDIVPRVFLFGAKAAPGYYLAKNIIYAINQVAEKINNDPIVADRLKVVFIPDYSV
                     SVAELMIPAADVSEQISTAGKEASGTGNMKLALNGALTIGTLDGANVEIAEQVGEDNI
                     FIFGLTVDEVKAQLKKGYKPKALVKKDKHLKAILDELASGFYASGDKKAFDLMLNSLL
                     DGGDPYLVLADFASYCEAQKQVDALYRNADEWTRRTLLNTARVGMFSADRSIRDYQQR
                     IWQAKR"
     misc_feature    259834..262242
                     /locus_tag="Rahaq2_0244"
                     /note="maltodextrin phosphorylase; Provisional; Region:
                     PRK14985"
                     /db_xref="CDD:237881"
     misc_feature    259906..262236
                     /locus_tag="Rahaq2_0244"
                     /note="This is a family of oligosaccharide phosphorylases.
                     It includes yeast and mammalian glycogen phosphorylases,
                     plant starch/glucan phosphorylase, as well as the
                     maltodextrin phosphorylases of bacteria. The members of
                     this family catalyze the breakdown of...; Region:
                     GT1_Glycogen_Phosphorylase; cd04300"
                     /db_xref="CDD:99996"
     misc_feature    order(260041..260043,260047..260049,260179..260187,
                     260620..260622,260629..260631,260635..260637,
                     260656..260658,260773..260775,260779..260781,
                     260887..260892,260902..260904,261199..261201,
                     261220..261222,261454..261459,261463..261474,
                     261574..261576,261589..261591,261595..261597,
                     261697..261702,261766..261768,261772..261783,
                     261790..261792)
                     /locus_tag="Rahaq2_0244"
                     /note="active site pocket [active]"
                     /db_xref="CDD:99996"
     gene            262254..264380
                     /locus_tag="Rahaq2_0245"
                     /note="IMG reference gene:2506707270"
                     /db_xref="GeneID:11789970"
     CDS             262254..264380
                     /locus_tag="Rahaq2_0245"
                     /note="PFAM: 4-alpha-glucanotransferase;
                     TIGRFAM: 4-alpha-glucanotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-glucanotransferase"
                     /protein_id="YP_005198332.1"
                     /db_xref="GI:383188204"
                     /db_xref="InterPro:IPR003385"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11789970"
                     /translation="MEDKQLAEAARRAGIVDSFINMTDDVETVSDDTRVALLAAMGRD
                     PADVPEITPVPPVNVFTQGKKVLLTPEVSGAFSWQLTQENGSQTQGEIPAGTVLNLGA
                     ALPTGYHQLTLSQNGNVWPCRIIVVPPRCYEPEALLTGEKLWGATLQLYTLRSENNWG
                     VGDFGDLKKMVEEIGLRGGAFVGLNPIHALYPANPQSASPYSPSSRRWLNLTYIDVNA
                     VEEFTASSEAQRWWHSHETREALLQARSTEFVDYPQVIELKLTALKLAWQLFCSLPES
                     RPRKQDFRQFVELGGESLRQQALFDALHVHLRDLDLGQWGWPVWPEAYRDAKSADVRE
                     FSERYASEVAFYQWLQWLAQTQFSACYQRSVELKMPIGVYRDLAVGVAQGGAETWSDP
                     ALYCLNATVGAPPDILGPQGQNWGLPPIDPHEMKARAYQPFIDLLRANMAECGALRID
                     HVMGLLRLWWIPADQEAGSGAYVRYPLEDLLGVLALESQRHQCMVIGEDLGTVPKEIL
                     ASLRDCGVYSYKVLYFEHDKNFLYRPPQDYVSQAMATVTTHDLPTLRGYWEGADLTLG
                     ASLGVYPDPLVLEKLRGERERSKQGLLDALHRTGCVPKSISRSAENMPMMPLLNRGLQ
                     RYLAGSASALLGLQPEDWLDMSTPVNVPGTNTEYPNWRRKLTRTLEEMFADEYIDALL
                     SDLNQRRACASSAKPSPRLPLRRGRS"
     misc_feature    262254..264332
                     /locus_tag="Rahaq2_0245"
                     /note="4-alpha-glucanotransferase; Provisional; Region:
                     malQ; PRK11052"
                     /db_xref="CDD:236831"
     misc_feature    262644..264329
                     /locus_tag="Rahaq2_0245"
                     /note="4-alpha-glucanotransferase [Carbohydrate transport
                     and metabolism]; Region: MalQ; COG1640"
                     /db_xref="CDD:224555"
     gene            complement(264553..265128)
                     /locus_tag="Rahaq2_0246"
                     /note="IMG reference gene:2506707271"
                     /db_xref="GeneID:11789971"
     CDS             complement(264553..265128)
                     /locus_tag="Rahaq2_0246"
                     /note="PFAM: Iron-sulphur cluster biosynthesis; NifU-like
                     domain;
                     TIGRFAM: IscR-regulated protein YhgI"
                     /codon_start=1
                     /transl_table=11
                     /product="IscR-regulated protein YhgI"
                     /protein_id="YP_005198333.1"
                     /db_xref="GI:383188205"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR017726"
                     /db_xref="GeneID:11789971"
                     /translation="MILITDAAQEHFAKLLANQEEGTQIRVFVINPGTPTAECGVSYC
                     PPDAVEATDTELKFEKLSAFIDELSAPYLQDAVIDFVTDQLGSQLTLKAPNAKMRKVS
                     DDAPLMERVEYQLQSQINPQLASHGGRVSLMEITDDGIAVLQFGGGCNGCSMIDVTLK
                     DGIEKELLQNFPELKGVRDLTEHQRGEHSFY"
     misc_feature    complement(264556..265128)
                     /locus_tag="Rahaq2_0246"
                     /note="Fe/S biogenesis protein NfuA; Provisional; Region:
                     PRK11190"
                     /db_xref="CDD:183027"
     misc_feature    complement(264838..265128)
                     /locus_tag="Rahaq2_0246"
                     /note="Fe-S cluster assembly scaffold protein
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: sufA; COG0316"
                     /db_xref="CDD:223393"
     misc_feature    complement(264562..264837)
                     /locus_tag="Rahaq2_0246"
                     /note="Thioredoxin-like proteins and domains
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0694"
                     /db_xref="CDD:223766"
     gene            complement(265226..265915)
                     /locus_tag="Rahaq2_0247"
                     /note="IMG reference gene:2506707272"
                     /db_xref="GeneID:11789972"
     CDS             complement(265226..265915)
                     /locus_tag="Rahaq2_0247"
                     /note="PFAM: Phosphoribosyl transferase domain;
                     TIGRFAM: comF family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative amidophosphoribosyltransferase"
                     /protein_id="YP_005198334.1"
                     /db_xref="GI:383188206"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="GeneID:11789972"
                     /translation="MLTIASRCWLCQCPLHLPVQGICSLCMKYLPAAPPCCLRCGLPS
                     SGGNTDCGRCLLKPPPWDAMIFASPYEMPVSGLVLRFKFSGKPELDTTLARLLLLRWQ
                     ERYRMNNLPRPDVLLSVPLHQKRYFSRGYNQSELLAKPLARWLHCEYLPDALSRDRRT
                     PPQQSLTEQQRKWNLRKAFTCHASLRDKHVMLLDDVVTTGSTVREISKILRNHGVASL
                     QIACICRTLQA"
     misc_feature    complement(265235..265915)
                     /locus_tag="Rahaq2_0247"
                     /note="Predicted amidophosphoribosyltransferases [General
                     function prediction only]; Region: ComFC; COG1040"
                     /db_xref="CDD:223970"
     misc_feature    complement(265247..265594)
                     /locus_tag="Rahaq2_0247"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(265310..265324,265328..265336,
                     265529..265531,265556..265558))
                     /locus_tag="Rahaq2_0247"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            265962..266732
                     /locus_tag="Rahaq2_0248"
                     /note="IMG reference gene:2506707273"
                     /db_xref="GeneID:11789973"
     CDS             265962..266732
                     /locus_tag="Rahaq2_0248"
                     /note="PFAM: alpha/beta hydrolase fold;
                     TIGRFAM: putative pimeloyl-BioC--CoA transferase BioH"
                     /codon_start=1
                     /transl_table=11
                     /product="putative pimeloyl-BioC--CoA transferase BioH"
                     /protein_id="YP_005198335.1"
                     /db_xref="GI:383188207"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR010076"
                     /db_xref="GeneID:11789973"
                     /translation="MNTLYRETIGEGNRHLVLLHGWGLNAEVWRYTAERLAPHFCLHL
                     IDLPGYGRSEGFGAMTLEDMAETVLAAMPEKASLLGWSLGGLVASQIALSAPQRVEKL
                     ITVASSPCFVAHEDWPGIRPDVLQGFQHQLSEDFQRTVERFLALQTLGSDSARQDARL
                     LKSIVLNLPMPPVAVLNSGLEILRNVDLRQPMTQLTLPILRIYGALDGLVPRKMVPLL
                     DAILPGSRSEIVEKAAHAPFISHPDMFCELVGQFLITD"
     misc_feature    265962..266708
                     /locus_tag="Rahaq2_0248"
                     /note="carboxylesterase BioH; Provisional; Region:
                     PRK10349"
                     /db_xref="CDD:137836"
     misc_feature    266007..>266270
                     /locus_tag="Rahaq2_0248"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            266965..267234
                     /locus_tag="Rahaq2_0249"
                     /note="IMG reference gene:2506707274"
                     /db_xref="GeneID:11789974"
     CDS             266965..267234
                     /locus_tag="Rahaq2_0249"
                     /note="PFAM: Protein of unknown function (DUF1471)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198336.1"
                     /db_xref="GI:383188208"
                     /db_xref="InterPro:IPR010854"
                     /db_xref="GeneID:11789974"
                     /translation="MKSNKIIVAAILTGLFSLNAMAAEMISKEEAKDKGYTSLGVVTT
                     SNEYTAPMDAKEELSKLADEKGGKYYVVIAAQEKKKITATAEVFK"
     misc_feature    267070..267231
                     /locus_tag="Rahaq2_0249"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; pfam07338"
                     /db_xref="CDD:254164"
     gene            267543..269204
                     /locus_tag="Rahaq2_0250"
                     /note="IMG reference gene:2506707275"
                     /db_xref="GeneID:11789975"
     CDS             267543..269204
                     /locus_tag="Rahaq2_0250"
                     /note="TIGRFAM: malonate decarboxylase, alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit alpha"
                     /protein_id="YP_005198337.1"
                     /db_xref="GI:383188209"
                     /db_xref="GeneID:11789975"
                     /translation="MPQHPQTTKVWDTRRKEKQRRIDSVRSVAEGKVLPTDKIIPILE
                     TLIASGDRVVMEGNNQKQADFLSRSLAKVDPEKLHDLHMIMPSVSRAEHLDLFERGIA
                     RKLDFAFSGPQSLRIAQLLEDGQMEIGAIHTYIELYSRLYVDLVPNIALIAGFKADRK
                     GNLYTGASTEDTPALVEAAAFKNGIVIAQVNELVDEETDLPRVDIPGDWIDFVVVADK
                     PFFIEPLFTRDPRLIKPVHVLMAMMAIKGIYAKHNVQSLNHGIGFNTAAIELLLPTYG
                     EQLGLRGKICKHWTLNPHPTLIPAIESGWVETVHCFGGELGMEEYIRARPDVFFTGSD
                     GSMRSNRAFCQLAGQYAVDMFIGSTLQVDGLANSSTVTRGRLAGFGGAPNMGHDPHGR
                     RHSTPAWLDMIEEPDPMARGKKLVVQMVETFQAGGKPTFVEKLEAVDVGKESGMPLAP
                     VMIYGDDVTHVLTEEGIAYLYRARSLEERRAMVAAVAGITDIGLGVDAKRVADLRRQE
                     LVVFPEDMGIRRTDATRSLLAAGSVSELVDWSGGLYNPPAKFRSW"
     misc_feature    267573..269201
                     /locus_tag="Rahaq2_0250"
                     /note="malonate decarboxylase, alpha subunit; Region:
                     mdcA; TIGR01110"
                     /db_xref="CDD:233274"
     misc_feature    <267975..268202
                     /locus_tag="Rahaq2_0250"
                     /note="Coenzyme A transferase; Region: CoA_trans; cl17247"
                     /db_xref="CDD:247801"
     gene            269207..270067
                     /locus_tag="Rahaq2_0251"
                     /note="IMG reference gene:2506707276"
                     /db_xref="GeneID:11789976"
     CDS             269207..270067
                     /locus_tag="Rahaq2_0251"
                     /note="PFAM: ATP:dephospho-CoA triphosphoribosyl
                     transferase;
                     TIGRFAM: triphosphoribosyl-dephospho-CoA synthase MdcB"
                     /codon_start=1
                     /transl_table=11
                     /product="triphosphoribosyl-dephospho-CoA synthase MdcB"
                     /protein_id="YP_005198338.1"
                     /db_xref="GI:383188210"
                     /db_xref="InterPro:IPR002736"
                     /db_xref="GeneID:11789976"
                     /translation="MMPQTLTIGAVLTAEELAERLAETATQALIDEARLSPKPGLVDS
                     RSAGAHQDLSLDLMVRSARSLTTTFYLLALHSWQRPADIALRQEVGRLGRAGEAQMMA
                     ETGGVNTHRGAIWAMGLLVSAVAMQPERLLPLHIAQRAAKIAVLPDAFSPKKFSKGSH
                     AVQRYQVPGAREEAQSGFPHIIGCALPQLHHSRARGASESEAQVDALLAVMSTLADTC
                     VLSRGGLPALEAMHQGAQAVLEAGGTSTMAGKQRLRHLEQRMLADNVSPGGAADLLAA
                     TLFLDRVSVA"
     misc_feature    269255..270052
                     /locus_tag="Rahaq2_0251"
                     /note="ATP:dephospho-CoA triphosphoribosyl transferase;
                     Region: CitG; cl00768"
                     /db_xref="CDD:260611"
     gene            270108..270410
                     /locus_tag="Rahaq2_0252"
                     /note="IMG reference gene:2506707277"
                     /db_xref="GeneID:11789977"
     CDS             270108..270410
                     /locus_tag="Rahaq2_0252"
                     /note="PFAM: Malonate decarboxylase delta subunit (MdcD);
                     TIGRFAM: malonate decarboxylase acyl carrier protein"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase acyl carrier protein"
                     /protein_id="YP_005198339.1"
                     /db_xref="GI:383188211"
                     /db_xref="InterPro:IPR009662"
                     /db_xref="GeneID:11789977"
                     /translation="MERFEFSYPAAKPLADHAQAGVVGSGDLEALYEPQTTSALKITV
                     TTSVDGSHSLWQHFFDRLNALRELPAGRLDINDFGATPGVARLRIEQVFEEAEHAN"
     misc_feature    270108..270401
                     /locus_tag="Rahaq2_0252"
                     /note="Malonate decarboxylase delta subunit (MdcD);
                     Region: ACP; cl06082"
                     /db_xref="CDD:244293"
     gene            270400..271251
                     /locus_tag="Rahaq2_0253"
                     /note="IMG reference gene:2506707278"
                     /db_xref="GeneID:11789978"
     CDS             270400..271251
                     /locus_tag="Rahaq2_0253"
                     /note="PFAM: Carboxyl transferase domain;
                     TIGRFAM: malonate decarboxylase, beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit beta"
                     /protein_id="YP_005198340.1"
                     /db_xref="GI:383188212"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="GeneID:11789978"
                     /translation="MPTDTSVQDQSFIELNARQRARKLLDAGTFRELLGPFERIMSPW
                     LEPQGIVPQADDGMVVAKGQINGQPAVVVAIEGSFQGGSMGEVSGAKMAAALEMAAED
                     NRNGIPTQAVLLLETGGVRLQEANLGLAAIADIHAAIVDLRRYTPVIGVVAGTVGCFG
                     GMSIAAALCSYLIVTREARLGLNGPQVIEQEAGIDEYDSRDRPFIWSMTGGEVRYHSG
                     FVDALVKDSLAEVKDSMLGFMKKGVPVTHRSDNYEYYLPKLTGFDTAQQASREVTEVL
                     FNREDRA"
     misc_feature    270400..271203
                     /locus_tag="Rahaq2_0253"
                     /note="malonate decarboxylase subunit beta; Reviewed;
                     Region: PRK07189"
                     /db_xref="CDD:235954"
     gene            271248..272063
                     /locus_tag="Rahaq2_0254"
                     /note="IMG reference gene:2506707279"
                     /db_xref="GeneID:11789979"
     CDS             271248..272063
                     /locus_tag="Rahaq2_0254"
                     /note="PFAM: Malonate decarboxylase gamma subunit (MdcE);
                     TIGRFAM: malonate decarboxylase, gamma subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit gamma"
                     /protein_id="YP_005198341.1"
                     /db_xref="GI:383188213"
                     /db_xref="InterPro:IPR009648"
                     /db_xref="GeneID:11789979"
                     /translation="MSNVNNNAVSRGDYWFAELTKDATPVAGLCPSVKAADGKMNDQP
                     VRFIAVVPDKNNQYPRAAGGEVGLLEGWNLAKVVSDVIDADANASTKRAIVAVIDVPS
                     QAYGRREEAFGIHQALAGAAGAYAKARLAGHPVIGLIVGKAMSGAFLAHGYQANKLIA
                     FKNNGVMIHAMGKESAARITLRSVDALEKLAATIPPMAYDIENYATLGLLSQLLDIAD
                     PDNATPDDISSVENAVWQNIQDARKEGVSLSNRLGAENRASSQRVRQQMRQEW"
     misc_feature    271278..272060
                     /locus_tag="Rahaq2_0254"
                     /note="Malonate decarboxylase gamma subunit (MdcE);
                     Region: MdcE; cl17835"
                     /db_xref="CDD:266870"
     gene            272254..273216
                     /locus_tag="Rahaq2_0255"
                     /note="IMG reference gene:2506707280"
                     /db_xref="GeneID:11789980"
     CDS             272254..273216
                     /locus_tag="Rahaq2_0255"
                     /note="PFAM: Membrane transport protein;
                     TIGRFAM: he Auxin Efflux Carrier (AEC) Family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative permease"
                     /protein_id="YP_005198342.1"
                     /db_xref="GI:383188214"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="GeneID:11789980"
                     /translation="MTYVILHALAPIFVIMILGFYAGKAKMVDNQNVSLLNIFVMDFA
                     LPAALFAATVQTPWTGIVEQSPLILVLVLAMWITYAAIYFICTKVFKKSPQDAAVLTL
                     TVALPNYAALGLPILSSVLGDAPSTSLSVAVSIACGSVLMTPFCLLILEREKARLSGE
                     NQGSSLALLPVLMWRSVKKPIVWAPLLGVILSAIGIKMPEIFLASIKPLGLSATASAL
                     FLTGVILSARKLKINGPVLLSCVAKNLVQPFIAWGLVLAFGLSGQVAVTAILMIALSA
                     GFFGIVFGNRFGVQSPDAEASLLISSVLCIVTLPLFISLTAALH"
     misc_feature    272254..273204
                     /locus_tag="Rahaq2_0255"
                     /note="he Auxin Efflux Carrier (AEC) Family; Region: 2a69;
                     TIGR00946"
                     /db_xref="CDD:233203"
     gene            273234..273860
                     /locus_tag="Rahaq2_0256"
                     /note="IMG reference gene:2506707281"
                     /db_xref="GeneID:11789981"
     CDS             273234..273860
                     /locus_tag="Rahaq2_0256"
                     /note="PFAM: Phosphoribosyl-dephospho-CoA transferase
                     MdcG;
                     TIGRFAM: malonate decarboxylase
                     holo-[acyl-carrier-protein] synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase
                     holo-(acyl-carrier-protein) synthase"
                     /protein_id="YP_005198343.1"
                     /db_xref="GI:383188215"
                     /db_xref="InterPro:IPR017557"
                     /db_xref="GeneID:11789981"
                     /translation="MCDPRAHDFVWIRDRSALESDDVLPEWVNTGWRTALPLVVRRDK
                     RADGAIPVGIRGLTRIQRAAAWIDPAAVERVVTPESLVSDVNALLHSPFVSQQPVQAL
                     ITLCSLKLPFPWGVTGSCAFALVSDLPVMHADSDLDLLVRCDTPVDSSLFSDFYDQLQ
                     RLPCRADVQITTPQGGFALSEWLRGGDIMLKTASGPLLVRDPWQPPAD"
     misc_feature    273234..273854
                     /locus_tag="Rahaq2_0256"
                     /note="phosphoribosyl-dephospho-CoA transferase;
                     Provisional; Region: PRK01293"
                     /db_xref="CDD:234936"
     gene            273888..274823
                     /locus_tag="Rahaq2_0257"
                     /note="IMG reference gene:2506707282"
                     /db_xref="GeneID:11793767"
     CDS             273888..274823
                     /locus_tag="Rahaq2_0257"
                     /note="PFAM: Acyl transferase domain;
                     TIGRFAM: malonate decarboxylase, epsilon subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate decarboxylase subunit epsilon"
                     /protein_id="YP_005198344.1"
                     /db_xref="GI:383188216"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="GeneID:11793767"
                     /translation="MKILFTFPGQGPQVPHMLHRLPDNPLTDSLIAQASLALGEDVLL
                     LDTADALRSTRAVQLCLLIAGVVWAKQCQAEGIEADFCSGLSIGAFPAAVMAGALDFD
                     DAIRLVALRGELMQQAYPQGFGLSAITGLRQMQVEDLVAQVNSPTSPVYLANINAEDQ
                     LVIAGSDAAMAQVMQLAKARGAQKTHQLAVSVPSHCALLDQPAAKLVEAFKNIQISRP
                     ACGYLSGTTGRVYWQPEKIADDLAMNMARTVNWRDAMVAAYQREVRLAIEMPPGAVLT
                     GLTRRAMEQGEALSLCQSGMQVAARLATRLRENER"
     misc_feature    273894..274760
                     /locus_tag="Rahaq2_0257"
                     /note="malonate decarboxylase, epsilon subunit; Region:
                     malonate_mdcH; TIGR03131"
                     /db_xref="CDD:132175"
     gene            274924..275163
                     /locus_tag="Rahaq2_0258"
                     /note="IMG reference gene:2506707283"
                     /db_xref="GeneID:11789982"
     CDS             274924..275163
                     /locus_tag="Rahaq2_0258"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198345.1"
                     /db_xref="GI:383188217"
                     /db_xref="GeneID:11789982"
                     /translation="MPVILRFKNYRFFFYSNEGNPLEPHHIHVRSGQKEAKLWLSPVA
                     ICRQTGFSAKEVREIITLTNVYQTLFQGAWNEYFA"
     misc_feature    274951..275148
                     /locus_tag="Rahaq2_0258"
                     /note="Domain of unknown function (DUF4160); Region:
                     DUF4160; pfam13711"
                     /db_xref="CDD:258009"
     gene            275147..275413
                     /locus_tag="Rahaq2_0259"
                     /note="IMG reference gene:2506707284"
                     /db_xref="GeneID:11789983"
     CDS             275147..275413
                     /locus_tag="Rahaq2_0259"
                     /note="PFAM: Protein of unknown function (DUF3532)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198346.1"
                     /db_xref="GI:383188218"
                     /db_xref="InterPro:IPR021921"
                     /db_xref="GeneID:11789983"
                     /translation="MNISPKSVRFDESTMWVTLEDGQILTVPLAQFPALLNATPAQRQ
                     DCETSAYGLHWDALDEDISIEGLIVGKPIAKPATHTNASALSAR"
     misc_feature    275159..275350
                     /locus_tag="Rahaq2_0259"
                     /note="Protein of unknown function (DUF2442); Region:
                     DUF2442; pfam10387"
                     /db_xref="CDD:255955"
     gene            complement(275393..276313)
                     /locus_tag="Rahaq2_0260"
                     /note="IMG reference gene:2506707285"
                     /db_xref="GeneID:11789984"
     CDS             complement(275393..276313)
                     /locus_tag="Rahaq2_0260"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198347.1"
                     /db_xref="GI:383188219"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789984"
                     /translation="MIDSEITFRKLEIFLAYMEKQNITRAAEQLGLSSVSVHRALHSL
                     EEGLRCPLFIHRGRNLLPLPAAEALLEHATQVIEQMEHGILATRRAAGFGDKRLKVGT
                     LYSLTLETIPRLIMGLKLRRPELELELVMGSNNDLLHKLEDGQLDAILISTSDSSVDA
                     QRYDQLPLFQDDIFLAAPASAELASEGTADLRDYKQKKFVSLAEGFATYHGFQEAFQV
                     AGFEPDIVTRVNDIFSMLSLVQAGVGYTLIPGRMKGVYENTVKLLPLAEAYQMRQTIS
                     LVFPHSREHDPNLLALAAESRMYALASRKR"
     misc_feature    complement(275396..276298)
                     /locus_tag="Rahaq2_0260"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(276113..276292)
                     /locus_tag="Rahaq2_0260"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(275429..276025)
                     /locus_tag="Rahaq2_0260"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(275591..275596,275600..275605,
                     275621..275638,275921..275941,275945..275947,
                     275957..275959,275966..275971,275975..275980))
                     /locus_tag="Rahaq2_0260"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(276383..276622)
                     /locus_tag="Rahaq2_0261"
                     /note="IMG reference gene:2506707286"
                     /db_xref="GeneID:11789985"
     CDS             complement(276383..276622)
                     /locus_tag="Rahaq2_0261"
                     /note="PFAM: FeoC like transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="FeoC like transcriptional regulator"
                     /protein_id="YP_005198348.1"
                     /db_xref="GI:383188220"
                     /db_xref="InterPro:IPR015102"
                     /db_xref="GeneID:11789985"
                     /translation="MTSLIQVRDSLALVGRADARQLSHQLNAPQPLVQAMLERLVAMR
                     KAEVVEADDSCLSGSCKSCADGKNCLTVSYQLIQH"
     misc_feature    complement(276395..276622)
                     /locus_tag="Rahaq2_0261"
                     /note="FeoC like transcriptional regulator; Region: FeoC;
                     cl17677"
                     /db_xref="CDD:266770"
     gene            complement(276631..278949)
                     /locus_tag="Rahaq2_0262"
                     /note="IMG reference gene:2506707287"
                     /db_xref="GeneID:11793768"
     CDS             complement(276631..278949)
                     /locus_tag="Rahaq2_0262"
                     /note="PFAM: Ferrous iron transport protein B; Ferrous
                     iron transport protein B C terminus; Nucleoside
                     recognition;
                     TIGRFAM: ferrous iron transporter FeoB; small GTP-binding
                     protein domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transporter FeoB"
                     /protein_id="YP_005198349.1"
                     /db_xref="GI:383188221"
                     /db_xref="InterPro:IPR011619"
                     /db_xref="InterPro:IPR011640"
                     /db_xref="InterPro:IPR011642"
                     /db_xref="GeneID:11793768"
                     /translation="MKPLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQ
                     FTTAEHQITLVDLPGTYSLTTISEQTSLDEQIACHYILSGDADLMINVVDASNLERNL
                     YLTLQLLELGVPCIVALNMLDIAKIQNININIPALSARLGCPVVALVSTRASGIKELK
                     AAIDELPQVAALERVQYHPVLQQEVDVLAAGMPQDMALQQRRWLALQILEGDIYSQTH
                     AGNAQALLPQVKARLAEHKLEDPALLIADARYQSIAALCAEISNSHLTAPNKLTQVLD
                     RVILNRFLGVPIFLLVMYLMFVLAINIGGALQPIFDIGSAAIFIQGMQWIGFTLHFPQ
                     WLTIFLAQGLGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQSLGLPG
                     KSFVPLIVGFGCNVPSIMGARTLDAPRERLITVMMAPFMSCGARLAIFAVFSAAFFGQ
                     DGASVVFSLYLLGIVVAILTGLLLKYTIMRGEASPFVMELPVYHVPHLKSLLLQTWQR
                     LKGFVLRAGKVIVIASIFIGALNSFSFSGKAVDNINDSALASVSKVLTPVLSPMGVQP
                     DNWQATVGLVTGAMAKEVVVGTLNTLYTAEHITNETFDAASFNLFDELGGAVKETWQG
                     LKDTFSISVLSNPIEASKGDGEMGVSSMGVMSTKFGSAISAYSYLIFVLLYVPCVSVM
                     GAIARETSRNWMTFSIFWGLNVAYSLATVFYQAATFSRHPAHSAGIILVVLIFNAIVL
                     TALRKARSRVSVHLQPRNVAACCKPATGSDCH"
     misc_feature    complement(276634..278949)
                     /locus_tag="Rahaq2_0262"
                     /note="ferrous iron transport protein B; Reviewed; Region:
                     feoB; PRK09554"
                     /db_xref="CDD:236563"
     misc_feature    complement(278452..278928)
                     /locus_tag="Rahaq2_0262"
                     /note="Ferrous iron transport protein B (FeoB) family;
                     Region: FeoB; cd01879"
                     /db_xref="CDD:206667"
     misc_feature    complement(278899..278922)
                     /locus_tag="Rahaq2_0262"
                     /note="G1 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(order(278497..278505,278581..278583,
                     278587..278592,278896..278907,278911..278913))
                     /locus_tag="Rahaq2_0262"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206667"
     misc_feature    complement(278830..278844)
                     /locus_tag="Rahaq2_0262"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(278839..278841)
                     /locus_tag="Rahaq2_0262"
                     /note="G2 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(278773..278784)
                     /locus_tag="Rahaq2_0262"
                     /note="G3 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(order(278692..278697,278707..278733,
                     278746..278775))
                     /locus_tag="Rahaq2_0262"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(278581..278592)
                     /locus_tag="Rahaq2_0262"
                     /note="G4 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(278497..278505)
                     /locus_tag="Rahaq2_0262"
                     /note="G5 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    complement(277621..277890)
                     /locus_tag="Rahaq2_0262"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     misc_feature    complement(277426..277587)
                     /locus_tag="Rahaq2_0262"
                     /note="Ferrous iron transport protein B C terminus;
                     Region: FeoB_C; pfam07664"
                     /db_xref="CDD:254341"
     misc_feature    complement(<277153..277407)
                     /locus_tag="Rahaq2_0262"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     gene            complement(279037..279261)
                     /locus_tag="Rahaq2_0263"
                     /note="IMG reference gene:2506707288"
                     /db_xref="GeneID:11793769"
     CDS             complement(279037..279261)
                     /locus_tag="Rahaq2_0263"
                     /note="PFAM: FeoA domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+ transport system protein A"
                     /protein_id="YP_005198350.1"
                     /db_xref="GI:383188222"
                     /db_xref="InterPro:IPR007167"
                     /db_xref="GeneID:11793769"
                     /translation="MQLQSKRAYKITGFSHEISPAYRQKLLSLGMLPGSFFNIIRVAP
                     MGDPVQIETRRTSLVVRRKDLDLLQLEMLA"
     misc_feature    complement(279040..279261)
                     /locus_tag="Rahaq2_0263"
                     /note="ferrous iron transport protein A; Reviewed; Region:
                     feoA; PRK09555"
                     /db_xref="CDD:181949"
     gene            279289..279486
                     /locus_tag="Rahaq2_0264"
                     /note="IMG reference gene:2506707289"
                     /db_xref="GeneID:11789986"
     CDS             279289..279486
                     /locus_tag="Rahaq2_0264"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198351.1"
                     /db_xref="GI:383188223"
                     /db_xref="GeneID:11789986"
                     /translation="MDDGVLVILRRASLPGDVADQRFMWLTIFVAKDSAQKLSLVRNY
                     QPLADGALNTQRSTNENSYHN"
     gene            complement(279694..282024)
                     /locus_tag="Rahaq2_0265"
                     /note="IMG reference gene:2506707290"
                     /db_xref="GeneID:11789987"
     CDS             complement(279694..282024)
                     /locus_tag="Rahaq2_0265"
                     /note="PFAM: Tex-like protein N-terminal domain; S1 RNA
                     binding domain;
                     TIGRFAM: competence protein ComEA helix-hairpin-helix
                     repeat region"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional accessory protein"
                     /protein_id="YP_005198352.1"
                     /db_xref="GI:383188224"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR005227"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016027"
                     /db_xref="InterPro:IPR018974"
                     /db_xref="InterPro:IPR023097"
                     /db_xref="GeneID:11789987"
                     /translation="MNDQLSRIIASELQVRPEQVASVVRLLDEGNTVPFIARYRKEVT
                     GGLDDTQLRQLDTRLGYLRELEDRRQTILKSIEEQGKLSDDLAKAINTTLSKTELEDL
                     YLPFKPKRRTRGQIAIEAGLEPLAELLWNAPQNEPDAAAAQFVDAEKGVADTKAALDG
                     ARYILMERFAEDASLLAKVRDYLWKNAHLTSRMVEGKEQEGAKFRDYFDHHEPISQVP
                     SHRALAMFRGRNEGVLQLALNADPQHDEPPKESYAEQLIIDHLGLRLNNAPADVWRRA
                     VVNWTWRIKVLLHLETELMGTVRERAEDEAINVFARNMHDLLMAAPAGMRATMGLDPG
                     LRTGVKVAVVDNTGKLVDIDTVYPHTGQAAKAAQQVAALCIKHNVELVAIGNGTASRE
                     TERFFLELQKQFPAVKAQKVIVSEAGASVYSASELAALEFPDLDVSIRGAVSIARRLQ
                     DPLAELVKIDPKSIGVGQYQHDVSQSQLAKKLDTVVEDCVNAVGVDLNTASVPLLTRV
                     AGLTRMMAQNIVNWRDENGQFRNREQLLKVSRLGPKAFEQCAGFLRINHGDNPLDAST
                     VHPETYPVVERILAATQMALKELMGDSNVLRGLKASEFTDEQFGVPTVTDIIKELEKP
                     GHDPRPEFKTATFADGVETMNDLMPGMILEGSVTNVTNFGAFVDIGVHQDGLVHISSL
                     ANKFVEDPHTVVKAGDIVKVKVMEVDLQRKRIALTMRLDEQPGEAPARRSSAPAADTR
                     DNQKRHSPNKPAGRNTVPAGNNAMADALAAALGKKR"
     misc_feature    complement(279766..282024)
                     /locus_tag="Rahaq2_0265"
                     /note="Transcriptional accessory protein [Transcription];
                     Region: Tex; COG2183"
                     /db_xref="CDD:225094"
     misc_feature    complement(281422..282000)
                     /locus_tag="Rahaq2_0265"
                     /note="Tex-like protein N-terminal domain; Region: Tex_N;
                     pfam09371"
                     /db_xref="CDD:255322"
     misc_feature    complement(280756..281049)
                     /locus_tag="Rahaq2_0265"
                     /note="Likely ribonuclease with RNase H fold; Region:
                     YqgFc; smart00732"
                     /db_xref="CDD:128971"
     misc_feature    complement(280660..>280791)
                     /locus_tag="Rahaq2_0265"
                     /note="Uncharacterized protein family (UPF0081); Region:
                     UPF0081; cl17278"
                     /db_xref="CDD:266606"
     misc_feature    complement(280363..280557)
                     /locus_tag="Rahaq2_0265"
                     /note="Helix-hairpin-helix motif; Region: HHH_3;
                     pfam12836"
                     /db_xref="CDD:257337"
     misc_feature    complement(279874..280077)
                     /locus_tag="Rahaq2_0265"
                     /note="S1_Tex: The C-terminal S1 domain of a transcription
                     accessory factor called Tex, which has been characterized
                     in Bordetella pertussis and Pseudomonas aeruginosa. The
                     tex gene is essential in Bortella pertusis and is named
                     for its role in toxin expression; Region: S1_Tex; cd05685"
                     /db_xref="CDD:240190"
     misc_feature    complement(order(279991..279993,279997..279999,
                     280027..280029,280051..280053))
                     /locus_tag="Rahaq2_0265"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240190"
     gene            complement(282136..282609)
                     /locus_tag="Rahaq2_0266"
                     /note="IMG reference gene:2506707291"
                     /db_xref="GeneID:11789988"
     CDS             complement(282136..282609)
                     /locus_tag="Rahaq2_0266"
                     /note="PFAM: domain; Transcription elongation factor,
                     GreA/GreB, C-term;
                     TIGRFAM: transcription elongation factor GreB"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreB"
                     /protein_id="YP_005198353.1"
                     /db_xref="GI:383188225"
                     /db_xref="InterPro:IPR001437"
                     /db_xref="InterPro:IPR018151"
                     /db_xref="InterPro:IPR022691"
                     /db_xref="GeneID:11789988"
                     /translation="MKTKLITREGYDKLKTELDYLWREERPEVTKKVTWAASLGDRSE
                     NADYQYNKKRLREIDRRVRYLTKCLEQLRIVDYSPQQDGKVFFGAWVEVENDDGDIKR
                     FRIVGYDEIFGRKDYISIDSPMARALLKKEVGDSLVVTTPVGDATWYVNQIEYIK"
     misc_feature    complement(282145..282609)
                     /locus_tag="Rahaq2_0266"
                     /note="transcription elongation factor GreB; Reviewed;
                     Region: greB; PRK01885"
                     /db_xref="CDD:179345"
     misc_feature    complement(282388..282594)
                     /locus_tag="Rahaq2_0266"
                     /note="Transcription elongation factor, N-terminal;
                     Region: GreA_GreB_N; pfam03449"
                     /db_xref="CDD:251961"
     misc_feature    complement(282145..282372)
                     /locus_tag="Rahaq2_0266"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            282840..288857
                     /locus_tag="Rahaq2_0267"
                     /note="IMG reference gene:2506707292"
                     /db_xref="GeneID:11789989"
     CDS             282840..288857
                     /locus_tag="Rahaq2_0267"
                     /note="PFAM: Alpha-2-macroglobulin family; MG2 domain;
                     Alpha-2-macroglobulin family N-terminal region;
                     Alpha-2-macroglobulin MG1 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="large extracellular alpha-helical protein"
                     /protein_id="YP_005198354.1"
                     /db_xref="GI:383188226"
                     /db_xref="InterPro:IPR001599"
                     /db_xref="InterPro:IPR002890"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR011625"
                     /db_xref="InterPro:IPR021868"
                     /db_xref="GeneID:11789989"
                     /translation="MDLLKFLLRLPFTLIKGLFRVLAFILSLLGRVFKPLVGNIDWRA
                     PAWWTATSGWLKRSFTRMEKGVDNSPKAISLAILLLLCVAGAGVYGWHWWLNRPQPIE
                     PAPMVYQDTSLRVSGPESVNYAAQKSAPQQVIFTFRNSAAPVTDVGKVVEKGISLKPA
                     TEGEWKWVSGYTLVFTPKNPLPMGSKYEVNFSPDVLLAPQSKLAKTRYEFSAPAFGYQ
                     LGQAEYYQDPQDPQKRSAIFNVKFNAPVDVASFEKQISLGLTEGKAKTESKLNYSVVY
                     DQKKLNAWVHSEPLKSLDHGGSVRVTIGEGVKSSVPSNATAQAKNGVVSVPTLYSLTV
                     NEASAQVVDAEGAKGQRALIVGFSDAVKDKDIRQAVKAWLLPQHNPNDQDEAKGADDY
                     ASWAVDSVENNVLAQSTPLNIRLNDAESDYQPQFSFRFDAPAHRAMLVEIDNILTSSG
                     GYKMPEKVYRIVQVPDYPKSLQFMSQGSLLSVSGDKQISVAARNVPGLRLDIKRVIPS
                     QLQHIVSFKSREYSSAEFNRLNDEYFTEHFKYQTAVNNDKPGEVNYQGVDLSRYLSTD
                     PASHRGVFLLTLSEWDPKKKEDKPETDDDGNVYQDEQQNEDEAPVGDSRFVVVTDLGI
                     IAKRSQDKTRDVFVQSIHSGTPVANATVSVIAKNGVTLLTQTTGADGHVRFPALDVYT
                     SERQPVMFLVEKEGDVSFLPADRNNDRGLDFSRFDVDGEITPNDPRTLSSYLFSDRGV
                     YRPGDTFNIGLITRAADWSNGLAGVPVRAEIHDPRDKLMSTIPLTLGASGFNELSYTT
                     DDNSPTGEWNVYLYLIGKDNESSTFLGHTAVNVKEFEPDQLKVKLQLTPERKQGWVKP
                     SELQANIDVQNLFGTPAQDRRVTSRLTLRPMYPSFDKFPDYAFYENRQNSDGFETELE
                     DRTTDEKGAANIPLDLKSYADATYQLQLLSEAFVAGGGRSVAATARVLVSPYDYLIGV
                     KADGDLGYINRDAARHLNIIAVDPSLKQIALPDLKVALIEQKYISVLTKQDSGVYKYQ
                     SKMKEVQLSEQPLSLTAQGNDLTLATDKPGDFVLVVEDAKGNVLNRIGYTVAGNANLS
                     RSLDRNAELKLKLNQAEYLPGEEIEVSVNAPYTGSGLITIEKDKVYSWQWFHTDTTSS
                     VQKIRVPAAMEGNGYINVQFVRDVNSNEIFMSPLSYGVMPFKISTMARQNTLEITAPE
                     VIKPGENLVMTVKTDGPQQVALFAVDEGILQVARYRLKDPLEYFFRKRELGVESSQIL
                     DLILPEFSKLMQLAAAPGGDAGEGLDLNVNPFKRKRDKPVAYWSGITEVNGEKQFDYP
                     VPDYFNGKIRVMAISVTPDKIGKAQTSATVRDNFIMTPNVPSMVAPGDEFDVSVGVSN
                     NLEGLNGKSIPVAIHLTVPPQLEVVGNADQNLSLAEKREGVINFRLRANAVPGDAPLV
                     FEATYGDKTSRRTISTSVRPAMPFRTQSVMGRMSGSSQNVDNLRQMFDAYAVRKAAVS
                     NSPLVLTRGLSQYLADYPYYCSEQIVSRSVPLILEMVHPEMRGNLSPAESSKQLKDMM
                     AVLRSRQNDSGAIGLWRSSPQTDPFVTPYVVQYLLEAKAAGVALPAGMLEEASSALRE
                     LAANQNDDLYSLRLRAWAVYLLTRQGEITTSLLASVQDTLQQRYPDTWKTDLSAMYLA
                     SSYRLLKMDDEADTLLQPTWKELSKAYDQAWWTQSYFDPLVQDATRLYLITRHFPEKV
                     SAIPPQVLENMVKALKEERYTTYSSAMSILALESYSAQVAAQATAPDALKITQISKTK
                     NVEPRLISEVQGLFAKANFTADAQALRIENGNDAPAWYVVTQAGYDLAAPEKAISRGL
                     EITRDYTDEKGNAVTQVTLGQKINVHLKIRANSQEGQDNLAIVDLLPGGFEVVQQTPP
                     EPESDSNDENSDAEASASWQSPLAASGSTWTPDYSDIREDRVVIYGSASTDVQEFVYQ
                     IKATNTGSFVIPPAYGEAMYNRDVQALSVSDKKLLVVPADDAAVAKK"
     misc_feature    283230..>283397
                     /locus_tag="Rahaq2_0267"
                     /note="IgD-like repeat domain of mycobacterial
                     L,D-transpeptidases; Region: LDT_IgD_like; cl17506"
                     /db_xref="CDD:248060"
     misc_feature    283668..288830
                     /locus_tag="Rahaq2_0267"
                     /note="Large extracellular alpha-helical protein [General
                     function prediction only]; Region: COG2373"
                     /db_xref="CDD:225248"
     misc_feature    284766..>284879
                     /locus_tag="Rahaq2_0267"
                     /note="Carboxypeptidase regulatory-like domain; Region:
                     CarboxypepD_reg; pfam13620"
                     /db_xref="CDD:257932"
     misc_feature    285036..285305
                     /locus_tag="Rahaq2_0267"
                     /note="MG2 domain; Region: A2M_N; pfam01835"
                     /db_xref="CDD:250904"
     misc_feature    286128..286547
                     /locus_tag="Rahaq2_0267"
                     /note="Alpha-2-macroglobulin family N-terminal region;
                     Region: A2M_N_2; pfam07703"
                     /db_xref="CDD:254373"
     misc_feature    286743..287021
                     /locus_tag="Rahaq2_0267"
                     /note="Alpha-2-macroglobulin family; Region: A2M;
                     pfam00207"
                     /db_xref="CDD:249678"
     misc_feature    287346..288122
                     /locus_tag="Rahaq2_0267"
                     /note="Proteins similar to alpha2-macroglobulin (alpha
                     (2)-M).  Alpha (2)-M is a major carrier protein in serum.
