GenomeNet

Database: RefSeq
Entry: NC_016819
LinkDB: NC_016819
Original site: NC_016819 
LOCUS       NC_016819             115487 bp    DNA     circular CON 08-JUN-2013
DEFINITION  Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq202,
            complete sequence.
ACCESSION   NC_016819
VERSION     NC_016819.1  GI:383192311
DBLINK      Project: 86855
            BioProject: PRJNA86855
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Rahnella aquatilis CIP 78.65 = ATCC 33071
  ORGANISM  Rahnella aquatilis CIP 78.65 = ATCC 33071
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Rahnella.
REFERENCE   1  (bases 1 to 115487)
  AUTHORS   Martinez,R.J., Bruce,D., Detter,C., Goodwin,L.A., Han,J., Han,C.S.,
            Held,B., Land,M.L., Mikhailova,N., Nolan,M., Pennacchio,L.,
            Pitluck,S., Tapia,R., Woyke,T. and Sobecky,P.A.
  TITLE     Complete genome sequence of Rahnella aquatilis CIP 78.65
  JOURNAL   J. Bacteriol. 194 (11), 3020-3021 (2012)
   PUBMED   22582378
REFERENCE   2  (bases 1 to 115487)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 115487)
  AUTHORS   Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
            Peters,L., Ovchinnikova,G., Held,B., Detter,J.C., Han,C., Tapia,R.,
            Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Sobecky,P.,
            Martinez,R. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003246.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4089211
            Source DNA and organism available from Robert Martinez
            (rmartinez@bama.ua.edu)
            Contacts: Robert Martinez (rmartinez@bama.ua.edu)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Rahnella aquatilis CIP 78.65
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Host
            num_replicons       :: 4
            ref_biomaterial     :: Missing
            biotic_relationship :: Missing
            trophic_level       :: Missing
            rel_to_oxygen       :: Facultative
            isol_growth_condt   :: Missing
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi06369
            Type Strain         :: Yes
            Funding Program     :: DOE-CSP 2010
            Gene Calling Method :: Prodigal 1.4, GenePRIMP
            Isolation Site      :: drinking water
            Host Name           :: Water, humans
            Cell Shape          :: Rod-shaped
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram-
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..115487
                     /organism="Rahnella aquatilis CIP 78.65 = ATCC 33071"
                     /mol_type="genomic DNA"
                     /strain="CIP 78.65"
                     /isolation_source="drinking water"
                     /culture_collection="ATCC:33071"
                     /db_xref="taxon:745277"
                     /plasmid="pRahaq202"
     gene            complement(60..563)
                     /locus_tag="Rahaq2_4994"
                     /note="IMG reference gene:2506712017"
                     /pseudo
                     /db_xref="GeneID:11789752"
     gene            complement(584..1585)
                     /locus_tag="Rahaq2_4995"
                     /note="IMG reference gene:2506712018"
                     /db_xref="GeneID:11789753"
     CDS             complement(584..1585)
                     /locus_tag="Rahaq2_4995"
                     /note="PFAM: Uncharacterized protein conserved in bacteria
                     (DUF2186)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202439.1"
                     /db_xref="GI:383192312"
                     /db_xref="InterPro:IPR019238"
                     /db_xref="GeneID:11789753"
                     /translation="MKPQRLVTKAAENMPYGIRLDYELTEGEGGTDGSATLTTSYGQK
                     THFTLEVKTVHRMETLSGVERRTLTPVNNLPVLLICNRLSPALVDYCSQNRINFIDSA
                     GNARIDVPGLCIMIQGKQEEKKVTAAGGIFPAGVMKLLFVVLSEPDALNKTYRQLAEL
                     SGISLGMVSKAFDVLEQRRHYRKAKSGRRLMDTDGLCAMWIKDYARSLKPRLDLLTVE
                     APKSWDHLPLEPGEYAGGELAAALLSGGYLAPATGIIYTPYSLLERRNKLALKPAREP
                     GLQIMASFWGSLTLNSRAKAMLCLGDLLDGGDDRSREVARIINDQYLNLKDSALFSD"
     misc_feature    complement(623..>1381)
                     /locus_tag="Rahaq2_4995"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2186); Region: DUF2186; cl19875"