                     It is a broadly specific proteinase inhibitor.  The
                     structural thioester of alpha (2)-M, is involved in the
                     immobilization and entrapment of...; Region: A2M_like;
                     cd02891"
                     /db_xref="CDD:239221"
     misc_feature    order(287382..287384,287388..287393,287400..287402,
                     287511..287513,287541..287543,287550..287552)
                     /locus_tag="Rahaq2_0267"
                     /note="surface patch; other site"
                     /db_xref="CDD:239221"
     misc_feature    287382..287393
                     /locus_tag="Rahaq2_0267"
                     /note="thioester region; other site"
                     /db_xref="CDD:239221"
     misc_feature    order(287655..287657,287661..287663)
                     /locus_tag="Rahaq2_0267"
                     /note="specificity defining residues; other site"
                     /db_xref="CDD:239221"
     gene            288914..291283
                     /locus_tag="Rahaq2_0268"
                     /note="IMG reference gene:2506707293"
                     /db_xref="GeneID:11789990"
     CDS             288914..291283
                     /locus_tag="Rahaq2_0268"
                     /note="PFAM: Penicillin-Binding Protein C-terminus Family;
                     Penicillin binding protein transpeptidase domain;
                     Transglycosylase;
                     TIGRFAM: penicillin-binding protein 1C"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1C"
                     /protein_id="YP_005198355.1"
                     /db_xref="GI:383188227"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR009647"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="GeneID:11789990"
                     /translation="MITFPAFSKTAKRLLQNMAMAVFLLALIAVACRLWPHPPLSQGQ
                     PFSTVYYDRQGTLMRITLANDDRYRLWTPLEQVSPLAVKSLLLHEDRWFYSNPGFNPF
                     SLLRGFWRSYVAGGKMQGGSTITMQLARMHWHLNTRTPSGKLIQLLRAVQLELSYSKH
                     DILEAYLNTAPYGRNIESIGAASLIYFNKAPKDLTLPEALTLAVLPQSPSYRIDSKTG
                     VVGAALTQARNRLFQRWQAHYETDSSQLSLFRLPLALRQPEQMPYIAPHFIEQLRQQN
                     HQVIRTDTRVDSTLDAGLQRLAERQVNAFITRNESRGIHNAAVVLVDTRDMGVRALVG
                     SADYYNRTIQGQVNGTNAKRSPGSALKPFIYALGMEQGVLHPMTILKDVPSAFGAYAP
                     ENFDRRFLGPVTATDALNFSRNIPAVYVASQLHQPTFYQFLRLSGIANMSSENHYGLS
                     LVLGGGEVTMQELAKLYALLANRGVLQPLRMQKSDPRQAMTVRLLSEEASFMTLDMLR
                     QHRRPGDTLAQAPSSLPVYWKTGTSWGFRDAWSVGIFGPYVLVVWEGNFDSKGNNVFV
                     GADAAAPLFFNIIDSITASYPDLQEPERPFPKQLKRVDICLASGDLPTPWCQQKGKTW
                     FIPGKSPIKVDTVYRPVRLDKLTGEVACPPFDEDETRTEVFEFWPSDLANVFAQAGLP
                     KRKPPANHCKDEGVDVSGNPPRITSPLKNTTYTLRQSQQGRDRISFNAVTDADSKTVY
                     WFVDDIYLGSSASKSAIDWRPINNGQYRIRAVDDHGRADSRLVSIEIVN"
     misc_feature    289022..291271
                     /locus_tag="Rahaq2_0268"
                     /note="penicillin-binding protein 1C; Region: PBP_1c;
                     TIGR02073"
                     /db_xref="CDD:233709"
     misc_feature    289106..289615
                     /locus_tag="Rahaq2_0268"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:250219"
     misc_feature    289862..290653
                     /locus_tag="Rahaq2_0268"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl17760"
                     /db_xref="CDD:266819"
     misc_feature    291008..291253
                     /locus_tag="Rahaq2_0268"
                     /note="Penicillin-Binding Protein C-terminus Family;
                     Region: BiPBP_C; pfam06832"
                     /db_xref="CDD:253934"
     gene            complement(291298..292413)
                     /locus_tag="Rahaq2_0269"
                     /note="IMG reference gene:2506707294"
                     /db_xref="GeneID:11789991"
     CDS             complement(291298..292413)
                     /locus_tag="Rahaq2_0269"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198356.1"
                     /db_xref="GI:383188228"
                     /db_xref="InterPro:IPR000259"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="GeneID:11789991"
                     /translation="MNTKKQVLHNLASLIKLTLLGIAINSFSSLAQAGSAICSPENGA
                     GMSYENFLQEDIPASDNERGKKYEKSMNGGMQNYTIACNCTDNDASSSNGVLLMYTVK
                     TALPKGTELGYYKINDHIDVKASLDLPPATNVPVPTTKTLGDATHHTDANNNGVCVQQ
                     NTRASLNIGSQGSLTFYITTPFIGELDIPRTEIAEIYLSSGTAIVTAPPLGPPVARVY
                     VSGKLTVPQSCEINKGETITVNFGAIATNKFTTLNQPPKGFIPVTFNITYDCTVNGLP
                     QIPAGTQLAMLLKGDDLTDQYTLVARRRPSDNKADIGIRVENASGTAIPFESGNLPMN
                     QNGMGNISMTAYPINLIGGGLDTGEFSGMATLKIDIR"
     misc_feature    complement(291301..292359)
                     /locus_tag="Rahaq2_0269"
                     /note="Fimbrial protein; Region: Fimbrial; cl01416"
                     /db_xref="CDD:260929"
     gene            complement(292423..294966)
                     /locus_tag="Rahaq2_0270"
                     /note="IMG reference gene:2506707295"
                     /db_xref="GeneID:11789992"
     CDS             complement(292423..294966)
                     /locus_tag="Rahaq2_0270"
                     /note="PFAM: Fimbrial Usher protein"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, porin PapC"
                     /protein_id="YP_005198357.1"
                     /db_xref="GI:383188229"
                     /db_xref="InterPro:IPR000015"
                     /db_xref="InterPro:IPR018030"
                     /db_xref="GeneID:11789992"
                     /translation="MLTDEKFLQKSLSGDIKKTSAPLVLKLGSLLASTALGLLAAHPA
                     RSENVYFDPQFIERQAGDVGDVDLSLFQSNDQAQLPGNYDTALYVNKKLKIRYSISYL
                     PRPDGTLEPQITPDILRLLGVNVDAFPALKNHQPDAPLGALAQYIPAADVKFDFYLMQ
                     LNFSIPQAAILQKAEDYIDPEKWDDGAPVLFSNYSYSGGQRSYRNGSDDSSQYLNLQN
                     GFNVGPWRLRNYTTYSDSGDEKRWDTISTYAERDIKTLKSKFQIGENSTSGEILSSVP
                     FSGVQLFSDDNMLPNSQRGFAPTIRGIANSNAEVTIRQNDHIIYQSFVPPGAFEINDL
                     YPSSYSGNLEITVKEADGTERRFNQPFSAIPIMQRPGRLKYSATAGTYRATDNNEKEP
                     TFAQGTAIYGLSNTITSYGGSVVSEDYLSGLIGIGYNLQWLGGISADVTHARSTLDNN
                     QTTSGQSYRVQYSKNIEMTDTDLSLASYRYSSAGYYDFDESTQYLNGDNAPELDYHKR
                     SKIQFNINQTLWQGASLYLSGYKQDYWNNTGKEKNISLGLNNSLFGISYNLSYSYSQL
                     QDQDNDQQISLNVRIPLSRWLPQSWGTYNVSHQKGEGTRHQVGLSGTALDDRRLSYSV
                     QQSYTDQNSENGSNLYSSYRSSFGNINAGYNYSRDSQQLSYGIAGGIVAHSRGATLSQ
                     PLGDSFALIDTNGASGARLQNLPGVRTDWRGFAVVPYLTAYNENRIAMDTTTLPDDVD
                     IESTSVIVIPNSGAMVTAHFEAHVGARVLVTLVRPNGATVPFGAVAATDKQSNIVDEG
                     GVVYLSGIPLEKLVLLQVKWGNDASQQCQAQLNLSASTSQVNSLTAQCI"
     misc_feature    complement(292426..294882)
                     /locus_tag="Rahaq2_0270"
                     /note="P pilus assembly protein, porin PapC [Cell motility
                     and secretion / Intracellular trafficking and secretion];
                     Region: FimD; COG3188"
                     /db_xref="CDD:225729"
     misc_feature    complement(294373..294822)
                     /locus_tag="Rahaq2_0270"
                     /note="PapC N-terminal domain; Region: PapC_N; pfam13954"
                     /db_xref="CDD:258209"
     misc_feature    complement(292687..294330)
                     /locus_tag="Rahaq2_0270"
                     /note="Outer membrane usher protein; Region: Usher;
                     pfam00577"
                     /db_xref="CDD:249973"
     misc_feature    complement(292456..292659)
                     /locus_tag="Rahaq2_0270"
                     /note="PapC C-terminal domain; Region: PapC_C; pfam13953"
                     /db_xref="CDD:258208"
     gene            complement(295039..295725)
                     /locus_tag="Rahaq2_0271"
                     /note="IMG reference gene:2506707296"
                     /db_xref="GeneID:11789993"
     CDS             complement(295039..295725)
                     /locus_tag="Rahaq2_0271"
                     /note="PFAM: Gram-negative pili assembly chaperone,
                     C-terminal domain; Gram-negative pili assembly chaperone,
                     N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, chaperone PapD"
                     /protein_id="YP_005198358.1"
                     /db_xref="GI:383188230"
                     /db_xref="InterPro:IPR001829"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR016147"
                     /db_xref="InterPro:IPR016148"
                     /db_xref="InterPro:IPR018046"
                     /db_xref="GeneID:11789993"
                     /translation="MGKSKKLTLLFIIISVFTSQITYAGGIIVGRTRVIYDADKREAT
                     LSVKNNADNNPFLIQSWVDAGGEKTRGPFIITPPLFRLNAQQESNLRISYNGSALPTD
                     RESVFYINVKAIPSTPKNTKNELKLVVNTRIKLFYRPTKLPGKSFEAPKALTFSKNNG
                     HLVIKNQSPYHVVFSSLSIGSTFLKEVAMIAPLSELDVILPAKISGNSVKWEAINDYG
                     GTTERYEQPL"
     misc_feature    complement(295045..295725)
                     /locus_tag="Rahaq2_0271"
                     /note="P pilus assembly protein, chaperone PapD [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: FimC; COG3121"
                     /db_xref="CDD:225663"
     misc_feature    complement(295297..295650)
                     /locus_tag="Rahaq2_0271"
                     /note="Pili and flagellar-assembly chaperone, PapD
                     N-terminal domain; Region: PapD_N; pfam00345"
                     /db_xref="CDD:249787"
     misc_feature    complement(295054..295242)
                     /locus_tag="Rahaq2_0271"
                     /note="Pili assembly chaperone PapD, C-terminal domain;
                     Region: PapD_C; pfam02753"
                     /db_xref="CDD:251514"
     gene            complement(295831..296379)
                     /locus_tag="Rahaq2_0272"
                     /note="IMG reference gene:2506707297"
                     /db_xref="GeneID:11789994"
     CDS             complement(295831..296379)
                     /locus_tag="Rahaq2_0272"
                     /note="PFAM: Fimbrial protein"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, pilin FimA"
                     /protein_id="YP_005198359.1"
                     /db_xref="GI:383188231"
                     /db_xref="InterPro:IPR000259"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="InterPro:IPR014779"
                     /db_xref="GeneID:11789994"
                     /translation="MKTKFKLLAGGIFMAIAVNSYAIDGAINFTGAIVEEACEINGGE
                     ELNIPLGTYSAAQFQEIGDLSPKIPFTLPLDNCPVVSASNPTPHFRIWLESDTVADTT
                     DLIALGNDYGDAMADGVGIRIEDAETNEVMKINGLPDIIYPIPGKVMNVNLLAYYESF
                     KLPGDITAGAADARVKVTLDYR"
     misc_feature    complement(295834..296379)
                     /locus_tag="Rahaq2_0272"
                     /note="P pilus assembly protein, pilin FimA [Cell motility
                     and secretion / Intracellular trafficking and secretion];
                     Region: FimA; COG3539"
                     /db_xref="CDD:226069"
     gene            296967..297686
                     /locus_tag="Rahaq2_0273"
                     /note="IMG reference gene:2506707298"
                     /db_xref="GeneID:11789995"
     CDS             296967..297686
                     /locus_tag="Rahaq2_0273"
                     /note="PFAM: Response regulator receiver domain;
                     Transcriptional regulatory protein, C terminal"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator with CheY-like receiver
                     domain and winged-helix DNA-binding domain"
                     /protein_id="YP_005198360.1"
                     /db_xref="GI:383188232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="GeneID:11789995"
                     /translation="MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLL
                     TRESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDY
                     IPKPFNPRELLARIRAVLRRQANELPGAPSQEEAVISFGKFKLNLGTREMFREDEPMP
                     LTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAH
                     PRYIQTVWGLGYVFVPDGSKA"
     misc_feature    296967..297680
                     /locus_tag="Rahaq2_0273"
                     /note="osmolarity response regulator; Provisional; Region:
                     ompR; PRK09468"
                     /db_xref="CDD:181883"
     misc_feature    296988..297326
                     /locus_tag="Rahaq2_0273"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(296997..297002,297129..297131,297153..297155,
                     297213..297215,297270..297272,297279..297284)
                     /locus_tag="Rahaq2_0273"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    297129..297131
                     /locus_tag="Rahaq2_0273"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(297138..297143,297147..297155)
                     /locus_tag="Rahaq2_0273"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    297279..297287
                     /locus_tag="Rahaq2_0273"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    297378..297662
                     /locus_tag="Rahaq2_0273"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(297450..297452,297507..297512,297564..297566,
                     297573..297575,297597..297602,297636..297638,
                     297651..297653)
                     /locus_tag="Rahaq2_0273"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            297683..299044
                     /locus_tag="Rahaq2_0274"
                     /note="IMG reference gene:2506707299"
                     /db_xref="GeneID:11789996"
     CDS             297683..299044
                     /locus_tag="Rahaq2_0274"
                     /note="PFAM: HAMP domain; Histidine kinase-, DNA gyrase
                     B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="YP_005198361.1"
                     /db_xref="GI:383188233"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="GeneID:11789996"
                     /translation="MKRIRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQ
                     QFNKVLAYEVRMLMTDRLQLEDGTLLAVPPAFRREIYRELGISLYTNSAAEESGLRWA
                     QHYEFLSQQMAQQLGGPTDVRVEVNKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPL
                     FRYTLAIMLLAIGGAWLFIRIQNRPLVELEHAALQVGKGIIPPPLREYGASEVRSVTR
                     AFNQMAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMMGDDDSYLAESINKDIEE
                     CNAIIEQFIDYLRTGQEMPTEITDLNGILGEVIATESGYEREIDSDLADGELLVNAHP
                     LSIKRAVVNMVVNAARYGDGWIKVSSGRELQRAWFQVEDDGPGIAPDQLKHLFQPFVR
                     GESARTTSGTGLGLAIVQRIIDAHSGTLDIGKSDRGGLRIRAYLPLPVEMLKAVAVQQ
                     KPV"
     misc_feature    297695..298999
                     /locus_tag="Rahaq2_0274"
                     /note="osmolarity sensor protein; Provisional; Region:
                     envZ; PRK09467"
                     /db_xref="CDD:236531"
     misc_feature    298232..298354
                     /locus_tag="Rahaq2_0274"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(298238..298243,298247..298252,298259..298264,
                     298268..298270,298316..298321,298325..298330,
                     298337..298342,298346..298351)
                     /locus_tag="Rahaq2_0274"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    298382..298549
                     /locus_tag="Rahaq2_0274"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(298391..298393,298403..298405,298415..298417,
                     298424..298426,298436..298438,298445..298447,
                     298478..298480,298490..298492,298499..298501,
                     298511..298513,298520..298522,298532..298534)
                     /locus_tag="Rahaq2_0274"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    298409..298411
                     /locus_tag="Rahaq2_0274"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    298691..298990
                     /locus_tag="Rahaq2_0274"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(298709..298711,298721..298723,298730..298732,
                     298793..298795,298799..298801,298805..298807,
                     298811..298816,298889..298900,298946..298948,
                     298952..298954,298967..298972,298976..298978)
                     /locus_tag="Rahaq2_0274"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    298721..298723
                     /locus_tag="Rahaq2_0274"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(298805..298807,298811..298813,298889..298891,
                     298895..298897)
                     /locus_tag="Rahaq2_0274"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(299135..299299)
                     /locus_tag="Rahaq2_0275"
                     /note="IMG reference gene:2506707300"
                     /pseudo
                     /db_xref="GeneID:11789997"
     gene            complement(299395..301017)
                     /locus_tag="Rahaq2_0276"
                     /note="IMG reference gene:2506707301"
                     /db_xref="GeneID:11789998"
     CDS             complement(299395..301017)
                     /locus_tag="Rahaq2_0276"
                     /note="PFAM: Phosphoenolpyruvate carboxykinase;
                     TIGRFAM: phosphoenolpyruvate carboxykinase (ATP)"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent phosphoenolpyruvate carboxykinase"
                     /protein_id="YP_005198362.1"
                     /db_xref="GI:383188234"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /db_xref="GeneID:11789998"
                     /translation="MPTTIGITAETLSQYGIHQNSEIIYNPDYETLFAEETAPGLEGY
                     ERGQVTELGAVNVDTGIFTGRSPKDKYIVRDDTTRDTLWWADQGKGKNDNKPLSQATW
                     TSLKALVSKQLSGKRLFIIDAFCGANADSRLKVRFITEVAWQAHFVKNMFIRPDDSEL
                     ENFEPDFIVMNGAKCTNPDWQKQGLNSENFIAFNLTERIQLIGGSWYGGEMKKGMFAV
                     MNYLLPLQGIASMHCSANVGEKGDVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDD
                     GVFNFEGGCYAKTIKLSKDAEPEIFGAIKRDALLENVMVSADGKIDFNDGSKTENTRV
                     SYPIYHIQNIVKPVSKAGHASKVIFLTADAFGVLPPVSRLTAAQTQYHFLSGFTAKLA
                     GTERGVTEPTPTFSACFGAAFLMLHPTQYSEVLVKRMEAAGAQAYLVNTGWNGTGKRI
                     SLKNTRAIIDAILNGTIDDAETFTLPLFNLAVPVELPGVDTHILDPRNTYASREQWQE
                     KAEHLAQLFIDNFDKYTDTPAGAALVSAGPKR"
     misc_feature    complement(299407..300957)
                     /locus_tag="Rahaq2_0276"
                     /note="Phosphoenolpyruvate carboxykinase (PEPCK), a
                     critical gluconeogenic enzyme, catalyzes the first
                     committed step in the diversion of tricarboxylic acid
                     cycle intermediates toward gluconeogenesis. It catalyzes
                     the reversible decarboxylation and...; Region: PEPCK_ATP;
                     cd00484"
                     /db_xref="CDD:238270"
     misc_feature    complement(order(299653..299655,299662..299664,
                     299671..299673,300019..300021,300127..300129,
                     300154..300156,300160..300162,300211..300216,
                     300250..300270,300322..300324,300379..300384,
                     300391..300393,300397..300399,300823..300825))
                     /locus_tag="Rahaq2_0276"
                     /note="active site"
                     /db_xref="CDD:238270"
     misc_feature    complement(order(300019..300021,300160..300162,
                     300379..300384,300391..300393,300397..300399,
                     300823..300825))
                     /locus_tag="Rahaq2_0276"
                     /note="substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238270"
     misc_feature    complement(order(300160..300162,300211..300216,
                     300253..300255,300322..300324,300379..300381))
                     /locus_tag="Rahaq2_0276"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238270"
     misc_feature    complement(order(299653..299655,299671..299673,
                     300127..300129,300250..300270))
                     /locus_tag="Rahaq2_0276"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238270"
     gene            complement(301245..302129)
                     /locus_tag="Rahaq2_0277"
                     /note="IMG reference gene:2506707302"
                     /db_xref="GeneID:11793770"
     CDS             complement(301245..302129)
                     /locus_tag="Rahaq2_0277"
                     /note="PFAM: Hsp33 protein"
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide bond chaperone"
                     /protein_id="YP_005198363.1"
                     /db_xref="GI:383188235"
                     /db_xref="InterPro:IPR000397"
                     /db_xref="InterPro:IPR016153"
                     /db_xref="InterPro:IPR016154"
                     /db_xref="GeneID:11793770"
                     /translation="MSNHDQLHRYLFSHHAVRGELVSLKETFQQVVAGHDYPAEVRNL
                     LGEMLVATSLLTATLKFDGDITVQLQGDGPLKLAVINGNNKQELRGVARLQGDITEGS
                     SLKEMIGNGYMVITISPTVGERYQGVVGLEGENLAECLENYFMQSEQLPTRIFIRTGE
                     VEGQPAAGAMLLQVLPAQDTDPEEFSHLAQLTTTIKAEELLTLPANEVLYRLYHQEEV
                     TLYEPQDVCFRCTCSRERCAAALLTLPDEDIHEMLEADGKIEMHCDYCGADYEFDGMD
                     MATLKAGGDVHSGDDHVH"
     misc_feature    complement(301281..302123)
                     /locus_tag="Rahaq2_0277"
                     /note="Hsp33-like chaperonin; Reviewed; Region: hslO;
                     PRK00114"
                     /db_xref="CDD:234643"
     misc_feature    complement(301311..302111)
                     /locus_tag="Rahaq2_0277"
                     /note="Heat shock protein 33 (Hsp33):  Cytosolic protein
                     that acts as a molecular chaperone under oxidative
                     conditions.  In normal (reducing) cytosolic conditions,
                     four conserved Cys residues are coordinated by a Zn ion.
                     Under oxidative stress (such as heat...; Region: Hsp33;
                     cd00498"
                     /db_xref="CDD:238278"
     misc_feature    complement(order(301440..301442,301611..301613,
                     301683..301691,301701..301703,302076..302078))
                     /locus_tag="Rahaq2_0277"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238278"
     misc_feature    complement(order(301602..301613,301623..301625,
                     301629..301631,302076..302078))
                     /locus_tag="Rahaq2_0277"
                     /note="domain crossover interface; other site"
                     /db_xref="CDD:238278"
     misc_feature    complement(order(301332..301334,301341..301343,
                     301434..301436,301440..301442))
                     /locus_tag="Rahaq2_0277"
                     /note="redox-dependent activation switch; other site"
                     /db_xref="CDD:238278"
     gene            complement(302188..302592)
                     /locus_tag="Rahaq2_0278"
                     /note="IMG reference gene:2506707303"
                     /db_xref="GeneID:11789999"
     CDS             complement(302188..302592)
                     /locus_tag="Rahaq2_0278"
                     /note="PFAM: S4 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated heat shock protein"
                     /protein_id="YP_005198364.1"
                     /db_xref="GI:383188236"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="GeneID:11789999"
                     /translation="MKGKTEDDDNAVRLDKWLWAARFYKTRALAREMIDGGKVHYNGQ
                     RGKPSKLMELNAELTLRQGNDTKTIIVLGLTTQRRSAEEAQKLYQETEASIASREKIA
                     EARKMNAMPHPDRRPDKKERRNLIKFKYGDSE"
     misc_feature    complement(<302410..302559)
                     /locus_tag="Rahaq2_0278"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    complement(order(302434..302436,302440..302457,
                     302458..302460,302479..302481,302485..302490,
                     302497..302502,302506..302511,302515..302520,
                     302554..302556))
                     /locus_tag="Rahaq2_0278"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            complement(302617..303306)
                     /locus_tag="Rahaq2_0279"
                     /note="IMG reference gene:2506707304"
                     /db_xref="GeneID:11790000"
     CDS             complement(302617..303306)
                     /locus_tag="Rahaq2_0279"
                     /note="PFAM: haloacid dehalogenase-like hydrolase;
                     TIGRFAM: haloacid dehalogenase superfamily, subfamily IA,
                     variant 3 with third motif having DD or ED"
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase superfamily protein"
                     /protein_id="YP_005198365.1"
                     /db_xref="GI:383188237"
                     /db_xref="InterPro:IPR005833"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="GeneID:11790000"
                     /translation="MPSDFDWQCIDTVLLDMDGTLLDLAFDSQFWLQDVPLALSQQRA
                     IPLENARQLIHDEYLAVQHTMNWYCFDYWSERLSLDIYQMTTNIGKNARLRDDTLPFL
                     AHLRESGRQTILLTNAHPHSLSVKIEHTGLDQHLDLLLSTHTFGYPKEDQRLWSAVQR
                     QTGFNPDRTLFVDDGEPILNAAKTFGIRYCLGIENPDSTMANKSFEGHPSINDYRSLL
                     PAIHPVTGPAK"
     misc_feature    complement(302638..303306)
                     /locus_tag="Rahaq2_0279"
                     /note="GMP/IMP nucleotidase; Provisional; Region:
                     PRK14988"
                     /db_xref="CDD:237882"
     misc_feature    complement(302734..303273)
                     /locus_tag="Rahaq2_0279"
                     /note="haloacid dehalogenase superfamily, subfamily IA,
                     variant 3 with third motif having DD or ED; Region:
                     HAD-SF-IA-v3; TIGR01509"
                     /db_xref="CDD:233443"
     misc_feature    complement(302779..303030)
                     /locus_tag="Rahaq2_0279"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(302959..302961)
                     /locus_tag="Rahaq2_0279"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(303419..305551)
                     /locus_tag="Rahaq2_0280"
                     /note="IMG reference gene:2506707305"
                     /db_xref="GeneID:11790001"
     CDS             complement(303419..305551)
                     /locus_tag="Rahaq2_0280"
                     /note="PFAM: Intracellular growth attenuator protein IgaA"
                     /codon_start=1
                     /transl_table=11
                     /product="Intracellular growth attenuator protein IgaA"
                     /protein_id="YP_005198366.1"
                     /db_xref="GI:383188238"
                     /db_xref="InterPro:IPR010771"
                     /db_xref="GeneID:11790001"
                     /translation="MTLVLLCIAIIATASYFWLVLRRRQRDESVVRFSTPSQRKLSQK
                     ERDAVERYLRQNEGLGQTPITHRNNLIILRDKLTLTTKSENVYSLTRAITRYGVASED
                     PNKWRYFLDSTEIHLPPFWEQYIAQENQVELIKTQTLPLVISLNGHTLTEHVYEGPAP
                     VSAVMPSQPQNASIRHEESEHIELVKVRRETREEHALTRSNGVKEALAVSAILLVLFI
                     TLQSPVIFLPWLLLISAGLAAWVIWRLVSERLGKNRKEIHCLRGLPKRWGLFGESKQG
                     DISNISLGAVDLIYPPHWQPYIGRDLGQPTDVEVYMNSHVVRQGSYLTLHDEVKKFPL
                     QLWGRNLVLATSAFLLLLALLVYVPLGLPLKLSVAWLQGAQSSQVNSVQELEKAALRV
                     GDTLKVQGTGMCYVPPAASRSASGFMPFDCSAIYWNTATPLPVPQSEIIDAATALQTT
                     VNNQLHPGQNQMPEQNINPQLATAIEKSGMILLDDFADIVLKTETLCGNSNDCVRLKN
                     ALVNLGNSSNWNSLVKRAKAGTLQGINVLLRPVSAQSLSELVNNATSSFFVQETRRAA
                     DSLNSPPPGGFLISNDEGRQLIEMPAPPVGVFANPPQEQWKQLQQLSTLLLHTPFSAQ
                     GVITSISIDANGTRHISLHSEPDISTLWRYLGTSLLLLLLIGVLAVNTVLFIRRFIKD
                     KRRIDDIQQYYNSCFHPTLMPMPVQKLG"
     misc_feature    complement(303440..305545)
                     /locus_tag="Rahaq2_0280"
                     /note="Intracellular growth attenuator protein IgaA;
                     Region: IgaA; pfam07095"
                     /db_xref="CDD:254054"
     gene            306009..306566
                     /locus_tag="Rahaq2_0281"
                     /note="IMG reference gene:2506707306"
                     /db_xref="GeneID:11790002"
     CDS             306009..306566
                     /locus_tag="Rahaq2_0281"
                     /note="PFAM: NUDIX domain"
                     /codon_start=1
                     /transl_table=11
                     /product="NTP pyrophosphohydrolase"
                     /protein_id="YP_005198367.1"
                     /db_xref="GI:383188239"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="GeneID:11790002"
                     /translation="MTQHLQKPKITKVETVARSRLFTIESVDLTFSNGAERVYERMRP
                     SDREAVMIVPIIDNELLLIQEYAVGIESYELGFPKGLIDPGEGVLEAANRELMEEVGY
                     GARHFDVLAKLTMAPSYFSSRMNIVIAKDLYMKSLEGDEPEPLPQTRWPVSRMMELLQ
                     HPDFCEARNVSALFLAHDFLMRNAR"
     misc_feature    306009..306548
                     /locus_tag="Rahaq2_0281"
                     /note="adenosine nucleotide hydrolase NudE; Provisional;
                     Region: nudE; PRK11762"
                     /db_xref="CDD:183303"
     misc_feature    306153..306536
                     /locus_tag="Rahaq2_0281"
                     /note="ADP-ribose pyrophosphatase (ADPRase) catalyzes the
                     hydrolysis of ADP-ribose and a variety of additional
                     ADP-sugar conjugates to AMP and ribose-5-phosphate. Like
                     other members of the Nudix hydrolase superfamily, it
                     requires a divalent cation, such as Mg2+; Region:
                     ADPRase_NUDT5; cd03424"
                     /db_xref="CDD:239516"
     misc_feature    order(306153..306155,306207..306209,306249..306251,
                     306291..306293,306303..306305,306372..306374)
                     /locus_tag="Rahaq2_0281"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239516"
     misc_feature    order(306198..306200,306204..306206,306210..306212,
                     306225..306227,306342..306353,306357..306359,
                     306363..306377,306435..306440,306444..306446,
                     306483..306488,306510..306512,306522..306524,
                     306531..306533)
                     /locus_tag="Rahaq2_0281"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(306207..306209,306243..306251,306291..306293,
                     306303..306305,306372..306374,306435..306437)
                     /locus_tag="Rahaq2_0281"
                     /note="active site"
                     /db_xref="CDD:239516"
     misc_feature    order(306246..306257,306261..306314)
                     /locus_tag="Rahaq2_0281"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(306291..306293,306303..306305,306435..306437)
                     /locus_tag="Rahaq2_0281"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239516"
     gene            complement(306640..309195)
                     /locus_tag="Rahaq2_0282"
                     /note="IMG reference gene:2506707307"
                     /db_xref="GeneID:11793771"
     CDS             complement(306640..309195)
                     /locus_tag="Rahaq2_0282"
                     /note="PFAM: Penicillin binding protein transpeptidase
                     domain; Transglycosylase;
                     TIGRFAM: penicillin-binding protein, 1A family"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="YP_005198368.1"
                     /db_xref="GI:383188240"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="GeneID:11793771"
                     /translation="MKFVKYLLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDVRL
                     QTPMQVFSAEGDLIAQYGEKRRIPLKLDQIPPELVHAFIATEDSRFYEHHGVDPIGIF
                     RAASVALVSGHASQGASTITQQLARNFFLSPERTLTRKIKEAFLAIRIEQMMSKDEIL
                     ELYLNKIYLGYRAYGVGAAAQVYFGKNVSQLTLSEMAVIAGLPKAPSTFNPLYSHDRS
                     LARRNTVLARMLDEKYITQAQYDQARAEPLVANYHAPHIEFSAPYLTEMVRQEMVKRY
                     GDNAYNDGYMVYTTITKKTQLAAQEALRTNVLNYDMRHGYRGPSNQLWKVGEPAWDQD
                     KIVQSLKTLPVYGPLFPAVITATDDAQATATMSNRAVISLPFSGMRWARPYRNDNAQG
                     PTPKKVTDVVRPGQQVWVRKVGDDWWLAQVPDVNSAIVSLNPNDGAIEALVGGFDFNQ
                     SKFNRANQAVRQLGSNIKPFLYTAAMDKGLTLATILNDMPITRWDAGAGTDWRPKNSP
                     PTYYGPIRLRQGLGESKNVVMVRAMRAMGVDYAAEYLQRFGFPAANIVHSESLALGSA
                     SFTPLQVVRGYATLTNGGYLVDPYFITKIVDESGQVQFEAKPKIACRTCNIPVIYGDT
                     QKSAVLSDDNVENVATSAINNNTSVPTPQLEQVPPNSPQVDAAQQYAPHVISTPLSFL
                     ISDALNSNIFGEPGWMGTGWRAGRDLKRHDIGGKTGTTNSSKDAWFSGYGPDVVTSVW
                     IGFDDHRRDLGRSTASGVIPDQISGAEGGAKSAQPAWDDYMKAVLEGVPEQPQTPPPG
                     IVTVTIDKGTGKLSDGGGNSRPEYFIDGTQPTEHAVHEVGTTIMDNGQEHELF"
     misc_feature    complement(306643..309195)
                     /locus_tag="Rahaq2_0282"
                     /note="penicillin-binding protein 1a; Provisional; Region:
                     mrcA; PRK11636"
                     /db_xref="CDD:183248"
     misc_feature    complement(308506..309036)
                     /locus_tag="Rahaq2_0282"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:250219"
     misc_feature    complement(<307411..307914)
                     /locus_tag="Rahaq2_0282"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl17760"
                     /db_xref="CDD:266819"
     gene            309317..310168
                     /locus_tag="Rahaq2_0283"
                     /note="IMG reference gene:2506707308"
                     /db_xref="GeneID:11793772"
     CDS             309317..310168
                     /locus_tag="Rahaq2_0283"
                     /note="PFAM: Competence protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="Competence protein A"
                     /protein_id="YP_005198369.1"
                     /db_xref="GI:383188241"
                     /db_xref="GeneID:11793772"
                     /translation="MRLQAWQVGLDIQAGFARAIAVQRRRHGWQLRHWWQHPLPPFTL
                     REGILHETAPLIAILSCWRKTLPTAFSLRISLPAQRIMQQRMVAPDTRLGEPQRSAFI
                     FANAAKQFPLGMEHLVMDYRADPHGDNQLVVTAARQQEIEQWVQCMAQARLFPDAIEL
                     APCALQMAACAAGVPGDALLIHPLDDAFLWASPHSLPFQFGLLDHAEVVTETAVSQKI
                     RTQYRAAALCHAEDYFSGEFSGESSFAAMQCWSPLSAIVQLSAPLPANPGAFAPAVGL
                     AIRQADN"
     misc_feature    309338..>309820
                     /locus_tag="Rahaq2_0283"
                     /note="Tfp pilus assembly protein, ATPase PilM [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: PilM; COG4972"
                     /db_xref="CDD:227306"
     gene            310168..310731
                     /locus_tag="Rahaq2_0284"
                     /note="IMG reference gene:2506707309"
                     /db_xref="GeneID:11790003"
     CDS             310168..310731
                     /locus_tag="Rahaq2_0284"
                     /note="PFAM: Fimbrial assembly protein (PilN)"
                     /codon_start=1
                     /transl_table=11
                     /product="Tfp pilus assembly protein PilN"
                     /protein_id="YP_005198370.1"
                     /db_xref="GI:383188242"
                     /db_xref="InterPro:IPR007813"
                     /db_xref="GeneID:11790003"
                     /translation="MLQVNLLPWRKLRRQKRMRNWLKIFVSVPLSVVVCAWLLAAFIV
                     QERTLLQVKLSALNSGIQKIMLQQRRVDVASAQVKVLAETRLLSHQRVLQSRDYLQLL
                     ELLALKMPEELWLTELTEHQGMLTLKGEGRLYHDILALSEILSAGELLSKVSLSAVQQ
                     QPNHNLSFVMKTQFRSERALPAPGVSQ"
     misc_feature    310168..>310650
                     /locus_tag="Rahaq2_0284"
                     /note="Fimbrial assembly protein (PilN); Region: PilN;
                     cl19830"
                     /db_xref="CDD:268183"
     gene            310728..311588
                     /locus_tag="Rahaq2_0285"
                     /note="IMG reference gene:2506707310"
                     /db_xref="GeneID:11790004"
     CDS             310728..311588
                     /locus_tag="Rahaq2_0285"
                     /note="PFAM: Protein of unknown function (DUF2531)"
                     /codon_start=1
                     /transl_table=11
                     /product="Tfp pilus assembly protein PilO"
                     /protein_id="YP_005198371.1"
                     /db_xref="GI:383188243"
                     /db_xref="InterPro:IPR019684"
                     /db_xref="GeneID:11790004"
                     /translation="MTGFLSEHIDPLMEKPGWQRVFILTACLLVLVLTLYQCVLRGLW
                     QQQETLKREIDTARQTLSRDQMALMRMIPLERLEQELAGNAILRRESLPLEQEFAGPL
                     QDAQAVLIRWQPVSPPKQEPQGELQLQVTFTGLMHFLYALLQRPEQPAFSELNLHTTG
                     DAGMKASVVLTQTVQAGVFVNGAVAAKAVRDPFRAPQTPACADVSPLSEWLLSGISDA
                     GGQRYGWLLSPQGRWNKVETGSRFGAPQWTVEALSSSQVELSLSDARCGAQRQIISLG
                     KGNDSPGKGK"
     misc_feature    310761..>311138
                     /locus_tag="Rahaq2_0285"
                     /note="Pilus assembly protein, PilO; Region: PilO;
                     cl01234"
                     /db_xref="CDD:260846"
     misc_feature    311289..>311516
                     /locus_tag="Rahaq2_0285"
                     /note="Protein of unknown function (DUF2531); Region:
                     DUF2531; pfam10748"
                     /db_xref="CDD:256151"
     gene            311588..312850
                     /locus_tag="Rahaq2_0286"
                     /note="IMG reference gene:2506707311"
                     /db_xref="GeneID:11790005"
     CDS             311588..312850
                     /locus_tag="Rahaq2_0286"
                     /note="PFAM: Bacterial type II/III secretion system short
                     domain; Secretin and TonB N terminus short domain;
                     Bacterial type II and III secretion system protein;
                     TIGRFAM: type IV pilus secretin (or competence protein)
                     PilQ"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus secretin PilQ/competence protein"
                     /protein_id="YP_005198372.1"
                     /db_xref="GI:383188244"
                     /db_xref="InterPro:IPR001775"
                     /db_xref="InterPro:IPR001814"
                     /db_xref="InterPro:IPR004846"
                     /db_xref="InterPro:IPR005644"
                     /db_xref="InterPro:IPR011662"
                     /db_xref="GeneID:11790005"
                     /translation="MKYVNKQIVLFLLCLCLSPVKADAPPLISLEFQSSPVGLVLQAL
                     ADSRQLNLVTAPGLEGLMSVKLKEVPWQQALDIILQMNHLTSQLQGNVLLVSPEEDPQ
                     IVQQRMKDAADQQALQSPLISLTVPLQYADAKETALSLNAQKGSLLSQKGNASADTRT
                     NTLLLRDTQVALDVVAPWVKEMDLPLQQVQLAAHIVTMNSESLRELGVRWGFTGEEPI
                     TKAVRMNNFSMGMPVENPIFTAGFNLAHISGRILDLELTALEQEDKVDIIASPRLLTA
                     HMQTASIKQGTEIPYQVSSGASGSTSIEFKEAVLGMEVTPKIQRNGHIQLALQISQNM
                     PGRSIKQSEGEALAIDKQEIKTQVTVKDGETIVLGGIFQRKTQKTDTKVPVLGDIPGV
                     GSLFKHQYTNEQRRELVIFITPTLILTR"
     misc_feature    311705..312838
                     /locus_tag="Rahaq2_0286"
                     /note="putative outer membrane porin HofQ; Provisional;
                     Region: hofQ; PRK13568"
                     /db_xref="CDD:237430"
     misc_feature    311711..311878
                     /locus_tag="Rahaq2_0286"
                     /note="Secretin and TonB N terminus short domain; Region:
                     STN; pfam07660"
                     /db_xref="CDD:254338"
     misc_feature    311960..312142
                     /locus_tag="Rahaq2_0286"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    312359..312838
                     /locus_tag="Rahaq2_0286"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; pfam00263"
                     /db_xref="CDD:249725"
     gene            313199..313720
                     /locus_tag="Rahaq2_0287"
                     /note="IMG reference gene:2506707312"
                     /db_xref="GeneID:11790006"
     CDS             313199..313720
                     /locus_tag="Rahaq2_0287"
                     /note="PFAM: Shikimate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="YP_005198373.1"
                     /db_xref="GI:383188245"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR023000"
                     /db_xref="GeneID:11790006"
                     /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDHEIERRTG
                     ADVGWVFDLEGEDGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVY
                     LETTIEKQLARTQRDKKRPLLQVSAPPREVLEALARERNPLYEEIADVTIRTDDQSAK
                     VVANQIINMLESN"
     misc_feature    313208..313717
                     /locus_tag="Rahaq2_0287"
                     /note="Shikimate kinase [Amino acid transport and
                     metabolism]; Region: AroK; COG0703"
                     /db_xref="CDD:223775"
     misc_feature    313214..313672
                     /locus_tag="Rahaq2_0287"
                     /note="Shikimate kinase (SK) is the fifth enzyme in the
                     shikimate pathway, a seven-step biosynthetic pathway which
                     converts erythrose-4-phosphate to chorismic acid, found in
                     bacteria, fungi and plants. Chorismic acid is a important
                     intermediate in the synthesis...; Region: SK; cd00464"
                     /db_xref="CDD:238260"
     misc_feature    order(313238..313255,313535..313537,313556..313558)
                     /locus_tag="Rahaq2_0287"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:238260"
     misc_feature    order(313250..313252,313298..313300,313304..313306)
                     /locus_tag="Rahaq2_0287"
                     /note="magnesium binding site [ion binding]; other site"
                     /db_xref="CDD:238260"
     misc_feature    order(313304..313306,313376..313378,313385..313387,
                     313439..313447,313616..313618)
                     /locus_tag="Rahaq2_0287"
                     /note="putative shikimate binding site; other site"
                     /db_xref="CDD:238260"
     gene            313778..314860
                     /locus_tag="Rahaq2_0288"
                     /note="IMG reference gene:2506707313"
                     /db_xref="GeneID:11790007"
     CDS             313778..314860
                     /locus_tag="Rahaq2_0288"
                     /note="PFAM: 3-dehydroquinate synthase;
                     TIGRFAM: 3-dehydroquinate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="YP_005198374.1"
                     /db_xref="GI:383188246"
                     /db_xref="InterPro:IPR002658"
                     /db_xref="InterPro:IPR016037"
                     /db_xref="InterPro:IPR016303"
                     /db_xref="GeneID:11790007"
                     /translation="MERITVTLGERSYPITIAAGLFHDPASFMPVKAGDQVMIVTNET
                     LAPLYLDAIRSVLEQAGVRVDQVILPDGEQYKSLTVLNDVFSALLEKPHGRDTTLIAL
                     GGGVVGDLTGFAAASYQRGVRFVQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQP
                     ASVVVDLDCLRTLPAREMSSGLAEVIKYGIILDADFFMWLEDNMDALLALDMNALAYC
                     IRRCCELKAEVVAADERENGLRALLNLGHTYGHAIEAEMGYGNWLHGEAVAAGMVMAC
                     YTAHRLGQFSLGDIARVKALLTRAGLPVTGPEVMAAQSYLPHMMRDKKVLAGELRLVL
                     PKAIGQSEVRSGVSHEMVLASIEDCR"
     misc_feature    313811..314845
                     /locus_tag="Rahaq2_0288"
                     /note="Dehydroquinate synthase (DHQS) catalyzes the
                     conversion of DAHP to DHQ in shikimate pathway for
                     aromatic compounds synthesis; Region: DHQS; cd08195"
                     /db_xref="CDD:173954"
     misc_feature    order(313901..313903,314087..314095,314102..314104,
                     314111..314113,314162..314167,314171..314173,
                     314228..314230,314237..314239,314282..314284,
                     314306..314308,314327..314329,314339..314341,
                     314516..314518,314528..314530,314567..314569)
                     /locus_tag="Rahaq2_0288"
                     /note="active site"
                     /db_xref="CDD:173954"
     misc_feature    order(314009..314011,314030..314035,314114..314116,
                     314123..314125,314129..314137,314201..314206,
                     314231..314248)
                     /locus_tag="Rahaq2_0288"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173954"
     misc_feature    order(314327..314329,314516..314518,314567..314569)
                     /locus_tag="Rahaq2_0288"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173954"
     gene            314988..316037
                     /locus_tag="Rahaq2_0289"
                     /note="IMG reference gene:2506707314"
                     /db_xref="GeneID:11790008"
     CDS             314988..316037
                     /locus_tag="Rahaq2_0289"
                     /note="PFAM: Sporulation related domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198375.1"
                     /db_xref="GI:383188247"
                     /db_xref="InterPro:IPR007730"
                     /db_xref="GeneID:11790008"
                     /translation="MDDLTPEDDLKPDTSDRRPPRARKPSPSIPKVAVSRQYVMIGIG
                     IVVLVLLIVGIGSAMKSPSSSQTVQQTNGPKDISLAGNDAAAPAQPSAQAQANTAQAV
                     DGQQPADSQQPKSIGLPPVSPTPTEAQPVPDNGQAKERVDLPGDMSDALSSQQNQVDG
                     VAQGSMAPAAQSLTSLPTAPATVNGSARTQAPAGSQPSATHTRPAQSSRNVQPAHTSK
                     PAEHKTSATASHTAKTPATKSSASSAPVASAPATASGSTSAIKSAPGTHFTLQLSGAS
                     QSNTLNAFAKQQGLKNYLVYQTARDGKPWFVLVSGNYASSAEAKRAISSLPAEVQAKK
                     PWVKPVHQVQQDLKK"
     misc_feature    314988..316034
                     /locus_tag="Rahaq2_0289"
                     /note="hypothetical protein; Reviewed; Region: PRK11901"
                     /db_xref="CDD:237015"
     misc_feature    315777..316004
                     /locus_tag="Rahaq2_0289"
                     /note="Sporulation related domain; Region: SPOR;
                     pfam05036"
                     /db_xref="CDD:252961"
     gene            316118..316933
                     /locus_tag="Rahaq2_0290"
                     /note="IMG reference gene:2506707315"
                     /db_xref="GeneID:11790009"
     CDS             316118..316933
                     /locus_tag="Rahaq2_0290"
                     /note="PFAM: D12 class N6 adenine-specific DNA
                     methyltransferase;
                     TIGRFAM: DNA adenine methylase (dam)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA adenine methylase Dam"
                     /protein_id="YP_005198376.1"
                     /db_xref="GI:383188248"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR012327"
                     /db_xref="InterPro:IPR023095"
                     /db_xref="GeneID:11790009"
                     /translation="MKKNRAFLKWAGGKYPLIDDIRRHLPVGDCLIEPFVGAGSVFLN
                     TEYDAYILADINSDLINLYNIVKTRTEEFVRDARVLFTPEFNESDRFYVLRAEFNASS
                     DTYRRSVLFLYLNRHCYNGLCRYNLSGAFNVPFGRYKKPYFPEEELYWFAEKAKHAVF
                     VCEHYQDTLLKAQSGSVVYCDPPYAPLSATANFTAYHTNSFSMDDQRNLARLAYQLSN
                     ENDVPVLISNHETPLTLEWYAQAKQLHRVSARRTISSKVAQRSMVNELLALYR"
     misc_feature    316118..316930
                     /locus_tag="Rahaq2_0290"
                     /note="D12 class N6 adenine-specific DNA
                     methyltransferase; Region: MethyltransfD12; cl17344"
                     /db_xref="CDD:266636"
     gene            316984..317661
                     /locus_tag="Rahaq2_0291"
                     /note="IMG reference gene:2506707316"
                     /db_xref="GeneID:11790010"
     CDS             316984..317661
                     /locus_tag="Rahaq2_0291"
                     /note="PFAM: Ribulose-phosphate 3 epimerase family;
                     TIGRFAM: ribulose-phosphate 3-epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="YP_005198377.1"
                     /db_xref="GI:383188249"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:11790010"
                     /translation="MKQFLIAPSILSADFARLGEDTAKALEAGGDVVHFDVMDNHYVP
                     NLTMGPAILKSLRNYGITAPIDVHLMVKPVDRLIPDFAEAGASYITFHPEASEHVDRS
                     LQLIKSHGCKAGLVFNPATSLSYLEYVMDKLDVILLMSVNPGFGGQSFIPGTLDKLRQ
                     VRKIIDASGYDIRLEVDGGVKAENIGEIAAAGADMFVAGSAIFNQPDYRTVIDHMRSE
                     LAKVSHD"
     misc_feature    316996..317631
                     /locus_tag="Rahaq2_0291"
                     /note="Ribulose-5-phosphate 3-epimerase (RPE). This enzyme
                     catalyses the interconversion of D-ribulose 5-phosphate
                     (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin
                     cycle (reductive pentose phosphate pathway) in
                     chloroplasts and in the oxidative pentose...; Region: RPE;
                     cd00429"
                     /db_xref="CDD:238244"
     misc_feature    order(317008..317010,317014..317016,317089..317091,
                     317191..317193,317410..317415,317419..317424,
                     317512..317514,317518..317520,317578..317583)
                     /locus_tag="Rahaq2_0291"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238244"
     misc_feature    order(317029..317031,317038..317040,317098..317100,
                     317104..317109,317113..317115,317119..317130,
                     317200..317202,317212..317214,317275..317277,
                     317281..317286,317338..317340,317347..317349,
                     317353..317355,317365..317367,317407..317409,
                     317434..317436,317440..317442,317452..317454)
                     /locus_tag="Rahaq2_0291"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238244"
     misc_feature    order(317083..317085,317089..317091,317185..317187,
                     317512..317514)
                     /locus_tag="Rahaq2_0291"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238244"
     gene            317654..318352
                     /locus_tag="Rahaq2_0292"
                     /note="IMG reference gene:2506707317"
                     /db_xref="GeneID:11790011"
     CDS             317654..318352
                     /locus_tag="Rahaq2_0292"
                     /note="PFAM: haloacid dehalogenase-like hydrolase;
                     TIGRFAM: haloacid dehalogenase superfamily, subfamily IA,
                     variant 3 with third motif having DD or ED; haloacid
                     dehalogenase superfamily, subfamily IA, variant 1 with
                     third motif having Dx(3-4)D or Dx(3-4)E;
                     2-phosphoglycolate phosphatase, prokaryotic"
                     /codon_start=1
                     /transl_table=11
                     /product="2-phosphoglycolate phosphatase"
                     /protein_id="YP_005198378.1"
                     /db_xref="GI:383188250"
                     /db_xref="InterPro:IPR005833"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006346"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="GeneID:11790011"
                     /translation="MTDILAARGLGFDLDGTLVDSAPGLSEAMDLALQDFGLPAAGVE
                     RLSTWIGNGADVMVERAVRWAEGDLSPEFLQSVRDKFDHYYADTAAGGSRLYPQVKET
                     LAALAAAGLPMGLVTNKPTPFIAPLLQSLGIDSYFTVVIGGDDVVAKKPHPAPVYMTL
                     ALLGLRASEMVFVGDSRNDIHAAQAAGCPCVGMTYGYNYGETIALTKPDRVLDNFADL
                     LPTLGLLSLKDQEA"
     misc_feature    317675..318304
                     /locus_tag="Rahaq2_0292"
                     /note="phosphoglycolate phosphatase; Provisional; Region:
                     PRK13222"
                     /db_xref="CDD:237310"
     misc_feature    317894..318232
                     /locus_tag="Rahaq2_0292"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    318002..318004
                     /locus_tag="Rahaq2_0292"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            318354..319370
                     /locus_tag="Rahaq2_0293"
                     /note="IMG reference gene:2506707318"
                     /db_xref="GeneID:11790012"
     CDS             318354..319370
                     /locus_tag="Rahaq2_0293"
                     /note="PFAM: tRNA synthetases class I (W and Y);
                     TIGRFAM: tryptophanyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="YP_005198379.1"
                     /db_xref="GI:383188251"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="GeneID:11790012"
                     /translation="MSKPIVFSGAQPSGELTIGNYMGALRQWVKMQDDYECIYCIVDL
                     HAITVRQDAEKLRKATLDTLALYLAVGIDPKKSTIFVQSHVPEHSQLSWALNCYTYFG
                     ELGRMTQFKDKSARYETSNSESITAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLEL
                     SRDIASRFNALYGDVFTVPEPFIPKSGARVMSLQEPTKKMSKSDDNRKNVIGLLEDPK
                     AVTKKIKSAMTDSEEPPVIRYDIKNKPGVSNLLDILSGVTGKAIPELEAEFEGQMYGH
                     LKGAVAEAVSGMLTEVQERFNRFRSDEAYLQEVMKEGAEKARARASVTLKKAYEAIGF
                     VTLP"
     misc_feature    318360..319358
                     /locus_tag="Rahaq2_0293"
                     /note="tryptophanyl-tRNA synthetase; Reviewed; Region:
                     PRK00927"
                     /db_xref="CDD:234866"
     misc_feature    318366..319217
                     /locus_tag="Rahaq2_0293"
                     /note="catalytic core domain of tryptophanyl-tRNA
                     synthetase; Region: TrpRS_core; cd00806"
                     /db_xref="CDD:173903"
     misc_feature    order(318372..318386,318402..318404,318408..318413,
                     318420..318422,318471..318473,318486..318488,
                     318597..318599,318747..318749,318759..318761,
                     318768..318770,318795..318797,318801..318806,
                     318810..318815,318822..318824,318918..318920,
                     318948..318953,318957..318959)
                     /locus_tag="Rahaq2_0293"
                     /note="active site"
                     /db_xref="CDD:173903"
     misc_feature    318402..318413
                     /locus_tag="Rahaq2_0293"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173903"
     misc_feature    order(318483..318485,318492..318497,318615..318620,
                     318624..318632,318639..318644,318648..318659,
                     318663..318668,318735..318737,318741..318746,
                     318753..318758)
                     /locus_tag="Rahaq2_0293"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173903"
     misc_feature    318948..318962
                     /locus_tag="Rahaq2_0293"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173903"
     gene            complement(319459..320844)
                     /locus_tag="Rahaq2_0294"
                     /note="IMG reference gene:2506707319"
                     /db_xref="GeneID:11790013"
     CDS             complement(319459..320844)
                     /locus_tag="Rahaq2_0294"
                     /note="PFAM: Sirohaem synthase dimerisation region;
                     Tetrapyrrole (Corrin/Porphyrin) Methylases;
                     TIGRFAM: uroporphyrin-III C-methyltransferase; siroheme
                     synthase, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="YP_005198380.1"
                     /db_xref="GI:383188252"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR003043"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019478"
                     /db_xref="GeneID:11790013"
                     /translation="MDYLPLFCQLKNRACLLVGAGDVAERKARLLLEAGAKLTVNALT
                     FTPQFQIWAEEGKVRLLRGEFSPLLVDEKWLVIAATDSDLVNQEVSEAADHRRVFCNV
                     VDAPESASVIMPSIIDRSPLMIAVSSGGNAPVLARLLRERLESILPQHLGKLAQIAGG
                     LRARVKTHFPDASERRRWWEKLFNHHRLAQSLANNDDAQSQEYLEELFREPVDKQGEV
                     ILVGAGPGDAGLLTLKGLQQMQLADVVVYDRLVSDGVLNLVRRDAERIFVGKRAGHHC
                     VPQERINEILLEQAQMGKRVVRLKGGDPFIFGRGGEELEALKAAGIPFSVVPGITAAS
                     GCSAYSGIPLTHRDHAQSVRLITGHAKQDGILDWACMAQPQQTLVFYMGLTQAGEIQR
                     NLLENGLTAETPVALVENGTSQQQRVVTGKLTELESLAKKVQSPSLIIVGSVVSLRQQ
                     LNWFASETLTV"
     misc_feature    complement(319474..320844)
                     /locus_tag="Rahaq2_0294"
                     /note="siroheme synthase; Provisional; Region: cysG;
                     PRK10637"
                     /db_xref="CDD:182606"
     misc_feature    complement(320500..320829)
                     /locus_tag="Rahaq2_0294"
                     /note="Putative NAD(P)-binding; Region: NAD_binding_7;
                     pfam13241"
                     /db_xref="CDD:257598"
     misc_feature    complement(320404..320484)
                     /locus_tag="Rahaq2_0294"
                     /note="Sirohaem biosynthesis protein central; Region:
                     Sirohm_synth_M; pfam14824"
                     /db_xref="CDD:258961"
     misc_feature    complement(320221..320400)
                     /locus_tag="Rahaq2_0294"
                     /note="Sirohaem synthase dimerization region; Region:
                     CysG_dimeriser; pfam10414"
                     /db_xref="CDD:204480"
     misc_feature    complement(319507..320196)
                     /locus_tag="Rahaq2_0294"
                     /note="Uroporphyrin-III C-methyltransferase
                     (S-Adenosyl-L-methionine:uroporphyrinogen III
                     methyltransferase, SUMT); Region: SUMT; cd11642"
                     /db_xref="CDD:212501"
     misc_feature    complement(order(319531..319542,319606..319608,
                     319612..319617,319621..319623,319693..319707,
                     319768..319770,319774..319776,319837..319839,
                     319849..319854,319918..319929,319936..319944,
                     320095..320103,320170..320172))
                     /locus_tag="Rahaq2_0294"
                     /note="active site"
                     /db_xref="CDD:212501"
     misc_feature    complement(order(319531..319539,319612..319617,
                     319621..319623,319702..319704,319849..319854,
                     319924..319929,319936..319944,320170..320172))
                     /locus_tag="Rahaq2_0294"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212501"
     misc_feature    complement(order(319780..319794,319804..319812,
                     319816..319818,319840..319845,319855..319857,
                     319861..319863,319867..319869,319888..319893,
                     319903..319905,319909..319914,319924..319932,
                     319936..319938,320137..320139,320143..320160))
                     /locus_tag="Rahaq2_0294"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212501"
     gene            complement(320905..321258)
                     /locus_tag="Rahaq2_0295"
                     /note="IMG reference gene:2506707320"
                     /db_xref="GeneID:11790014"
     CDS             complement(320905..321258)
                     /locus_tag="Rahaq2_0295"
                     /note="TIGRFAM: nitrite reductase [NAD(P)H], small
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent nitrite reductase, small
                     subunit"
                     /protein_id="YP_005198381.1"
                     /db_xref="GI:383188253"
                     /db_xref="InterPro:IPR017881"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="GeneID:11790014"
                     /translation="MMSQWLTLCSVDQILPACGVCALAGDQQIALFRPYADEQIFALS
                     NIDPFAQASVLSRGIIAEHQGELWVASPLKKQHFRLTDGVCMEDEQYSVPAYEVRVQD
                     GNVQINTASLRAEIS"
     misc_feature    complement(320938..321246)
                     /locus_tag="Rahaq2_0295"
                     /note="Assimilatory nitrite reductase (NirD) family,
                     Rieske domain; Assimilatory nitrate and nitrite reductases
                     convert nitrate through nitrite to ammonium. Members
                     include bacterial and fungal proteins. The bacterial NirD
                     contains a single Rieske domain while...; Region:
                     Rieske_NirD; cd03529"
                     /db_xref="CDD:239605"
     gene            complement(321255..323804)
                     /locus_tag="Rahaq2_0296"
                     /note="IMG reference gene:2506707321"
                     /db_xref="GeneID:11790015"
     CDS             complement(321255..323804)
                     /locus_tag="Rahaq2_0296"
                     /note="PFAM: Pyridine nucleotide-disulphide
                     oxidoreductase; Nitrite and sulphite reductase 4Fe-4S
                     domain; BFD-like [2Fe-2S] binding domain; Nitrite/Sulfite
                     reductase ferredoxin-like half domain;
                     TIGRFAM: nitrite reductase [NAD(P)H], large subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent nitrite reductase, large
                     subunit"
                     /protein_id="YP_005198382.1"
                     /db_xref="GI:383188254"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005117"
                     /db_xref="InterPro:IPR006066"
                     /db_xref="InterPro:IPR006067"
                     /db_xref="InterPro:IPR007419"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR017121"
                     /db_xref="GeneID:11790015"
                     /translation="MSKVRLAIIGNGMVGHRFIEDLLDKAEPGQFDITVFCEEPRVAY
                     DRVHLSSYFSHHTAEELSLVREGFYEKHHVNVLTGERAITLNRKEKVIHSSSGRTVYY
                     DKLIIATGSYPWVPPITGSDGQDCFVYRTIEDLHAIESCARRSKRGAVVGGGLLGLEA
                     AGALKNLGVETHVVEFAPGLMAEQLDTQGGSQLRQKIESMGVRVHTAKNTKQIIQGGT
                     SARKTMEFADGTFLEVDFIVFSTGIRPQDKLARQCDLEIAPRGGIVINDQCQTSDPDV
                     YAIGECASWNQRTFGLVAPGYKMAQVTADHLLGRDNAFTGADMSAKLKLLGVDVAGIG
                     DAHARTPGARSYVYLDETKALYKRLVVSEDNKTLLGAVLVGDTSDYGNLLQLVLNSIP
                     LPENPDALILPAHSGSGTAVIGTDALPESAQICSCFDVTKGDIIKAVQGGCHTVAALK
                     SATKAGTGCGGCIPLVTQVLNAELSKQGIEVNHHLCEHFAYSRQELYHLIRVEGIRSF
                     DDLLNKYGKGYGCEVCKPTVGSLLASCWNDYVLKPQHTPLQDTNDVFLANMQKDGTYS
                     VIPRSPGGEITPQGLQAIGEIAAEYNLYTKITGSQRIGMFGAQKDDLPAIWQKLINAG
                     FETGQAYAKALRMAKTCVGSTWCRYGVGDSLGFGISLENRYKGIRTPHKMKFGVSGCT
                     RECSEAQGKDVGIIATENGWNLYVCGNGGMKPRHGDLLAADLDNDTLLRYLDRFMMFY
                     IRTADKLQRTSVWMDNLEGGIGYLRNVIIDNKLGLNDQLEAELTRLRESAVCEWQETL
                     NDPAAQTRFSHFINSSQRDPNVQFVGERQQHRPARPDERIPVTLVTDGEEV"
     misc_feature    complement(321270..323804)
                     /locus_tag="Rahaq2_0296"
                     /note="nitrite reductase subunit NirD; Provisional;
                     Region: PRK14989"
                     /db_xref="CDD:184951"
     misc_feature    complement(322383..322541)
                     /locus_tag="Rahaq2_0296"
                     /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
                     pfam04324"
                     /db_xref="CDD:252526"
     misc_feature    complement(321948..322127)
                     /locus_tag="Rahaq2_0296"
                     /note="Nitrite/Sulfite reductase ferredoxin-like half
                     domain; Region: NIR_SIR_ferr; pfam03460"
                     /db_xref="CDD:251971"
     misc_feature    complement(321495..321914)
                     /locus_tag="Rahaq2_0296"
                     /note="Nitrite and sulphite reductase 4Fe-4S domain;
                     Region: NIR_SIR; pfam01077"
                     /db_xref="CDD:250346"
     gene            324028..325311
                     /locus_tag="Rahaq2_0297"
                     /note="IMG reference gene:2506707322"
                     /db_xref="GeneID:11790016"
     CDS             324028..325311
                     /locus_tag="Rahaq2_0297"
                     /note="PFAM: Amidohydrolase family"
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine deaminase"
                     /protein_id="YP_005198383.1"
                     /db_xref="GI:383188255"
                     /db_xref="InterPro:IPR013108"
                     /db_xref="GeneID:11790016"
                     /translation="MTKTLLRTVKNVRLPDREGLWQIDIEDGVIRQIVPQLDNADYGK
                     HILDAEGGLAIPPFIEPHIHLDTTQTAGQPAWNQSGTLFEGIERWAERKALLSHEDVK
                     QRAWQTLKWQIANGIQHVRTHVDVSDPTLTALKAMLEVKAEVAPWITLQIVAFPQEGI
                     MSYPNGEALLEEALRLGADVVGAIPHFEFTREYGVESLHKTFGLAKKYNALIDVHCDE
                     IDDEQSRFVETVAALALRENMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVAN
                     PLVNIHLQGRFDTYPKRRGITRVKEMLEAGINVCFGHDDVFDPWYPLGTANMLQVLHM
                     GLHVCQLMGYQQIDDGLKLITTYSARTMNLQGYGLESGHAASLIILPAQSGFDAVRRQ
                     TPVQYSLREGVLIAQTQLAKTIIHLDKDHLVDFNS"
     misc_feature    324028..325293
                     /locus_tag="Rahaq2_0297"
                     /note="Cytosine deaminase and related metal-dependent
                     hydrolases [Nucleotide transport and metabolism / General
                     function prediction only]; Region: SsnA; COG0402"
                     /db_xref="CDD:223479"
     misc_feature    324049..325242
                     /locus_tag="Rahaq2_0297"
                     /note="Bacterial cytosine deaminase and related
                     metal-dependent hydrolases. Cytosine deaminases (CDs)
                     catalyze the deamination of cytosine, producing uracil and
                     ammonia. They play an important role in pyrimidine
                     salvage. CDs are present in prokaryotes and fungi; Region:
                     Bact_CD; cd01293"
                     /db_xref="CDD:238618"
     misc_feature    order(324211..324213,324217..324219,324670..324672,
                     324679..324681,324766..324768,324967..324969)
                     /locus_tag="Rahaq2_0297"
                     /note="active site"
                     /db_xref="CDD:238618"
     gene            325457..326023
                     /locus_tag="Rahaq2_0298"
                     /note="IMG reference gene:2506707323"
                     /db_xref="GeneID:11790017"
     CDS             325457..326023
                     /locus_tag="Rahaq2_0298"
                     /note="PFAM: Cyclophilin type peptidyl-prolyl cis-trans
                     isomerase/CLD"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_005198384.1"
                     /db_xref="GI:383188256"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR015891"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="GeneID:11790017"
                     /translation="MFKRTLVALTALLSLTAMAPVLAAAQTHVMLTTSAGNIELELDS
                     AKAPVSVKNFVDYAQSGYYNNTIFHRVIPGFMVQGGGFTTDMQQKATKEPIKNEADNG
                     LRNLRGTVAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVIKGMDVVDKM
                     SQVKTDNVGPYQNVPTTPIVILSAKVLP"
     misc_feature    325547..326008
                     /locus_tag="Rahaq2_0298"
                     /note="cyclophilin_EcCYP_like: cyclophilin-type A-like
                     peptidylprolyl cis- trans isomerase (PPIase) domain
                     similar to the cytosolic E. coli cyclophilin A and
                     Streptomyces antibioticus SanCyp18. Compared to the
                     archetypal cyclophilin Human cyclophilin A, these...;
                     Region: cyclophilin_EcCYP_like; cd01920"
                     /db_xref="CDD:238901"
     misc_feature    order(325664..325666,325670..325672,325679..325684,
                     325688..325690,325793..325810,325832..325834,
                     325856..325861,325886..325888)
                     /locus_tag="Rahaq2_0298"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238901"
     gene            326562..327767
                     /locus_tag="Rahaq2_0299"
                     /note="IMG reference gene:2506707324"
                     /db_xref="GeneID:11790018"
     CDS             326562..327767
                     /locus_tag="Rahaq2_0299"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198385.1"
                     /db_xref="GI:383188257"
                     /db_xref="GeneID:11790018"
                     /translation="MKKLLVTGIVLGLFSWQATAQTIVLTDAEAGTELGNWKTDNKKL
                     NIAGTDFSIEQKVLHGGKQEGSKVITITSKGLTIALSPTRGMDLLHVTGDNIRLGWDS
                     PVQEVVNPAYINLESRNGVGWLEGFNEMMVRCGFEWTGHPVTADGMIYTLHGRAGNTP
                     ASKVVVDIADKAPHEITVRGLLKEDTFKKAKLETWTELRYVPGSHSWTIHDTLTNQSD
                     YPHDYQIIYHSNFGQPILEQGARFIAPLKSISPFNDYAKKGLADWQTYAGPTKGFDEM
                     VFNMVPLADAQGKTIAGVVNKAGNKGASIEFDTHQLPLLTLWKNTDTLKQGYVTGIEP
                     GTNYAYPVTIERKQGRVKQLQPGQSTVFELKYSLLPDAQAVKQLEDRVKTLQADHKTD
                     VNETPIAVE"
     misc_feature    326799..327653
                     /locus_tag="Rahaq2_0299"
                     /note="Aldose 1-epimerase, similar to Escherichia coli
                     c4013; Region: Aldose_epim_Ec_c4013; cd09023"
                     /db_xref="CDD:185700"
     misc_feature    order(327018..327020,327243..327245,327249..327251,
                     327378..327380,327522..327524,327558..327560)
                     /locus_tag="Rahaq2_0299"
                     /note="active site"
                     /db_xref="CDD:185700"
     misc_feature    order(327243..327245,327558..327560)
                     /locus_tag="Rahaq2_0299"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:185700"
     gene            327865..328035
                     /locus_tag="Rahaq2_0300"
                     /note="IMG reference gene:2506707325"
                     /db_xref="GeneID:11790019"
     CDS             327865..328035
                     /locus_tag="Rahaq2_0300"
                     /note="PFAM: Protein of unknown function (DUF2559)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198386.1"
                     /db_xref="GI:383188258"
                     /db_xref="InterPro:IPR022541"
                     /db_xref="GeneID:11790019"
                     /translation="MAKKLTLRQQEKLFRERQRQNFQASSALDGLQVEIITLDNEQIS
                     QRLTELRRHYER"
     misc_feature    327871..328032
                     /locus_tag="Rahaq2_0300"
                     /note="Protein of unknown function (DUF2559); Region:
                     DUF2559; cl08097"
                     /db_xref="CDD:186766"
     gene            328025..328627
                     /locus_tag="Rahaq2_0301"
                     /note="IMG reference gene:2506707326"
                     /db_xref="GeneID:11790020"
     CDS             328025..328627
                     /locus_tag="Rahaq2_0301"
                     /note="PFAM: Fic/DOC family"
                     /codon_start=1
                     /transl_table=11
                     /product="protein involved in cell division"
                     /protein_id="YP_005198387.1"
                     /db_xref="GI:383188259"
                     /db_xref="InterPro:IPR003812"
                     /db_xref="GeneID:11790020"
                     /translation="MNDKLVAGADPYYYPGINVLKNRLEIREEHRLLQAELAFTALRA
                     SVMPLGPSVMGLPHLCAVHLSLFQDIYPWAGEFREIDIYKDDTQFCHFEYIEKEGNAL
                     MQELEEEEFLVGLPLDNLAERLAHYYTGLNLLHPFRHGNGRALRIFIEQLVIHAGYDI
                     DWSKVDRERWLAANKTAVFGDETELVAIFNTVVSEIPQEH"
     misc_feature    328025..328609
                     /locus_tag="Rahaq2_0301"
                     /note="Fic/DOC family; Region: Fic; cl00960"
                     /db_xref="CDD:260722"
     gene            328704..329279
                     /locus_tag="Rahaq2_0302"
                     /note="IMG reference gene:2506707327"
                     /db_xref="GeneID:11793773"
     CDS             328704..329279
                     /locus_tag="Rahaq2_0302"
                     /note="PFAM: Glutamine amidotransferase class-I;
                     TIGRFAM: glutamine amidotransferase of anthranilate
                     synthase or aminodeoxychorismate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase of anthranilate
                     synthase or aminodeoxychorismate synthase"
                     /protein_id="YP_005198388.1"
                     /db_xref="GI:383188260"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR001317"
                     /db_xref="InterPro:IPR006220"
                     /db_xref="InterPro:IPR011702"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="GeneID:11793773"
                     /translation="MLLLIDNYDSFTYNLYQYFCELGAEVKVMRNDQLTLTGIEQLSP
                     SHLVISPGPCTPDEAGISLQAITYFSDRLPILGVCLGHQAMAQAFGANIVRARQAIHG
                     KTSPVRHTGRSVFTGLNNPLTVTRYHSLVVAPQTLPDCFEVTAWTERDGGRDDIMGIM
                     HKTLPLHGVQFHPESILSEQGHQLLDNFLKI"
     misc_feature    328704..329270
                     /locus_tag="Rahaq2_0302"
                     /note="para-aminobenzoate synthase component II;
                     Provisional; Region: PRK08857"
                     /db_xref="CDD:181566"
     misc_feature    328707..329270
                     /locus_tag="Rahaq2_0302"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Anthranilate synthase; Region:
                     GATase1_Anthranilate_Synthase; cd01743"
                     /db_xref="CDD:153214"
     misc_feature    order(328854..328859,328863..328865,328938..328943,
                     328950..328952,329082..329093)
                     /locus_tag="Rahaq2_0302"
                     /note="glutamine binding [chemical binding]; other site"
                     /db_xref="CDD:153214"
     misc_feature    order(328938..328940,329217..329219,329223..329225)
                     /locus_tag="Rahaq2_0302"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153214"
     gene            329403..330620
                     /locus_tag="Rahaq2_0303"
                     /note="IMG reference gene:2506707328"
                     /db_xref="GeneID:11793774"
     CDS             329403..330620
                     /locus_tag="Rahaq2_0303"
                     /note="PFAM: Aminotransferase class-III;
                     TIGRFAM: succinylornithine transaminase family;
                     acetylornithine and succinylornithine aminotransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine/succinylornithine
                     aminotransferase"
                     /protein_id="YP_005198389.1"
                     /db_xref="GI:383188261"
                     /db_xref="InterPro:IPR004636"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11793774"
                     /translation="MAEKSAVDRGTFDKVILPVYSPAKFIPVKGKGSRVWDQQGNEYV
                     DFAGGIAVTALGHCHPALVKALHEQGETLWHVSNVFTNEPALRLAQKLIDATFADRVF
                     FANSGAEANEAAFKLARYYASHRHSPYKSKIIAFHNAFHGRTLFTVSVGGQPKYSDGF
                     GPKPADIVHVPFNDLDAVKAVIDDHTCAIVVEPVQGEGGVTPATKEFLQGLRELCNKH
                     QALLVLDEVQSGMGRSGKLFSYMHYGVTPDILTTAKALGGGFPVSAMLATEEVASVME
                     PGKHGTTYGGNPLACAVAEAALDIINTPDVLAGINERREKFISALEAINQKYHIFSEF
                     RGQGLLIGAELADAYKNRAGEFHAAAAEFGLMMLVAGPNVMRFAPSLVIDFADIEEGM
                     ARFEKAVGKVCGG"
     misc_feature    329439..330599
                     /locus_tag="Rahaq2_0303"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    329457..330608
                     /locus_tag="Rahaq2_0303"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(329718..329726,329820..329825,329829..329831,
                     329976..329978,330075..330077,330081..330086,
                     330162..330164)
                     /locus_tag="Rahaq2_0303"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(329721..329726,329820..329825,329976..329978,
                     330075..330077,330084..330086,330162..330164)
                     /locus_tag="Rahaq2_0303"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    330162..330164
                     /locus_tag="Rahaq2_0303"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(331290..333365)
                     /locus_tag="Rahaq2_0304"
                     /note="IMG reference gene:2506707329"
                     /db_xref="GeneID:11790021"
     CDS             complement(331290..333365)
                     /locus_tag="Rahaq2_0304"
                     /note="PFAM: Fusaric acid resistance protein family;
                     TIGRFAM: integral membrane protein, YccS/YhfK family"
                     /codon_start=1
                     /transl_table=11
                     /product="YccS/YhfK family integral membrane protein"
                     /protein_id="YP_005198390.1"
                     /db_xref="GI:383188262"
                     /db_xref="InterPro:IPR006726"
                     /db_xref="GeneID:11790021"
                     /translation="MTLWRRLFYHPEVNYALRQTLVLCLPVSICWLFGNLQMGLLFSL
                     CPACCNIAGLDTPHKRFFKRLLVGGSLFAVSSILLQLMLENWHVPLPLIMLSLALLLG
                     VTGEISPLHARLLPGALVATIFTLSMVGVRPMWQAPVLFAAGTAWYGLFNWAWFRISK
                     EQPMRETLSQLYLQLADYFEAKYSLLTQHTDPETALPPLLTRQQQVIDLIALLYQQLH
                     MLPQHGHHHHHKRLFQRFQVALDLQEHITVSLHQPEEVQKLVEESHAEAVIRRNAQVI
                     SARLRVIADDILYHRLSERFTMANELTALEKIAARNPDNPVGQFCYYHFSRIARLLRT
                     QRPLYRRDLMNTQPRLPFWPALKSYLSFKSVALRNAARLGIILAIGSSLGLFFNLPKP
                     YWILLTIMLVSQNGYNATRVRIQHRALGTLAGLLIASGLLKLELPEGTTLLYMLLITL
                     LSYTVLRKNYGLAMVGMTVTAVYTLQLLAMNGVHFLVPRLVDTLIGCALAFGGTIWLW
                     PQWQSGLLRQNAHQALETYQNAIRLLLEENPDTARLAYTRMQVNQAHNKLFTSLNQAM
                     QEPGFNSHYLADMRLWVTHSQFVVEHINAMTILAREHYMLPEKLATEYLQTCEIALQS
                     CQQRLLYDGPGSENNLFNAPELHPDMPLTEMERHLRRVISHLSVMHTISSLAWKQRPH
                     HGIWLTRRA"
     misc_feature    complement(331338..333326)
                     /locus_tag="Rahaq2_0304"
                     /note="integral membrane protein, YccS/YhfK family;
                     Region: YCCS_YHJK; TIGR01667"
                     /db_xref="CDD:130728"
     misc_feature    complement(332364..333176)
                     /locus_tag="Rahaq2_0304"
                     /note="FUSC-like inner membrane protein yccS; Region:
                     FUSC-like; pfam12805"
                     /db_xref="CDD:257312"
     misc_feature    complement(331863..332231)
                     /locus_tag="Rahaq2_0304"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; pfam13515"
                     /db_xref="CDD:257835"
     gene            complement(333427..334059)
                     /locus_tag="Rahaq2_0305"
                     /note="IMG reference gene:2506707330"
                     /db_xref="GeneID:11790022"
     CDS             complement(333427..334059)
                     /locus_tag="Rahaq2_0305"
                     /note="PFAM: Bacterial regulatory proteins, crp family;
                     Cyclic nucleotide-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="cAMP-binding protein"
                     /protein_id="YP_005198391.1"
                     /db_xref="GI:383188263"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001808"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012318"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018335"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="GeneID:11790022"
                     /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIV
                     KGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKK
                     FRQLIQVNPDILMRLSAQMANRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTH
                     PDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQSLISAHGKTIVVYGTR"
     misc_feature    complement(333430..334059)
                     /locus_tag="Rahaq2_0305"
                     /note="DNA-binding transcriptional dual regulator Crp;
                     Provisional; Region: PRK11753"
                     /db_xref="CDD:236969"
     misc_feature    complement(333709..334038)
                     /locus_tag="Rahaq2_0305"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(333805..333813,333841..333846))
                     /locus_tag="Rahaq2_0305"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(333721..333729,333739..333747))
                     /locus_tag="Rahaq2_0305"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(333439..333642)
                     /locus_tag="Rahaq2_0305"
                     /note="helix_turn_helix, cAMP Regulatory protein
                     C-terminus; DNA binding domain of prokaryotic regulatory
                     proteins belonging to the catabolite activator protein
                     family; Region: HTH_CRP; cd00092"
                     /db_xref="CDD:238044"
     misc_feature    complement(333628..333633)
                     /locus_tag="Rahaq2_0305"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(333520..333522,333547..333555,
                     333559..333561))
                     /locus_tag="Rahaq2_0305"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(333502..333522)
                     /locus_tag="Rahaq2_0305"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(333502..333504,333514..333519))
                     /locus_tag="Rahaq2_0305"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(333514..333519)
                     /locus_tag="Rahaq2_0305"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            334423..334830
                     /locus_tag="Rahaq2_0306"
                     /note="IMG reference gene:2506707331"
                     /db_xref="GeneID:11790023"
     CDS             334423..334830
                     /locus_tag="Rahaq2_0306"
                     /note="PFAM: OsmC-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative redox protein, regulator of disulfide
                     bond formation"
                     /protein_id="YP_005198392.1"
                     /db_xref="GI:383188264"
                     /db_xref="InterPro:IPR003718"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="GeneID:11790023"
                     /translation="MHARVKWVEGLTFLGESASGHQISMDGNAGDKAPSPMEMLLMSA
                     GGCSAIDVVSILQKGRNDVRDCEVKLTSQRREEAPRLFTHINLHFIVTGKDLTDKIVE
                     RAVSLSAEKYCSVSLMLGKAATITHSFEVIAAE"
     misc_feature    334423..334824
                     /locus_tag="Rahaq2_0306"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10738"
                     /db_xref="CDD:182688"
     gene            complement(334834..335703)
                     /locus_tag="Rahaq2_0307"
                     /note="IMG reference gene:2506707332"
                     /db_xref="GeneID:11790024"
     CDS             complement(334834..335703)
                     /locus_tag="Rahaq2_0307"
                     /note="PFAM: Phosphoribulokinase / Uridine kinase family"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribulokinase"
                     /protein_id="YP_005198393.1"
                     /db_xref="GI:383188265"
                     /db_xref="InterPro:IPR006082"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="GeneID:11790024"
                     /translation="MSAKHPVIAVTGSSGAGTTTTSVAFRKIFQQLGLRAAELEGDSF
                     HHFTRPEMDAAIRKARDLGRHISYFGPEANDFGLLEKSFIEYGETGTGRSRKYLHTYD
                     EAVPYNQVPGTFTPWQALPEPTDILFYEGLHGGVVADKIDVAAQVDLLVGVVPIVNLE
                     WIQKLVRDTGERGHSREAVMDSVVRSMDDYISYITPQFSRTHINFQRVPTIDTSNPFA
                     AKAIPSLDESFVVIHFQGLDDIDFPYLLAMLQGSFISHIKTLVVPGGKMGLAMELIMA
                     PLVQRLMEGKKIE"
     misc_feature    complement(334840..335703)
                     /locus_tag="Rahaq2_0307"
                     /note="phosphoribulokinase; Provisional; Region: PRK15453"
                     /db_xref="CDD:237970"
     misc_feature    complement(order(335644..335655,335668..335670))
                     /locus_tag="Rahaq2_0307"
                     /note="active site"
                     /db_xref="CDD:238977"
     gene            complement(335839..336753)
                     /locus_tag="Rahaq2_0308"
                     /note="IMG reference gene:2506707333"
                     /db_xref="GeneID:11790025"
     CDS             complement(335839..336753)
                     /locus_tag="Rahaq2_0308"
                     /note="PFAM: Bacterial regulatory helix-turn-helix
                     protein, lysR family; LysR substrate binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198394.1"
                     /db_xref="GI:383188266"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11790025"
                     /translation="MLDEESIKTFMHVAQTGSFSRAAEMLHKTPATISYRIKMLEDST
                     GTLLLNRTTRTVSLTPAGQHLLERCRQWLTWLEGVPAELQQINDGIERQLNVVVNNLM
                     YCPEALAALLSSLTQRYPFTQFTFTRQIYMGVWDTLLYEDFQLAIGVTGTESLSNAVN
                     LLPLGEVDWVFVHAPFHPLQHITGMLEEAVLRQYIAINVEDTSRHLNKRVAWLLTGQR
                     QIIVADVATKLACHLKGMGIGFLPRHLCQPYLDSGELIARQIRYPRAPSPLSLAWKKE
                     YTGKALHDIVSLFHQKDPLIQPLLAGLE"
     misc_feature    complement(335854..336753)
                     /locus_tag="Rahaq2_0308"
                     /note="DNA-binding transcriptional activator AllS;
                     Provisional; Region: PRK10094"
                     /db_xref="CDD:182237"
     misc_feature    complement(336565..336741)
                     /locus_tag="Rahaq2_0308"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(335908..336438)
                     /locus_tag="Rahaq2_0308"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(336052..336057,336061..336066,
                     336082..336099,336370..336390,336394..336396,
                     336406..336408,336415..336420,336424..336429))
                     /locus_tag="Rahaq2_0308"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            336821..337474
                     /locus_tag="Rahaq2_0309"
                     /note="IMG reference gene:2506707334"
                     /db_xref="GeneID:11790026"
     CDS             336821..337474
                     /locus_tag="Rahaq2_0309"
                     /note="PFAM: Ureidoglycolate hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate hydrolase"