                     /db_xref="CDD:268228"
     gene            complement(1582..1749)
                     /locus_tag="Rahaq2_4996"
                     /note="IMG reference gene:2506712019"
                     /db_xref="GeneID:11789754"
     CDS             complement(1582..1749)
                     /locus_tag="Rahaq2_4996"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202440.1"
                     /db_xref="GI:383192313"
                     /db_xref="GeneID:11789754"
                     /translation="MGNNFLFNLITPSRNPAPFFSKQGLNPTITEVHEVFFVHNIFLF
                     MIREQTSGVNK"
     gene            complement(2464..2739)
                     /locus_tag="Rahaq2_4997"
                     /note="IMG reference gene:2506712020"
                     /db_xref="GeneID:11789755"
     CDS             complement(2464..2739)
                     /locus_tag="Rahaq2_4997"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202441.1"
                     /db_xref="GI:383192314"
                     /db_xref="GeneID:11789755"
                     /translation="MALKKPPFSNRRVVTEAEADALANRLADRPYGDEKVVEPAQEIL
                     TRTTISIPQNTLREIEDLALHNKRIGVAPKSVSAIIRDALEAYLKKV"
     misc_feature    complement(<2470..2610)
                     /locus_tag="Rahaq2_4997"
                     /note="Predicted transcriptional regulators containing the
                     CopG/Arc/MetJ DNA-binding domain and a metal-binding
                     domain [Transcription]; Region: NikR; COG0864"
                     /db_xref="CDD:223932"
     gene            complement(2739..3374)
                     /locus_tag="Rahaq2_4998"
                     /note="IMG reference gene:2506712021"
                     /db_xref="GeneID:11789756"
     CDS             complement(2739..3374)
                     /locus_tag="Rahaq2_4998"
                     /note="PFAM: CobQ/CobB/MinD/ParA nucleotide binding
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning ATPase"
                     /protein_id="YP_005202442.1"
                     /db_xref="GI:383192315"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="GeneID:11789756"
                     /translation="MITIIGCNKGGAAKTTTAINLAVGLALRGEDVCLVDADVQRSAS
                     RWYAEREAAGITPSITLIEKRDNISQTLRSLDEKFAHVIVDVAGRNSRELITGGTVAH
                     QIIAPHQCSQLDLDTMVELQQQLESMRDLNPELKAYCYQSMATTNPLLQGNERHEFLE
                     YVREFEGLIPLTATACYRKVYRDVMSEGKSVLETTNEKAKAEVLALMNEVF"
     misc_feature    complement(2742..3374)
                     /locus_tag="Rahaq2_4998"
                     /note="ParA-like protein; Provisional; Region: PHA02518"
                     /db_xref="CDD:222854"
     misc_feature    complement(2967..3368)
                     /locus_tag="Rahaq2_4998"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(3330..3350)
                     /locus_tag="Rahaq2_4998"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(3120..3122,3330..3332))
                     /locus_tag="Rahaq2_4998"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            3595..3970
                     /locus_tag="Rahaq2_4999"
                     /note="IMG reference gene:2506712022"
                     /pseudo
                     /db_xref="GeneID:11789757"
     gene            complement(4092..4499)
                     /locus_tag="Rahaq2_5000"
                     /note="IMG reference gene:2506712023"
                     /db_xref="GeneID:11789758"
     CDS             complement(4092..4499)
                     /locus_tag="Rahaq2_5000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202443.1"
                     /db_xref="GI:383192316"
                     /db_xref="GeneID:11789758"
                     /translation="MVTTEHLDAYLNAMGNRHVEGLEAYMADNVILSSPIVPVPFEGK
                     ELVFQIVSRLLETIDDFELKLLFRDGADFVAVFTIKFGDHIIDGMDHMHLDDMGFIDS
                     MTVAWRPLASVVAVQQKLAPKLGGKPMQLVPLE"
     misc_feature    complement(4212..4481)
                     /locus_tag="Rahaq2_5000"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            4660..5610
                     /locus_tag="Rahaq2_5001"
                     /note="IMG reference gene:2506712024"
                     /db_xref="GeneID:11789759"
     CDS             4660..5610
                     /locus_tag="Rahaq2_5001"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005202444.1"