                     /protein_id="YP_005198395.1"
                     /db_xref="GI:383188267"
                     /db_xref="InterPro:IPR007247"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="GeneID:11790026"
                     /translation="MDFINFMESFSIFILSKLEKVSTVIALRINPPIWRAYLTGFILN
                     AGMNAMELPVYPLTQAAFAAYGDVIETTGRDFFHINDGKVERYHDLTNVEILGQDRPL
                     VSINRAQPAPLPIVVTQLEKHPLGSQAFVPMQGERFIVIVAAGGETPDISTLKAFITN
                     GLQGVNYHRNVWHHPLFAFETVTNFLTVDRGGADNCDISQLPQGYQLILPVAAGLKS"
     misc_feature    336974..337447
                     /locus_tag="Rahaq2_0309"
                     /note="ureidoglycolate hydrolase; Provisional; Region:
                     PRK03606"
                     /db_xref="CDD:179606"
     gene            337561..338370
                     /locus_tag="Rahaq2_0310"
                     /note="IMG reference gene:2506707335"
                     /db_xref="GeneID:11790027"
     CDS             337561..338370
                     /locus_tag="Rahaq2_0310"
                     /note="PFAM: IclR helix-turn-helix domain; Bacterial
                     transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198396.1"
                     /db_xref="GI:383188268"
                     /db_xref="InterPro:IPR005471"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014757"
                     /db_xref="GeneID:11790027"
                     /translation="MAEVKKRGRPSQPGSGSQKGAQALERGIAVLNYLAQSGGSSSVS
                     NIAENLSLPLSTTFRLLKVLEEADFVYQDAQLSWWHIGLQAFTVGSSYIHNRDVLSVA
                     APYMQRLMLLSGETANLAIRNGFEAVLIGQRECQSMVRMCAPLGSRLPLHASGAGKAL
                     LYSLDDEALMSLMMQAGLKNFTTHTLDNLNALKKDLQHARQQGFAQDSEEHVTGLNCL
                     ASAIFDSNNNAVAAISISGPSSRLTTERFTDLGELVRDTARDISLALGQRH"
     misc_feature    337561..338358
                     /locus_tag="Rahaq2_0310"
                     /note="DNA-binding transcriptional repressor AllR;
                     Provisional; Region: PRK10163"
                     /db_xref="CDD:182279"
     misc_feature    337624..337893
                     /locus_tag="Rahaq2_0310"
                     /note="helix_turn_helix isocitrate lyase regulation;
                     Region: HTH_ICLR; smart00346"
                     /db_xref="CDD:214629"
     misc_feature    337978..338352
                     /locus_tag="Rahaq2_0310"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            338485..340266
                     /locus_tag="Rahaq2_0311"
                     /note="IMG reference gene:2506707336"
                     /db_xref="GeneID:11790028"
     CDS             338485..340266
                     /locus_tag="Rahaq2_0311"
                     /note="PFAM: Thiamine pyrophosphate enzyme, central
                     domain; Thiamine pyrophosphate enzyme, N-terminal TPP
                     binding domain; Thiamine pyrophosphate enzyme, C-terminal
                     TPP binding domain;
                     TIGRFAM: glyoxylate carboligase"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxylate carboligase"
                     /protein_id="YP_005198397.1"
                     /db_xref="GI:383188269"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="GeneID:11790028"
                     /translation="MARMTAAQAAMYVLEKEGITTAFGVPGAAINPFYNAMRLHGKIR
                     HVLARHVEGASHMAEGYTRAKAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITG
                     QAPRARLHKEDFQAVDIQAIAGPVSKMAVTVLEPALVPRVLQQAFHLMRSGRPGPVLV
                     DLPYDVQTAEIEFDPETYESLPAYKPIATVAQAVKAMEMLNACERPLIVAGGGVINAD
                     AAVLLQRFAELTQVPVIPTLMGWGVIPDDHRLMAGMVGLQTAHRYGNTSLLASDLVFG
                     IGNRFANRHTGSVEKYTAGRKIIHVDIEPTQIGRVLCPDLGIVSDAGEALKLLIEVAE
                     EQRKAGKLPCRESWIQECEERKRTMLRKTHFNDVPVKPQRVYEEMSKAFGRNVNYVTT
                     IGLSQIAAAQMLHVFEPRHWINCGQAGPLGWTIPAALGVCIAAPERQVVGISGDYDFQ
                     FMIEELAVGAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSEDVKGYG
                     VDHVKVVEGLGCKAIRVFRPEDIAPAFAEAKRLMKQHQVPVVVEIMLERVTNISMGGE
                     IDSVNEFEPVADNADDAPTHVSFMKYE"
     misc_feature    338485..340254
                     /locus_tag="Rahaq2_0311"
                     /note="glyoxylate carboligase; Provisional; Region:
                     PRK11269"
                     /db_xref="CDD:183066"
     misc_feature    338506..338976
                     /locus_tag="Rahaq2_0311"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(338545..338547,338560..338565,338575..338577,
                     338587..338589,338614..338634,338641..338643,
                     338650..338655,338662..338667,338671..338679,
                     338716..338718,338737..338739,338749..338751,
                     338758..338763)
                     /locus_tag="Rahaq2_0311"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(338560..338568,338575..338577,338587..338589,
                     338617..338619,338623..338634,338638..338640,
                     338716..338718,338725..338730,338734..338739,
                     338746..338748,338848..338850,338857..338859)
                     /locus_tag="Rahaq2_0311"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(338560..338562,338635..338637,338716..338718,
                     338728..338730)
                     /locus_tag="Rahaq2_0311"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    339067..339471
                     /locus_tag="Rahaq2_0311"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    339571..340176
                     /locus_tag="Rahaq2_0311"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    order(339745..339747,339817..339828,339901..339903,
                     339907..339909)
                     /locus_tag="Rahaq2_0311"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            340281..341057
                     /locus_tag="Rahaq2_0312"
                     /note="IMG reference gene:2506707337"
                     /db_xref="GeneID:11790029"
     CDS             340281..341057
                     /locus_tag="Rahaq2_0312"
                     /note="PFAM: Xylose isomerase-like TIM barrel;
                     TIGRFAM: hydroxypyruvate isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate isomerase"
                     /protein_id="YP_005198398.1"
                     /db_xref="GI:383188270"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="GeneID:11790029"
                     /translation="MLKFSANLSMLFLEVDFLQRFKAAAEGGFTAVEFMFPYDYPAGT
                     LKALLAENHLQHTLHNLPAGNWAEGERGIACLAGREAEFREGVAQAIAYAKALGNRKI
                     NCLTGKIPAGSDAASVTPLVVENLRYAAQALAKEGLMLLIEPINHFDIPGFYLTGTQQ
                     ALDLIDLVGSDNMFIQYDIYHMQRMEGELANTMTRHAEKIGHLQVADNPHRNEPGTGE
                     INYDFIFNLIKQSDYDGWVGCEYKPRARTEDGLGWLNAYR"
     misc_feature    340281..341054
                     /locus_tag="Rahaq2_0312"
                     /note="hydroxypyruvate isomerase; Provisional; Region:
                     PRK09997"
                     /db_xref="CDD:182188"
     misc_feature    340287..341045
                     /locus_tag="Rahaq2_0312"
                     /note="hydroxypyruvate isomerase; Region: OH-pyruv-isom;
                     TIGR03234"
                     /db_xref="CDD:163190"
     gene            341149..342027
                     /locus_tag="Rahaq2_0313"
                     /note="IMG reference gene:2506707338"
                     /db_xref="GeneID:11790030"
     CDS             341149..342027
                     /locus_tag="Rahaq2_0313"
                     /note="PFAM: NAD binding domain of 6-phosphogluconate
                     dehydrogenase;
                     TIGRFAM: 2-hydroxy-3-oxopropionate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-3-oxopropionate reductase"
                     /protein_id="YP_005198399.1"
                     /db_xref="GI:383188271"
                     /db_xref="InterPro:IPR002204"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006183"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR015815"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11790030"
                     /translation="MKIGFIGLGIMGAPMAQHLVDAGHSLHFSTLGNVPASLTDAGAK
                     ACATPAEVASYADVIIIMVPDTPDVATVLFGDNGCASVPLKGKTIVDMSSISPIDTKT
                     FAQRVQQLGGEYLDAPVSGGEIGAQQGTLTIMVGGKEAVFNDIKPLFELMGKNITLVG
                     DCGAGQTCKVANQIIVALNIEAVSEALLFASRAGADPARVRQALMGGFASSRILEVHG
                     ERMIKRTFAPGFKVALHQKDLNLALQSAKALSISLPNTATCQELFNVCAANGGSQLDH
                     SSLIQSLEMMSNHKIG"
     misc_feature    341149..342021
                     /locus_tag="Rahaq2_0313"
                     /note="tartronate semialdehyde reductase; Provisional;
                     Region: PRK15059"
                     /db_xref="CDD:185019"
     misc_feature    341149..341625
                     /locus_tag="Rahaq2_0313"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    341635..341991
                     /locus_tag="Rahaq2_0313"
                     /note="NAD-binding of NADP-dependent 3-hydroxyisobutyrate
                     dehydrogenase; Region: NAD_binding_11; pfam14833"
                     /db_xref="CDD:258970"
     gene            342103..343557
                     /locus_tag="Rahaq2_0314"
                     /note="IMG reference gene:2506707339"
                     /db_xref="GeneID:11790031"
     CDS             342103..343557
                     /locus_tag="Rahaq2_0314"
                     /note="PFAM: Permease for cytosine/purines, uracil,
                     thiamine, allantoin;
                     TIGRFAM: NCS1 nucleoside transporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="NCS1 nucleoside transporter-like protein"
                     /protein_id="YP_005198400.1"
                     /db_xref="GI:383188272"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="GeneID:11790031"
                     /translation="MNESECTQQERYCERGYSNDLLPKLKEKRNWKGFNYFTLWMGSV
                     HNVPNYIAVGGFLILGLSTFSVMMAIIISALFIAAVMVLNGAAGSKYGVPFAMILRGS
                     YGIRGALFPGILRGCIAAIMWFGLQCYAGSLAFLILIGKIWPEFLTLGGDFNLLGISM
                     PGLIAFLIFWAINVMIGFGGGGVLNKFTAILNPCIYVVFGGMAVWAISLAGLENILNY
                     VPANAEQSGNPLFLFLVVINAVVAVWAAPAVSASDFTQNASSFKQQAWGQTLGLIVAY
                     VLFAVASVCILAGASIHYGVDTWNVLDIVQKWDSLFASVFAVLVILMTTISTNATGNI
                     IPAGFQIAAIAPKKLTYKKGVLIASLISVVICPWKLMENQESIYLFLDIIGGMLGPVI
                     GVMMAHYFIVVRSELDLDTLYTAPGNYNYYHRGFNTVAFAVTLIAVVLSLGGKFIPVL
                     EPLSRVSWFVGVIVAFVLYSIFMKREPSLQPQNV"
     misc_feature    342148..343527
                     /locus_tag="Rahaq2_0314"
                     /note="uncharacterized nucleobase-cation-symport-1 (NCS1)
                     transporter subfamily, YbbW-like; solute-binding domain;
                     Region: SLC-NCS1sbd_YbbW-like; cd11485"
                     /db_xref="CDD:212054"
     misc_feature    order(342226..342228,342235..342237,343072..343074,
                     343081..343086)
                     /locus_tag="Rahaq2_0314"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212054"
     misc_feature    order(342238..342240,342469..342471,342481..342483,
                     342829..342834,342838..342840,343087..343089,
                     343099..343101)
                     /locus_tag="Rahaq2_0314"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:212054"
     gene            343640..345001
                     /locus_tag="Rahaq2_0315"
                     /note="IMG reference gene:2506707340"
                     /db_xref="GeneID:11790032"
     CDS             343640..345001
                     /locus_tag="Rahaq2_0315"
                     /note="PFAM: Amidohydrolase family;
                     TIGRFAM: allantoinase; dihydroorotase, multifunctional
                     complex type"
                     /codon_start=1
                     /transl_table=11
                     /product="allantoinase"
                     /protein_id="YP_005198401.1"
                     /db_xref="GI:383188273"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="GeneID:11790032"
                     /translation="MSYDLIIKKGTVVLESEAVITDIAVKNGKIVAIGDDLTGAEKIL
                     SAEGVIVAPGMVDAHTHISEPGRSHWEGYATGTRAAAKGGITTMIEMPLNQLPATVDR
                     ASLHMKFDAAEGKLTIDAAQFGGLVSYNLDRLHELDEEGVVAYKCFVATCGDRSVSND
                     FRDVNDWEYFKGLQILAKRDQLVAVHAENALICDELGREAKDAGRVTAHDYVASRPVF
                     TEVEAIRRVLYLAKVADCRLHVCHISSPEGLAEVLRARHEGQRVTCESCPHYFVLDTA
                     QFEEIGTLAKCSPPIRDKKNQEGMWEHLLKGDFDCLVSDHSPCPPDMKAGNVMQAWGG
                     IAGLQNCVDVMFDEAVQKRGMSLPMFSKLMSSNAADIFGLKHKGRISIGKDADFVFIK
                     PNSSYVLKASDLEYRHKVSPYVGRTINAQVVKTILRGETIYDIQDGFQDKCIGKFVLK
                     HLQ"
     misc_feature    343640..344986
                     /locus_tag="Rahaq2_0315"
                     /note="allantoinase; Provisional; Region: PRK08044"
                     /db_xref="CDD:169193"
     misc_feature    343649..344986
                     /locus_tag="Rahaq2_0315"
                     /note="L-Hydantoinases (L-HYDs) and Allantoinase (ALN);
                     L-Hydantoinases are a member of the dihydropyrimidinase
                     family, which catalyzes the reversible hydrolytic ring
                     opening of dihydropyrimidines and hydantoins
                     (five-membered cyclic diamides used in...; Region:
                     L-HYD_ALN; cd01315"
                     /db_xref="CDD:238640"
     misc_feature    order(343814..343816,343820..343822,344195..344197,
                     344363..344365,344582..344584)
                     /locus_tag="Rahaq2_0315"
                     /note="active site"
                     /db_xref="CDD:238640"
     gene            345064..346368
                     /locus_tag="Rahaq2_0316"
                     /note="IMG reference gene:2506707341"
                     /db_xref="GeneID:11790033"
     CDS             345064..346368
                     /locus_tag="Rahaq2_0316"
                     /note="PFAM: Permease family"
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine/uracil permease"
                     /protein_id="YP_005198402.1"
                     /db_xref="GI:383188274"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="GeneID:11790033"
                     /translation="MMLFPRVQFLPGIQWFFFIFCNTVVIPPTLQSAFQLSDAATLCL
                     MQYSFIATGLACVAQAALGHGRAIMEGPTGLWWGVILTVTLAEAAHGTPLPVIGGSLA
                     VGIALSGVITVLIGLSGLGHRIAVLFRPAVMMVFMFLLGAQLLSLFIRGMLGLPFGVP
                     QGPVNIDFPAFLLALAVAALVVGIVVWLPSPWNKYGLLAGTLTGWAAYRIIFPQAVSP
                     GTGTDWQWFPLGAPQGLRGGIILTATLTGLLNISNTFGALRGTQTFYPQQTPQYRRSF
                     VVSGLFTLGSAVLGIVPFSPFVSSIGLLTQTNDNRKAPFILGALVVVAIGLFTPLTAF
                     FARIPLSISSAVLLVSYLPLLSSSLSFLPHIRLSSRNVYRLAIPLFSGIFLMGLPAGY
                     LQEVPLWLRPLLSNGLLTGVMLAIVLENLLPWDRVHANNAPH"
     misc_feature    345076..346365
                     /locus_tag="Rahaq2_0316"
                     /note="Xanthine/uracil permeases [Nucleotide transport and
                     metabolism]; Region: UraA; COG2233"
                     /db_xref="CDD:225142"
     misc_feature    345091..346344
                     /locus_tag="Rahaq2_0316"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     gene            complement(346419..347210)
                     /locus_tag="Rahaq2_0317"
                     /note="IMG reference gene:2506707342"
                     /db_xref="GeneID:11790034"
     CDS             complement(346419..347210)
                     /locus_tag="Rahaq2_0317"
                     /note="PFAM: Cupin domain; Protein of unknown function
                     (DUF861);
                     TIGRFAM: putative allantoin catabolism protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative allantoin catabolism protein"
                     /protein_id="YP_005198403.1"
                     /db_xref="GI:383188275"
                     /db_xref="InterPro:IPR008579"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="GeneID:11790034"
                     /translation="MGYINHNTGYIKDLLSNRSIIKRGNYALIEPDGLVKNTLPGFER
                     CEITILATPKLGATFVDYLINMLEGGKNLAGFGGDAHIETFVYVIDGNITANAEGQDY
                     RLESGGYLYCPPGVSMTLENANGSRNSRLFLYKKRYTPVTGFQPHVVCNNVHQLEKIH
                     YEGMSDVIVQDLLPANLGFDMNIHILTFAPGACHGYVETHVQEHGALILSGEGMYNLD
                     NHWIPVKKNDYIFMGAYCPQACYAVGRDEPLSYIYSKDCNRDVEL"
     misc_feature    complement(346422..347177)
                     /locus_tag="Rahaq2_0317"
                     /note="putative allantoin catabolism protein; Region:
                     ura-cupin; TIGR03214"
                     /db_xref="CDD:200251"
     misc_feature    complement(346767..>346958)
                     /locus_tag="Rahaq2_0317"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     misc_feature    complement(346455..346661)
                     /locus_tag="Rahaq2_0317"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            complement(347233..348459)
                     /locus_tag="Rahaq2_0318"
                     /note="IMG reference gene:2506707343"
                     /db_xref="GeneID:11790035"
     CDS             complement(347233..348459)
                     /locus_tag="Rahaq2_0318"
                     /note="PFAM: Peptidase family M20/M25/M40;
                     TIGRFAM: allantoate amidohydrolase; amidase,
                     hydantoinase/carbamoylase family"
                     /codon_start=1
                     /transl_table=11
                     /product="allantoate amidohydrolase"
                     /protein_id="YP_005198404.1"
                     /db_xref="GI:383188276"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="GeneID:11790035"
                     /translation="MSPFYQEVESQLDWLSVFGADPEGGISRLLYSPEWLETQNQLKQ
                     RMEQAGFATRFDAVGNVYGRIEGSDRKDEVILSGSHIDTVVSGGHLDGQFGVLAAFIA
                     MRYLKDTFGTPRRTLEVVSLAEEEGSRFPYVFWGSKNIVGQADPADVRDITDAQGVKF
                     TDAMQQCGFTLSGSPLPARRDIKAFVELHIEQGSVLERNQQQLGVVNAIVGQRRYTVT
                     LTGTANHAGTTPMSYRKDTLLAFSQICVAATDSAEAHGDPLVLTFGKVVPVPGTVNVV
                     PGKTVFSIDCRHTDQQALLAFTTELEATMRRICQERGIGIDIDLWMDEAPVPMDKQLV
                     AQLDALCREQNSRYRVMHSGAGHDAQIFAACVPTCLLFVPSIAGISHNPAENTAIADL
                     AAGVETLAKMLHQLAY"
     misc_feature    complement(347236..348450)
                     /locus_tag="Rahaq2_0318"
                     /note="allantoate amidohydrolase; Region: AllC; TIGR03176"
                     /db_xref="CDD:234137"
     misc_feature    complement(347251..348438)
                     /locus_tag="Rahaq2_0318"
                     /note="M20 Peptidase beta-alanine synthase, an
                     amidohydrolase; Region: M20_bAS; cd03884"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(347317..347319,347392..347397,
                     347599..347601,347818..347820,347824..347826,
                     347884..347886,347893..347895,348061..348063,
                     348082..348087,348184..348189,348220..348222))
                     /locus_tag="Rahaq2_0318"
                     /note="active site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(347317..347319,347893..347895,
                     348082..348087,348187..348189,348220..348222))
                     /locus_tag="Rahaq2_0318"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(347398..347400,347599..347601,
                     347605..347607,347629..347640,347644..347649,
                     347659..347682,347701..347706,347710..347715,
                     347719..347727,347731..347739,347743..347748,
                     347758..347760,347767..347769,347773..347787,
                     347818..347820,347863..347868,347875..347886))
                     /locus_tag="Rahaq2_0318"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:193505"
     gene            complement(348481..349530)
                     /locus_tag="Rahaq2_0319"
                     /note="IMG reference gene:2506707344"
                     /db_xref="GeneID:11790036"
     CDS             complement(348481..349530)
                     /locus_tag="Rahaq2_0319"
                     /note="PFAM: Malate/L-lactate dehydrogenase;
                     TIGRFAM: ureidoglycolate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate dehydrogenase"
                     /protein_id="YP_005198405.1"
                     /db_xref="GI:383188277"
                     /db_xref="InterPro:IPR003767"
                     /db_xref="GeneID:11790036"
                     /translation="MKVSREELHQLIARKLTTAGLTPEHAAVVADVLSYADARGIHSH
                     GAVRVEYYAERIARGGTNTSPALQWEETGPCSGILHADNGPGHVAANLAMEHAIDMAK
                     IKGIAVVGVRQMGHCGALSYFVHRAAQAGMLAVSVCQSDPMVVPFGSADIYYGTNPIA
                     FAAPGEGEQIITFDMATTVQAWGKILDARARNEKIPDTWAVDGAGNPTTDPFAVEALL
                     PMSGPKGYGLMMMVDVLSGILLGLPFGRSVSSMYEDLTAGRDLGQLHIVINPAFFTSS
                     QIFRKNISQMLAELVALSPAPGFEKVLYPGQNLDIYEEETKKNGIELVDDIYRYLISD
                     ELYTRTYETQSPFAH"
     misc_feature    complement(348487..349530)
                     /locus_tag="Rahaq2_0319"
                     /note="Malate/L-lactate dehydrogenase; Region: Ldh_2;
                     cl00900"
                     /db_xref="CDD:260688"
     gene            349828..351495
                     /locus_tag="Rahaq2_0320"
                     /note="IMG reference gene:2506707345"
                     /db_xref="GeneID:11793775"
     CDS             349828..351495
                     /locus_tag="Rahaq2_0320"
                     /note="PFAM: CoA binding domain; CoA-ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA synthetase subunit alpha"
                     /protein_id="YP_005198406.1"
                     /db_xref="GI:383188278"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="GeneID:11793775"
                     /translation="MIHACIKKGSFQDSVSLMIISRQLSESPDVDDVSVMMGTPANKA
                     LLDATGFWHACFEQATPNDICVAVRSESRDESIISAITGRLEEALKAMSAGQRGGRSL
                     PVARRFASAEQRLPEANLMLISIAGEYAAGLAHQALDSGRNVMIFSDNVTLEDEILLK
                     QKARDKGLLVMGPDCGTAIIAGAPLAFANVLPQGMIGVIGASGTGIQELTSQIALNGQ
                     GISQAIGLGGRDLSAQVGGISALTSLKMLAEDPQSQVLAFVSKPPADAVRLKVMAAMK
                     AIDKPVVALFLGAPVSQARDGNVWLASTLDEAARIACLLARVVQVAASQPDVAGKKIA
                     GLFTGGTLAAEAAMVLAGLLDVEADHAHEHGTMLDHNGHRIIDLGDDFYTVGKPHPMI
                     DPTSREQLILGLAGKSETGVLLLDVVIGYGAQRDPAGSVATAVRHLMTQRARHAPLVV
                     IAMVTGSEQDPQCRSQQIALLREVGILVVQTLPEATLLAHTLCTQTAVTPAASTCLLL
                     SQVAVINAGLLGFALDLQSASVPVVHYPWSPVAGGNLRLASLLKQLG"
     misc_feature    349828..351489
                     /locus_tag="Rahaq2_0320"
                     /note="membrane protein FdrA; Validated; Region: PRK06091"
                     /db_xref="CDD:180395"
     misc_feature    350413..350691
                     /locus_tag="Rahaq2_0320"
                     /note="CoA binding domain; Region: CoA_binding; pfam02629"
                     /db_xref="CDD:251432"
     misc_feature    350833..351303
                     /locus_tag="Rahaq2_0320"
                     /note="CoA-ligase; Region: Ligase_CoA; pfam00549"
                     /db_xref="CDD:249950"
     gene            351530..352798
                     /locus_tag="Rahaq2_0321"
                     /note="IMG reference gene:2506707346"
                     /db_xref="GeneID:11790037"
     CDS             351530..352798
                     /locus_tag="Rahaq2_0321"
                     /note="PFAM: Protein of unknown function (DUF1116)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198407.1"
                     /db_xref="GI:383188279"
                     /db_xref="InterPro:IPR009499"
                     /db_xref="GeneID:11790037"
                     /translation="MKNILEQANTAVIERIRQARPHWLDVQPARQAIPVLNQGKTLLH
                     AGPPIRWEDMTGPVRGACIGACLFEGWAQDEQRALQLLNSGEIRFVPCHHVSAVGPMG
                     GITSANMPVLVIGNLTDGNRAFCNMNEGIGKVMRFGAYGPDVQMRLRWMRDVLAPALS
                     GALRRLERGIDLTAMMAQGITMGDEFHQRNIATSALLMRSLAPQLAAGNLDKTTLTDV
                     LHFLSTTDQFFLNLAMAYCKAAMDAGAAVGKGSIVTAMTRNGKEFGIRVSGLGDRWFT
                     APVNMPQGLFFSGYSQQDANPDMGDSAITETFGVGGAAMIAAPGVTRFVGAGGMDAAI
                     TVSEEMAEIFLERNMMLQIPGWDFQGACLGLDVRRVVETGITPLINTGIAHREPGIGQ
                     IGAGTVRAPLACFEQALEALAEHLGVHPQV"
     misc_feature    351788..352438
                     /locus_tag="Rahaq2_0321"
                     /note="Protein of unknown function (DUF1116); Region:
                     DUF1116; pfam06545"
                     /db_xref="CDD:148259"
     gene            352795..353556
                     /locus_tag="Rahaq2_0322"
                     /note="IMG reference gene:2506707347"
                     /db_xref="GeneID:11790038"
     CDS             352795..353556
                     /locus_tag="Rahaq2_0322"
                     /note="PFAM: Protein of unknown function (DUF2877)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198408.1"
                     /db_xref="GI:383188280"
                     /db_xref="InterPro:IPR021530"
                     /db_xref="GeneID:11790038"
                     /translation="MNIPAPLAVSAHAPVCSGDWLVVGLFSRAINLVNERGEWLTLHR
                     YGKGLSPMGWLLRARDFEGLLSRLTLGDMMREGAENQPTRRLDLHVTQGSRQLYDYVH
                     GFLTGCPQLTGLFGELGQVVLEPPGGELAHIQHQLLRQLQGHRVDWQNVVGKGAGLTP
                     SHDDTLTGMLLVCAAHGLPVGDFFDHTPDLRTLTSSVSCAYLHHAVRRQFSTPLLHLI
                     RARRAEQVLALGHTSGADTLLGVWLALTLFREHFL"
     misc_feature    353248..353535
                     /locus_tag="Rahaq2_0322"
                     /note="Protein of unknown function (DUF2877); Region:
                     DUF2877; pfam11392"
                     /db_xref="CDD:256444"
     gene            353566..354465
                     /locus_tag="Rahaq2_0323"
                     /note="IMG reference gene:2506707348"
                     /db_xref="GeneID:11793776"
     CDS             353566..354465
                     /locus_tag="Rahaq2_0323"
                     /note="PFAM: Amino acid kinase family;
                     TIGRFAM: carbamate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamate kinase"
                     /protein_id="YP_005198409.1"
                     /db_xref="GI:383188281"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR003964"
                     /db_xref="GeneID:11793776"
                     /translation="METLVVALGGNALLQRGECLSAENQYRNIATVAGALARLATRYR
                     LAIVHGNGPQVGLLSLQNQAYTEVPAYPLDILVAETQGMIGFMLAQMLGQQTGMPEVS
                     TVLTRIEVDSRDPAFASPEKFIGPVYPPESQQELETLHGWKMKADGRFLRRVVASPVP
                     KRIVDIDAIQQLLARGHVVICNGGGGIPVFEDGNGAKAVIDKDLSAALLARQLKAQKL
                     VILTDADAVYEHWGTSQQRAIRRATPAQLAPFAQNDGSMGPKVAAVSAFVNYSGYPAY
                     IGALDQIEAVLAGDAGTCISATA"
     misc_feature    353572..354453
                     /locus_tag="Rahaq2_0323"
                     /note="AAK_CK: Carbamate kinase (CK) catalyzes both the
                     ATP-phosphorylation of carbamate and carbamoyl phosphate
                     (CP) utilization with the production of ATP from ADP and
                     CP. Both CK (this CD) and nonhomologous CP synthetase
                     synthesize carbamoyl phosphate, an...; Region: AAK_CK;
                     cd04235"
                     /db_xref="CDD:239768"
     misc_feature    order(353584..353586,353590..353595,353713..353721,
                     353929..353931,354166..354174)
                     /locus_tag="Rahaq2_0323"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239768"
     misc_feature    order(353593..353595,354229..354234,354247..354249,
                     354256..354258,354331..354336,354343..354345)
                     /locus_tag="Rahaq2_0323"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239768"
     misc_feature    order(353593..353595,354229..354234,354247..354249,
                     354256..354258,354331..354336,354343..354345)
                     /locus_tag="Rahaq2_0323"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239768"
     misc_feature    order(353743..353745,353776..353778,353785..353790,
                     353797..353799,353809..353814,353821..353823,
                     353830..353835,353872..353880,353884..353886,
                     354058..354060,354067..354069,354148..354150)
                     /locus_tag="Rahaq2_0323"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239768"
     gene            complement(354497..354742)
                     /locus_tag="Rahaq2_0324"
                     /note="IMG reference gene:2506707349"
                     /db_xref="GeneID:11790039"
     CDS             complement(354497..354742)
                     /locus_tag="Rahaq2_0324"
                     /note="PFAM: Uncharacterised protein family (UPF0270)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198410.1"
                     /db_xref="GI:383188282"
                     /db_xref="InterPro:IPR010648"
                     /db_xref="GeneID:11790039"
                     /translation="MIIPWQELDAELLTSVVESFVLREGTDYGEQERSLEQKVDDVKR
                     QLKSGEVVLVWSELHETLNIMPRGQFRAGQEETPQDG"
     misc_feature    complement(354527..354742)
                     /locus_tag="Rahaq2_0324"
                     /note="hypothetical protein; Provisional; Region:
                     PRK04966"
                     /db_xref="CDD:179903"
     gene            complement(354739..355734)
                     /locus_tag="Rahaq2_0325"
                     /note="IMG reference gene:2506707350"
                     /db_xref="GeneID:11790040"
     CDS             complement(354739..355734)
                     /locus_tag="Rahaq2_0325"
                     /note="PFAM: alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydrolase of the alpha/beta-hydrolase
                     fold protein"
                     /protein_id="YP_005198411.1"
                     /db_xref="GI:383188283"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000952"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="GeneID:11790040"
                     /translation="MVESFRPLRGASNPHIQTLLPRLVRRHAKLKPHWQRLDTPDGDF
                     LDLAWSEDPEQARHKPRMILFHGLEGSFYSPYAHGLLQAWKDKGWLGVVMHFRGCSGE
                     PNKLLRIYHSGETEDARFFIRWLNETHGEVPTGAVGVSLGGNMLACYLGQEGEKCTLS
                     AAVVVSAPLMLEPCAYRLERGSSRIYQHYLLGQLKGNALRKLAKYPGTLPVTLAQLKA
                     MRRLREFDDAITSKAHGFTDALDYYRRCSALPLLAQIRTPLLIIHAKDDPFMTPEVIP
                     KAEDLPDCVEYQLTEHGGHVGFVSGSLRNPQMWLEQRIPAWIAPFLENKTKETTE"
     misc_feature    complement(354760..355728)
                     /locus_tag="Rahaq2_0325"
                     /note="putative hydrolase; Provisional; Region: PRK10985"
                     /db_xref="CDD:182883"
     misc_feature    complement(354760..355722)
                     /locus_tag="Rahaq2_0325"
                     /note="Predicted hydrolase of the alpha/beta-hydrolase
                     fold [General function prediction only]; Region: COG0429"
                     /db_xref="CDD:223506"
     gene            355835..356437
                     /locus_tag="Rahaq2_0326"
                     /note="IMG reference gene:2506707351"
                     /db_xref="GeneID:11790041"
     CDS             355835..356437
                     /locus_tag="Rahaq2_0326"
                     /note="PFAM: LysE type translocator"
                     /codon_start=1
                     /transl_table=11
                     /product="putative threonine efflux protein"
                     /protein_id="YP_005198412.1"
                     /db_xref="GI:383188284"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="GeneID:11790041"
                     /translation="MEPGLFLSMLGFLWVAAITPGPNNMLLTTSGANFGFFRSLWLMV
                     GIMLGMQSILLLVAFGVGGLITIYPALHLFLKIAGSLYLLWLAWKIATSVYEKLETGA
                     PPPKPIRLYQGWLLQFLNPKAWLMGLGAVASFSLAGAAYNHSIAGISLGMFLVNLVSG
                     IIWLGFGTVIGRLLRSKRAWYTFNIAMGMLTAACVLLIWH"
     misc_feature    355835..356434
                     /locus_tag="Rahaq2_0326"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            complement(356492..358411)
                     /locus_tag="Rahaq2_0327"
                     /note="IMG reference gene:2506707352"
                     /db_xref="GeneID:11790042"
     CDS             complement(356492..358411)
                     /locus_tag="Rahaq2_0327"
                     /note="PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_005198413.1"
                     /db_xref="GI:383188285"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11790042"
                     /translation="MIVFSSLQIRRGTNVLLDNASATINPGQKVGLVGKNGCGKSTLI
                     SLLKGEMSADAGNLTFPSNWALAWVNQETPALDEPAIEYVIDGDREFRQLEAQLQHAN
                     ERDDGHAIATLHGKLDAINAWTIPARAASLLSGLGFTQNQLQQPVKSFSGGWRMRLNL
                     AQALICRSDLLLLDEPTNHLDLDAVIWLEKWLKSYTGTLVLISHDRDFLDPIVDKILH
                     IEQQMLNEYTGNYSSFERQRATKLSQQQALFESQQEKVAHLQSYIDRFRAQATKAKQA
                     QSRIKMLERMELIAPAHVDNPFHFSFRSPESLPDPLLRMEKVSAGYGDTTILESIKLN
                     LVPGSRIGLLGRNGAGKSTLIKLLAGTMPPLQGDIGLAKGVKLGYFAQHQLEFLRAED
                     SPLQHLVRLANKETEQQLRDYLGGFGFHGDKVTDPTGRFSGGEKARLVLALIVWQRPN
                     LLLLDEPTNHLDLDMRQALTEALIDFEGAMVVVSHDRHLLRSTTDDLYLVHGGKVEQF
                     DGDLEDYQQWLVDIQRQESQQDAPAKDGGVNSAQSRKDQKRREADFRNQTQPLRKQIT
                     QLEAQMEKLSTELAAIEARLADSAIYDISRKADLTDCLQQQTKVKGALEETEMTWLDA
                     QEQLEEMSKAFDIEN"
     misc_feature    complement(356498..358411)
                     /locus_tag="Rahaq2_0327"
                     /note="putative ABC transporter ATP-binding protein;
                     Provisional; Region: PRK10636"
                     /db_xref="CDD:236729"
     misc_feature    complement(357746..358408)
                     /locus_tag="Rahaq2_0327"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    complement(357512..357763)
                     /locus_tag="Rahaq2_0327"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    complement(356900..357475)
                     /locus_tag="Rahaq2_0327"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    complement(<356519..>356881)
                     /locus_tag="Rahaq2_0327"
                     /note="The Bin/Amphiphysin/Rvs (BAR) domain, a
                     dimerization module that binds membranes and detects
                     membrane curvature; Region: BAR; cl12013"
                     /db_xref="CDD:264507"
     gene            358541..359095
                     /locus_tag="Rahaq2_0328"
                     /note="IMG reference gene:2506707353"
                     /db_xref="GeneID:11790043"
     CDS             358541..359095
                     /locus_tag="Rahaq2_0328"
                     /note="PFAM: Flavodoxin-like fold"
                     /codon_start=1
                     /transl_table=11
                     /product="putative NADPH-quinone reductase (modulator of
                     drug activity B)"
                     /protein_id="YP_005198414.1"
                     /db_xref="GI:383188286"
                     /db_xref="InterPro:IPR003680"
                     /db_xref="GeneID:11790043"
                     /translation="MSQPPKVLLLYAHPESPDSVANRVLLQQAQQLEHVTVHDLYAHY
                     PDFFIDIHREQQLLREHKVIVFQHPLYTYSCPALLKEWMDRVLARGFASGAGGNALNG
                     KYWRSVVTTGEPEGAYRAGGYNRYPMSDIMRPFELTSAMCHMHWMTPIVIYWARRQKP
                     DVLQSHAEAYGEWLRSPLPHGGIV"
     misc_feature    358541..359089
                     /locus_tag="Rahaq2_0328"
                     /note="glutathione-regulated potassium-efflux system
                     ancillary protein KefG; Provisional; Region: PRK04930"
                     /db_xref="CDD:179895"
     gene            359095..360903
                     /locus_tag="Rahaq2_0329"
                     /note="IMG reference gene:2506707354"
                     /db_xref="GeneID:11790044"
     CDS             359095..360903
                     /locus_tag="Rahaq2_0329"
                     /note="PFAM: TrkA-N domain; Sodium/hydrogen exchanger
                     family;
                     TIGRFAM: transporter, monovalent cation:proton
                     antiporter-2 (CPA2) family"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, monovalent cation:proton
                     antiporter-2 (CPA2) family"
                     /protein_id="YP_005198415.1"
                     /db_xref="GI:383188287"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11790044"
                     /translation="MDVSSIPTAILLFLFAAVVAVPLAQRLGIGAVLGYLLAGIAIGP
                     WGLGFIRDVDEILHFSELGVVFLMFIIGLELNPGKLWALRRQIFGVGAGQVILTALVL
                     GGLLYLTKFSWQAAVIGGIGLAMSSTAMALQLMRDKGMTRNEGGQLGFAVLLFQDIAV
                     IPALALIPILAGGSEGSNNWEMIGLKVLAFGGMLIGGRYLLRPIFRLIVASGVREVFT
                     AAALLVVLGSALFMDTLGFSMALGTFIAGILLAESEYQHELEIAIEPFKGLLLGLFFI
                     SVGMALNLGVLYTHILLVLAGVIILVAVKSALLYGLSRVFGLRTSVRLQFSAVLSQGG
                     EFAFVLFSAAGAQKVISSSQLSLLLVVVTLSMMTTPLLMQWVDRILVRRYNDGEESDE
                     KHFVQDDEPQVIIVGFGRFGQVIGRLLMANKMRITVLERDISAVGLMRTYGYKVYYGD
                     ATELELLRASGAEKAKSIVITSNEPEDTMAIVHLCQQHFPHLNILARARGRVEAHELL
                     QAGVVNFSRETFSSALELGKKALVTLGMHPHSAYRAQQHFRRLDMRMLRELVPQNRGD
                     VAQISRVKEARRELEDIFQSEMHNERRQLDGWDDDE"
     misc_feature    359095..360897
                     /locus_tag="Rahaq2_0329"
                     /note="glutathione-regulated potassium-efflux system
                     protein KefB; Provisional; Region: PRK03659"
                     /db_xref="CDD:179625"
     misc_feature    359095..360273
                     /locus_tag="Rahaq2_0329"
                     /note="Kef-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: KefB;
                     COG0475"
                     /db_xref="CDD:223551"
     misc_feature    360301..360630
                     /locus_tag="Rahaq2_0329"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     gene            360982..361185
                     /locus_tag="Rahaq2_0330"
                     /note="IMG reference gene:2506707355"
                     /db_xref="GeneID:11790045"
     CDS             360982..361185
                     /locus_tag="Rahaq2_0330"
                     /note="PFAM: Probable metal-binding protein (DUF2387);
                     TIGRFAM: conserved hypothetical metal-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198416.1"
                     /db_xref="GI:383188288"
                     /db_xref="InterPro:IPR012658"
                     /db_xref="GeneID:11790045"
                     /translation="MATTRKRFIAGAVCPKCKAMDTLALWQEDQVEVVECVKCGHHQR
                     QTDAQVSKKLRPEEQVIGIFDPK"
     misc_feature    360991..361173
                     /locus_tag="Rahaq2_0330"
                     /note="Probable metal-binding protein (DUF2387); Region:
                     DUF2387; pfam09526"
                     /db_xref="CDD:150261"
     gene            361384..361971
                     /locus_tag="Rahaq2_0331"
                     /note="IMG reference gene:2506707356"
                     /db_xref="GeneID:11790046"
     CDS             361384..361971
                     /locus_tag="Rahaq2_0331"
                     /note="PFAM: FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_005198417.1"
                     /db_xref="GI:383188289"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="GeneID:11790046"
                     /translation="MKVAKDLVVSVAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISG
                     LETALDGHAVGDRFDVHVGANDAYGNYDENLVQRVPKDVFMGVEELEVGMRFLADTDQ
                     GPVPVEITEVDGDHVVVDGNHMLAGQNLNFHVEVVAIREATEEELAHGHVHGEHGHDH
                     GHDHEHGDGCCGGHDHDHDHGKKGGCGGNGGCGCH"
     misc_feature    361384..>361842
                     /locus_tag="Rahaq2_0331"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Provisional; Region: PRK10737"
                     /db_xref="CDD:236748"
     misc_feature    361384..361827
                     /locus_tag="Rahaq2_0331"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerases 2
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: SlpA; COG1047"
                     /db_xref="CDD:223976"
     gene            complement(362036..362254)
                     /locus_tag="Rahaq2_0332"
                     /note="IMG reference gene:2506707357"
                     /db_xref="GeneID:11793777"
     CDS             complement(362036..362254)
                     /locus_tag="Rahaq2_0332"
                     /note="PFAM: SlyX"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198418.1"
                     /db_xref="GI:383188290"
                     /db_xref="InterPro:IPR007236"
                     /db_xref="GeneID:11793777"
                     /translation="MNSNTVEQRLEMLENKLAFQEITIEELNMIVTQHQLEMSRLHDH
                     LRLLTDKLRASQPSMIADPSEETPPPHY"
     misc_feature    complement(362039..362254)
                     /locus_tag="Rahaq2_0332"
                     /note="phi X174 lysis protein; Provisional; Region:
                     PRK02793"
                     /db_xref="CDD:179472"
     gene            362548..363408
                     /locus_tag="Rahaq2_0333"
                     /note="IMG reference gene:2506707358"
                     /db_xref="GeneID:11790047"
     CDS             362548..363408
                     /locus_tag="Rahaq2_0333"
                     /note="PFAM: FKBP-type peptidyl-prolyl cis-trans
                     isomerase; Domain amino terminal to FKBP-type
                     peptidyl-prolyl isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_005198419.1"
                     /db_xref="GI:383188291"
                     /db_xref="InterPro:IPR000774"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="GeneID:11790047"
                     /translation="MKSLFKVTLLATTMAIALNATQVMAAEATAPAAAATAPAAAPAA
                     AAPAATDTAKFKSDDEQAAYALGASLGRYMDNSLKEQEKLGIKLDKDQLIAGVQDAFA
                     NKSKLSDQEIEQTLQTFEGRVKASAQAKMEQDAKANADKGDKFRADFAKEKGVKKTES
                     GLLYQVEKPGAGAAPKDSDTVVVNYKGTLTDGTEFDNSYTRGEPLSFRLDGVIPGWTE
                     GLKHIKKGGKIKLVIPPALAYGKTGVPGIPANSTLVFDVELLDVKAAPKADPKAAEKP
                     AEAEAAPKAN"
     misc_feature    362548..363333
                     /locus_tag="Rahaq2_0333"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Provisional; Region: PRK10902"
                     /db_xref="CDD:236791"
     misc_feature    362707..363045
                     /locus_tag="Rahaq2_0333"
                     /note="Domain amino terminal to FKBP-type peptidyl-prolyl
                     isomerase; Region: FKBP_N; pfam01346"
                     /db_xref="CDD:250550"
     misc_feature    363067..363327
                     /locus_tag="Rahaq2_0333"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Region: FKBP_C; pfam00254"
                     /db_xref="CDD:249719"
     gene            363672..364394
                     /locus_tag="Rahaq2_0334"
                     /note="IMG reference gene:2506707359"
                     /db_xref="GeneID:11790048"
     CDS             363672..364394
                     /locus_tag="Rahaq2_0334"
                     /note="PFAM: YheO-like PAS domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198420.1"
                     /db_xref="GI:383188292"
                     /db_xref="InterPro:IPR013559"
                     /db_xref="GeneID:11790048"
                     /translation="MSNSLITGETGELDLLDQRPFSQVDHEILSSYEAVVDGLAMLIG
                     EHCEIVLHSLEDLKCSAVRIANGEHTGRKIGSPITDLALRMLHDMTGADSNVSKAYFT
                     RAKSGVLMKSVTIAIRNREQRVIGLLCINMNLDVPFSQIIQTFMPPETQEVASSVNFA
                     SSVDDLVAQTLEFTIEEVNADRNVSNNAKNRQVVLNLYEKGIFDIKDAINQVADRLNI
                     SKHTVYLYIRQFKSGDLVGNER"
     misc_feature    363726..364373
                     /locus_tag="Rahaq2_0334"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2964"
                     /db_xref="CDD:225512"
     misc_feature    363753..364103
                     /locus_tag="Rahaq2_0334"
                     /note="YheO-like PAS domain; Region: PAS_6; pfam08348"
                     /db_xref="CDD:254749"
     misc_feature    364164..364355
                     /locus_tag="Rahaq2_0334"
                     /note="HTH domain; Region: HTH_22; pfam13309"
                     /db_xref="CDD:257646"
     gene            364391..364783
                     /locus_tag="Rahaq2_0335"
                     /note="IMG reference gene:2506707360"
                     /db_xref="GeneID:11793778"
     CDS             364391..364783
                     /locus_tag="Rahaq2_0335"
                     /note="PFAM: DsrE/DsrF-like family;
                     TIGRFAM: sulfur relay protein TusD/DsrE"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur relay protein TusD/DsrE"
                     /protein_id="YP_005198421.1"
                     /db_xref="GI:383188293"
                     /db_xref="InterPro:IPR003787"
                     /db_xref="InterPro:IPR017463"
                     /db_xref="GeneID:11793778"
                     /translation="MKLRYCLLVTGPAYGTQQASAAYQFALALISSGHHLDSVFFYRE
                     GVLNGNLLSAPASDEFDLVRSWQRMAADYQVALNVCVAAALRRGVIDETEAHNQGHGQ
                     TNLQPGFTLTGLGSLAEASLTCDRLVQF"
     misc_feature    364397..364780
                     /locus_tag="Rahaq2_0335"
                     /note="sulfur transfer complex subunit TusD; Validated;
                     Region: PRK00207"
                     /db_xref="CDD:178928"
     gene            364806..365165
                     /locus_tag="Rahaq2_0336"
                     /note="IMG reference gene:2506707361"
                     /db_xref="GeneID:11790049"
     CDS             364806..365165
                     /locus_tag="Rahaq2_0336"
                     /note="PFAM: DsrE/DsrF-like family;
                     TIGRFAM: sulfur relay protein TusC/DsrF"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur relay protein TusC/DsrF"
                     /protein_id="YP_005198422.1"
                     /db_xref="GI:383188294"
                     /db_xref="InterPro:IPR003787"
                     /db_xref="InterPro:IPR017462"
                     /db_xref="GeneID:11790049"
                     /translation="MKKIAFVFTQGPHGTSAGREGLDALLATSALTEDIGVFFMSDGV
                     FQLMPAQQPEKILARNYIATFGVLSLYDVDQCFVCEESLKTRGLSAGHEWVLDVEPLP
                     VAEIRQRLADYDVVMTF"
     misc_feature    364806..365162
                     /locus_tag="Rahaq2_0336"
                     /note="sulfur relay protein TusC; Validated; Region:
                     PRK00211"
                     /db_xref="CDD:178930"
     gene            365179..365466
                     /locus_tag="Rahaq2_0337"
                     /note="IMG reference gene:2506707362"
                     /db_xref="GeneID:11790050"
     CDS             365179..365466
                     /locus_tag="Rahaq2_0337"
                     /note="PFAM: DsrH like protein;
                     TIGRFAM: sulfur relay protein TusB/DsrH"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur relay protein TusB/DsrH"
                     /protein_id="YP_005198423.1"
                     /db_xref="GI:383188295"
                     /db_xref="InterPro:IPR007215"
                     /db_xref="GeneID:11790050"
                     /translation="MLFTLASSPQQCDFSLLINMITQDDALLLMQDGVLAAVDGSEAC
                     NLMSQHVQSVYVLSEDLAARGLVGQISHKITLIDYTGFVALTEKHAQQTAW"
     misc_feature    365179..365463
                     /locus_tag="Rahaq2_0337"
                     /note="DsrH like protein; Region: DsrH; cl17347"
                     /db_xref="CDD:266638"
     gene            365610..365984
                     /locus_tag="Rahaq2_0338"
                     /note="IMG reference gene:2506707363"
                     /db_xref="GeneID:11790051"
     CDS             365610..365984
                     /locus_tag="Rahaq2_0338"
                     /note="PFAM: Ribosomal protein S12;
                     TIGRFAM: ribosomal protein S12, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="YP_005198424.1"
                     /db_xref="GI:383188296"
                     /db_xref="InterPro:IPR005679"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016027"
                     /db_xref="GeneID:11790051"
                     /translation="MATINQLVRKPRSTKVAKSNVPALEACPQKRGVCTRVYTTTPKK
                     PNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGAL
                     DCSGVKDRKQSRSKYGVKKPKS"
     misc_feature    365616..365939
                     /locus_tag="Rahaq2_0338"
                     /note="S12-like family, 30S ribosomal protein S12
                     subfamily; S12 is located at the interface of the large
                     and small ribosomal subunits of prokaryotes, chloroplasts
                     and mitochondria, where it plays an important role in both
                     tRNA and ribosomal subunit...; Region: Ribosomal_S12;
                     cd03368"
                     /db_xref="CDD:239466"
     misc_feature    order(365619..365624,365628..365633,365640..365645)
                     /locus_tag="Rahaq2_0338"
                     /note="S17 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239466"
     misc_feature    365619..365621
                     /locus_tag="Rahaq2_0338"
                     /note="S8 interaction site; other site"
                     /db_xref="CDD:239466"
     misc_feature    order(365643..365651,365685..365687,365691..365696,
                     365700..365702,365745..365750,365754..365762,
                     365781..365783,365805..365807,365814..365819,
                     365856..365861,365871..365876,365937..365939)
                     /locus_tag="Rahaq2_0338"
                     /note="16S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(365736..365741,365871..365873)
                     /locus_tag="Rahaq2_0338"
                     /note="streptomycin interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    365739..365744
                     /locus_tag="Rahaq2_0338"
                     /note="23S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(365742..365759,365817..365843)
                     /locus_tag="Rahaq2_0338"
                     /note="aminoacyl-tRNA interaction site (A-site)
                     [nucleotide binding]; other site"
                     /db_xref="CDD:239466"
     gene            366081..366551
                     /locus_tag="Rahaq2_0339"
                     /note="IMG reference gene:2506707364"
                     /db_xref="GeneID:11790052"
     CDS             366081..366551
                     /locus_tag="Rahaq2_0339"
                     /note="PFAM: Ribosomal protein S7p/S5e;
                     TIGRFAM: ribosomal protein S7, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="YP_005198425.1"
                     /db_xref="GI:383188297"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="GeneID:11790052"
                     /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVY
                     TALETLAQRSGKGHLEAFEVALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
                     WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFAHYRW"
     misc_feature    366081..366548
                     /locus_tag="Rahaq2_0339"
                     /note="30S ribosomal protein S7; Validated; Region:
                     PRK05302"
                     /db_xref="CDD:235398"
     gene            366648..368762
                     /locus_tag="Rahaq2_0340"
                     /note="IMG reference gene:2506707365"
                     /db_xref="GeneID:11793779"
     CDS             366648..368762
                     /locus_tag="Rahaq2_0340"
                     /note="PFAM: Elongation factor Tu domain 2; Elongation
                     factor G C-terminus; Elongation factor Tu GTP binding
                     domain; Elongation factor G, domain IV;
                     TIGRFAM: translation elongation factor EF-G; small
                     GTP-binding protein domain"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor EF-G"
                     /protein_id="YP_005198426.1"
                     /db_xref="GI:383188298"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="GeneID:11793779"
                     /translation="MARKTPIERYRNIGISAHIDAGKTTTTERVLFYTGVNHKIGEVH
                     DGAATMDWMEQEQERGITITSAATTCFWSGMAKQFEPHHINIIDTPGHVDFTIEVERS
                     MRVLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVDQIEK
                     RLGATPVPLQLAIGAEEKFTGVVDLVKMKAINWNEADQGVTFEYEEIPANMQELAEEW
                     RQKLVESAAEGSDELMEKFFGGEELTEEEIKASLRKRVLNNEIILVTCGSAFKNKGVQ
                     AMLDAVVEYLPAPTDVEAINGLLDDGKDTPAVRHSDDSEPFSALAFKIATDPFVGNLT
                     FFRVYSGLVNSGDTVFNPVKSQRERLGRIVQMHANKREEIKEVRAGDIAAAIGLKDVT
                     TGDTLCDPDNVIILERMEFPEPVISVAVEPKTKADQEKMGLALGRLAKEDPSFRVWTD
                     EESGQTIIAGMGELHLDILVDRMRREFNVEANVGKPQVAYREAIRAKVTDVEGKHAKQ
                     SGGRGQYGHVVIDMYPLEPGTNPKGYEFVNEIKGGVIPGEFIGAIDKGIQEQLKSGPL
                     AGYPVVDLGVRLHFGSYHDVDSSELAFKLAASIAFKDGFKKAKPVLLEPIMKVEVETP
                     EENTGDVIGDLSRRRGMLKGQESNATGVVIHAEVPLSEMFGYATQLRSLTKGRASYSM
                     EFLKYDDAPNNVALAVIEARGK"
     misc_feature    366648..368759
                     /locus_tag="Rahaq2_0340"
                     /note="elongation factor G; Reviewed; Region: PRK00007"
                     /db_xref="CDD:234569"
     misc_feature    366681..367514
                     /locus_tag="Rahaq2_0340"
                     /note="Elongation factor G (EF-G) family involved in both
                     the elongation and ribosome recycling phases of protein
                     synthesis; Region: EF-G; cd01886"
                     /db_xref="CDD:206673"
     misc_feature    366696..366719
                     /locus_tag="Rahaq2_0340"
                     /note="G1 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    order(366699..366701,366705..366707,366717..366722,
                     366729..366731,366738..366743,366843..366848,
                     366921..366926,366993..366998,367104..367106,
                     367116..367118)
                     /locus_tag="Rahaq2_0340"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206673"
     misc_feature    order(366705..366707,366711..366722,367071..367076,
                     367080..367082,367449..367457)
                     /locus_tag="Rahaq2_0340"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206673"
     misc_feature    366786..366845
                     /locus_tag="Rahaq2_0340"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206673"
     misc_feature    366831..366833
                     /locus_tag="Rahaq2_0340"
                     /note="G2 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    366909..366920
                     /locus_tag="Rahaq2_0340"
                     /note="G3 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    366915..366971
                     /locus_tag="Rahaq2_0340"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206673"
     misc_feature    367071..367082
                     /locus_tag="Rahaq2_0340"
                     /note="G4 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    367449..367457
                     /locus_tag="Rahaq2_0340"
                     /note="G5 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    367596..367844
                     /locus_tag="Rahaq2_0340"
                     /note="EFG_mtEFG_II: this subfamily represents the domain
                     II of elongation factor G (EF-G) in bacteria and, the
                     C-terminus of mitochondrial Elongation factor G1 (mtEFG1)
                     and G2 (mtEFG2)_like proteins found in eukaryotes. During
                     the process of peptide synthesis...; Region: EFG_mtEFG_II;
                     cd04088"
                     /db_xref="CDD:239755"
     misc_feature    367878..368099
                     /locus_tag="Rahaq2_0340"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    368115..368474
                     /locus_tag="Rahaq2_0340"
                     /note="EFG_mtEFG1_IV: domains similar to domain IV of the
                     bacterial translational elongation factor (EF) EF-G.
                     Included in this group is a domain of mitochondrial
                     Elongation factor G1 (mtEFG1) proteins homologous to
                     domain IV of EF-G. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG1_IV; cd01434"
                     /db_xref="CDD:238715"
     misc_feature    368487..368720
                     /locus_tag="Rahaq2_0340"
                     /note="EFG_mtEFG_C: domains similar to the C-terminal
                     domain of the bacterial translational elongation factor
                     (EF) EF-G.  Included in this group is the C-terminus of
                     mitochondrial Elongation factor G1 (mtEFG1) and G2
                     (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG_C; cd03713"
                     /db_xref="CDD:239683"
     gene            368834..370018
                     /locus_tag="Rahaq2_0341"
                     /note="IMG reference gene:2506707366"
                     /db_xref="GeneID:11790053"
     CDS             368834..370018
                     /locus_tag="Rahaq2_0341"
                     /note="PFAM: Elongation factor Tu domain 2; Elongation
                     factor Tu C-terminal domain; Elongation factor Tu GTP
                     binding domain;
                     TIGRFAM: small GTP-binding protein domain; translation
                     elongation factor TU"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor TU"
                     /protein_id="YP_005198427.1"
                     /db_xref="GI:383188299"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="GeneID:11790053"
                     /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYMIVFMNKCDMVDDEELLELVEMEVRELLSA
                     YEFPGDDIPVIKGSALKALEGDATWEAKIIELAEALDSYIPLPERAIDKPFLLPIEDV
                     FSISGRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVG
                     VLLRGIKREDIERGQVLAKPGSIKPHTKFDSEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNVNMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IA"
     misc_feature    368834..370015
                     /locus_tag="Rahaq2_0341"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     misc_feature    368864..369442
                     /locus_tag="Rahaq2_0341"
                     /note="Elongation Factor Tu (EF-Tu) GTP-binding proteins;
                     Region: EF_Tu; cd01884"
                     /db_xref="CDD:206671"
     misc_feature    368888..368911
                     /locus_tag="Rahaq2_0341"
                     /note="G1 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    order(368891..368893,368897..368899,368909..368914,
                     368921..368923,368930..368935,368945..368947,
                     369029..369034,369086..369091,369158..369163,
                     369167..369178,369185..369187,369278..369280,
                     369290..369292,369368..369373)
                     /locus_tag="Rahaq2_0341"
                     /note="GEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    order(368897..368914,368972..368974,369239..369244,
                     369248..369250,369353..369361)
                     /locus_tag="Rahaq2_0341"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    368999..369031
                     /locus_tag="Rahaq2_0341"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206671"
     misc_feature    369017..369019
                     /locus_tag="Rahaq2_0341"
                     /note="G2 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    369074..369085
                     /locus_tag="Rahaq2_0341"
                     /note="G3 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    369080..369136
                     /locus_tag="Rahaq2_0341"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206671"
     misc_feature    369239..369250
                     /locus_tag="Rahaq2_0341"
                     /note="G4 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    369353..369361
                     /locus_tag="Rahaq2_0341"
                     /note="G5 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    369464..369724
                     /locus_tag="Rahaq2_0341"
                     /note="EFTU_II: Elongation factor Tu domain II. Elongation
                     factors Tu (EF-Tu) are three-domain GTPases with an
                     essential function in the elongation phase of mRNA
                     translation. The GTPase center of EF-Tu is in the
                     N-terminal domain (domain I), also known as the...;
                     Region: EFTU_II; cd03697"
                     /db_xref="CDD:239668"
     misc_feature    369731..370000
                     /locus_tag="Rahaq2_0341"
                     /note="Domain III of elongation factor (EF) Tu. Ef-Tu
                     consists of three structural domains, designated I, II and
                     III. Domain III adopts a beta barrel structure. Domain III
                     is involved in binding to both charged tRNA and binding to
                     elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707"
                     /db_xref="CDD:239678"
     misc_feature    order(369767..369769,369773..369781,369833..369835,
                     369953..369961,369989..369991)
                     /locus_tag="Rahaq2_0341"
                     /note="Antibiotic Binding Site [chemical binding]; other
                     site"
                     /db_xref="CDD:239678"
     gene            370304..372508
                     /locus_tag="Rahaq2_0342"
                     /note="IMG reference gene:2506707367"
                     /db_xref="GeneID:11790054"
     CDS             370304..372508
                     /locus_tag="Rahaq2_0342"
                     /note="PFAM: Glycosyl hydrolases family 18"
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="YP_005198428.1"
                     /db_xref="GI:383188300"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR003610"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11790054"
                     /translation="MKLKYIASLIALSLISTSAMAKLKANDDTNQMEGTNGETMMRSN
                     DNGKTWFHFETTKDGESYGLNNNFPGTQTVIVANEMYPVMNTPAWDASQTYSKPDNKV
                     RYDGYFWTNQWWAGPEQVPGVDDVWKKGEPTNLQSNILGTFYFTPWTGEKAEQFQAES
                     KAQVASQRKIIGYFPEWGVYDAHNNFTPDKINMSNLTHVNYGFAVIKNGIVEMHDAEK
                     APQLIPELVGRTSTQGRRLMISFGGWDNSQEGAFEAATATSAGSEKLAQSMVDYMLKW
                     HFDGIDVDWEYPDNEQEKAQFTQLIQLLRSKLDSVGLQNDKYFQLSAAVTTSYKNMEF
                     INPTVTTPLLDSVNVMAYDIHGAFDPITGHNAPLFANSKDTDTKLNDAYAMKEYNQTY
                     GVPKSKLMMGLAFYGRAWGEVEPTIIVPGLPGLFVPGNATVKGAWDDVGQTTGTNPYY
                     LLKDWAKNPAFTRYYDTEARVPYLYNAQTKEFFTYDDEQSIREKVDYIQSEGFGGAII
                     WDLSGDTPDYDLGNIAKDILYSNVKENDVTRFVIEMKGAIPVVRADINKDYNSHYIFK
                     KNDKYFGELFTNGSSPYMSQGNTDESIILRSDTVKPKAGDELTITMEDEDHVFSTVKT
                     LVVTDEMLVQEQSITTDPNFLSMNVDSDKLLVSISKDFTDHYILQSNGNYIGELYTNK
                     TSPYLYRQDTADTIVLKHNLTTTEKAPGTKFTVLRENKVAGQFVIVGETVTP"
     misc_feature    370562..370690
                     /locus_tag="Rahaq2_0342"
                     /note="Chitin-binding domain of chitinase C; Region:
                     ChiC_BD; cd12215"
                     /db_xref="CDD:213178"
     misc_feature    370640..370645
                     /locus_tag="Rahaq2_0342"
                     /note="aromatic chitin/cellulose binding site residues
                     [chemical binding]; other site"
                     /db_xref="CDD:213178"
     misc_feature    370808..371845
                     /locus_tag="Rahaq2_0342"
                     /note="Glyco_18 domain; Region: Glyco_18; smart00636"
                     /db_xref="CDD:214753"
     misc_feature    370811..371845
                     /locus_tag="Rahaq2_0342"
                     /note="The GH18 (glycosyl hydrolases, family 18) type II
                     chitinases hydrolyze chitin, an abundant polymer of
                     N-acetylglucosamine and have been identified in bacteria,
                     fungi, insects, plants, viruses, and protozoan parasites.
                     The structure of this domain is an...; Region:
                     GH18_chitinase; cd06548"
                     /db_xref="CDD:119365"
     misc_feature    order(370820..370822,370910..370912,371147..371149,
                     371153..371155,371159..371161,371351..371353,
                     371357..371362,371519..371521,371828..371830)
                     /locus_tag="Rahaq2_0342"
                     /note="active site"
                     /db_xref="CDD:119365"
     gene            372679..372873
                     /locus_tag="Rahaq2_0343"
                     /note="IMG reference gene:2506707368"
                     /db_xref="GeneID:11793780"
     CDS             372679..372873
                     /locus_tag="Rahaq2_0343"
                     /note="PFAM: BFD-like [2Fe-2S] binding domain;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin-associated ferredoxin"
                     /protein_id="YP_005198429.1"
                     /db_xref="GI:383188301"
                     /db_xref="InterPro:IPR007419"
                     /db_xref="GeneID:11793780"
                     /translation="MYVCLCNSVSDKTIRQAVRRYQPQTFQQLRNFVPVGTQCGKCVR
                     VARQIMEDELQQIPQFDNIA"
     misc_feature    372679..372870
                     /locus_tag="Rahaq2_0343"
                     /note="bacterioferritin-associated ferredoxin;
                     Provisional; Region: PRK10509"
                     /db_xref="CDD:182506"
     gene            372959..373438
                     /locus_tag="Rahaq2_0344"
                     /note="IMG reference gene:2506707369"
                     /db_xref="GeneID:11790055"
     CDS             372959..373438
                     /locus_tag="Rahaq2_0344"
                     /note="PFAM: Ferritin-like domain;
                     TIGRFAM: bacterioferritin"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="YP_005198430.1"
                     /db_xref="GI:383188302"
                     /db_xref="InterPro:IPR002024"
                     /db_xref="InterPro:IPR008331"
                     /db_xref="InterPro:IPR009040"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="GeneID:11790055"
                     /translation="MKGDKKVIAHLNKLLGNELVAINQYFLHARMFKNWGLMRLNGIE
                     YHESIDEMKHADIYIERILFLEGLPNLQDLGKLNIGEDVEEMLKSDLLLELEGAKDLR
                     EGIAYADSVHDYVSRDLMITILADEEHHIDWLETELELIGRIGIQNYIQSQLKEESQ"
     misc_feature    372962..373420
                     /locus_tag="Rahaq2_0344"
                     /note="Bacterioferritin, ferritin-like diiron-binding
                     domain; Region: Bacterioferritin; cd00907"
                     /db_xref="CDD:153099"
     misc_feature    372980..373390
                     /locus_tag="Rahaq2_0344"
                     /note="Ferritin-like domain; Region: Ferritin; pfam00210"
                     /db_xref="CDD:249681"
     misc_feature    order(373001..373003,373025..373027,373046..373048,
                     373091..373093,373112..373114,373124..373126)
                     /locus_tag="Rahaq2_0344"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:153099"
     misc_feature    order(373007..373012,373016..373021,373031..373033,
                     373109..373111,373118..373120,373235..373240,
                     373247..373249,373259..373261,373334..373339)
                     /locus_tag="Rahaq2_0344"
                     /note="ferroxidase pore; other site"
                     /db_xref="CDD:153099"
     misc_feature    order(373010..373012,373031..373033,373109..373111,
                     373118..373120,373238..373240,373259..373261,
                     373337..373339,373346..373348)
                     /locus_tag="Rahaq2_0344"
                     /note="ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153099"
     gene            complement(373450..374283)
                     /locus_tag="Rahaq2_0345"
                     /note="IMG reference gene:2506707370"
                     /db_xref="GeneID:11790056"
     CDS             complement(373450..374283)
                     /locus_tag="Rahaq2_0345"
                     /note="PFAM: Bacterial Peptidase A24 N-terminal domain;
                     Type IV leader peptidase family"
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin signal peptidase PulO-like peptidase"
                     /protein_id="YP_005198431.1"
                     /db_xref="GI:383188303"
                     /db_xref="InterPro:IPR000045"
                     /db_xref="InterPro:IPR010627"
                     /db_xref="InterPro:IPR014032"
                     /db_xref="GeneID:11790056"
                     /translation="MSEGWQQMAYITSLPGGFYHTCITLLGLLMGSFLNVAVYRLPLM
                     IRNDERKAENSFNLSFPASHCPTCKHPLQYWQNIPVLSWLLLRGKCHYCETTISKRYP
                     LTEAGCAVMFLGLSFLFTTPLSLFSALLLFWFLLALSLIDLATYLLPDRLTLPLLWAG
                     LLIHSLYGNVTLQDALYGAVAGYLVLWFLYQAVKFVSGKEGMGYGDFKLLAALGAWVG
                     WQMLPYLCIFAALTGIVFTLARVGLYKMSEQTPFGPCLALAGALIYISQESKIIWLML
                     S"
     misc_feature    complement(373456..374217)
                     /locus_tag="Rahaq2_0345"
                     /note="Type II secretory pathway, prepilin signal
                     peptidase PulO and related peptidases [Cell motility and
                     secretion / Posttranslational modification, protein
                     turnover, chaperones / Intracellular trafficking and
                     secretion]; Region: PulO; COG1989"
                     /db_xref="CDD:224900"
     misc_feature    complement(373927..374211)
                     /locus_tag="Rahaq2_0345"
                     /note="Bacterial Peptidase A24 N-terminal domain; Region:
                     DiS_P_DiS; pfam06750"
                     /db_xref="CDD:253893"
     misc_feature    complement(373570..373863)
                     /locus_tag="Rahaq2_0345"
                     /note="Type IV leader peptidase family; Region:
                     Peptidase_A24; pfam01478"
                     /db_xref="CDD:250649"
     gene            complement(374301..374759)
                     /locus_tag="Rahaq2_0346"
                     /note="IMG reference gene:2506707371"
                     /db_xref="GeneID:11793781"
     CDS             complement(374301..374759)
                     /locus_tag="Rahaq2_0346"
                     /note="PFAM: General secretion pathway, M protein"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretory pathway, component PulM"
                     /protein_id="YP_005198432.1"
                     /db_xref="GI:383188304"
                     /db_xref="InterPro:IPR007690"
                     /db_xref="GeneID:11793781"
                     /translation="MKQWLMLKNERERWLILIAAFLLAVTCLWYGILTPLNNRIAQSR
                     ARINTQHHQLEWMVQQTQRLGTPSGWRTQKDKLTEAINTSATRLSLQLPQLLADDRGI
                     TLSYEQISYPELLRWLEVLNKEYGIQVVAITIVAGTGEKGSVKVSQLILR"
     misc_feature    complement(374304..374756)
                     /locus_tag="Rahaq2_0346"
                     /note="Type II secretion system (T2SS), protein M; Region:
                     T2SM; pfam04612"
                     /db_xref="CDD:252702"
     gene            complement(374756..375931)
                     /locus_tag="Rahaq2_0347"
                     /note="IMG reference gene:2506707372"
                     /db_xref="GeneID:11790057"
     CDS             complement(374756..375931)
                     /locus_tag="Rahaq2_0347"
                     /note="PFAM: General secretion pathway protein L (GspL);
                     TIGRFAM: general secretion pathway protein L"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein L"
                     /protein_id="YP_005198433.1"
                     /db_xref="GI:383188305"
                     /db_xref="InterPro:IPR007812"
                     /db_xref="GeneID:11790057"
                     /translation="MEQLHPANRLFIRAGTTPERSLYWFTDKAECDEDIHCLQDTEHL
                     SELATQPAAQNICLFIPASEVIFRQIALPQRASKITRQMIGYLTEESIASDVDTLHWV
                     ELYREEQTLFVAGIESDYLRNWLQRFSDAGLTIKHVYIDALLLPRHEKGWTIMKLDEQ
                     WLLRQSEYSGSQIEQVLLDTLLKIAMPETLHYYGDEKEIPPDWVRADLPFHPLIMMKN
                     NCPSAVNLLQGEFAVRQEEPAWGRHMQRVATSMAILTVIVIIGAKLFTWWHVSQQESL
                     LKNEMLVLHQTWFPQDKHTRNLKFYFEQNMKKAPTAFLPALAKLTAYQGEIPQIAIDK
                     LDFQQETKQFILQITTDDQAAIDDFVERTDSDFHFAISNLATSPTGITATLTQRSKS"
     misc_feature    complement(374765..375904)
                     /locus_tag="Rahaq2_0347"
                     /note="type II secretion system protein L; Region:
                     typeII_sec_gspL; TIGR01709"
                     /db_xref="CDD:233540"
     misc_feature    complement(375230..375904)
                     /locus_tag="Rahaq2_0347"
                     /note="Type II secretion system (T2SS), protein L; Region:
                     T2SL; pfam05134"
                     /db_xref="CDD:253032"
     misc_feature    complement(374759..375196)
                     /locus_tag="Rahaq2_0347"
                     /note="GspL periplasmic domain; Region: GspL_C; pfam12693"
                     /db_xref="CDD:257227"
     gene            complement(375932..376918)
                     /locus_tag="Rahaq2_0348"
                     /note="IMG reference gene:2506707373"
                     /db_xref="GeneID:11790058"
     CDS             complement(375932..376918)
                     /locus_tag="Rahaq2_0348"
                     /note="PFAM: General secretion pathway protein K"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretory pathway, component PulK"
                     /protein_id="YP_005198434.1"
                     /db_xref="GI:383188306"
                     /db_xref="InterPro:IPR005628"
                     /db_xref="GeneID:11790058"
                     /translation="MNKQQGVALLIVLMILAIMAALAAKMTLQFQVSQQRQSWLLNQQ
                     QLRWLTFAAEEIALPRLKKALTENPDQNNLDQFAVQEGHFTGQDGFSVDYIINDGQNC
                     FNLNSLRNNEPDSATEGEPYNTQVLKQLLLNAQATSVETERFADTLSDYLDADNETRT
                     AGAESEYYETLIVPRSAANQRLFSLNELALLPELPLLPLKQIRHQLCTLPEEFQQINV
                     NTLTEEQASLLSALFLGGINQEDATKLISARPRRGWVSVDAFLKEAKKQRFTLEIQSS
                     ELKPLLTVRSQYFVLYTLGRFEEQQNAMTSFVQFNPKDSKIKIYQRRYRVIE"
     misc_feature    complement(375947..376915)
                     /locus_tag="Rahaq2_0348"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cl19066"
                     /db_xref="CDD:267419"
     misc_feature    complement(375968..376834)
                     /locus_tag="Rahaq2_0348"
                     /note="Type II secretion system (T2SS), protein K; Region:
                     T2SK; pfam03934"
                     /db_xref="CDD:252257"
     gene            complement(376911..377594)
                     /locus_tag="Rahaq2_0349"
                     /note="IMG reference gene:2506707374"
                     /db_xref="GeneID:11790059"
     CDS             complement(376911..377594)
                     /locus_tag="Rahaq2_0349"
                     /note="PFAM: Prokaryotic N-terminal methylation motif;
                     Pseudopilin GspJ;
                     TIGRFAM: prepilin-type N-terminal cleavage/methylation
                     domain; general secretion pathway protein J"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein J"
                     /protein_id="YP_005198435.1"
                     /db_xref="GI:383188307"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:11790059"
                     /translation="MNSQQAAKQQGFTLIEVMIAMAIFALLSLLAYQILSASLKNSEM
                     AQEHTARLTEIQTAFSLLERDLTQILPRQTDEEEAFLSASETSLSFTTISSDSASAPL
                     SASDLTRATWTFTDHTLTRSAQALPSPPLTDLSPLIPFTLLTGVKSLHWRFYSSDWTN
                     SWSKPDTFPKVIELVVTLEDMGEIRRLFLLPQTIEETKAESVDNPSEQTGSEAAAPIP
                     LNGESAINE"
     misc_feature    complement(377499..377570)
                     /locus_tag="Rahaq2_0349"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     misc_feature    complement(377025..377564)
                     /locus_tag="Rahaq2_0349"
                     /note="type II secretion system protein J; Region: gspJ;
                     TIGR01711"
                     /db_xref="CDD:130772"
     misc_feature    complement(377022..377471)
                     /locus_tag="Rahaq2_0349"
                     /note="Type II secretion system (T2SS), protein J; Region:
                     T2SJ; pfam11612"
                     /db_xref="CDD:256530"
     gene            complement(377591..377980)
                     /locus_tag="Rahaq2_0350"
                     /note="IMG reference gene:2506707375"
                     /db_xref="GeneID:11790060"
     CDS             complement(377591..377980)
                     /locus_tag="Rahaq2_0350"
                     /note="PFAM: Bacterial type II secretion system protein
                     I/J;
                     TIGRFAM: prepilin-type N-terminal cleavage/methylation
                     domain; general secretion pathway protein I"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein I"
                     /protein_id="YP_005198436.1"
                     /db_xref="GI:383188308"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR003413"
                     /db_xref="GeneID:11790060"
                     /translation="MRISSTRSAKNQQGMTLIEVIIALGIFATAALALLNSMSSQMSA
                     VDHFRTSLFASWVAENTLIEAQIKLGKKEKEHVTLAGQQWFVEQQYALDRENKIRQNQ
                     VRVLQAEDARLPILSVSSWTQIMAEKP"
     misc_feature    complement(377876..377947)
                     /locus_tag="Rahaq2_0350"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     misc_feature    complement(377666..377941)
                     /locus_tag="Rahaq2_0350"
                     /note="type II secretion system protein I; Region: gspI;
                     TIGR01707"
                     /db_xref="CDD:233539"
     misc_feature    complement(377618..377827)
                     /locus_tag="Rahaq2_0350"
                     /note="Type II secretion system (T2SS), protein I; Region:
                     T2SI; pfam02501"
                     /db_xref="CDD:251336"
     gene            complement(377980..378501)
                     /locus_tag="Rahaq2_0351"
                     /note="IMG reference gene:2506707376"
                     /db_xref="GeneID:11790061"
     CDS             complement(377980..378501)
                     /locus_tag="Rahaq2_0351"
                     /note="PFAM: Prokaryotic N-terminal methylation motif;
                     Type II transport protein GspH;
                     TIGRFAM: prepilin-type N-terminal cleavage/methylation
                     domain; general secretion pathway protein H"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein H"
                     /protein_id="YP_005198437.1"
                     /db_xref="GI:383188309"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR002416"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="InterPro:IPR022346"
                     /db_xref="GeneID:11790061"
                     /translation="MSAAKQSGFTLLEILMVLAIFAIAAGVVIMVLPSDNSQIQRAEQ
                     MKTVMEYASERAVLEGKPLGLSLTASAYRFVVLGGTLPLIPQTREPQWEEIKSSRMPV
                     SGKLSENEILSLSPLALNKSINLPPQIVFMPDGTLSVFELSFSSSASEPACCSIISEG
                     RQPLIFNVRRSEK"
     misc_feature    complement(378415..378486)
                     /locus_tag="Rahaq2_0351"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     misc_feature    complement(378028..378378)
                     /locus_tag="Rahaq2_0351"
                     /note="Type II transport protein GspH; Region: GspH;
                     pfam12019"
                     /db_xref="CDD:256804"
     gene            complement(378504..378959)
                     /locus_tag="Rahaq2_0352"
                     /note="IMG reference gene:2506707377"
                     /db_xref="GeneID:11790062"
     CDS             complement(378504..378959)
                     /locus_tag="Rahaq2_0352"
                     /note="PFAM: Prokaryotic N-terminal methylation motif;
                     Bacterial type II secretion system protein G;
                     TIGRFAM: general secretion pathway protein G;
                     prepilin-type N-terminal cleavage/methylation domain"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein G"
                     /protein_id="YP_005198438.1"
                     /db_xref="GI:383188310"
                     /db_xref="InterPro:IPR000983"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="InterPro:IPR013545"
                     /db_xref="GeneID:11790062"
                     /translation="MLNIQKYHHVTSKKQQGFTLIELMVVIVILGVLAALVVPNVMGN
                     KERADTQKAISDIVALENALDMYKLDNHRYPTTEQTLEALVTLPTLNPLPANYRNDGY
                     IKRLPADPWGNEYMLVSPGEHGTIDVFSAGPDSEPNTADDIKNWVEKDH"
     misc_feature    complement(378846..378917)
                     /locus_tag="Rahaq2_0352"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     misc_feature    complement(378522..378914)
                     /locus_tag="Rahaq2_0352"
                     /note="type II secretion system protein G; Region:
                     typeII_sec_gspG; TIGR01710"
                     /db_xref="CDD:130771"
     misc_feature    complement(378522..378836)
                     /locus_tag="Rahaq2_0352"
                     /note="Type II secretion system (T2SS), protein G; Region:
                     T2SG; pfam08334"
                     /db_xref="CDD:254737"
     gene            complement(378972..380189)
                     /locus_tag="Rahaq2_0353"
                     /note="IMG reference gene:2506707378"
                     /db_xref="GeneID:11790063"
     CDS             complement(378972..380189)
                     /locus_tag="Rahaq2_0353"
                     /note="PFAM: Bacterial type II secretion system protein F
                     domain;
                     TIGRFAM: general secretion pathway protein F"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein F"
                     /protein_id="YP_005198439.1"
                     /db_xref="GI:383188311"
                     /db_xref="InterPro:IPR001992"
                     /db_xref="InterPro:IPR003004"
                     /db_xref="InterPro:IPR018076"
                     /db_xref="GeneID:11790063"
                     /translation="MSRFSFHAISPTGKAQRGVIDADSLRLARQMVRERGLTLLEIKQ
                     VGNSLTAINNKNKGLKTRVPSHAVSLFSRQLATLTHAALPVEAALAVIARQTEHAGLT
                     QVLTAVRNKVVEGHTLADALSDFPRIFDPMFRTLVTAGERTGQLGTVLEKMADYYEIR
                     QQIKSKLSQAMIYPAMLTFVAILVIVILLVAVVPQIIEQFVHMKHTLPITTRILIGVS
                     GFLGRAWWLIAIVLIAVIGIFRLALRRKHNLMRFHTALLGVAVLGPLIRAINSARYAR
                     TLSILQSSGVPLLDAMKISTEGITNLRIHYLLTQAAEHVRQGSSLFAVLEQTRLFPPM
                     MLYMIASGEQSGRLGELMAHAADNQDKLMQHRLSMVLALFEPLLIVTMASIVLFIIMS
                     ILQPILQLNNLVS"
     misc_feature    complement(378978..380180)
                     /locus_tag="Rahaq2_0353"
                     /note="type II secretion system protein F; Region: GspF;
                     TIGR02120"
                     /db_xref="CDD:233734"
     misc_feature    complement(379653..379979)
                     /locus_tag="Rahaq2_0353"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     misc_feature    complement(379002..379370)
                     /locus_tag="Rahaq2_0353"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     gene            complement(380186..381712)
                     /locus_tag="Rahaq2_0354"
                     /note="IMG reference gene:2506707379"
                     /db_xref="GeneID:11790064"
     CDS             complement(380186..381712)
                     /locus_tag="Rahaq2_0354"
                     /note="PFAM: Type II/IV secretion system protein;
                     TIGRFAM: general secretory pathway protein E"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretory pathway protein E"
                     /protein_id="YP_005198440.1"
                     /db_xref="GI:383188312"
                     /db_xref="InterPro:IPR001482"
                     /db_xref="GeneID:11790064"
                     /translation="MNRDNELLNRPVVEHAAPVLPYTYAKQKGVTLLDNVLFCRQDIS
                     VETLLEARRVMGEIMAVEIVETTLFDEKLSATYQRSSGQSQQIIDDIDNEVDLLSLSE
                     ELPDNEDLLASDENSPIIRLINAVLSEAVKEGASDIHIETFERTLSIRFRIDGVLRQI
                     LQPARKLAPFLVSRIKVMAKLDIAEKRLPQDGRISLRIGHRAIDIRVSTIPAQYGERV
                     VMRLLDKNNLCLDIPQLGLSPQDEQQLSALIHKPHGIILVTGPTGSGKSTTLYAVLSA
                     LNNNERNILTVEDPIEYELEGVGQTQVNPRVEMTFALGLRAILRQDPDVVMVGEIRDN
                     ETAQIAVQASLTGHLVMSTLHTNSAVGAITRLRDMGLEPFLLASSLLGVVAQRLVRRL
                     CPHCSQQSPLDASHIPLFHFLPEPPPFVFKASGCSQCHFTGYKGRAAIHECMVVDNAI
                     RQAIHENQDEFSIENIHRKTARSLRENGLLKAISGETTLEEVIRVTAEQEIAAGGTTS
                     "
     misc_feature    complement(380225..381655)
                     /locus_tag="Rahaq2_0354"
                     /note="type II secretion system protein E; Region:
                     type_II_gspE; TIGR02533"
                     /db_xref="CDD:131585"
     misc_feature    complement(380402..381193)
                     /locus_tag="Rahaq2_0354"
                     /note="PulE/GspE The type II secretory pathway is the main
                     terminal branch of the general secretory pathway (GSP).