                     /db_xref="GI:383192317"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789759"
                     /translation="MDSFSALGGLEVFVQTARTRSFAEAGRTLGISASAVSKSISRLE
                     ERVGVRLFQRSTRSVRLTSEGEMFLERCGRIFGEIQAAEDELSAMTQHPRGRLRVGLA
                     LSAGLPLPVLSAFMARYPEIELDLDFTDRLVDVIDEGFDVVIRGNSLRDSRLVSRPLG
                     PYRACLVAAPSYLKEKGMPTKPDDLLNHACLHYRWTPTGKIYQWPLEHTVGTTAISSL
                     PLSMVCNSLDALLYMALAGRGIACVPDFSVRTPVAEGRLKTLLDAYITDANTIHIMWP
                     SNRKMTPKVRVFVDFMHANFCDYLATPMNDPKRKRERYPT"
     misc_feature    4687..5562
                     /locus_tag="Rahaq2_5001"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    4687..4857
                     /locus_tag="Rahaq2_5001"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    4942..5535
                     /locus_tag="Rahaq2_5001"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_7; cd08476"
                     /db_xref="CDD:176165"
     misc_feature    order(4966..4968,4978..4980,5095..5097,5137..5139,
                     5143..5145,5338..5340,5389..5391,5470..5472)
                     /locus_tag="Rahaq2_5001"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176165"
     misc_feature    order(4969..4974,4984..4989,4993..4998,5005..5007,
                     5017..5019,5023..5043,5224..5226,5320..5334,5353..5358,
                     5365..5367)
                     /locus_tag="Rahaq2_5001"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176165"
     gene            complement(6252..7301)
                     /locus_tag="Rahaq2_5002"
                     /note="IMG reference gene:2506712025"
                     /db_xref="GeneID:11789760"
     CDS             complement(6252..7301)
                     /locus_tag="Rahaq2_5002"
                     /note="PFAM: Initiator Replication protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Initiator Replication protein"
                     /protein_id="YP_005202445.1"
                     /db_xref="GI:383192318"
                     /db_xref="InterPro:IPR000525"
                     /db_xref="GeneID:11789760"
                     /translation="MSGNEPKNIEIAKAFAETDKRTGELVTLVPNSNNTVQPVALMRL
                     GLFVPTLKSTARGRKGQMNSMDVTSELKQLSIVKSEGYENIKITGARLDMDNDFKTWV
                     GIIHAFAKHKVLGDSVYLPFVEFAKLCGIPSARSSAKLRARLEASLERIATNTLSFSN
                     KEGDYYVTHLVQSAKYSPKKDVVELQADPKIFELYQFDKKVLLQLRAINELSRKESAQ
                     ALYTFIESLPTDPAPISMSRLRARLNLTSRAITQNATVRKAMEQLKAIGYLDYTEVKR
                     GKAVYFCIHYRRPKLRPAQIPTGIGDDVYDVLDDEHIIDIPAEKDVDSGAPREMVMLT
                     KEELELLEQLRQAKK"
     misc_feature    complement(6786..>6995)
                     /locus_tag="Rahaq2_5002"
                     /note="Exonuclease V - a 5' deoxyribonuclease; Region:
                     Exo5; pfam09810"
                     /db_xref="CDD:255574"
     misc_feature    complement(6462..>6896)
                     /locus_tag="Rahaq2_5002"
                     /note="Initiator Replication protein; Region: Rep_3;
                     pfam01051"
                     /db_xref="CDD:250324"
     gene            complement(8095..8802)
                     /locus_tag="Rahaq2_5003"
                     /note="IMG reference gene:2506712026"
                     /db_xref="GeneID:11789761"
     CDS             complement(8095..8802)
                     /locus_tag="Rahaq2_5003"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, ribosomal protein
                     N-acetylase"
                     /protein_id="YP_005202446.1"
                     /db_xref="GI:383192319"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11789761"
                     /translation="MTELNAYGQTLGKELPDWQPRALPQKIILRGKYCYLEPIDVKHS
                     RDLFDAWHSIDDERDWTYFHIKRPVTIKQCDYYIASLAASKDPLFYAVINISTGKAVG
                     FLALQRMDPDNGSVEIGWINWSPLMKRTFCSTEAIFLLLYYTLETLQYRRCGWKCDSL
                     HEAAISAAERLGFTYEGTLRQTQVSKGHSRDVRWYSIIDSEWDGIRQAMELWLSPSNL
                     DERRKQKHRLAEFMPHL"
     misc_feature    complement(8185..8697)
                     /locus_tag="Rahaq2_5003"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    complement(8200..>8352)
                     /locus_tag="Rahaq2_5003"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            complement(8877..9251)
                     /locus_tag="Rahaq2_5004"
                     /note="IMG reference gene:2506712027"
                     /db_xref="GeneID:11789762"
     CDS             complement(8877..9251)
                     /locus_tag="Rahaq2_5004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202447.1"
                     /db_xref="GI:383192320"
                     /db_xref="GeneID:11789762"
                     /translation="MFNNLAFRNFSIGKKLFSGFIILIILISGMSVYSIYSFKIIQAN
                     AEKTDVVNKIGHLLDIARRNRLLFQQTGDEQAMKANGEAISNMQSLTRKSEDRRCLRP
                     RMVRSMMTGLHFKFSNSGSPQY"
     misc_feature    complement(<8964..9227)
                     /locus_tag="Rahaq2_5004"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     gene            9869..10019
                     /locus_tag="Rahaq2_5005"
                     /note="IMG reference gene:2506712028"
                     /pseudo
                     /db_xref="GeneID:11789644"
     gene            10123..10215
                     /locus_tag="Rahaq2_5006"
                     /note="IMG reference gene:2506712029"
                     /pseudo
                     /db_xref="GeneID:11789645"
     gene            complement(10255..11262)
                     /locus_tag="Rahaq2_5007"
                     /note="IMG reference gene:2506712030"
                     /db_xref="GeneID:11789646"
     CDS             complement(10255..11262)
                     /locus_tag="Rahaq2_5007"
                     /note="PFAM: Bacterial regulatory proteins, lacI family;
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005202448.1"
                     /db_xref="GI:383192321"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11789646"
                     /translation="MASLKDVAKLANVSLMTVSRALNSPERLKPETLSRVQSAIDATN
                     YVPDLSAKKIRGAHAIAKTIGVLALDTVTTPFSVEITLSIEETARAHGWNSFVVNMFS
                     DDSPENIVDLLLSHRPDGIIYTTMGLRQVPLPEKLLNLPCVLANCESLHQQVASYIPD
                     DEHGQYAAVRALLSAGYRRPLCLHLPATHLATVRRRKGLEQACMEAGLAPETLDHYYM
                     EYGDEHYRDIPAVVQAHIYQQKPLFDSVICGNDRIAFMVYQTLLAQGLRIPEDVAIIG
                     YDNMVGIGDLFLPSLSTVQLPHYEIGRLSALHIIEGKSHRDIIKVDSPLLLRQSMNTV
                     K"
     misc_feature    complement(10270..11259)
                     /locus_tag="Rahaq2_5007"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(11095..11250)
                     /locus_tag="Rahaq2_5007"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(11098..11103,11107..11112,11119..11121,
                     11128..11130,11167..11169,11176..11181,11194..11196,
                     11203..11208,11212..11226,11248..11250))
                     /locus_tag="Rahaq2_5007"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(11101..11130)
                     /locus_tag="Rahaq2_5007"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(10273..11076)
                     /locus_tag="Rahaq2_5007"
                     /note="Ligand-binding domain of DNA-binding regulatory
                     proteins specific to sucrose that are members of the
                     LacI-GalR family of bacterial transcription repressors;
                     Region: PBP1_sucrose_transcription_regulator; cd06288"
                     /db_xref="CDD:107283"
     misc_feature    complement(order(10474..10479,10486..10488,10498..10500,
                     10594..10596,10912..10920,10927..10929,10936..10938,
                     10966..10968,10972..10986,11005..11010,11014..11019,
                     11026..11034,11074..11076))
                     /locus_tag="Rahaq2_5007"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107283"
     misc_feature    complement(order(10375..10377,10429..10431,10603..10605,
                     10678..10680,10786..10788,10825..10827,10891..10893,
                     11023..11025,11032..11037))
                     /locus_tag="Rahaq2_5007"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107283"
     gene            11507..12748
                     /locus_tag="Rahaq2_5008"
                     /note="IMG reference gene:2506712031"
                     /db_xref="GeneID:11789647"
     CDS             11507..12748
                     /locus_tag="Rahaq2_5008"
                     /note="PFAM: LacY proton/sugar symporter;