                     It is responsible for the export the majority of
                     Gram-negative bacterial exoenzymes and toxins. PulE is a
                     cytoplasmic protein of the GSP, which...; Region:
                     PulE-GspE; cd01129"
                     /db_xref="CDD:238549"
     misc_feature    complement(380912..380935)
                     /locus_tag="Rahaq2_0354"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238549"
     misc_feature    complement(order(380723..380728,380846..380851,
                     380855..380857,380912..380920,380930..380932))
                     /locus_tag="Rahaq2_0354"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238549"
     misc_feature    complement(380723..380740)
                     /locus_tag="Rahaq2_0354"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238549"
     gene            complement(381716..383701)
                     /locus_tag="Rahaq2_0355"
                     /note="IMG reference gene:2506707380"
                     /db_xref="GeneID:11790065"
     CDS             complement(381716..383701)
                     /locus_tag="Rahaq2_0355"
                     /note="PFAM: Bacterial type II/III secretion system short
                     domain; Bacterial type II and III secretion system
                     protein;
                     TIGRFAM: general secretion pathway protein D; type IV
                     pilus secretin (or competence protein) PilQ"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein D"
                     /protein_id="YP_005198441.1"
                     /db_xref="GI:383188313"
                     /db_xref="InterPro:IPR001775"
                     /db_xref="InterPro:IPR004845"
                     /db_xref="InterPro:IPR004846"
                     /db_xref="InterPro:IPR005644"
                     /db_xref="GeneID:11790065"
                     /translation="MKKFINPLLVKACILCATLPWIVHAEEFTASFKGTDIKEFIDTI
                     SKNLNKTILIDPSVQGTISVRSYDVLNEEQYYQFFLSVLDVYGFAVIPMDNGLLKVVR
                     SANAKMSGVPVADKNRPGKGDEIVTRVVTLLNVPVRELAPLLRQMNDSTGVGSVVHYE
                     PSNVLLLTGRASVVNRLINLVERVDSMGDQQRQTIKLKYASAPEMAEMMNNLIREESK
                     GQSSSILQAKIVADERTNTLIVSGPENVRSRAAKLVNQLDKDQSSQGNTRVFYLKYAK
                     AEKIVPVLTGITQEMKEGKTAQPSTASNNPMSITADEQTNSIVITAQQDVMQSLEQVI
                     TKLDIRRAQVLVEAIIVEVQDGNGLNLGIQWSNNQVGGTQFTGTGAPLSTVAAGVRQY
                     KKEGVISSDNPLSSTLQTFNGMTAGFFSGDWNVLLTALSTSNKNDILATPSIVTLDNK
                     EASFNVGQEVPSLSGSQTTSGDNIYSSVVYKTVGTKLKVTPQINEGDSVLMEIEQEVS
                     SVDTSTNSSLGPTFNTRTISNAVLVRTGETVVLGGLLDDSTKETKSKVPLLGDIPWIG
                     NLFRYTSTESAKRNLMVFIRPTIIRDDEVYSSISNKKYSHFQKLQKTRQDEDHQDLLT
                     PNTRAVLPDYPAPENSSPKTSLSTMPDNDKPRNPFSG"
     misc_feature    complement(381902..383608)
                     /locus_tag="Rahaq2_0355"
                     /note="type II secretion system protein D; Region:
                     type_II_gspD; TIGR02517"
                     /db_xref="CDD:233907"
     misc_feature    complement(383147..383323)
                     /locus_tag="Rahaq2_0355"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    complement(382919..383125)
                     /locus_tag="Rahaq2_0355"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    complement(382679..382903)
                     /locus_tag="Rahaq2_0355"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    complement(381929..382417)
                     /locus_tag="Rahaq2_0355"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; pfam00263"
                     /db_xref="CDD:249725"
     gene            complement(383685..384518)
                     /locus_tag="Rahaq2_0356"
                     /note="IMG reference gene:2506707381"
                     /db_xref="GeneID:11790066"
     CDS             complement(383685..384518)
                     /locus_tag="Rahaq2_0356"
                     /note="TIGRFAM: general secretion pathway protein C"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein C"
                     /protein_id="YP_005198442.1"
                     /db_xref="GI:383188314"
                     /db_xref="GeneID:11790066"
                     /translation="MYAAWNKWHWPNISLKIGMLIVITFMCTIICCSTIAITVLNSWE
                     KSVITPKASGNTKMLINIHGTLFDKRRKAVIKETTQSPVTSVKLPLILKGVLTSTETR
                     RSLAILQGPSGQHSYREGEKLADVENAFLQSVKPDEVLIRTPGGTAILYLNDKPRDDK
                     RPEPQKEKVSREHAKYLMHYLVANPIYKDEKLTGYRFNPRTSSNIYLRAGLIPDEFVV
                     KINGQSLDDAVTADKYIEQLANLRDVQLTVLRENQVQNIYINLATIETSLDTESHEEV
                     H"
     misc_feature    complement(383736..384482)
                     /locus_tag="Rahaq2_0356"
                     /note="Type II secretory pathway, component PulC
                     [Intracellular trafficking and secretion]; Region: PulC;
                     COG3031"
                     /db_xref="CDD:225575"
     misc_feature    complement(384093..384290)
                     /locus_tag="Rahaq2_0356"
                     /note="Type IV pilus biogenesis; Region: Pilus_PilP;
                     pfam11356"
                     /db_xref="CDD:256430"
     misc_feature    complement(383748..>383897)
                     /locus_tag="Rahaq2_0356"
                     /note="PDZ domain, also called DHR (Dlg homologous region)
                     or GLGF (after a conserved sequence motif). Many PDZ
                     domains bind C-terminal polypeptides, though binding to
                     internal (non-C-terminal) polypeptides and even to lipids
                     has been demonstrated; Region: PDZ; cl00117"
                     /db_xref="CDD:260201"
     gene            384719..386239
                     /locus_tag="Rahaq2_0357"
                     /note="IMG reference gene:2506707382"
                     /db_xref="GeneID:11790067"
     CDS             384719..386239
                     /locus_tag="Rahaq2_0357"
                     /note="PFAM: Putative peptidoglycan binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretory pathway protein ExeA"
                     /protein_id="YP_005198443.1"
                     /db_xref="GI:383188315"
                     /db_xref="InterPro:IPR002477"
                     /db_xref="GeneID:11790067"
                     /translation="MYCDHFNFVTFPFLEGNYFNNIRLLAAQDFILQKLNQGGIAIIG
                     GNKGVGKTRLAHEVARQSQRRVLNLSAAPLNGADGENLGQLLACCFHLKKWRTLPASI
                     LPLRIAETFDQNEYSTQPWLVVVDNAENLSVESYEFLRTFKSYPQSSCVSFLLVEERK
                     GDSGDRKRCRRLFPHTDYHLLPMSFAETSDYLSQRLQSSGGEAAVIPGPVAKLLHNAS
                     GGRIQLINALAADSLNSAYAEKTSSVTYRQMKICTEAWGLTPGRKKCITLLIACYMLF
                     GGMLGWTYYNYAKSYLPLPLTFSEKLHEIPAAAKTLSDVGSNERNGMRQLFQVWGYDV
                     PTDDAFCDQAIRAQLTCKKGKATLETLLQEGIPWLSPITADKRTVYVTVVKVTDETLD
                     VLIKDETWTVQRSWFNEVWGGEYIQLFPQTPSGKNVINNTSPEADTAWLDMTLSKILN
                     LPFSKTGQWDNDLIGKIKLFQQREDLIVDGRVGKGTLMQIAKRTGNMPVLLTKEEL"
     misc_feature    384719..385450
                     /locus_tag="Rahaq2_0357"
                     /note="putative secretion ATPase, PEP-CTERM locus
                     subfamily; Region: pepcterm_ATPase; TIGR03015"
                     /db_xref="CDD:132060"
     misc_feature    384821..385186
                     /locus_tag="Rahaq2_0357"
                     /note="AAA domain; Region: AAA_22; pfam13401"
                     /db_xref="CDD:257726"
     misc_feature    386018..386179
                     /locus_tag="Rahaq2_0357"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_1; pfam01471"
                     /db_xref="CDD:250643"
     gene            386247..386732
                     /locus_tag="Rahaq2_0358"
                     /note="IMG reference gene:2506707383"
                     /db_xref="GeneID:11793782"
     CDS             386247..386732
                     /locus_tag="Rahaq2_0358"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198444.1"
                     /db_xref="GI:383188316"
                     /db_xref="GeneID:11793782"
                     /translation="MQNIHLSAYVSHLNKQKVKVAAHHQLRKSLYCVVLSGLCLFAGA
                     LAGSYLHIIYLNWQGYRIEISEESHLPYQQSALHYIYKNKELPAVSQTAYIDDNENAE
                     GELPEDTSPMENETLEEAPADESDESQIIKLDEGSPDMPLQEWLKKAMLEQQQEEKSA
                     K"
     misc_feature    386313..386702
                     /locus_tag="Rahaq2_0358"
                     /note="protein secretion protein GspB; Provisional;
                     Region: PRK09697"
                     /db_xref="CDD:182033"
     gene            386967..387278
                     /locus_tag="Rahaq2_0359"
                     /note="IMG reference gene:2506707384"
                     /db_xref="GeneID:11790068"
     CDS             386967..387278
                     /locus_tag="Rahaq2_0359"
                     /note="PFAM: Ribosomal protein S10p/S20e;
                     TIGRFAM: ribosomal protein S10, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="YP_005198445.1"
                     /db_xref="GI:383188317"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005731"
                     /db_xref="InterPro:IPR018268"
                     /db_xref="GeneID:11790068"
                     /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPT
                     RKERFTILISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL
                     G"
     misc_feature    386967..387272
                     /locus_tag="Rahaq2_0359"
                     /note="30S ribosomal protein S10; Reviewed; Region: rpsJ;
                     PRK00596"
                     /db_xref="CDD:179076"
     gene            387312..387941
                     /locus_tag="Rahaq2_0360"
                     /note="IMG reference gene:2506707385"
                     /db_xref="GeneID:11790069"
     CDS             387312..387941
                     /locus_tag="Rahaq2_0360"
                     /note="PFAM: Ribosomal protein L3;
                     TIGRFAM: 50S ribosomal protein L3, bacterial"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="YP_005198446.1"
                     /db_xref="GI:383188318"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="GeneID:11790069"
                     /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKDLDNDG
                     YRAVQVTTGSKKANRVTKPEAGHFAKAGVEAGRGLWEFRLAEGEEFTAGQNISVEIFA
                     DVKKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKK
                     MAGQLGNERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA"
     misc_feature    387312..387938
                     /locus_tag="Rahaq2_0360"
                     /note="50S ribosomal protein L3; Validated; Region: rplC;
                     PRK00001"
                     /db_xref="CDD:234564"
     gene            387958..388563
                     /locus_tag="Rahaq2_0361"
                     /note="IMG reference gene:2506707386"
                     /db_xref="GeneID:11790070"
     CDS             387958..388563
                     /locus_tag="Rahaq2_0361"
                     /note="PFAM: Ribosomal protein L4/L1 family;
                     TIGRFAM: 50S ribosomal protein L4, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="YP_005198447.1"
                     /db_xref="GI:383188319"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013005"
                     /db_xref="InterPro:IPR015498"
                     /db_xref="GeneID:11790070"
                     /translation="MELVVKDAQSALTVSETTFGRDFNEALVHQVVVAYAAGARQGTR
                     AQKTRAEVTGSGKKPWRQKGTGRARSGSVKSPIWRSGGVTFAAKPQDHSQKVNKKMYR
                     GALKSILSELVRQDRLIVVETFSVEAPKTKLLAQKLKDMALEDVLIVTGEVDENLFLA
                     ARNLYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
     misc_feature    387958..388560
                     /locus_tag="Rahaq2_0361"
                     /note="50S ribosomal protein L4; Provisional; Region:
                     rplD; PRK05319"
                     /db_xref="CDD:235404"
     gene            388560..388862
                     /locus_tag="Rahaq2_0362"
                     /note="IMG reference gene:2506707387"
                     /db_xref="GeneID:11790071"
     CDS             388560..388862
                     /locus_tag="Rahaq2_0362"
                     /note="PFAM: Ribosomal protein L23"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="YP_005198448.1"
                     /db_xref="GI:383188320"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="GeneID:11790071"
                     /translation="MIREERLLKVLRAPHVSEKASTAMEKNNTIVLKVAKDATKAEIK
                     AAVSKLFEVEVEDVNTLLVKGKVKRHGQRVGRRSDWKKAYVTLKEGQNLDFISGAE"
     misc_feature    388581..388856
                     /locus_tag="Rahaq2_0362"
                     /note="50S ribosomal protein L23; Reviewed; Region: rplW;
                     PRK05738"
                     /db_xref="CDD:235586"
     gene            388881..389705
                     /locus_tag="Rahaq2_0363"
                     /note="IMG reference gene:2506707388"
                     /db_xref="GeneID:11790072"
     CDS             388881..389705
                     /locus_tag="Rahaq2_0363"
                     /note="PFAM: Ribosomal Proteins L2, RNA binding domain;
                     Ribosomal Proteins L2, C-terminal domain;
                     TIGRFAM: ribosomal protein L2, bacterial/organellar"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="YP_005198449.1"
                     /db_xref="GI:383188321"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR016027"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="GeneID:11790072"
                     /translation="MAIVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKLSKSGGRN
                     NNGRITTRHIGGGHKQHYRLVDFKRNKDGIAAVVERLEYDPNRSANIALVLYKDGERR
                     YILAPKGLKVGDQIQSGVDAAIKTGNTLPMRNIPVGSTVHNVEMKPGKGGQMARSAGA
                     YVQIVARDGSYVTLRLRSGEMRKVQVDCRATLGEVGNSEHMLRVLGKAGAARWRGIRP
                     TVRGTAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSKK"
     misc_feature    388881..389702
                     /locus_tag="Rahaq2_0363"
                     /note="50S ribosomal protein L2; Validated; Region: rplB;
                     PRK09374"
                     /db_xref="CDD:236488"
     misc_feature    389004..389234
                     /locus_tag="Rahaq2_0363"
                     /note="Ribosomal Proteins L2, RNA binding domain; Region:
                     Ribosomal_L2; pfam00181"
                     /db_xref="CDD:249659"
     misc_feature    389250..389627
                     /locus_tag="Rahaq2_0363"
                     /note="Ribosomal Proteins L2, C-terminal domain; Region:
                     Ribosomal_L2_C; pfam03947"
                     /db_xref="CDD:202823"
     gene            389720..389998
                     /locus_tag="Rahaq2_0364"
                     /note="IMG reference gene:2506707389"
                     /db_xref="GeneID:11790073"
     CDS             389720..389998
                     /locus_tag="Rahaq2_0364"
                     /note="PFAM: Ribosomal protein S19;
                     TIGRFAM: ribosomal protein S19, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="YP_005198450.1"
                     /db_xref="GI:383188322"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="GeneID:11790073"
                     /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNM
                     IGLTIAVHNGRQHVPVFVSDEMVGHKLGEFAPTRTYRGHAADKKAKKR"
     misc_feature    389720..389995
                     /locus_tag="Rahaq2_0364"
                     /note="30S ribosomal protein S19; Reviewed; Region: rpsS;
                     PRK00357"
                     /db_xref="CDD:178985"
     gene            390013..390345
                     /locus_tag="Rahaq2_0365"
                     /note="IMG reference gene:2506707390"
                     /db_xref="GeneID:11790074"
     CDS             390013..390345
                     /locus_tag="Rahaq2_0365"
                     /note="PFAM: Ribosomal protein L22p/L17e;
                     TIGRFAM: ribosomal protein L22, bacterial type"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="YP_005198451.1"
                     /db_xref="GI:383188323"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="GeneID:11790074"
                     /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLAYTNKKAA
                     GLVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSH
                     ITVVVSDR"
     misc_feature    390025..390333
                     /locus_tag="Rahaq2_0365"
                     /note="Ribosomal protein L22/L17e.  L22 (L17 in
                     eukaryotes) is a core protein of the large ribosomal
                     subunit.  It is the only ribosomal protein that interacts
                     with all six domains of 23S rRNA, and is one of the
                     proteins important for directing the proper...; Region:
                     Ribosomal_L22; cd00336"
                     /db_xref="CDD:238205"
     misc_feature    order(390028..390030,390034..390036,390043..390045,
                     390049..390057,390064..390066,390076..390078,
                     390085..390087,390169..390171,390181..390183,
                     390190..390192,390229..390231,390235..390243,
                     390247..390249,390256..390258,390292..390309)
                     /locus_tag="Rahaq2_0365"
                     /note="protein-rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238205"
     misc_feature    order(390088..390096,390100..390105,390109..390114,
                     390175..390192,390217..390234,390328..390333)
                     /locus_tag="Rahaq2_0365"
                     /note="putative translocon binding site; other site"
                     /db_xref="CDD:238205"
     gene            390363..391061
                     /locus_tag="Rahaq2_0366"
                     /note="IMG reference gene:2506707391"
                     /db_xref="GeneID:11790075"
     CDS             390363..391061
                     /locus_tag="Rahaq2_0366"
                     /note="PFAM: KH domain; Ribosomal protein S3, C-terminal
                     domain; Ribosomal protein S3, N-terminal domain;
                     TIGRFAM: ribosomal protein S3, bacterial type"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="YP_005198452.1"
                     /db_xref="GI:383188324"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR008282"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="InterPro:IPR018280"
                     /db_xref="GeneID:11790075"
                     /translation="MGQKVHPNGIRLGIVKPWNSTWYANTKDFADNLDGDFKVRQFLT
                     KELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQIN
                     IAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGA
                     EIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPE
                     PAAQPKKQQRKGRK"
     misc_feature    390363..391058
                     /locus_tag="Rahaq2_0366"
                     /note="30S ribosomal protein S3; Reviewed; Region: rpsC;
                     PRK00310"
                     /db_xref="CDD:234722"
     misc_feature    390366..390689
                     /locus_tag="Rahaq2_0366"
                     /note="K homology RNA-binding (KH) domain of the
                     prokaryotic 30S small ribosomal subunit protein S3. S3  is
                     part of the head region of the 30S ribosomal subunit and
                     is believed to interact with mRNA as it threads its way
                     from the latch into the channel.  The KH...; Region:
                     30S_S3_KH; cd02412"
                     /db_xref="CDD:239095"
     misc_feature    390594..390605
                     /locus_tag="Rahaq2_0366"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239095"
     misc_feature    390717..390968
                     /locus_tag="Rahaq2_0366"
                     /note="Ribosomal protein S3, C-terminal domain; Region:
                     Ribosomal_S3_C; pfam00189"
                     /db_xref="CDD:249666"
     gene            391074..391484
                     /locus_tag="Rahaq2_0367"
                     /note="IMG reference gene:2506707392"
                     /db_xref="GeneID:11790076"
     CDS             391074..391484
                     /locus_tag="Rahaq2_0367"
                     /note="PFAM: Ribosomal protein L16p/L10e;
                     TIGRFAM: ribosomal protein L16, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="YP_005198453.1"
                     /db_xref="GI:383188325"
                     /db_xref="InterPro:IPR000114"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR020798"
                     /db_xref="GeneID:11790076"
                     /translation="MLQPKRTKFRKVHKGRNRGLAQGTDVSFGTYGLKAVGRGRLTAR
                     QIEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVL
                     YEMDGVPEELAREAFQLAAAKLPIKTTFVTKTVM"
     misc_feature    391140..391466
                     /locus_tag="Rahaq2_0367"
                     /note="Ribosomal_L16_L10e: L16 is an essential protein in
                     the large ribosomal subunit of bacteria, mitochondria, and
                     chloroplasts. Large subunits that lack L16 are defective
                     in peptidyl transferase activity, peptidyl-tRNA hydrolysis
                     activity, association with...; Region: Ribosomal_L16_L10e;
                     cd01433"
                     /db_xref="CDD:238714"
     misc_feature    order(391143..391148,391155..391157,391203..391208,
                     391215..391217,391224..391226,391236..391238,
                     391245..391247,391263..391271,391275..391277,
                     391281..391283,391293..391298,391317..391331,
                     391371..391373,391425..391430,391437..391442)
                     /locus_tag="Rahaq2_0367"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238714"
     misc_feature    391182..391187
                     /locus_tag="Rahaq2_0367"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(391218..391226,391233..391238)
                     /locus_tag="Rahaq2_0367"
                     /note="putative antibiotic binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(391245..391247,391254..391259,391263..391265,
                     391389..391391)
                     /locus_tag="Rahaq2_0367"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(391311..391316,391323..391328)
                     /locus_tag="Rahaq2_0367"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     gene            391484..391675
                     /locus_tag="Rahaq2_0368"
                     /note="IMG reference gene:2506707393"
                     /db_xref="GeneID:11790077"
     CDS             391484..391675
                     /locus_tag="Rahaq2_0368"
                     /note="PFAM: Ribosomal L29 protein;
                     TIGRFAM: ribosomal protein L29"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="YP_005198454.1"
                     /db_xref="GI:383188326"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="InterPro:IPR018254"
                     /db_xref="GeneID:11790077"
                     /translation="MKAQELREKSVEELNTELLNLLREQFNLRMQTASGQLQQTHLLK
                     QVRRDVARVKTLLTEKAGA"
     misc_feature    391493..391663
                     /locus_tag="Rahaq2_0368"
                     /note="Ribosomal L29 protein/HIP.  L29 is a protein of the
                     large ribosomal Subunit. A homolog, called heparin/heparan
                     sulfate interacting protein (HIP), has also been
                     identified in mammals.  L29 is located on the surface of
                     the large ribosomal subunit, where it...; Region:
                     Ribosomal_L29_HIP; cd00427"
                     /db_xref="CDD:238243"
     misc_feature    order(391493..391495,391502..391504,391604..391606,
                     391634..391639,391643..391648,391658..391660)
                     /locus_tag="Rahaq2_0368"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238243"
     misc_feature    order(391493..391501,391505..391507,391517..391522,
                     391526..391531,391538..391543,391550..391555,
                     391562..391564,391571..391576,391598..391600,
                     391607..391609,391619..391621,391628..391633,
                     391640..391645,391652..391654)
                     /locus_tag="Rahaq2_0368"
                     /note="putative translocon interaction site; other site"
                     /db_xref="CDD:238243"
     misc_feature    order(391541..391543,391553..391555,391562..391564,
                     391574..391576,391619..391621)
                     /locus_tag="Rahaq2_0368"
                     /note="signal recognition particle (SRP54) interaction
                     site; other site"
                     /db_xref="CDD:238243"
     misc_feature    order(391559..391561,391568..391573)
                     /locus_tag="Rahaq2_0368"
                     /note="L23 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238243"
     misc_feature    391580..391585
                     /locus_tag="Rahaq2_0368"
                     /note="trigger factor interaction site; other site"
                     /db_xref="CDD:238243"
     gene            391675..391929
                     /locus_tag="Rahaq2_0369"
                     /note="IMG reference gene:2506707394"
                     /db_xref="GeneID:11790078"
     CDS             391675..391929
                     /locus_tag="Rahaq2_0369"
                     /note="PFAM: Ribosomal protein S17;
                     TIGRFAM: 30S ribosomal protein S17"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="YP_005198455.1"
                     /db_xref="GI:383188327"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016027"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="GeneID:11790078"
                     /translation="MTDKIRTLQGRVISDKMEKSIVVAIERVVKHPIYGKFIKRTTKL
                     HVHDENNECGIGDVVEISECRPLSKTKSWTLVRVVEKAIL"
     misc_feature    391675..391920
                     /locus_tag="Rahaq2_0369"
                     /note="30S ribosomal protein S17; Reviewed; Region: rpsQ;
                     PRK05610"
                     /db_xref="CDD:235532"
     gene            392100..392471
                     /locus_tag="Rahaq2_0370"
                     /note="IMG reference gene:2506707395"
                     /db_xref="GeneID:11790079"
     CDS             392100..392471
                     /locus_tag="Rahaq2_0370"
                     /note="PFAM: Ribosomal protein L14p/L23e;
                     TIGRFAM: ribosomal protein L14, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="YP_005198456.1"
                     /db_xref="GI:383188328"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR005745"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="GeneID:11790079"
                     /translation="MIQEQTMLTVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIK
                     EAIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNSEQPIGTRIFGP
                     VTRELRNEKFMKIISLAPEVL"
     misc_feature    392100..392468
                     /locus_tag="Rahaq2_0370"
                     /note="50S ribosomal protein L14; Validated; Region: rplN;
                     PRK05483"
                     /db_xref="CDD:180117"
     gene            392482..392796
                     /locus_tag="Rahaq2_0371"
                     /note="IMG reference gene:2506707396"
                     /db_xref="GeneID:11790080"
     CDS             392482..392796
                     /locus_tag="Rahaq2_0371"
                     /note="PFAM: KOW motif;
                     TIGRFAM: ribosomal protein L24, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="YP_005198457.1"
                     /db_xref="GI:383188329"
                     /db_xref="InterPro:IPR003256"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014723"
                     /db_xref="GeneID:11790080"
                     /translation="MAAKIRRDDEVILLTGKDKGKRGKVKNVLSSGKVIVEGINLVKK
                     HQKPVPALNQPGGIVEKEAAIPVSNVALFNTATGKADRVGFRFEDGKKVRFFKSNSVT
                     IK"
     misc_feature    392503..392697
                     /locus_tag="Rahaq2_0371"
                     /note="KOW motif of Ribosomal Protein L26; Region:
                     KOW_RPL26; cd06089"
                     /db_xref="CDD:240513"
     misc_feature    order(392524..392532,392566..392568,392608..392613,
                     392680..392685)
                     /locus_tag="Rahaq2_0371"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240513"
     gene            392811..393350
                     /locus_tag="Rahaq2_0372"
                     /note="IMG reference gene:2506707397"
                     /db_xref="GeneID:11790081"
     CDS             392811..393350
                     /locus_tag="Rahaq2_0372"
                     /note="PFAM: ribosomal L5P family C-terminus; Ribosomal
                     protein L5"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="YP_005198458.1"
                     /db_xref="GI:383188330"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR020929"
                     /db_xref="InterPro:IPR022803"
                     /db_xref="GeneID:11790081"
                     /translation="MAKLHDYYKDDVVKKLMAEFGYNSVMQVPRVEKITLNMGVGEAI
                     ADKKLLDNAAADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFER
                     LVSIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTA
                     KSDDEGRALLTAFNFPFRK"
     misc_feature    392811..393347
                     /locus_tag="Rahaq2_0372"
                     /note="50S ribosomal protein L5; Validated; Region: rplE;
                     PRK00010"
                     /db_xref="CDD:178791"
     misc_feature    392880..393050
                     /locus_tag="Rahaq2_0372"
                     /note="Ribosomal protein L5; Region: Ribosomal_L5;
                     pfam00281"
                     /db_xref="CDD:109342"
     misc_feature    393060..393344
                     /locus_tag="Rahaq2_0372"
                     /note="ribosomal L5P family C-terminus; Region:
                     Ribosomal_L5_C; pfam00673"
                     /db_xref="CDD:250045"
     gene            393364..393669
                     /locus_tag="Rahaq2_0373"
                     /note="IMG reference gene:2506707398"
                     /db_xref="GeneID:11790082"
     CDS             393364..393669
                     /locus_tag="Rahaq2_0373"
                     /note="PFAM: Ribosomal protein S14p/S29e"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="YP_005198459.1"
                     /db_xref="GI:383188331"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /db_xref="InterPro:IPR023036"
                     /db_xref="GeneID:11790082"
                     /translation="MAKQSMKAREVVRVKLADKYRAKREELKAIISGVNSSDEDRWDA
                     VLKLQSLPRDSSPSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW"
     misc_feature    393364..393666
                     /locus_tag="Rahaq2_0373"
                     /note="30S ribosomal protein S14; Reviewed; Region: rpsN;
                     PRK08881"
                     /db_xref="CDD:181574"
     gene            393703..394095
                     /locus_tag="Rahaq2_0374"
                     /note="IMG reference gene:2506707399"
                     /db_xref="GeneID:11790083"
     CDS             393703..394095
                     /locus_tag="Rahaq2_0374"
                     /note="PFAM: Ribosomal protein S8"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="YP_005198460.1"
                     /db_xref="GI:383188332"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="GeneID:11790083"
                     /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEG
                     YIEEFKIEGDAKPELELVLKYFQGKAVVESIQRISRPGLRIYKKKDELPKVMAGMGIA
                     VISTSKGVMTDRAARQAGLGGEIICYVA"
     misc_feature    393706..394092
                     /locus_tag="Rahaq2_0374"
                     /note="30S ribosomal protein S8; Validated; Region: rpsH;
                     PRK00136"
                     /db_xref="CDD:234658"
     gene            394109..394642
                     /locus_tag="Rahaq2_0375"
                     /note="IMG reference gene:2506707400"
                     /db_xref="GeneID:11790084"
     CDS             394109..394642
                     /locus_tag="Rahaq2_0375"
                     /note="PFAM: Ribosomal protein L6;
                     TIGRFAM: ribosomal protein L6, bacterial type"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="YP_005198461.1"
                     /db_xref="GI:383188333"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002358"
                     /db_xref="InterPro:IPR019906"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="GeneID:11790084"
                     /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELSRTIHDAVVVK
                     QEENTLTFAPREGAVDGWAQAGTTRALLNSMVVGVTDGFTKKLQLVGVGYRAAVKGNV
                     VNLALGFSHPVDHQLPEGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGK
                     GVRYADEVVRTKEAKKK"
     misc_feature    394109..394639
                     /locus_tag="Rahaq2_0375"
                     /note="50S ribosomal protein L6; Validated; Region: rplF;
                     PRK05498"
                     /db_xref="CDD:235495"
     misc_feature    394139..394354
                     /locus_tag="Rahaq2_0375"
                     /note="Ribosomal protein L6; Region: Ribosomal_L6;
                     pfam00347"
                     /db_xref="CDD:249789"
     misc_feature    394376..394600
                     /locus_tag="Rahaq2_0375"
                     /note="Ribosomal protein L6; Region: Ribosomal_L6;
                     pfam00347"
                     /db_xref="CDD:249789"
     gene            394652..395005
                     /locus_tag="Rahaq2_0376"
                     /note="IMG reference gene:2506707401"
                     /db_xref="GeneID:11790085"
     CDS             394652..395005
                     /locus_tag="Rahaq2_0376"
                     /note="PFAM: Ribosomal L18p/L5e family;
                     TIGRFAM: ribosomal protein L18, bacterial type"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="YP_005198462.1"
                     /db_xref="GI:383188334"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="GeneID:11790085"
                     /translation="MDKKSARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNG
                     SEVIVAASTVEKTITEQLKYTGNKDAATAVGKAIAERALEKGITKVSFDRSGFQYHGR
                     VQALADAAREAGLQF"
     misc_feature    394700..394996
                     /locus_tag="Rahaq2_0376"
                     /note="Ribosomal L18/L5e:  L18 (L5e) is a ribosomal
                     protein found in the central protuberance (CP) of the
                     large subunit. L18 binds 5S rRNA and induces a
                     conformational change that stimulates the binding of L5 to
                     5S rRNA. Association of 5S rRNA with 23S rRNA...; Region:
                     Ribosomal_L18_L5e; cd00432"
                     /db_xref="CDD:238246"
     misc_feature    order(394700..394702,394925..394927,394934..394936,
                     394982..394984)
                     /locus_tag="Rahaq2_0376"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238246"
     misc_feature    order(394700..394705,394709..394711,394724..394726,
                     394736..394753,394757..394759,394763..394765,
                     394784..394792,394799..394801,394922..394924,
                     394955..394957)
                     /locus_tag="Rahaq2_0376"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    394703..394708
                     /locus_tag="Rahaq2_0376"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    394940..394942
                     /locus_tag="Rahaq2_0376"
                     /note="L5 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     gene            395020..395520
                     /locus_tag="Rahaq2_0377"
                     /note="IMG reference gene:2506707402"
                     /db_xref="GeneID:11790086"
     CDS             395020..395520
                     /locus_tag="Rahaq2_0377"
                     /note="PFAM: Ribosomal protein S5, N-terminal domain;
                     Ribosomal protein S5, C-terminal domain;
                     TIGRFAM: ribosomal protein S5, bacterial/organelle type"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="YP_005198463.1"
                     /db_xref="GI:383188335"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="GeneID:11790086"
                     /translation="MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNG
                     RVGFGYGKAREVPAAIQKAMEKARRNMMNVALNSGTLQHPVKGAHTGSRVFMQPASEG
                     TGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDALANMKSPQMVAAKRGKS
                     VEEILG"
     misc_feature    395020..395517
                     /locus_tag="Rahaq2_0377"
                     /note="30S ribosomal protein S5; Validated; Region: rpsE;
                     PRK00550"
                     /db_xref="CDD:234790"
     misc_feature    395047..395247
                     /locus_tag="Rahaq2_0377"
                     /note="Ribosomal protein S5, N-terminal domain; Region:
                     Ribosomal_S5; pfam00333"
                     /db_xref="CDD:144065"
     misc_feature    395272..395493
                     /locus_tag="Rahaq2_0377"
                     /note="Ribosomal protein S5, C-terminal domain; Region:
                     Ribosomal_S5_C; pfam03719"
                     /db_xref="CDD:252121"
     gene            395527..395706
                     /locus_tag="Rahaq2_0378"
                     /note="IMG reference gene:2506707403"
                     /db_xref="GeneID:11790087"
     CDS             395527..395706
                     /locus_tag="Rahaq2_0378"
                     /note="PFAM: Ribosomal protein L30p/L7e;
                     TIGRFAM: ribosomal protein L30, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="YP_005198464.1"
                     /db_xref="GI:383188336"
                     /db_xref="InterPro:IPR005996"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /db_xref="GeneID:11790087"
                     /translation="MAKTIKVTQTRSSIGRLPKHKATLLGLGLRRIGHTVEREDTPAV
                     RGMINLVSYMVKVEE"
     misc_feature    395539..395700
                     /locus_tag="Rahaq2_0378"
                     /note="Ribosomal protein L30, which is found in eukaryotes
                     and prokaryotes but not in archaea, is one of the smallest
                     ribosomal proteins with a molecular mass of about 7kDa.