                     TIGRFAM: oligosaccharide:H+ symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="oligosaccharide:H+ symporter"
                     /protein_id="YP_005202449.1"
                     /db_xref="GI:383192322"
                     /db_xref="InterPro:IPR000576"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR022814"
                     /db_xref="GeneID:11789647"
                     /translation="MMKTRHSQSYLILSALLFFFFVTWSSTGSLLSIWLHQEVGLKAG
                     DTGIIFSVVSFSTLFVQICYGFIQDKLGLRKNLLWFITALLIFSGPAYLLFGHLLKIN
                     VFLGSFFGGIYIGLTFNGGIGVLESYTERVARQSQFEFGKARMWGSLGWAVATFFAGL
                     LFNINPKLNFAVASCSGLVFFILLMRLRVSSAPHAMQEAVAGGKVTLEDALRLLTLPR
                     FWALVFFVVGTCIYGVYDQQFPVYFSSQFPTQHEGNAMYGYLNSFQVFLEAAGMFCAP
                     WLVNRLGAKNGLIFAGMVMAMRMVASGLVEGPLLISITKLLHAVELPILLISIFKYNS
                     LNFDKRLSSTLYLVGFACTGSVIATVLSPLAGYSYEKYGFAQSYLFMGLMVFCITFIS
                     IFLLRSGKPSMDPQIPQLSTI"
     misc_feature    11507..12724
                     /locus_tag="Rahaq2_5008"
                     /note="galactoside permease; Reviewed; Region: lacY;
                     PRK09528"
                     /db_xref="CDD:236549"
     misc_feature    11537..12691
                     /locus_tag="Rahaq2_5008"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(11576..11578,11585..11593,11597..11602,11654..11656,
                     11663..11668,11675..11677,11687..11692,11696..11701,
                     11846..11851,11858..11863,11870..11875,11882..11884,
                     11924..11929,11936..11941,11957..11959,12191..12193,
                     12200..12205,12212..12217,12224..12226,12275..12277,
                     12287..12289,12299..12301,12308..12310,12320..12322,
                     12461..12463,12470..12475,12482..12484,12494..12499,
                     12506..12508,12539..12544,12554..12559,12566..12571,
                     12578..12580)
                     /locus_tag="Rahaq2_5008"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            12767..14200
                     /locus_tag="Rahaq2_5009"
                     /note="IMG reference gene:2506712032"
                     /db_xref="GeneID:11789648"
     CDS             12767..14200
                     /locus_tag="Rahaq2_5009"
                     /note="PFAM: Glycosyl hydrolases family 32 C terminal;
                     Glycosyl hydrolases family 32 N-terminal domain;
                     TIGRFAM: sucrose-6-phosphate hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose-6-phosphate hydrolase"
                     /protein_id="YP_005202450.1"
                     /db_xref="GI:383192323"
                     /db_xref="InterPro:IPR008985"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="GeneID:11789648"
                     /translation="MTYTIANAEQELQAKREMLNLRWYPRYHLAARAGWVNDPNGLIW
                     FDGWYHAFYQHHPYSPQWGAMHWGHARSKDLLHWEHLPVALAPEGPEDKDGCFSGSAV
                     VDGDTLALIYTGHKFHGDAGNDENLYQVQCLATSRDGVHFKREGIIIDTPADLHHFRD
                     PKVWREGDSWYMVVGARVGDTGQIRLYRSADLRQWQDEGILDEAQAGMGFMWECPDFF
                     TLNGKRVLMFSPQGIAAQGFENRNLFQSGYLVGDWQPGEPFVRAGEFAEMDHGHDFYA
                     PQSFLTPDGRRIVIGWLNMWESPMPEQQDGWSGMLSLPRELTLTEDNRLQMRPAKEVE
                     ALRQAWFPWPVSTLKNQQTLMADKGEAMEVVLHWDCANSDAEQYGLSLGQGLRVYVDT
                     QMQRLVLERRYPQYGLCGTRSVPLVPGVPLVLRMFIDSSSVEVFVNDGEACLSSRIYP
                     DADRRELSLFAWHGTATLSDAGAWQLE"
     misc_feature    12779..14197
                     /locus_tag="Rahaq2_5009"
                     /note="Beta-fructosidases (levanase/invertase)
                     [Carbohydrate transport and metabolism]; Region: SacC;
                     COG1621"
                     /db_xref="CDD:224536"
     misc_feature    12866..13762
                     /locus_tag="Rahaq2_5009"
                     /note="Glycosyl hydrolase family 32, beta-fructosidases;
                     Region: GH32_B_Fructosidase; cd08996"
                     /db_xref="CDD:185737"
     misc_feature    order(12875..12880,12926..12928,13055..13060,13241..13246,
                     13403..13405)
                     /locus_tag="Rahaq2_5009"
                     /note="substrate binding [chemical binding]; other site"
                     /db_xref="CDD:185737"
     misc_feature    order(12878..12880,13244..13246,13403..13405)
                     /locus_tag="Rahaq2_5009"
                     /note="active site"
                     /db_xref="CDD:185737"
     misc_feature    13883..14086
                     /locus_tag="Rahaq2_5009"
                     /note="Glycosyl hydrolases family 32 C terminal; Region:
                     Glyco_hydro_32C; pfam08244"
                     /db_xref="CDD:254688"
     gene            14323..15675
                     /locus_tag="Rahaq2_5010"
                     /note="IMG reference gene:2506712033"
                     /db_xref="GeneID:11789649"
     CDS             14323..15675
                     /locus_tag="Rahaq2_5010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202451.1"
                     /db_xref="GI:383192324"
                     /db_xref="GeneID:11789649"
                     /translation="MNKIWVGCILTSVCTSVAHAQGTLSLEQRLEQMEQRLKVTEQRA
                     AGAEAEIRALRQEKQLPPVVNNTPAAPAAPALQLTGNGNIKFYGDVEFNMDGASRTGS
                     LTSIKTSTNKNWAPGNKERWDMNGRILLGFDGLRNGVNGKYAGFSVQPLADIKGKMNL
                     DDAAFFFGQQDDWKIKIGRFEAWDMFPLNQDTFIEYSGNTANDLYSDGYGYIYMMKEG
                     RGRSSSGGNFLLSKTLDNWYFELNTLIEDGSSLFVDNNYHGNALDNRKNVVYARPVMA
                     WQSGEWSVAAAVESNLVNNAYGYQNTQGVWVDQSNRTGYGMTMSWNTLKTDAENGAVV
                     NLSTAYLDAADEKDFSAGINALWHRVEVGYIYAHNNIDKFNMAGVAGDCDNDCAILAP
                     GKYDIHTLHTSWHLPDIMDMPNFNIYLGAYASWLETPSVKTGNTDDRYGARVRFKYLF
                     "
     misc_feature    14338..14478
                     /locus_tag="Rahaq2_5010"
                     /note="Maltoporin periplasmic N-terminal extension;
                     Region: Sugarporin_N; pfam11471"
                     /db_xref="CDD:256472"
     gene            15743..16300
                     /locus_tag="Rahaq2_5011"
                     /note="IMG reference gene:2506712034"
                     /db_xref="GeneID:11789650"
     CDS             15743..16300
                     /locus_tag="Rahaq2_5011"
                     /note="PFAM: Maltose acetyltransferase; Bacterial
                     transferase hexapeptide (three repeats)"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_005202452.1"
                     /db_xref="GI:383192325"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="GeneID:11789650"
                     /translation="MTLSIEKQKMIAGELYESGDALLISERRRARQLLHGYNHSSPDD
                     EELRKQWLSELLGSHQGAYIEPTFRCDYGYNIHVGKNFYANFDCVILDVCEVRIGDNC
                     MLAPGVHIYTATHPLDAQMRISGKEFGKPVTIGNNVWIGGRAVINPGVTLGDNVVVAS
                     GAVVTKDVPFNCVVGGNPARIIKRL"
     misc_feature    15749..16297
                     /locus_tag="Rahaq2_5011"
                     /note="maltose O-acetyltransferase; Provisional; Region:
                     PRK10092"
                     /db_xref="CDD:182235"
     misc_feature    15785..16288
                     /locus_tag="Rahaq2_5011"
                     /note="Maltose O-acetyltransferase (MAT) and Galactoside
                     O-acetyltransferase (GAT): MAT and GAT catalyze the
                     CoA-dependent acetylation of the 6-hydroxyl group of their
                     respective sugar substrates. MAT acetylates maltose and
                     glucose exclusively at the C6...; Region: LbH_MAT_GAT;
                     cd03357"
                     /db_xref="CDD:100047"
     misc_feature    order(15794..15796,15821..15823,15953..15955,15989..15991,
                     15995..15997,16013..16015,16019..16021,16049..16051,
                     16055..16057,16073..16075,16079..16081,16085..16087,
                     16091..16093,16112..16117,16121..16123,16157..16159,
                     16163..16168,16181..16183,16217..16222,16229..16231,
                     16235..16240,16265..16276,16280..16282)
                     /locus_tag="Rahaq2_5011"
                     /note="active site"
                     /db_xref="CDD:100047"
     misc_feature    order(15794..15796,15821..15823,15953..15955,15989..15991,
                     15995..15997,16013..16015,16019..16021,16049..16051,
                     16079..16081,16085..16087,16112..16117,16121..16123)
                     /locus_tag="Rahaq2_5011"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100047"
     misc_feature    order(15824..15826,15833..15835,15845..15847,15866..15868,