                     L30 binds the 23SrRNA as well as the 5S rRNA and is one of
                     five ribosomal proteins that...; Region: Ribosomal_L30;
                     cd01658"
                     /db_xref="CDD:100100"
     misc_feature    order(395557..395562,395566..395571,395575..395583,
                     395590..395595,395602..395610,395614..395616,
                     395623..395625,395638..395643,395650..395658,
                     395662..395667)
                     /locus_tag="Rahaq2_0378"
                     /note="23S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100100"
     gene            395710..396144
                     /locus_tag="Rahaq2_0379"
                     /note="IMG reference gene:2506707404"
                     /db_xref="GeneID:11790088"
     CDS             395710..396144
                     /locus_tag="Rahaq2_0379"
                     /note="PFAM: Ribosomal protein L18e/L15;
                     TIGRFAM: ribosomal protein L15, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="YP_005198465.1"
                     /db_xref="GI:383188337"
                     /db_xref="InterPro:IPR001196"
                     /db_xref="InterPro:IPR005749"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="GeneID:11790088"
                     /translation="MRLNTLSPADGAKQAPRRVGRGIGSGLGKTGGRGHKGQNSRSGG
                     GVRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNALKAANVVG
                     IQIEFAKVILSGEVGRAVTLRGLRVTKGARVAIEAAGGKIEE"
     misc_feature    395710..396141
                     /locus_tag="Rahaq2_0379"
                     /note="50S ribosomal protein L15; Reviewed; Region: rplO;
                     PRK05592"
                     /db_xref="CDD:235523"
     gene            396152..397483
                     /locus_tag="Rahaq2_0380"
                     /note="IMG reference gene:2506707405"
                     /db_xref="GeneID:11790089"
     CDS             396152..397483
                     /locus_tag="Rahaq2_0380"
                     /note="PFAM: eubacterial secY protein;
                     TIGRFAM: preprotein translocase, SecY subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="YP_005198466.1"
                     /db_xref="GI:383188338"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR023201"
                     /db_xref="GeneID:11790089"
                     /translation="MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGI
                     DAAVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPAL
                     AEIKKEGEAGRRKISQYTRYGTLVLAVFQSIGIATGLPNMPGMQGLVLNPGFAFYFTA
                     VVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFL
                     LLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIP
                     AIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYATAIIFFCFFYTA
                     LVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLIGAMYITFICLIPEFMR
                     DAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYNR"
     misc_feature    396203..397450
                     /locus_tag="Rahaq2_0380"
                     /note="preprotein translocase subunit SecY; Reviewed;
                     Region: secY; PRK09204"
                     /db_xref="CDD:236412"
     misc_feature    396377..397402
                     /locus_tag="Rahaq2_0380"
                     /note="SecY translocase; Region: SecY; pfam00344"
                     /db_xref="CDD:249786"
     gene            397517..397633
                     /locus_tag="Rahaq2_0381"
                     /note="IMG reference gene:2506707406"
                     /db_xref="GeneID:11790090"
     CDS             397517..397633
                     /locus_tag="Rahaq2_0381"
                     /note="PFAM: Ribosomal protein L36;
                     TIGRFAM: ribosomal protein L36, bacterial type"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="YP_005198467.1"
                     /db_xref="GI:383188339"
                     /db_xref="GeneID:11790090"
                     /translation="MKVRASVKKLCRNCKIVKRNGVVRVICSAEPKHKQRQG"
     misc_feature    397517..397630
                     /locus_tag="Rahaq2_0381"
                     /note="Ribosomal protein L36; Region: Ribosomal_L36;
                     pfam00444"
                     /db_xref="CDD:249863"
     misc_feature    397703..397814
                     /note="Alpha operon ribosome binding site; IMG reference
                     gene:2506707407"
     gene            397782..398138
                     /locus_tag="Rahaq2_0383"
                     /note="IMG reference gene:2506707408"
                     /db_xref="GeneID:11790091"
     CDS             397782..398138
                     /locus_tag="Rahaq2_0383"
                     /note="PFAM: Ribosomal protein S13/S18;
                     TIGRFAM: 30S ribosomal protein S13;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="YP_005198468.1"
                     /db_xref="GI:383188340"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="GeneID:11790091"
                     /translation="MARIAGINIPDQKHTVIALTSIYGIGKTRSQSICAASGIAENVK
                     ISELSEEQIEKLRDEVAKFIVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRT
                     KTNARTRKGPRKPIKK"
     misc_feature    397782..398135
                     /locus_tag="Rahaq2_0383"
                     /note="30S ribosomal protein S13; Validated; Region: rpsM;
                     PRK05179"
                     /db_xref="CDD:235358"
     gene            398156..398545
                     /locus_tag="Rahaq2_0384"
                     /note="IMG reference gene:2506707409"
                     /db_xref="GeneID:11793783"
     CDS             398156..398545
                     /locus_tag="Rahaq2_0384"
                     /note="PFAM: Ribosomal protein S11;
                     TIGRFAM: 30S ribosomal protein S11"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="YP_005198469.1"
                     /db_xref="GI:383188341"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="GeneID:11793783"
                     /translation="MAKAPVRTRKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGW
                     ATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNA
                     AGFRITNITDVTPIPHNGCRPPKKRRV"
     misc_feature    398159..398542
                     /locus_tag="Rahaq2_0384"
                     /note="30S ribosomal protein S11; Validated; Region:
                     PRK05309"
                     /db_xref="CDD:180007"
     gene            398576..399196
                     /locus_tag="Rahaq2_0385"
                     /note="IMG reference gene:2506707410"
                     /db_xref="GeneID:11790092"
     CDS             398576..399196
                     /locus_tag="Rahaq2_0385"
                     /note="PFAM: Ribosomal protein S4/S9 N-terminal domain; S4
                     domain;
                     TIGRFAM: ribosomal protein S4, bacterial/organelle type"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="YP_005198470.1"
                     /db_xref="GI:383188342"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="GeneID:11790092"
                     /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGAR
                     KPRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGENLLQLLEGRLDNVV
                     YRMGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALE
                     LAEQREKPTWLEVDAAKMEGVFKRMPERTDLSSDINEHLIVELYSK"
     misc_feature    398576..399193
                     /locus_tag="Rahaq2_0385"
                     /note="30S ribosomal protein S4; Validated; Region: rpsD;
                     PRK05327"
                     /db_xref="CDD:235411"
     misc_feature    398579..398860
                     /locus_tag="Rahaq2_0385"
                     /note="Ribosomal protein S4/S9 N-terminal domain; Region:
                     Ribosomal_S4; pfam00163"
                     /db_xref="CDD:249643"
     misc_feature    398864..399043
                     /locus_tag="Rahaq2_0385"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(398864..398866,398900..398905,398909..398914,
                     398918..398923,398930..398935,398939..398941,
                     398960..398983,398987..398989)
                     /locus_tag="Rahaq2_0385"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            399222..400211
                     /locus_tag="Rahaq2_0386"
                     /note="IMG reference gene:2506707411"
                     /db_xref="GeneID:11790093"
     CDS             399222..400211
                     /locus_tag="Rahaq2_0386"
                     /note="PFAM: RNA polymerase Rpb3/Rpb11 dimerisation
                     domain; RNA polymerase Rpb3/RpoA insert domain; Bacterial
                     RNA polymerase, alpha chain C terminal domain;
                     TIGRFAM: DNA-directed RNA polymerase, alpha subunit,
                     bacterial and chloroplast-type"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="YP_005198471.1"
                     /db_xref="GI:383188343"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011260"
                     /db_xref="InterPro:IPR011261"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011773"
                     /db_xref="GeneID:11790093"
                     /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALR
                     RILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTL
                     NKSGIGPVTAADITHDGDVEIVKPQHVICHLTDENAAISMRIKVQRGRGYVPASARIH
                     SEEDERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIR
                     RAATILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIH
                     YIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
     misc_feature    399237..400169
                     /locus_tag="Rahaq2_0386"
                     /note="DNA-directed RNA polymerase subunit alpha;
                     Provisional; Region: PRK05182"
                     /db_xref="CDD:235359"
     misc_feature    399261..399914
                     /locus_tag="Rahaq2_0386"
                     /note="N-terminal domain of the Alpha subunit of Bacterial
                     RNA polymerase; Region: RNAP_alpha_NTD; cd06928"
                     /db_xref="CDD:132904"
     misc_feature    order(399261..399263,399267..399269,399303..399305,
                     399312..399314,399318..399326,399333..399335,
                     399345..399347,399354..399359,399369..399371,
                     399882..399884,399891..399896,399900..399905,
                     399909..399914)
                     /locus_tag="Rahaq2_0386"
                     /note="alphaNTD homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132904"
     misc_feature    order(399294..399296,399330..399332,399342..399344,
                     399351..399356,399417..399419,399423..399425,
                     399429..399431,399435..399446,399459..399461,
                     399477..399479,399621..399623,399675..399677,
                     399741..399743,399747..399749,399765..399773,
                     399777..399788,399816..399818,399825..399827,
                     399831..399833)
                     /locus_tag="Rahaq2_0386"
                     /note="alphaNTD - beta interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:132904"
     misc_feature    order(399423..399425,399459..399461,399468..399470,
                     399477..399482,399672..399677,399681..399683,
                     399747..399749,399762..399767,399792..399794)
                     /locus_tag="Rahaq2_0386"
                     /note="alphaNTD - beta' interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:132904"
     misc_feature    399972..400148
                     /locus_tag="Rahaq2_0386"
                     /note="Bacterial RNA polymerase, alpha chain C terminal
                     domain; Region: RNA_pol_A_CTD; pfam03118"
                     /db_xref="CDD:251738"
     gene            400252..400641
                     /locus_tag="Rahaq2_0387"
                     /note="IMG reference gene:2506707412"
                     /db_xref="GeneID:11793784"
     CDS             400252..400641
                     /locus_tag="Rahaq2_0387"
                     /note="PFAM: Ribosomal protein L17;
                     TIGRFAM: ribosomal protein L17"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="YP_005198472.1"
                     /db_xref="GI:383188344"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="GeneID:11793784"
                     /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKEL
                     RRVVEPLITLAKTDNVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGF
                     RAGDNAPMAYIELVDRAESKAEVATAE"
     misc_feature    400261..400599
                     /locus_tag="Rahaq2_0387"
                     /note="50S ribosomal protein L17; Validated; Region: rplQ;
                     PRK05591"
                     /db_xref="CDD:235522"
     gene            400649..401185
                     /locus_tag="Rahaq2_0388"
                     /note="IMG reference gene:2506707413"
                     /db_xref="GeneID:11790094"
     CDS             400649..401185
                     /locus_tag="Rahaq2_0388"
                     /note="PFAM: Domain of unknown function (DUF1992)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198473.1"
                     /db_xref="GI:383188345"
                     /db_xref="InterPro:IPR018961"
                     /db_xref="GeneID:11790094"
                     /translation="MHEKTGLLPGFFTSEMHCSNPSFFSSFNYSKFHYLLQHAASSYD
                     LEWLVQCDKGEIMFLIDQWVEKHINDAQEKGEFENLRGSGRPLILDDDSAVPDELRTS
                     YRILKNAGYLPPELQDRKEAIELDHLLNTLDSDDPKFLPAEKRLKVLQMRLQQAGMNT
                     GFLHGHYENALKDKFRGK"
     misc_feature    400817..401173
                     /locus_tag="Rahaq2_0388"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10203"
                     /db_xref="CDD:182303"
     gene            401188..401604
                     /locus_tag="Rahaq2_0389"
                     /note="IMG reference gene:2506707414"
                     /db_xref="GeneID:11790095"
     CDS             401188..401604
                     /locus_tag="Rahaq2_0389"
                     /note="PFAM: MerR family regulatory protein; MerR, DNA
                     binding;
                     TIGRFAM: Zn(II)-responsive transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn(II)-responsive transcriptional regulator"
                     /protein_id="YP_005198474.1"
                     /db_xref="GI:383188346"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR015358"
                     /db_xref="GeneID:11790095"
                     /translation="MYKIGELARLANVSTDTVRYYEKQGMMSTGARNLSGYRQYDESD
                     VQRLRFIRYAKSTGFTLDAIKELLSIRIDPLHHTCQESKSIVDERLAEVEHKLQELNQ
                     MRESLQRLSAACCGSAHTSVSCSILEALEDGAGKVT"
     misc_feature    401188..401589
                     /locus_tag="Rahaq2_0389"
                     /note="zinc-responsive transcriptional regulator;
                     Provisional; Region: zntR; PRK09514"
                     /db_xref="CDD:181924"
     misc_feature    401191..401568
                     /locus_tag="Rahaq2_0389"
                     /note="Helix-Turn-Helix DNA binding domain of Heavy Metal
                     Resistance transcription regulators; Region: HTH_HMRTR;
                     cd04770"
                     /db_xref="CDD:133398"
     misc_feature    order(401194..401202,401242..401244,401293..401301)
                     /locus_tag="Rahaq2_0389"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133398"
     misc_feature    order(401335..401337,401344..401346,401356..401361,
                     401386..401388,401422..401427,401434..401436,
                     401443..401445,401455..401457,401473..401475,
                     401485..401487,401494..401499,401518..401520,
                     401533..401538,401557..401559,401563..401565)
                     /locus_tag="Rahaq2_0389"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133398"
     misc_feature    order(401422..401424,401527..401529,401557..401559)
                     /locus_tag="Rahaq2_0389"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133398"
     gene            401711..401911
                     /locus_tag="Rahaq2_0390"
                     /note="IMG reference gene:2506707415"
                     /db_xref="GeneID:11790096"
     CDS             401711..401911
                     /locus_tag="Rahaq2_0390"
                     /note="PFAM: Domain of unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198475.1"
                     /db_xref="GI:383188347"
                     /db_xref="InterPro:IPR005589"
                     /db_xref="GeneID:11790096"
                     /translation="MSHYKHQKGVIQDNALQALLHDPLFKQRVEKNEKGKGSYRRKEK
                     NGKRSYLEGSVECLFEYSTLPF"
     misc_feature    401720..401872
                     /locus_tag="Rahaq2_0390"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3036"
                     /db_xref="CDD:225578"
     gene            complement(401936..402352)
                     /locus_tag="Rahaq2_0391"
                     /note="IMG reference gene:2506707416"
                     /db_xref="GeneID:11790097"
     CDS             complement(401936..402352)
                     /locus_tag="Rahaq2_0391"
                     /note="PFAM: Large-conductance mechanosensitive channel,
                     MscL;
                     TIGRFAM: large conductance mechanosensitive channel
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="large conductance mechanosensitive channel
                     protein"
                     /protein_id="YP_005198476.1"
                     /db_xref="GI:383188348"
                     /db_xref="InterPro:IPR001185"
                     /db_xref="InterPro:IPR019823"
                     /db_xref="GeneID:11790097"
                     /translation="MSFMKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSFVADIIMPP
                     LGLLIGGVDFKQFAFVLREAQGAAPAVVMHYGVFIQNVFDFIIVALAIFCAITLMNKM
                     RRKQEDKPAAPPKPTAEETLLAEIRDLLKEQQTPKL"
     misc_feature    complement(401942..402346)
                     /locus_tag="Rahaq2_0391"
                     /note="large-conductance mechanosensitive channel;
                     Reviewed; Region: mscL; PRK00567"
                     /db_xref="CDD:234795"
     gene            complement(402465..403841)
                     /locus_tag="Rahaq2_0392"
                     /note="IMG reference gene:2506707417"
                     /db_xref="GeneID:11790098"
     CDS             complement(402465..403841)
                     /locus_tag="Rahaq2_0392"
                     /note="PFAM: TrkA-N domain; TrkA-C domain"
                     /codon_start=1
                     /transl_table=11
                     /product="K+ transport system, NAD-binding component"
                     /protein_id="YP_005198477.1"
                     /db_xref="GI:383188349"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR006036"
                     /db_xref="InterPro:IPR006037"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11790098"
                     /translation="MKIIILGAGQVGGTLAENLVGENNDITVVDTNTVRLRQLQDKFD
                     LRVVQGHGSHPRVLREAGAEDADMLVAVTNSDETNMVACQIAYSLFNTPNRIARIRST
                     EYIRESEKLFHPEAVPIDHLISPEQLVTDYIYKLIEYPGALQVVNFAEGKVSIAAVKA
                     YYGGPLVGNALSSMREHMPHIETRVAAIFRQDRPIRPQGSTIIEAGDEVFFVAASQHI
                     RAVMSELQRLEKPYKRIMIVGGGNVGAGLAQRLEKNYSVKLIERDQQRAAELAEILQD
                     TIVFYGDASDQELLAEEHIEQVDVFIAITNDDEANIMSAMLAKRMGAKKAMVLIQRSA
                     YVDLVQGSVIDIAISPQQATISALLGHVRKADIVSVSSLRRGVAEAIEAIAHGDETTS
                     KVVGRTVEEIKLPPGTTIGAIVRGNEVIIANGTSRIQQGDHVVMFITDKKFVRDVERL
                     FQPSPFFL"
     misc_feature    complement(402474..403841)
                     /locus_tag="Rahaq2_0392"
                     /note="potassium transporter peripheral membrane
                     component; Reviewed; Region: trkA; PRK09496"
                     /db_xref="CDD:236541"
     misc_feature    complement(403467..403835)
                     /locus_tag="Rahaq2_0392"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(403179..403379)
                     /locus_tag="Rahaq2_0392"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     misc_feature    complement(402792..403139)
                     /locus_tag="Rahaq2_0392"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(402519..402677)
                     /locus_tag="Rahaq2_0392"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            complement(403902..405191)
                     /locus_tag="Rahaq2_0393"
                     /note="IMG reference gene:2506707418"
                     /db_xref="GeneID:11790099"
     CDS             complement(403902..405191)
                     /locus_tag="Rahaq2_0393"
                     /note="PFAM: NOL1/NOP2/sun family; NusB family;
                     TIGRFAM: ribosomal RNA small subunit methyltransferase
                     RsmB"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase
                     RsmB"
                     /protein_id="YP_005198478.1"
                     /db_xref="GI:383188350"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR006027"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="GeneID:11790099"
                     /translation="MKTAYNLRSIAAQAISQVLDKGLSLSTVLPGLQKNVSEKDRGLL
                     QELCFGTLRVLPQLEWCLQQLMAKPLTGKQRTLHYLLMVGLYQLIHTRIPAHAVLAET
                     VNGAVALKRPQLKGLINGVLRQFQRQQEELLQRMLNNDSRHLHPSWLFNRLKKAYPDD
                     WENIVDANNQRPPMWLRVNRLHHTRDEYLHLLNESQIEAVPHPEYGDAIRLITPCQVS
                     LLPGFTEGWITVQDASAQGSVDLLDPQNGELILDLCCAPGGKTTHILEAAPKAHVLAV
                     DVDEQRLKRVHENLQRLKLNAEVKQGDGREPQVWAGDRIFDRILLDAPCSATGVIRRH
                     PDIKWLRRDSDIAELASLQKEILHAVWPRLKSKGVMVYATCSILPDENCQQIASFLES
                     HQDATLVETGTMEKPGRQNLPHAEDGDGFYYAKLIKS"
     misc_feature    complement(403908..405179)
                     /locus_tag="Rahaq2_0393"
                     /note="16S rRNA methyltransferase B; Provisional; Region:
                     PRK10901"
                     /db_xref="CDD:236790"
     misc_feature    complement(404805..405176)
                     /locus_tag="Rahaq2_0393"
                     /note="N-terminal RNA binding domain of the
                     methyltransferase Sun. The rRNA-specific 5-methylcytidine
                     transferase Sun, also known as RrmB or Fmu shares the
                     RNA-binding non-catalytic domain with the transcription
                     termination factor NusB. The precise biological...;
                     Region: Methyltransferase_Sun; cd00620"
                     /db_xref="CDD:238343"
     misc_feature    complement(405168..405176)
                     /locus_tag="Rahaq2_0393"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238343"
     misc_feature    complement(404076..404444)
                     /locus_tag="Rahaq2_0393"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(404226..404228,404280..404288,
                     404358..404363,404415..404435))
                     /locus_tag="Rahaq2_0393"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(405267..406202)
                     /locus_tag="Rahaq2_0394"
                     /note="IMG reference gene:2506707419"
                     /db_xref="GeneID:11790100"
     CDS             complement(405267..406202)
                     /locus_tag="Rahaq2_0394"
                     /note="PFAM: Formyl transferase; Formyl transferase,
                     C-terminal domain;
                     TIGRFAM: methionyl-tRNA formyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="YP_005198479.1"
                     /db_xref="GI:383188351"
                     /db_xref="InterPro:IPR001555"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="InterPro:IPR005794"
                     /db_xref="InterPro:IPR011034"
                     /db_xref="InterPro:IPR015518"
                     /db_xref="GeneID:11790100"
                     /translation="MRIIFAGTPDFAARHLDALLSSEHQVVGVFTQPDRPAGRGNKLT
                     ASPVKVLAQTHDIPVFQPKSLRPEENQSLVSALQADVMVVVAYGLILPKAVLGMPKLG
                     CINVHGSLLPRWRGAAPIQRSLWAGDAKTGITIMQMDVGLDTGNMLHKVECDISPADT
                     SASLYDKLAELGPQGLLETLKQLANGTVKPEVQSEEDVTYAEKLSKEEARLDWNLSAE
                     QLERCIRAFNPWPVSFFMIEEQPVKVWQAECLPGKNSAAPGTIVAADKKGIQIATSDG
                     ILNITQLQPSGKKAMSAQDLLNSRREWFIEGTRLV"
     misc_feature    complement(405273..406202)
                     /locus_tag="Rahaq2_0394"
                     /note="methionyl-tRNA formyltransferase; Reviewed; Region:
                     fmt; PRK00005"
                     /db_xref="CDD:234567"
     misc_feature    complement(405591..406202)
                     /locus_tag="Rahaq2_0394"
                     /note="Methionyl-tRNA formyltransferase, N-terminal
                     hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N;
                     cd08646"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(405774..405779,405786..405791,
                     405795..405797,405855..405857,405879..405890,
                     405915..405917,405930..405953,406167..406172,
                     406182..406184))
                     /locus_tag="Rahaq2_0394"
                     /note="putative active site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(405594..405596,405849..405857,
                     405879..405884,405888..405890,405939..405950,
                     406080..406091,406095..406097,406107..406109,
                     406170..406172,406176..406181))
                     /locus_tag="Rahaq2_0394"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(405774..405779,405786..405791,
                     405888..405890,405915..405917,405930..405938,
                     405942..405944,405951..405953))
                     /locus_tag="Rahaq2_0394"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(405774..405776,405882..405884,
                     405888..405890))
                     /locus_tag="Rahaq2_0394"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(405324..405584)
                     /locus_tag="Rahaq2_0394"
                     /note="C-terminal domain of Formyltransferase and other
                     enzymes; Region: Met_tRNA_FMT_C; cd08704"
                     /db_xref="CDD:187732"
     misc_feature    complement(order(405330..405332,405336..405341,
                     405345..405347,405351..405353,405474..405476,
                     405480..405482,405513..405515))
                     /locus_tag="Rahaq2_0394"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187732"
     gene            complement(406228..406740)
                     /locus_tag="Rahaq2_0395"
                     /note="IMG reference gene:2506707420"
                     /db_xref="GeneID:11790101"
     CDS             complement(406228..406740)
                     /locus_tag="Rahaq2_0395"
                     /note="PFAM: Polypeptide deformylase;
                     TIGRFAM: peptide deformylase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="YP_005198480.1"
                     /db_xref="GI:383188352"
                     /db_xref="InterPro:IPR000181"
                     /db_xref="GeneID:11790101"
                     /translation="MSVLQILHFPDERLRITAKPVKEVNAEIQQIVDDMFETMYAEEG
                     IGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPDQRALVP
                     RAAKVKVRALDRDGKTFELEADDLLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKME
                     KMAKLNARAD"
     misc_feature    complement(406312..406725)
                     /locus_tag="Rahaq2_0395"
                     /note="Polypeptide or peptide deformylase; a family of
                     metalloenzymes that catalyzes the removal of the
                     N-terminal formyl group in a growing polypeptide chain
                     following translation initiation during protein synthesis
                     in prokaryotes. These enzymes utilize Fe(II)...; Region:
                     Pep_deformylase; cd00487"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(406330..406332,406339..406344,
                     406465..406473,406588..406590,406603..406611))
                     /locus_tag="Rahaq2_0395"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(406339..406341,406465..406467,
                     406588..406590,406603..406605))
                     /locus_tag="Rahaq2_0395"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(406330..406332,406342..406344,
                     406468..406470))
                     /locus_tag="Rahaq2_0395"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            406869..408038
                     /locus_tag="Rahaq2_0396"
                     /note="IMG reference gene:2506707421"
                     /db_xref="GeneID:11793785"
     CDS             406869..408038
                     /locus_tag="Rahaq2_0396"
                     /note="PFAM: DNA recombination-mediator protein A;
                     TIGRFAM: DNA protecting protein DprA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA protecting protein DprA"
                     /protein_id="YP_005198481.1"
                     /db_xref="GI:383188353"
                     /db_xref="InterPro:IPR003488"
                     /db_xref="GeneID:11793785"
                     /translation="MTLQEAWIRLSVVKRLDPQRAMGIIQTLFYRGAYSSSELANSEL
                     SPEQIADFQHINQHWLSATLKWLEGENCHLITFSSEFYSPLLAQISSPPLILFAKGAA
                     ELLLSPQIAMVGSRDYTHYGEQYAQVFAGGLVSSGFTVTSGLAMGIDGISHKATLDAQ
                     GKTIAVLGSGLMKCYPSCHLKLAARILEEGGALVSEHLVTAPPLAANFPRRNRVISGL
                     SAGVLVIEATLRSGSLITARYALEQGREVFALPGPLGSATSEGTHWLIQQGAYLVTEP
                     NDIADHIGSGLTWFPNIKAAESLKRPQDSRSTASEAIICASDSEVELPFADVLANVEY
                     EVTSVDVVAERAGQPVPEVVGKLLELELAGWIAAVPGGYVRIKRASHVRRTNVLI"
     misc_feature    406869..408035
                     /locus_tag="Rahaq2_0396"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10736"
                     /db_xref="CDD:236747"
     misc_feature    407064..407693
                     /locus_tag="Rahaq2_0396"
                     /note="DNA recombination-mediator protein A; Region:
                     DNA_processg_A; pfam02481"
                     /db_xref="CDD:251323"
     gene            408010..408483
                     /locus_tag="Rahaq2_0397"
                     /note="IMG reference gene:2506707422"
                     /db_xref="GeneID:11790102"
     CDS             408010..408483
                     /locus_tag="Rahaq2_0397"
                     /note="PFAM: Protein of unknown function (DUF494)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198482.1"
                     /db_xref="GI:383188354"
                     /db_xref="InterPro:IPR007456"
                     /db_xref="GeneID:11790102"
                     /translation="MFDVLMYLFETYIHNEAEMNVDEDRLTDDLTEAGFHRADIHNAL
                     NWLEKLADMQEGGTPSYMLDSDPSALRVYTDEETSRLDSSCRGFLLFLEQIKVLNFDT
                     REMVIDRVMALDAEEFDLEDLKWVVLMVLFNIPGYETAYQQMEELLFEVNEGYLH"
     misc_feature    408010..408480
                     /locus_tag="Rahaq2_0397"
                     /note="hypothetical protein; Validated; Region: PRK03430"
                     /db_xref="CDD:235125"
     gene            408508..409068
                     /locus_tag="Rahaq2_0398"
                     /note="IMG reference gene:2506707423"
                     /db_xref="GeneID:11790103"
     CDS             408508..409068
                     /locus_tag="Rahaq2_0398"
                     /note="PFAM: Topoisomerase DNA binding C4 zinc finger"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-finger domain-containing protein
                     (topoisomerase type I-like)"
                     /protein_id="YP_005198483.1"
                     /db_xref="GI:383188355"
                     /db_xref="InterPro:IPR013498"
                     /db_xref="GeneID:11790103"
                     /translation="MTKAALFADKQNGSCPECGADLVIRSGRHGPFLSCSSYPQCQYI
                     RPLKSQADGHVVKVLEGQACPKCDSTLVLRQGRYGMFIGCSQYPECDHIEAIDKPEET
                     TMGCPQCGKGHLLQRKSRFGKVFHACDRYPDCQFAINNKPVAGECEHCHYPLLMEKKT
                     AQGMKLFCASKLCGKAVEIKDNEQDE"
     misc_feature    408544..408657
                     /locus_tag="Rahaq2_0398"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    408655..409053
                     /locus_tag="Rahaq2_0398"
                     /note="Zn-finger domain associated with topoisomerase type
                     I [DNA replication, recombination, and repair]; Region:
                     TopA; COG0551"
                     /db_xref="CDD:223625"
     misc_feature    408688..408801
                     /locus_tag="Rahaq2_0398"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    408823..408933
                     /locus_tag="Rahaq2_0398"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     gene            409061..409630
                     /locus_tag="Rahaq2_0399"
                     /note="IMG reference gene:2506707424"
                     /db_xref="GeneID:11790104"
     CDS             409061..409630
                     /locus_tag="Rahaq2_0399"
                     /note="PFAM: yrdC domain;
                     TIGRFAM: Sua5/YciO/YrdC/YwlC family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative translation factor"
                     /protein_id="YP_005198484.1"
                     /db_xref="GI:383188356"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="GeneID:11790104"
                     /translation="MNKETEKSLNTVLEALRGQHVIAYPTEAVFGLGCDPDSEQAVEA
                     LLALKKRPKDKGLILIADNYQQLLPYIDDSSLTEQQLAHVVSFWPGPVTWVMPAKSST
                     PDWLTGRFTSLAVRVTDHPLVKELCQKFGKPLVSTSANLNGQSPCRLSEEVRLQFGKD
                     FPVLDGDVGGRDNPSEIRDALTGNLIRQG"
     misc_feature    409061..409627
                     /locus_tag="Rahaq2_0399"
                     /note="Telomere recombination; Region: Sua5_yciO_yrdC;
                     cl00305"
                     /db_xref="CDD:260340"
     gene            409634..410461
                     /locus_tag="Rahaq2_0400"
                     /note="IMG reference gene:2506707425"
                     /db_xref="GeneID:11793786"
     CDS             409634..410461
                     /locus_tag="Rahaq2_0400"
                     /note="PFAM: Shikimate dehydrogenase substrate binding
                     domain; Shikimate / quinate 5-dehydrogenase;
                     TIGRFAM: shikimate 5-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="YP_005198485.1"
                     /db_xref="GI:383188357"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022893"
                     /db_xref="GeneID:11793786"
                     /translation="MKVTPSFAVFGNPIGHSKSPRIHALFARQTGIDHTYGTVLAPQE
                     EFEETLRSFFDNGALGANITVPFKERAFAESDELTERAAMSGAVNTLKKFEDGRLLGD
                     NTDGIGMLSDLERLALLKPGDRVLLIGAGGAARGVILPLLSYGCPVVVTNRTFERALH
                     LSHIFEKKGDIRSIALADLADESFDLIINATASGIKGEIPMLPESVLTRQTRVYDMYY
                     QAGLTPFISWAKNNGVIHYADGLGMLVGQAAHAFYLWHGVMPQIEPVLEQLKKDLLV"
     misc_feature    409643..410452
                     /locus_tag="Rahaq2_0400"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region: aroE;
                     PRK00258"
                     /db_xref="CDD:234703"
     misc_feature    409658..409906
                     /locus_tag="Rahaq2_0400"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    409943..410404
                     /locus_tag="Rahaq2_0400"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    order(409946..409948,410285..410287,410363..410365,
                     410372..410374)
                     /locus_tag="Rahaq2_0400"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    order(410021..410023,410030..410032,410087..410092,
                     410201..410209,410279..410281,410351..410353,
                     410360..410365)
                     /locus_tag="Rahaq2_0400"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            complement(410513..411055)
                     /locus_tag="Rahaq2_0401"
                     /note="IMG reference gene:2506707426"
                     /db_xref="GeneID:11790105"
     CDS             complement(410513..411055)
                     /locus_tag="Rahaq2_0401"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase/acetyltransferase"
                     /protein_id="YP_005198486.1"
                     /db_xref="GI:383188358"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="GeneID:11790105"
                     /translation="MSQALRSYQELIPTLGERVMVDPSSVVIGDVDLADDVSIWPLVV
                     IRGDVNNVVIGCRTNVQDGSVLHVTHQSRQNPEGHPLIIGEDVTVGHKAMLHGCTIGN
                     RVLVGMGSILLDGAIVEDDVMIGAGSLVPPGKTLESGYLYLGSPVKQVRELTSDELAG
                     LTYSSNNYVTWKDLYLSQEQ"
     misc_feature    complement(410522..411043)
                     /locus_tag="Rahaq2_0401"
                     /note="Carbonic anhydrases/acetyltransferases, isoleucine
                     patch superfamily [General function prediction only];
                     Region: PaaY; COG0663"
                     /db_xref="CDD:223735"
     misc_feature    complement(410549..411016)
                     /locus_tag="Rahaq2_0401"
                     /note="Gamma carbonic anhydrase-like: This family is
                     composed of gamma carbonic anhydrase (CA), Ferripyochelin
                     Binding Protein (FBP), E. coli paaY protein, and similar
                     proteins. CAs are zinc-containing enzymes that catalyze
                     the reversible hydration of carbon...; Region:
                     LbH_gamma_CA_like; cd04645"
                     /db_xref="CDD:100051"
     misc_feature    complement(order(410732..410734,410768..410770,
                     410774..410785,410855..410857,410867..410872,
                     410912..410914,410918..410920,410924..410929,
                     410936..410938,410972..410974,410981..410986,
                     410990..410992,410996..410998))
                     /locus_tag="Rahaq2_0401"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100051"
     misc_feature    complement(order(410768..410770,410783..410785,
                     410855..410857))
                     /locus_tag="Rahaq2_0401"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:100051"
     gene            411596..413020
                     /locus_tag="Rahaq2_0402"
                     /note="IMG reference gene:2506707427"
                     /db_xref="GeneID:11790106"
     rRNA            411596..413020
                     /locus_tag="Rahaq2_0402"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:11790106"
     gene            413192..413268
                     /locus_tag="Rahaq2_0403"
                     /note="IMG reference gene:2506707428"
                     /db_xref="GeneID:11793787"
     tRNA            413192..413268
                     /locus_tag="Rahaq2_0403"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:11793787"
     gene            413402..413477
                     /locus_tag="Rahaq2_0404"
                     /note="IMG reference gene:2506707429"
                     /db_xref="GeneID:11790107"
     tRNA            413402..413477
                     /locus_tag="Rahaq2_0404"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:11790107"
     gene            413690..416594
                     /locus_tag="Rahaq2_0405"
                     /note="IMG reference gene:2506707430"
                     /db_xref="GeneID:11790108"
     rRNA            413690..416594
                     /locus_tag="Rahaq2_0405"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:11790108"
     gene            416733..416848
                     /locus_tag="Rahaq2_0406"
                     /note="IMG reference gene:2506707431"
                     /db_xref="GeneID:11793788"
     rRNA            416733..416848
                     /locus_tag="Rahaq2_0406"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11793788"
     gene            416899..416974
                     /locus_tag="Rahaq2_0407"
                     /note="IMG reference gene:2506707432"
                     /db_xref="GeneID:11790109"
     tRNA            416899..416974
                     /locus_tag="Rahaq2_0407"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:11790109"
     gene            417011..417126
                     /locus_tag="Rahaq2_0408"
                     /note="IMG reference gene:2506707433"
                     /db_xref="GeneID:11790110"
     rRNA            417011..417126
                     /locus_tag="Rahaq2_0408"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11790110"
     gene            complement(417264..418931)
                     /locus_tag="Rahaq2_0409"
                     /note="IMG reference gene:2506707434"
                     /db_xref="GeneID:11790111"
     CDS             complement(417264..418931)
                     /locus_tag="Rahaq2_0409"
                     /note="PFAM: Sodium:solute symporter family;
                     TIGRFAM: cation/acetate symporter ActP; transporter, SSS
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="cation/acetate symporter ActP"
                     /protein_id="YP_005198487.1"
                     /db_xref="GI:383188359"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR014083"
                     /db_xref="InterPro:IPR018212"
                     /db_xref="GeneID:11790111"
                     /translation="MIARRGSLSLLMLSLAFPFSLFAAEGIAGEVNRQPLNIEAIVMF
                     VLFVGATLYITYWAAKRTRSRQDYYTAGGRITGLQNGLAIAGDFMSAASFLGISALVY
                     TSGYDGLIYSIGFLIGWPIILFLIAERLRNLGKYTFADVASYRLKQKPIRLLSACGSL
                     VVVALYLIAQMVGAGKLIQLLFGLNYHVAVILVGILMVLYVLFGGMLATTWVQIIKAI
                     LLLAGATFMAIMVMRSVGFNFNTLFTQAVAVHSKGIAIMSPGGLVSDPISALSLGLAL
                     MFGTAGLPHILMRFFTVNDAKEARKSVFYATGFIGYFYILTFIIGFGAIVLVSSNPAF
                     KDASGILLGGNNMAAVHLADAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDL
                     YASVIKDGKATERDELRVSKITVILLGIVAIALGILFEKQNIAFMVGLAFSIAASCNF
                     PIILLSMYWSKLTTRGAMVGGWLGLLTAVILMILGPTIWVQILGHAKPIYPYEYPALF
                     SMIVAFVGTWFFSITDNSLEGQKERERFYPQFVRSQTGIGISQSSNH"
     misc_feature    complement(417369..418811)
                     /locus_tag="Rahaq2_0409"
                     /note="Uncharacterized bacterial solute carrier 5
                     subfamily; putative solute-binding domain; Region:
                     SLC5sbd_u4; cd11480"
                     /db_xref="CDD:212050"
     misc_feature    complement(order(417804..417809,417816..417818,
                     418665..418667,418674..418676))
                     /locus_tag="Rahaq2_0409"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212050"
     gene            complement(418928..419239)
                     /locus_tag="Rahaq2_0410"
                     /note="IMG reference gene:2506707435"
                     /db_xref="GeneID:11790112"
     CDS             complement(418928..419239)
                     /locus_tag="Rahaq2_0410"
                     /note="PFAM: Protein of unknown function, DUF485"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198488.1"
                     /db_xref="GI:383188360"
                     /db_xref="InterPro:IPR007436"
                     /db_xref="GeneID:11790112"
                     /translation="MNDLIYQRVVSNPRFRELVQKRSRFAWLLSGITLVLYVAFILLI
                     AFVPQWLGTPLYDGATITRGIPVGVGLIVISFVLTGIYVVRANGEFDRLTADIIREVK
                     P"
     misc_feature    complement(418934..419239)
                     /locus_tag="Rahaq2_0410"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3162"
                     /db_xref="CDD:225704"
     gene            complement(419295..421256)
                     /locus_tag="Rahaq2_0411"
                     /note="IMG reference gene:2506707436"
                     /db_xref="GeneID:11790113"
     CDS             complement(419295..421256)
                     /locus_tag="Rahaq2_0411"
                     /note="PFAM: Domain of unknown function (DUF3448);
                     AMP-binding enzyme;
                     TIGRFAM: acetate--CoA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="acetate--CoA ligase"
                     /protein_id="YP_005198489.1"
                     /db_xref="GI:383188361"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:11790113"
                     /translation="MSHVYKHPIPASVAERTLITPEKYQQYYQQSVEDPDAFWGEQAK
                     VLDWIKPFTKVKNTSFAPGNVDIRWFEDGTLNLAANCLDRHLTDKGDQTALVWEGDDP
                     KAENKYVTYKQLHHDVCQFANVLKGLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVH
                     SVIFAGFSPEAVAGRIVDSNAKLVITADEGLRAGRTIPLKQNVDDALKNPAVTSITHS
                     IIFKRTGKQGEWKEGRDIWWHDAIEGVSADCPPEEMKAEDPLFILYTSGSTGKPKGVL
                     HTTGGYLVYAALTFKYTFDYHDGDIYWCTADVGWVTGHSYLLYGPLACGAISLMFEGV
                     PNYPTPARMAQVIDKHKVNILYTAPTAIRALMAEGDKAIEGTSRASLRIMGSVGEPIN
                     PEAWEWYYKTIGNSQCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALV
                     DNEGVPQEGACEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDED
                     GYYWITGRVDDVLNISGHRLGTAEIESALVSHPKIAEAAVVGIPHNIKGQAIYAYITL
                     NHGEEPSPELYTEVRNWVRKEIGSIATPDILHWTDSLPKTRSGKIMRRILRKIAAGDT
                     SNLGDTSTLADPGVVDKLLEEKQSMKVPS"
     misc_feature    complement(419307..421241)
                     /locus_tag="Rahaq2_0411"
                     /note="acetyl-CoA synthetase; Provisional; Region:
                     PRK00174"
                     /db_xref="CDD:234677"
     misc_feature    complement(419352..421175)
                     /locus_tag="Rahaq2_0411"
                     /note="Acetyl-CoA synthetase (also known as acetate-CoA
                     ligase and acetyl-activating enzyme); Region: ACS;
                     cd05966"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(419484..419489,419502..419504,
                     419676..419687,419709..419711,419718..419720,
                     419754..419756,420006..420023,420087..420098,
                     420165..420167,420174..420179,420249..420257,
                     420321..420326,420339..420341,420666..420668,
                     420672..420674,420681..420683,420759..420767))
                     /locus_tag="Rahaq2_0411"
                     /note="active site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(419487..419489,419502..419504,
                     419679..419687,420165..420167,420174..420179,
                     420249..420257,420321..420323,420339..420341,
                     420666..420668,420672..420674,420681..420683,
                     420759..420767))
                     /locus_tag="Rahaq2_0411"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(420438..420443,420447..420464,
                     420471..420473))
                     /locus_tag="Rahaq2_0411"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(419676..419678,419709..419711,
                     419718..419720,419754..419756,420006..420023,
                     420087..420098,420321..420326))
                     /locus_tag="Rahaq2_0411"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(420012..420014,420093..420098,
                     420321..420326))
                     /locus_tag="Rahaq2_0411"