                     15941..15943,15947..15952,15998..16003,16043..16045,
                     16049..16051,16061..16063,16067..16069,16073..16075,
                     16085..16087,16091..16099,16103..16108,16124..16126,
                     16130..16132,16151..16153,16157..16159,16166..16174,
                     16181..16183,16205..16207,16211..16213,16220..16225,
                     16235..16237,16271..16273)
                     /locus_tag="Rahaq2_5011"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100047"
     misc_feature    order(16073..16075,16079..16081,16085..16087,16091..16093,
                     16157..16159,16163..16168,16181..16183,16217..16222,
                     16235..16240,16265..16270,16274..16276)
                     /locus_tag="Rahaq2_5011"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100047"
     gene            complement(16342..16665)
                     /locus_tag="Rahaq2_5012"
                     /note="IMG reference gene:2506712035"
                     /db_xref="GeneID:11789651"
     CDS             complement(16342..16665)
                     /locus_tag="Rahaq2_5012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202453.1"
                     /db_xref="GI:383192326"
                     /db_xref="GeneID:11789651"
                     /translation="MAPYKNYTVRDRHLPYFSCLMLTGVLIIAPITSARAEAVPPFIH
                     PGLLHTRKDFERMHTKVTQGAQPYIDGWQKLRGNKHASLDWHPNPQAVIYRGNFDRGV
                     TRQNG"
     gene            16980..17867
                     /locus_tag="Rahaq2_5013"
                     /note="IMG reference gene:2506712036"
                     /db_xref="GeneID:11789652"
     CDS             16980..17867
                     /locus_tag="Rahaq2_5013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202454.1"
                     /db_xref="GI:383192327"
                     /db_xref="GeneID:11789652"
                     /translation="MKPYKMVLKKLEYKLKLVRTFFISDLRYRKRKHLEEFRRVPDFE
                     NPQSLNEKINNRMIFERDPFFTMLADKVAVREYVKTKIGEDYLVPLLGCYERAELIDL
                     SELPEQFVLKCSHDSGSAIICKNKHQFDERAAKKKLNAHLNKNMYYVTREWHYKNIKP
                     YIICEKFIDVFGGEPLHLIPEVYRVHCFSGKAHITEADFTDAMNNEYVNVYDPHWKLL
                     PLTMGYNNAPHKITEPIFYRHMITLAEKLAEGIAYCRVDFIANKHQVFFSEITLTPCN
                     GRIQISPVHWDYFLGELWV"
     misc_feature    17130..17864
                     /locus_tag="Rahaq2_5013"
                     /note="TupA-like ATPgrasp; Region: ATPgrasp_TupA;
                     pfam14305"
                     /db_xref="CDD:206473"
     gene            complement(18132..18917)
                     /locus_tag="Rahaq2_5014"
                     /note="IMG reference gene:2506712037"
                     /db_xref="GeneID:11789653"
     CDS             complement(18132..18917)
                     /locus_tag="Rahaq2_5014"
                     /note="PFAM: MltA-interacting protein MipA"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein V"
                     /protein_id="YP_005202455.1"
                     /db_xref="GI:383192328"
                     /db_xref="InterPro:IPR010583"
                     /db_xref="GeneID:11789653"
                     /translation="MISRKLMLQMTCFSLSATVLQAMADNTPPAPTFTVGMGAQSAPR
                     YSGSDQRHWLVAPVIQARDGAFFFDSLKGVGYDLQADNGLYLEHTLGYSLGRTDRNST
                     WRDGSNKLKGMGNIDVTMNTALAVGWSATPWLSFEGKATLPLTDGQGVHYQTSVTVLP
                     LQNDTDTVALQSAALFGDQRYMNTFYGVSREQSNRTDFAPYQSAGGFYGVDSSLTWSH
                     QFTSHWGGVVSADYTWLDDKAGNSPIVVKRGGTTYNFGVLYTF"
     misc_feature    complement(18135..18821)
                     /locus_tag="Rahaq2_5014"
                     /note="MltA-interacting protein MipA; Region: MipA;
                     cl01504"
                     /db_xref="CDD:260968"
     gene            19237..20379
                     /locus_tag="Rahaq2_5015"
                     /note="IMG reference gene:2506712038"
                     /db_xref="GeneID:11789654"
     CDS             19237..20379
                     /locus_tag="Rahaq2_5015"
                     /note="PFAM: HlyD family secretion protein;
                     TIGRFAM: RND family efflux transporter, MFP subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter, MFP subunit"
                     /protein_id="YP_005202456.1"
                     /db_xref="GI:383192329"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:11789654"
                     /translation="MAVTFTDYARHAVRHLSASGRMLPFIPAACLIIVAIVLTGCGEK
                     AHKQAPSVRPVRAIIAPPPVALGSLIQTGEIRPHEEVTLGFRLDGRILTRQAEVGDRV
                     IAGQVLATQESDTSRNQLSSAQADLNSARAAEQVAALNLRRMQLLMPSGAIARTQLDS
                     AQADWQAARAKRQSSEDALKNAQENVSWTKLTAPADGVITQVSASAGQVVSAGQSVIT
                     LASGSIRDAVFDVADPQSVPQQADSQFNVSLLSAPSVVAQGHFRDVSPQADPQTRTWR
                     LRITLDNPPPAMALGASVQLTLNASGPRLIALPASALTRTGNKPAVFVVDEKTLTLHL
                     RPVVVGRYSTSEIFISAGVQPGERVVIAGVSKLREGEKVMPGEESE"
     misc_feature    19450..20355
                     /locus_tag="Rahaq2_5015"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    19804..20109
                     /locus_tag="Rahaq2_5015"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            20454..23450
                     /locus_tag="Rahaq2_5016"
                     /note="IMG reference gene:2506712039"
                     /db_xref="GeneID:11789655"
     CDS             20454..23450
                     /locus_tag="Rahaq2_5016"
                     /note="PFAM: AcrB/AcrD/AcrF family"
                     /codon_start=1
                     /transl_table=11
                     /product="cation/multidrug efflux pump"
                     /protein_id="YP_005202457.1"
                     /db_xref="GI:383192330"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="GeneID:11789655"
                     /translation="MLLLMAAGVISYEKLPRNEDPAFTIKTAVVSASWPGASVEDTVN
                     LVTDTLEKKLQETPYLDFVQSETHAGQSVIFVNLRDDTPPSEVAGIWYQVRKKMQDIA
                     PSLPAGVQGPAVNDEFDDTFGTIYGFTAEGFTPRELRDRVDDISRSLMSLPDMGKINL
                     LGVQEENIVLAFSPAQLAGMGLDLQQITDALKAQNAVEPSGVLRSDRENIALRVSGAL
                     TSEQSLRAVTLHIAGRYIPLTDIATISRQDAEPASPAFRVNGQPAIGLAISMASTGNM
                     LSFGKALNDRMAMIAGQLPHGIEMVKVADQSAVVSQAVSGFIRVLIEAVVIVLAVSFV
                     SLGTRAGLVVAAAIPIVLAMTFIGMMLAGIGLQRISLGALIIALGLLVDDAMITVEAM
                     VSRIEAGDSKWRAATYAFETTAFPMLTGTLVMIAGFIPVGFAASSAGEYCYSLFAVVL
                     IALLCSWVVAILFSPLIGTWLLPEKLASHAEKQGRLMRFYQRLLNQVLQRRVATLSIA
                     CLLLGLAAYATTFMQGEFFPASDRPELLVSLTLPGNASQSDTARQAERLEHALKNNPN
                     IDHFSTYVGSGAVRFYLPMDVLLNDENTAQLVIVAKSLEDRDKLRAQLETVLARDFSD
                     ITTRVSPLELGPPVGWPVKYRVSGPDYAKVRQIAQQLASVLGNSPETREVNLTAGEPE
                     RVITLQVNQTAARAAGVSSESLATLLNTVWSGSVVTTVRDKNRLIDVVLRGNKRERQD
                     LTTLSGLMITTANGQKIPLSQVATPVWGIDDPVIWRRQRLPFITVQTDLAAGLRAEAV
                     SQQLSPLVSRIRASLPPEYTIEEGGVVAESDKGNSSVFAVLPVTLFVMLILLMVQLQR
                     FSRMLLALFMAPFGLIGIVLAMLPTGTPMGFVALLGIIALAGMIIRNAVILISEVDNN
                     VREGLDRDDAIKAAAQHRSRPILLTACAAILGMIPIAEQVFWGPMAYAIIGGLIVATF
                     ITLTVLPASLSIIMQFEKNSDNAKLH"
     misc_feature    20454..23417
                     /locus_tag="Rahaq2_5016"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     misc_feature    <22881..23408
                     /locus_tag="Rahaq2_5016"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(23631..23798)
                     /locus_tag="Rahaq2_5017"
                     /note="IMG reference gene:2506712040"
                     /db_xref="GeneID:11789656"
     CDS             complement(23631..23798)
                     /locus_tag="Rahaq2_5017"
                     /note="PFAM: Stress-induced bacterial acidophilic repeat
                     motif"
                     /codon_start=1
                     /transl_table=11
                     /product="stress-induced acidophilic repeat
                     motif-containing protein"
                     /protein_id="YP_005202458.1"
                     /db_xref="GI:383192331"
                     /db_xref="InterPro:IPR019626"
                     /db_xref="GeneID:11789656"
                     /translation="MAEHRGGSGNFAEDHEKASEAGKKGGQKSGGNFANDRERASEAG
                     KKGGQHSHDND"
     misc_feature    complement(23643..23798)
                     /locus_tag="Rahaq2_5017"
                     /note="General stress protein [General function prediction
                     only]; Region: GsiB; COG3729"
                     /db_xref="CDD:226252"
     gene            24142..