                     /note="acetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213313"
     gene            421763..422341
                     /locus_tag="Rahaq2_0412"
                     /note="IMG reference gene:2506707437"
                     /db_xref="GeneID:11790114"
     CDS             421763..422341
                     /locus_tag="Rahaq2_0412"
                     /note="PFAM: Fimbrial protein"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, pilin FimA"
                     /protein_id="YP_005198490.1"
                     /db_xref="GI:383188362"
                     /db_xref="InterPro:IPR000259"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="InterPro:IPR014779"
                     /db_xref="GeneID:11790114"
                     /translation="MFNAKKKTLIIALSAFISASAFADDTTPPTGADQGSGRIHFTGT
                     VINAPCSIAAGDEDINVNMGQVANKVLESGNKYSQNVNYTIHLQDCDLTAQTAGTVEY
                     PAMSKVAVSFAGTPDSSAAELLANTGSAKGAGIRLIDANGDLLKVGDTSKDINLVTGN
                     NELVFAARVEANSQPVSTGTIVSQATYALNYK"
     misc_feature    421775..422338
                     /locus_tag="Rahaq2_0412"
                     /note="Fimbrial protein; Region: Fimbrial; cl01416"
                     /db_xref="CDD:260929"
     gene            422443..424944
                     /locus_tag="Rahaq2_0413"
                     /note="IMG reference gene:2506707438"
                     /db_xref="GeneID:11790115"
     CDS             422443..424944
                     /locus_tag="Rahaq2_0413"
                     /note="PFAM: Fimbrial Usher protein"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, porin PapC"
                     /protein_id="YP_005198491.1"
                     /db_xref="GI:383188363"
                     /db_xref="InterPro:IPR000015"
                     /db_xref="GeneID:11790115"
                     /translation="MSLAMNRTSAEIKNALWFIFLLSGCFISVRSFAVEFNVNFIDSA
                     DRNNVDLSRFQVADYIAPGEYLLDVVLNGRTLGEQSVIHYIPTADKKNSRLCLPPALV
                     DKFDLTKDAREKLTLWHHGECTSLDQQQEVTARYDQAKQTLNISIPQAWLIFHDQNWV
                     PPSQWDDGVNGALLDYNLLGSKYMPQSGDSTTSFSSYGTTGFNVGAWRARADYQYSSS
                     RTSGMPASDKFTWTQTYLYRALPSVGARLTGGQTYFSSDIFDSFRFLGVSLNSDQRML
                     PPSLRGYAPQVTGIAKTNAKVSISQNGRVIYQTNVSPGPFVVQDLTEAVQGALDVKIE
                     EENGSVTTYQVTTATIPFLTRKGQVRFKTAMGKPTTGSSNHVLQPGFYSGEMSWGALN
                     DFSLYGGLITTTGNYQAQAIGVGQNLQKLGAVSFDVTRSSATVPVAGKQTGLSYRANY
                     SKRFDSTGSQITFAGYRFSEKTFMSFSQYLDKVNGDGYSRDDKQTYTVTANQYLPWPA
                     ITLYLSATHKVYWNESASNNYSVSVSKIFDIGRFTGISATFSASKLNYRDTDENQMFL
                     SLSLPLSSGQQISYDAQQDSQSGFSQTASYYNSQDPNNSWRVGAGGSSPDLQKGNGVF
                     RANYQHMSPYGQLGANGSVKNNDYRSVNANWYGSFTATAAGAALHQSSAGSEPRMMVS
                     TGVKGIPISDGASVTNDYGIAVVNGVSSYQTSDIRVDVNNLPDDVEVYSSVVSKTLTE
                     GAIGFRKIRAIKGERLMAVIRLADGSHPPLGAAVTDNSSGFEAGLIGDGGLAYLAGVS
                     GEKSLTVRWGDGQQCQIQVPPQPVTYSGQVLLPCT"
     misc_feature    422503..424938
                     /locus_tag="Rahaq2_0413"
                     /note="fimbrial outer membrane usher protein StdB;
                     Provisional; Region: PRK15255"
                     /db_xref="CDD:185167"
     misc_feature    422542..422985
                     /locus_tag="Rahaq2_0413"
                     /note="PapC N-terminal domain; Region: PapC_N; pfam13954"
                     /db_xref="CDD:258209"
     misc_feature    423031..424683
                     /locus_tag="Rahaq2_0413"
                     /note="Outer membrane usher protein; Region: Usher;
                     pfam00577"
                     /db_xref="CDD:249973"
     misc_feature    424714..424896
                     /locus_tag="Rahaq2_0413"
                     /note="PapC C-terminal domain; Region: PapC_C; pfam13953"
                     /db_xref="CDD:258208"
     gene            424992..425729
                     /locus_tag="Rahaq2_0414"
                     /note="IMG reference gene:2506707439"
                     /db_xref="GeneID:11790116"
     CDS             424992..425729
                     /locus_tag="Rahaq2_0414"
                     /note="PFAM: Gram-negative pili assembly chaperone,
                     C-terminal domain; Gram-negative pili assembly chaperone,
                     N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, chaperone PapD"
                     /protein_id="YP_005198492.1"
                     /db_xref="GI:383188364"
                     /db_xref="InterPro:IPR001829"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR016147"
                     /db_xref="InterPro:IPR016148"
                     /db_xref="InterPro:IPR018046"
                     /db_xref="GeneID:11790116"
                     /translation="MNMHLLRFLAALLLMTGAAYPACAAVNLDRTRIIYNASDKSVSV
                     MLENQSKDLPYLAQVWLENAKGEKITSPLVALPPMQRIDAGQKSQIRILQLPETAGLP
                     KDRESLFYFNVREVPPKSDMANVMQVAIQSRVKLFFRPAEIRSLVKGNWQEQLQVIRL
                     SDGLKLTNPTPFYITVGYLGKDNKGNIPGFDSVMLAPFATENLSGRQYVSQQYSLGYM
                     DDYGGLQVNEYHCQTQQCQRISKDAKR"
     misc_feature    425037..425684
                     /locus_tag="Rahaq2_0414"
                     /note="P pilus assembly protein, chaperone PapD [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: FimC; COG3121"
                     /db_xref="CDD:225663"
     misc_feature    425064..425420
                     /locus_tag="Rahaq2_0414"
                     /note="Pili and flagellar-assembly chaperone, PapD
                     N-terminal domain; Region: PapD_N; pfam00345"
                     /db_xref="CDD:249787"
     misc_feature    425481..425666
                     /locus_tag="Rahaq2_0414"
                     /note="Pili assembly chaperone PapD, C-terminal domain;
                     Region: PapD_C; pfam02753"
                     /db_xref="CDD:251514"
     gene            425739..426710
                     /locus_tag="Rahaq2_0415"
                     /note="IMG reference gene:2506707440"
                     /db_xref="GeneID:11790117"
     CDS             425739..426710
                     /locus_tag="Rahaq2_0415"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198493.1"
                     /db_xref="GI:383188365"
                     /db_xref="InterPro:IPR000259"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="GeneID:11790117"
                     /translation="MAGIHRFQAGRMAFLLLLLFFCRSALALDCVEKGTGIVDKPAIP
                     VGQLAIPANVPAGTKVWESNDINVTAYCDNVLGSIIDVVHFYFNPKSQSIGEGLLLGV
                     SYNGQDLEQNEQRLSTNSTPIKKGQNVTVNVTFRLYIKVSGNAPSSGHYQGTDQFTVF
                     QLDGSRGINKTPGAKNLKYNLSGLQGIRFLACGSDLKVYPESQIVDFGAIQSTTLSRS
                     SGISLPFAIKAVKQGCLDNFSLQAEFSTASPLLDDTAIDLSNGAKLMLYNDQNKAITF
                     NRYDDFAELNNVNEVTKNFTAKLSAIPGKTLSLGRFDASVIVKINYY"
     misc_feature    426336..426707
                     /locus_tag="Rahaq2_0415"
                     /note="Fimbrial protein; Region: Fimbrial; pfam00419"
                     /db_xref="CDD:249845"
     gene            426738..427010
                     /locus_tag="Rahaq2_0416"
                     /note="IMG reference gene:2506707441"
                     /db_xref="GeneID:11790118"
     CDS             426738..427010
                     /locus_tag="Rahaq2_0416"
                     /note="PFAM: Helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005198494.1"
                     /db_xref="GI:383188366"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11790118"
                     /translation="MLRTAKLRAQALEEPVYKAQAPELIAETHIHALLQTLREDAGLS
                     KTELARRLGVTPPAITRLEKRPAQASFCTLSRYAQACGFRLYLCYK"
     misc_feature    426837..426983
                     /locus_tag="Rahaq2_0416"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(426840..426842,426852..426854,426927..426929)
                     /locus_tag="Rahaq2_0416"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(426849..426851,426924..426926)
                     /locus_tag="Rahaq2_0416"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(426870..426875,426906..426908,426915..426917,
                     426927..426932)
                     /locus_tag="Rahaq2_0416"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(427036..427593)
                     /locus_tag="Rahaq2_0417"
                     /note="IMG reference gene:2506707442"
                     /db_xref="GeneID:11790119"
     CDS             complement(427036..427593)
                     /locus_tag="Rahaq2_0417"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198495.1"
                     /db_xref="GI:383188367"
                     /db_xref="GeneID:11790119"
                     /translation="MISDRKRIFQGWKIIVLPLIPTVFILLFILHGFSVKKDRAVFPV
                     NIPCRGNMIVEARYDNQSAKLVSTLYFSFLDNHKILVSLSGTGYLYDEKGNITQRKTL
                     LRNIYYDYIHESTHSSTYSLTSSQINIDSVDNMDWQISSLLLLNSFFLTGHTDTLALK
                     KYDDNTLLIESNQSPVALCVFKKIF"
     gene            complement(427583..428464)
                     /locus_tag="Rahaq2_0418"
                     /note="IMG reference gene:2506707443"
                     /db_xref="GeneID:11790120"
     CDS             complement(427583..428464)
                     /locus_tag="Rahaq2_0418"
                     /note="PFAM: Transcriptional regulatory protein, C
                     terminal"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="YP_005198496.1"
                     /db_xref="GI:383188368"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="GeneID:11790120"
                     /translation="MHMNYLIENQILFNPEDNTISLPGDSENKIAISNPARRILLLLI
                     EKKGIVVEREIFFKKVWDDYGLTASNNNLNHCISKLRKVMVTLGYPNEFIVTVPKVGF
                     TIRKHIIIEPYFTHEISEKKIQIHNVQVSKTPENRLTETEQKEETIRPTVIPVQLKTQ
                     SENRTNRFRHGFMISLLVTMALTIWAFFIVYHDLQDPKTQLKIARLGACDLYSTAPVV
                     LSRQRDFIELAETFLQKNNITCKPGDIFIFQSERFTSPVNTGSVRDFMAQCLTDDNDK
                     ANICISYYTNDRTTHDQ"
     misc_feature    complement(428099..428464)
                     /locus_tag="Rahaq2_0418"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cl17355"
                     /db_xref="CDD:266645"
     misc_feature    complement(428144..>428353)
                     /locus_tag="Rahaq2_0418"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(order(428162..428164,428177..428179,
                     428213..428218,428240..428242,428249..428251,
                     428306..428311))
                     /locus_tag="Rahaq2_0418"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(428713..429738)
                     /locus_tag="Rahaq2_0419"
                     /note="IMG reference gene:2506707444"
                     /db_xref="GeneID:11790121"
     CDS             complement(428713..429738)
                     /locus_tag="Rahaq2_0419"
                     /note="PFAM: LD-carboxypeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative MccF-like protein (microcin C7
                     resistance)"
                     /protein_id="YP_005198497.1"
                     /db_xref="GI:383188369"
                     /db_xref="InterPro:IPR003507"
                     /db_xref="GeneID:11790121"
                     /translation="MPSSELPLFPPALKTGDTIGFFSASSPVTATAPNRYLRGKKFLE
                     DKGFVLKAGTMTGQYDHYRSGSIQARAEELNQLFRDPQVRCVMSTIGGNNTNSLLPYL
                     DYDALRADPKIIIGYSDTTALLAGIYAKTGLITFYGPALVASFGEFPPLVDETYASFA
                     DILMTRHSEPYRYALPQHWTDEKLNWNDVTPVRAKALYANTCRFLGRGRIEGRVIGGN
                     LNTLSGIWGSPYMPEIRQGDILFIEDSLKDIATVERSFSMLKLNGIFDRVSAILLGKH
                     ELFDDAGSGRQPADVLLEVLNGQDIPLVDGFDCCHTHPMLTLPLGTRIAVDFSQQHID
                     IPGPYLR"
     misc_feature    complement(428761..429690)
                     /locus_tag="Rahaq2_0419"
                     /note="Microcin C7 self-immunity protein determines
                     resistance to exogenous microcin C7; Region:
                     Peptidase_S66_mccF_like; cd07062"
                     /db_xref="CDD:132883"
     misc_feature    complement(order(428854..428859,428965..428970,
                     428977..428982,428986..428991,429058..429063,
                     429067..429072,429448..429453))
                     /locus_tag="Rahaq2_0419"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132883"
     misc_feature    complement(order(428806..428808,429010..429012,
                     429385..429387))
                     /locus_tag="Rahaq2_0419"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:132883"
     gene            complement(429829..431145)
                     /locus_tag="Rahaq2_0420"
                     /note="IMG reference gene:2506707445"
                     /db_xref="GeneID:11790122"
     CDS             complement(429829..431145)
                     /locus_tag="Rahaq2_0420"
                     /note="PFAM: Major Facilitator Superfamily;
                     TIGRFAM: D-galactonate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate permease"
                     /protein_id="YP_005198498.1"
                     /db_xref="GI:383188370"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11790122"
                     /translation="MYKSNYRVVIALLLFFAGILNYLDRAALSVMAPLIKSDLHINDA
                     QMGILFSAFFIGYCLFCFIGGWSADKFGPRKVFAFAAAFWSVFCGATALVSGFAHLLV
                     VRVMFGIGEGPMGTTTNKSISNWFPRKEVGRAVGFTNAGQPLGAAIAAPVVGLVGLHF
                     GWRIAFVVIAALGFVWLAAWMTFFRDKPEQHPRVSEEEKRLIASDRPATPVTNGVREK
                     DAHSLWYYVFSKPVLGVAAAFFCFNYIQYFFLSWLPSYLTDFQHLDIKSMSIIGILPW
                     LGATAGFIGGGIVADILYRRSGNFLFSRKAVIFAGLIVAAGCVLMTAYTQNTAGAVTL
                     ITVASIFAYMTPQACWSLLQDIVPAHRIGTAGGFVHLLANLAGILSPSITGFLIQYGG
                     GYQSAFILSSGLAIVGVIAMAILVRQNKVNELFGKKAPPEEIATGH"
     misc_feature    complement(429898..431112)
                     /locus_tag="Rahaq2_0420"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(429898..431097)
                     /locus_tag="Rahaq2_0420"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    complement(order(430015..430017,430024..430029,
                     430036..430041,430048..430053,430084..430086,
                     430093..430098,430108..430110,430117..430122,
                     430129..430131,430297..430299,430309..430311,
                     430318..430320,430330..430332,430342..430344,
                     430384..430386,430393..430398,430405..430410,
                     430417..430419,430708..430710,430726..430731,
                     430738..430743,430777..430779,430786..430791,
                     430798..430803,430810..430815,430951..430956,
                     430960..430965,430975..430977,430984..430989,
                     430996..430998,431047..431052,431056..431064,
                     431071..431073))
                     /locus_tag="Rahaq2_0420"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(431138..432298)
                     /locus_tag="Rahaq2_0421"
                     /note="IMG reference gene:2506707446"
                     /db_xref="GeneID:11793789"
     CDS             complement(431138..432298)
                     /locus_tag="Rahaq2_0421"
                     /note="PFAM: Mandelate racemase / muconate lactonizing
                     enzyme, C-terminal domain; Mandelate racemase / muconate
                     lactonizing enzyme, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="L-alanine-DL-glutamate epimerase-like protein"
                     /protein_id="YP_005198499.1"
                     /db_xref="GI:383188371"
                     /db_xref="InterPro:IPR001354"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="InterPro:IPR015654"
                     /db_xref="InterPro:IPR018110"
                     /db_xref="GeneID:11793789"
                     /translation="MKITKIEVLRVAIPFSSGRGKTPETQTDAYNAASPELTRMETLL
                     VKISTDTGLHGWGEGFGHLCNPMTETALNGLVGRFFLGQRCPQSPQEIAALMQQAEVN
                     FHAFGRTGPVMFALSAVDIALWDLLAKARKQPLWQMLGAKRQKIGVYASLVSYGNHPQ
                     RVAAKVLSTYQAGFRAIKLHETDYSAIAAAREILPADAELMVDVNCPWNVEEAAKQAQ
                     ALLSLNLGWLEEPVWPPDDLAGLAEVRKQGTRIAAGENAAGVQGFAEHFEHRAIDIAQ
                     PSVSKVGGITAMLKVFTLAKQYHIRVVPHCFYYGAGLMATAQLVAMLDDSVSLEVPYI
                     QWQETLYSQLNFKPHMLLPDMPGLGFEPSLSTLQKYLISSNTLSLNAETAHV"
     misc_feature    complement(431180..432298)
                     /locus_tag="Rahaq2_0421"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    complement(431216..432295)
                     /locus_tag="Rahaq2_0421"
                     /note="Mandelate racemase (MR)-like subfamily of the
                     enolase superfamily. Enzymes of this subgroup share three
                     conserved carboxylate ligands for the essential divalent
                     metal ion (usually Mg2+), two aspartates and a glutamate,
                     and conserved catalytic residues; Region: MR_like;
                     cd03316"
                     /db_xref="CDD:239432"
     misc_feature    complement(order(431309..431311,431384..431386,
                     431465..431467,431534..431536,431612..431614,
                     431690..431692,431759..431761,431765..431767))
                     /locus_tag="Rahaq2_0421"
                     /note="active site pocket [active]"
                     /db_xref="CDD:239432"
     gene            complement(432689..432764)
                     /locus_tag="Rahaq2_0422"
                     /note="IMG reference gene:2506707447"
                     /db_xref="GeneID:11790123"
     tRNA            complement(432689..432764)
                     /locus_tag="Rahaq2_0422"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:11790123"
     gene            complement(432894..433469)
                     /locus_tag="Rahaq2_0423"
                     /note="IMG reference gene:2506707448"
                     /db_xref="GeneID:11793790"
     CDS             complement(432894..433469)
                     /locus_tag="Rahaq2_0423"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005198500.1"
                     /db_xref="GI:383188372"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR015893"
                     /db_xref="GeneID:11793790"
                     /translation="MLREQVLDKTLNFLEQRGLATLSLETVAELVDVPLSELRRFWPD
                     AEALLYDSLRYHGEQIDIWRRQLMLDESLSAPQKLLARYKVLDEQVRQQRYPGCLFIA
                     ACTFFPDSDTPIHQLAQQQKRASYDYTLSLLQEMGSDDPEMVAQQMELILEGCLSKLL
                     VKRQLNDVEVARRLAEDVLNIARCREHGALS"
     misc_feature    complement(432897..433469)
                     /locus_tag="Rahaq2_0423"
                     /note="putative transcriptional regulator; Provisional;
                     Region: PRK11640"
                     /db_xref="CDD:183252"
     gene            complement(433513..435243)
                     /locus_tag="Rahaq2_0424"
                     /note="IMG reference gene:2506707449"
                     /db_xref="GeneID:11790124"
     CDS             complement(433513..435243)
                     /locus_tag="Rahaq2_0424"
                     /note="PFAM: Thioredoxin; Disulphide bond corrector
                     protein DsbC; Cytochrome C biogenesis protein
                     transmembrane region"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="YP_005198501.1"
                     /db_xref="GI:383188373"
                     /db_xref="InterPro:IPR003834"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017936"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="InterPro:IPR022910"
                     /db_xref="GeneID:11790124"
                     /translation="MDHRIFRLFFLLCSLCLLPFQANASLFGKPAVAQFVPVDQAFSF
                     DFRQQGHDLKLNWQIRDGYYLYRSKIELEPKNARLAAFLMPKGRDHHDEFFGDSEVYE
                     NALSLTVPLRQAGADATVRVTYQGCAAAGFCYPPETREVPLSAVTELSPLSTPATDTA
                     PVIATPEKQSTPLPFSPLWALLIGIGIAFTPCVLPMYPLISGIILGRQRPHSMKRIFM
                     LSLFYVQGMALTYTLLGMVVAAAGLQFQAALQSPWVLIVLSVMFIALALSMLGAFSLQ
                     LPSSVQTRLALWSNGQKGGSLPGVFIMGALAGLICSPCTTAPLSAILLYIAQSGNLLA
                     GAGTLYLYALGMGIPLIIVTMFGNKLLPRSGPWMQYVKEGFGFVILALPVFLLERVTG
                     DIWGLRLWSLLGVAFFGWALLLSLKSQHGMVRILQIAFLAAVLIVSRPLQDWAFAPAG
                     NTMAQTHALNFQKIHNVAELDTALQGAQGKRIMLDLYADWCVACKEFEKYTFSASEVQ
                     NELSDTVLLQADVTQNSPEQKALLARLNVLGLPTIIFFGPDGHELPQSRVTGFMDAAE
                     FSAHLQKVHP"
     misc_feature    complement(433516..435189)
                     /locus_tag="Rahaq2_0424"
                     /note="thiol:disulfide interchange protein precursor;
                     Provisional; Region: dipZ; PRK00293"
                     /db_xref="CDD:234717"
     misc_feature    complement(434809..435147)
                     /locus_tag="Rahaq2_0424"
                     /note="Disulphide bond corrector protein DsbC; Region:
                     DsbC; pfam11412"
                     /db_xref="CDD:256454"
     misc_feature    complement(434083..434706)
                     /locus_tag="Rahaq2_0424"
                     /note="Cytochrome c biogenesis protein [Posttranslational
                     modification, protein turnover, chaperones]; Region: CcdA;
                     COG0785"
                     /db_xref="CDD:223856"
     misc_feature    complement(433531..433845)
                     /locus_tag="Rahaq2_0424"
                     /note="DsbD gamma family; DsbD gamma is the C-terminal
                     periplasmic domain of the bacterial protein DsbD. It
                     contains a CXXC motif in a TRX fold and shuttles the
                     reducing potential from the membrane domain (DsbD beta) to
                     the N-terminal periplasmic domain (DsbD...; Region:
                     DsbDgamma; cd02953"
                     /db_xref="CDD:239251"
     misc_feature    complement(order(433534..433536,433561..433569,
                     433579..433584,433588..433590,433621..433629,
                     433744..433749,433759..433761,433765..433767,
                     433771..433779))
                     /locus_tag="Rahaq2_0424"
                     /note="DsbD alpha interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239251"
     misc_feature    complement(order(433762..433764,433771..433773))
                     /locus_tag="Rahaq2_0424"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239251"
     gene            complement(435416..436717)
                     /locus_tag="Rahaq2_0425"
                     /note="IMG reference gene:2506707450"
                     /db_xref="GeneID:11790125"
     CDS             complement(435416..436717)
                     /locus_tag="Rahaq2_0425"
                     /note="PFAM: Anaerobic c4-dicarboxylate membrane
                     transporter;
                     TIGRFAM: anaerobic c4-dicarboxylate membrane transporter
                     family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic c4-dicarboxylate membrane transporter
                     family protein"
                     /protein_id="YP_005198502.1"
                     /db_xref="GI:383188374"
                     /db_xref="InterPro:IPR004668"
                     /db_xref="GeneID:11790125"
                     /translation="MLIIEFIIVLAAIFLGARLGGIGIGFAGGLGVLVLALIGVKPGT
                     IPFDVISIIMAVIAAISTMQVAGGMDYLVQQTEKLLRRNPKHITLLAPIVTYFLTIMA
                     GTGNISLSALPVIAEVAKEQGIKPCRPLSTAVVAAQIAITASPISAAVVYMASTMEGH
                     GVSYLHLLMVMIPATLAAVILMSLIVSWCFDSKLSNDPVYLKRYEEGLIQLRGDKVPE
                     IKRGAKLSVLLFLLGVLTVVAYAVINSPSLGWVAQPVMTTNSAILIIMLSVATLITLL
                     CSIDTDAILTSSTFKSGMSACICILGVAWLGDTFVQANLGWIKETAGGLIQAHPWLLA
                     VIFFFSSALLYSQAATTKALLPMALALSVSPLTAVGSFAAVSGLFILPTYPTLVAAVQ
                     MDDTGTTRIGRFVFNHPFFIPGTIGVFLAVLFGFGFGSIIL"
     misc_feature    complement(435419..436717)
                     /locus_tag="Rahaq2_0425"
                     /note="anaerobic C4-dicarboxylate transporter; Reviewed;
                     Region: PRK09412"
                     /db_xref="CDD:236503"
     gene            complement(436853..438289)
                     /locus_tag="Rahaq2_0426"
                     /note="IMG reference gene:2506707451"
                     /db_xref="GeneID:11790126"
     CDS             complement(436853..438289)
                     /locus_tag="Rahaq2_0426"
                     /note="PFAM: Fumarase C C-terminus; Lyase;
                     TIGRFAM: aspartate ammonia-lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="YP_005198503.1"
                     /db_xref="GI:383188375"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR003031"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR018951"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="GeneID:11790126"
                     /translation="MSNTIRIEEDLLGTREVPAEAYYGIHTLRAIENFYISNTKISDV
                     PEFVRGMVMVKKAAALANKELRTIPRHIADIIIQACDEVLDKGKCMDQFPIDVYQGGA
                     GTSVNMNTNEVLANIGLELMGHQKGDYQFLNPNDHLNKCQSTNDAYPTGFRIAVYASL
                     LKLVDAISQLGDGFERKAKEFENIIKMGRTQLQDAVPMTLGQEFHAFNVLLKEETRNL
                     MRTGELLLEVNLGATAIGTRLNTPEGYQQLAVEKLAEVSNLACVPAEDLIEATSDCGA
                     YVMVHSSLKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVIPE
                     VVNQVCFKVIGNDVCVTMAAEAGQLQLNVMEPVIGQAMFESVHILTNACYNLLEKCIN
                     GITANKEVCEFYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTE
                     AELDDIFSIENLKHPAYKAKRYTDENEQ"
     misc_feature    complement(436871..438289)
                     /locus_tag="Rahaq2_0426"
                     /note="aspartate ammonia-lyase; Provisional; Region: aspA;
                     PRK12273"
                     /db_xref="CDD:237031"
     misc_feature    complement(436916..438274)
                     /locus_tag="Rahaq2_0426"
                     /note="Aspartase; Region: Aspartase; cd01357"
                     /db_xref="CDD:176462"
     misc_feature    complement(order(437288..437290,437303..437305,
                     437309..437311,437717..437722,437855..437863,
                     437978..437989))
                     /locus_tag="Rahaq2_0426"
                     /note="active sites [active]"
                     /db_xref="CDD:176462"
     misc_feature    complement(order(437051..437053,437210..437218,
                     437225..437227,437249..437251,437399..437404,
                     437411..437416,437420..437425,437432..437437,
                     437444..437446,437453..437458,437465..437467,
                     437471..437476,437483..437485,437492..437497,
                     437585..437587,437639..437641,437651..437653,
                     437663..437665,437681..437686,437702..437704,
                     437714..437725))
                     /locus_tag="Rahaq2_0426"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176462"
     gene            438517..438708
                     /locus_tag="Rahaq2_0427"
                     /note="IMG reference gene:2506707452"
                     /db_xref="GeneID:11790127"
     CDS             438517..438708
                     /locus_tag="Rahaq2_0427"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198504.1"
                     /db_xref="GI:383188376"
                     /db_xref="GeneID:11790127"
                     /translation="MLEIMMDEHHLSVVSLHFFDSKDPEQALIQGLECRCDSACGAKL
                     QGECGALVTVTTVIPAGLH"
     gene            438662..439153
                     /locus_tag="Rahaq2_0428"
                     /note="IMG reference gene:2506707453"
                     /db_xref="GeneID:11790128"
     CDS             438662..439153
                     /locus_tag="Rahaq2_0428"
                     /note="PFAM: FxsA cytoplasmic membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein affecting phage T7 exclusion by the F
                     plasmid"
                     /protein_id="YP_005198505.1"
                     /db_xref="GI:383188377"
                     /db_xref="InterPro:IPR007313"
                     /db_xref="GeneID:11790128"
                     /translation="MRWLPLLLLFLLAYIEITLFIKVAAVVGVATTLLLVVFTSCVGV
                     SLVKNQGMKTFMQLQQKLAVGESPAAEMVKSVSLVIAGFLLLVPGFFTDFLGLLLLLP
                     PIQKRLTLKLMPHLNIVRSGGNWGSSAPTGNTFDGEFQRTDETQERLVSPKKDDDTEH
                     RDR"
     misc_feature    438662..439126
                     /locus_tag="Rahaq2_0428"
                     /note="Protein affecting phage T7 exclusion by the F
                     plasmid [General function prediction only]; Region: FxsA;
                     COG3030"
                     /db_xref="CDD:225574"
     gene            439369..439662
                     /locus_tag="Rahaq2_0429"
                     /note="IMG reference gene:2506707454"
                     /db_xref="GeneID:11790129"
     CDS             439369..439662
                     /locus_tag="Rahaq2_0429"
                     /note="PFAM: Chaperonin 10 Kd subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Co-chaperonin GroES"
                     /protein_id="YP_005198506.1"
                     /db_xref="GI:383188378"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR018369"
                     /db_xref="InterPro:IPR020818"
                     /db_xref="GeneID:11790129"
                     /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEILAVG
                     HGRILENGEVKALDVKVGDIVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
     misc_feature    439372..439653
                     /locus_tag="Rahaq2_0429"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    order(439372..439374,439378..439380,439384..439386,
                     439393..439395,439474..439479,439540..439542,
                     439570..439572,439585..439587,439594..439596,
                     439642..439650)
                     /locus_tag="Rahaq2_0429"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    439420..439461
                     /locus_tag="Rahaq2_0429"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    order(439501..439503,439534..439536)
                     /locus_tag="Rahaq2_0429"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            439716..441362
                     /locus_tag="Rahaq2_0430"
                     /note="IMG reference gene:2506707455"
                     /db_xref="GeneID:11790130"
     CDS             439716..441362
                     /locus_tag="Rahaq2_0430"
                     /note="PFAM: TCP-1/cpn60 chaperonin family;
                     TIGRFAM: chaperonin GroL"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroL"
                     /protein_id="YP_005198507.1"
                     /db_xref="GI:383188379"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="GeneID:11790130"
                     /translation="MAAKEVKFGNDARVKMLRGVNILADAVKVTLGPKGRNVVLDKSF
                     GAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITE
                     GLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGK
                     LIAEAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP
                     FILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAV
                     KAPGFGDRRKAMLQDIATLTGGTVISEEIGLELEKATLEDMGQAKRVVINKDTTIIID
                     GVGEEATIQGRVSQIRQQIEEATSDYDREKLQERVAKLAGGVAVLKVGAATEVEMKEK
                     KARVEDALHATRAAVEEGVVAGGGVALVRVAHTLANLTGDNDDQNVGIRVALRAMESP
                     LRQIVVNAGEEASVIANKVKAGEGSFGYNAYTEEYGDMIAMGILDPTKVTRSALQYAS
                     SVAGLMITTECMITDLPKDDKVDMGGAGGMGGMGGMGGMM"
     misc_feature    439716..441299
                     /locus_tag="Rahaq2_0430"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    439725..441284
                     /locus_tag="Rahaq2_0430"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    order(439725..439727,439737..439739,439788..439790,
                     439821..439832,439836..439838,439851..439856,
                     439860..439862,439890..439892,439896..439898,
                     439920..439922,439932..439934,439941..439943,
                     440304..440306,440400..440402,440484..440486,
                     440865..440867,440871..440873,441090..441092,
                     441252..441254,441261..441281)
                     /locus_tag="Rahaq2_0430"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(439806..439814,439974..439976,439986..439988,
                     440163..440165,440907..440909,440958..440960,
                     441075..441077,441192..441194,441198..441200)
                     /locus_tag="Rahaq2_0430"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(440040..440042,441015..441017,441069..441071,
                     441096..441098,441102..441107,441114..441116)
                     /locus_tag="Rahaq2_0430"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(440136..440138,440271..440273,440292..440294,
                     440838..440840,440940..440945)
                     /locus_tag="Rahaq2_0430"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            441659..442003
                     /locus_tag="Rahaq2_0431"
                     /note="IMG reference gene:2506707456"
                     /db_xref="GeneID:11790131"
     CDS             441659..442003
                     /locus_tag="Rahaq2_0431"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005198508.1"
                     /db_xref="GI:383188380"
                     /db_xref="GeneID:11790131"
                     /translation="MRIKMLLGLSAIALLAGCSTTHQLDAAGQQVKFTDDKPGANCQL
                     LGEVTGAQSNWFSGTGGDGSSMRGAANDLRNKAAAMGGNTIYGANSPSQNFLSSFAPV
                     DSKMVGQVYKCP"
     misc_feature    441665..>441736
                     /locus_tag="Rahaq2_0431"
                     /note="YnbE-like lipoprotein; Region: Lipoprotein_19;
                     pfam13617"
                     /db_xref="CDD:257930"
     misc_feature    441719..441997
                     /locus_tag="Rahaq2_0431"
                     /note="Domain of unknown function (DUF4156); Region:
                     DUF4156; pfam13698"
                     /db_xref="CDD:205873"
     gene            complement(442192..443220)
                     /locus_tag="Rahaq2_0432"
                     /note="IMG reference gene:2506707457"
                     /db_xref="GeneID:11790132"
     CDS             complement(442192..443220)
                     /locus_tag="Rahaq2_0432"
                     /note="PFAM: Radical SAM superfamily;
                     TIGRFAM: KamA family protein;
                     lysine-2,3-aminomutase-related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine-2,3-aminomutase-related protein"
                     /protein_id="YP_005198509.1"
                     /db_xref="GI:383188381"
                     /db_xref="InterPro:IPR003739"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:11790132"
                     /translation="MANIVTLNAPFREDWLYQLGDVITDPDELLTLLALNDNAELQNG
                     REARRLFPLRVPRAFVARMQPGDPQDPLLLQVLTAREEFIAAPGFTTDPLDEQRSVVP
                     GLLHKYSNRALLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWVQALDYIRTRPELDEI
                     IFSGGDPLMAKDHELDWLIGELEGIAHIKRLRIHTRLPVVIPARITDNLCQRLEKSRL
                     QVLMVTHINHANEIDNALRASMAKLKHHGVTLLNQSVLLRGVNDSADVLAALSNALFE
                     AGILPYYIHVLDKVQGAAHFMVNDDEARVIMKGLMSKVSGYMVPKLTREIGGEPSKTL
                     LDLRLKQS"
     misc_feature    complement(442195..443211)
                     /locus_tag="Rahaq2_0432"
                     /note="Lysine 2,3-aminomutase [Amino acid transport and
                     metabolism]; Region: KamA; COG1509"
                     /db_xref="CDD:224426"
     misc_feature    complement(442360..442881)
                     /locus_tag="Rahaq2_0432"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(442360..442365,442456..442458,
                     442546..442548,442633..442641,442723..442728,
                     442732..442734,442837..442845,442849..442851,
                     442855..442857,442861..442863))
                     /locus_tag="Rahaq2_0432"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            443259..443825
                     /locus_tag="Rahaq2_0433"
                     /note="IMG reference gene:2506707458"
                     /db_xref="GeneID:11790133"
     CDS             443259..443825
                     /locus_tag="Rahaq2_0433"
                     /note="PFAM: Elongation factor P, C-terminal; Elongation
                     factor P (EF-P) KOW-like domain; Elongation factor P
                     (EF-P) OB domain;
                     TIGRFAM: translation elongation factor P"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor P"
                     /protein_id="YP_005198510.1"
                     /db_xref="GI:383188382"
                     /db_xref="InterPro:IPR001059"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR011768"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013185"
                     /db_xref="InterPro:IPR013852"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR015365"
                     /db_xref="InterPro:IPR016027"
                     /db_xref="InterPro:IPR020599"
                     /db_xref="GeneID:11790133"
                     /translation="MATYSSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMR
                     RLLTGSRVEKTFKSTDSCEGADVVDTNMNYLYNDGEFYHFMHPETFEQHQVEEKTVSD
                     ASKWLQDNAECIVTLWDGRPIAVQPPNFIEAEVVDTDPGLKGDTAGTGGKPATLSTGA
                     VVKVPLFVQIGEIVRCDTRSGEYVSRVK"
     misc_feature    443265..443822
                     /locus_tag="Rahaq2_0433"
                     /note="elongation factor P; Validated; Region: PRK00529"
                     /db_xref="CDD:234788"
     misc_feature    443271..443441
                     /locus_tag="Rahaq2_0433"
                     /note="Elongation factor P (EF-P) KOW-like domain; Region:
                     EFP_N; pfam08207"
                     /db_xref="CDD:254661"
     misc_feature    443463..443642
                     /locus_tag="Rahaq2_0433"
                     /note="S1_EF-P_repeat_1: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_1;
                     cd04470"
                     /db_xref="CDD:239916"
     misc_feature    order(443529..443531,443604..443606,443619..443624)
                     /locus_tag="Rahaq2_0433"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239916"
     misc_feature    443649..443816
                     /locus_tag="Rahaq2_0433"
                     /note="S1_EF-P_repeat_2: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_2;
                     cd05794"
                     /db_xref="CDD:240220"
     misc_feature    order(443736..443738,443787..443789,443802..443807)
                     /locus_tag="Rahaq2_0433"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240220"
     gene            443921..444049
                     /locus_tag="Rahaq2_0434"
                     /note="IMG reference gene:2506707459"
                     /db_xref="GeneID:11790134"
     CDS             443921..444049
                     /locus_tag="Rahaq2_0434"
                     /note="PFAM: Entericidin EcnA/B family;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="putative small secreted protein"
                     /protein_id="YP_005198511.1"
                     /db_xref="GI:383188383"
                     /db_xref="GeneID:11790134"
                     /translation="MLKKMMFIVVSVMLLASLSGCNTVHGFGEDIQHLGGAISKAG"
     misc_feature    443921..444043
                     /locus_tag="Rahaq2_0434"
                     /note="Entericidin EcnA/B family; Region: Entericidin;
                     cl02322"
                     /db_xref="CDD:242984"
     gene            444168..444302
                     /locus_tag="Rahaq2_0435"
                     /note="IMG reference gene:2506707460"
                     /db_xref="GeneID:11790135"
     CDS             444168..444302
                     /locus_tag="Rahaq2_0435"
                     /note="PFAM: Entericidin EcnA/B family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative small secreted protein"
                     /protein_id="YP_005198512.1"
                     /db_xref="GI:383188384"
                     /db_xref="GeneID:11790135"
                     /translation="MLKKSILAILSVLVLSSALTACNTTRGVGEDVSAGGQAIQKSAQ
                     "
     misc_feature    444168..444296
                     /locus_tag="Rahaq2_0435"
                     /note="Entericidin EcnA/B family; Region: Entericidin;
                     cl02322"
                     /db_xref="CDD:242984"
     gene            complement(444392..444916)
                     /locus_tag="Rahaq2_0436"
                     /note="IMG reference gene:2506707461"
                     /db_xref="GeneID:11790136"
     CDS             complement(444392..444916)
                     /locus_tag="Rahaq2_0436"
                     /note="PFAM: Lipocalin-like domain"
                     /codon_start=1
                     /transl_table=11
                     /product="lipocalin"
                     /protein_id="YP_005198513.1"
                     /db_xref="GI:383188385"
                     /db_xref="InterPro:IPR002446"
                     /db_xref="InterPro:IPR011038"
                     /db_xref="InterPro:IPR012674"
                     /db_xref="InterPro:IPR013208"
                     /db_xref="InterPro:IPR022271"
                     /db_xref="InterPro:IPR022272"
                     /db_xref="GeneID:11790136"
                     /translation="MRIWSKLSVIITALLSVACSVTPPADVKVVNNFELTRYLGTWYE
                     VARLDHSFESGLERVTANYSLRDDGGVKVINRGFNPQKNKWQESEGKGYFTGSPARAA
                     LKVSFFGPFYGGYNVIELDKDYRYALVCGPDKSYLWILSRTPTLDDSVKQQLLQTAQQ
                     YGFDTSKLVWVKQP"
     misc_feature    complement(444395..444916)
                     /locus_tag="Rahaq2_0436"
                     /note="Lipocalin-like domain; Region: Lipocalin_2;
                     cl19222"
                     /db_xref="CDD:267575"
     gene            complement(445041..445400)
                     /locus_tag="Rahaq2_0437"
                     /note="IMG reference gene:2506707462"
                     /db_xref="GeneID:11790137"
     CDS             complement(445041..445400)
                     /locus_tag="Rahaq2_0437"
                     /note="PFAM: Fumarate reductase subunit D"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit D"
                     /protein_id="YP_005198514.1"
                     /db_xref="GI:383188386"
                     /db_xref="InterPro:IPR003418"
                     /db_xref="GeneID:11790137"
                     /translation="MKNTLPKRSDEPVFWGLFGAGGMWSAIFAPVMILLVCFLLPLGF
                     FPGDALSYPRVLAFAQSGIGRLFLLLMIVLPLWCGLHRIHHCMHDLKIHVPAGKWVFY
                     GLATILSIVTLIVLIRL"
     misc_feature    complement(445044..445385)
                     /locus_tag="Rahaq2_0437"
                     /note="Quinol:fumarate reductase (QFR) Type D subfamily,
                     13kD hydrophobic subunit D; QFR couples the reduction of
                     fumarate to succinate to the oxidation of quinol to
                     quinone, the opposite reaction to that catalyzed by the
                     related protein, succinate:quinine...; Region:
                     QFR_TypeD_subunitD; cd00547"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(445134..445136,445356..445358,
                     445365..445367,445374..445379))
                     /locus_tag="Rahaq2_0437"
                     /note="Iron-sulfur protein interface; other site"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(445344..445349,445356..445358))
                     /locus_tag="Rahaq2_0437"
                     /note="proximal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(445044..445046,445065..445067,
                     445128..445136,445152..445157,445185..445187,
                     445224..445226,445233..445235,445239..445241,
                     445245..445247,445278..445280,445323..445325,
                     445335..445337))
                     /locus_tag="Rahaq2_0437"
                     /note="C-subunit interface; other site"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(445227..445229,445236..445241,
                     445293..445295,445305..445307))
                     /locus_tag="Rahaq2_0437"
                     /note="distal quinone binding site; other site"
                     /db_xref="CDD:238307"
     gene            complement(445410..445820)
                     /locus_tag="Rahaq2_0438"
                     /note="IMG reference gene:2506707463"
                     /db_xref="GeneID:11790138"
     CDS             complement(445410..445820)
                     /locus_tag="Rahaq2_0438"
                     /note="PFAM: Fumarate reductase subunit C"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit C"
                     /protein_id="YP_005198515.1"
                     /db_xref="GI:383188387"
                     /db_xref="InterPro:IPR003510"
                     /db_xref="GeneID:11790138"
                     /translation="MTTQSTGSKRKPYVHEMKASWWKSLPFYRFYMLREGTAVPAVWF
                     SLLLLAGVCSLRNGPESWAGFVNFLQNPVVLLINLIALLAALLHTKTWFELAPKASIV
                     VVKGKKMGPEPVIAGFWGVTIVVTLVVLVIALFL"
     misc_feature    complement(445461..445793)
                     /locus_tag="Rahaq2_0438"
                     /note="Quinol:fumarate reductase (QFR) Type D subfamily,
                     15kD hydrophobic subunit C;  QFR couples the reduction of
                     fumarate to succinate to the oxidation of quinol to
                     quinone, the opposite reaction to that catalyzed by the
                     related protein, succinate:quinine...; Region:
                     QFR_TypeD_subunitC; cd00546"
                     /db_xref="CDD:238306"
     misc_feature    complement(order(445518..445520,445524..445529,
                     445536..445538,445545..445547,445554..445559,
                     445575..445577,445587..445589,445611..445613,
                     445635..445637,445653..445658,445662..445664,
                     445674..445676,445686..445691,445704..445706,
                     445710..445712,445716..445721,445728..445730,
                     445737..445742,445746..445748,445758..445760,
                     445764..445766,445770..445772,445776..445778,
                     445782..445793))
                     /locus_tag="Rahaq2_0438"
                     /note="D-subunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238306"
     misc_feature    complement(order(445518..445520,445527..445529,
                     445536..445538,445719..445721,445728..445730,
                     445737..445742,445746..445748,445770..445772,
                     445776..445778,445782..445784,445788..445793))
                     /locus_tag="Rahaq2_0438"
                     /note="Iron-sulfur protein interface; other site"
                     /db_xref="CDD:238306"
     misc_feature    complement(order(445536..445538,445545..445547,
                     445716..445721))
                     /locus_tag="Rahaq2_0438"
                     /note="proximal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238306"
     gene            complement(445832..446566)
                     /locus_tag="Rahaq2_0439"
                     /note="IMG reference gene:2506707464"
                     /db_xref="GeneID:11790139"
     CDS             complement(445832..446566)
                     /locus_tag="Rahaq2_0439"
                     /note="TIGRFAM: succinate dehydrogenase and fumarate
                     reductase iron-sulfur protein"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase a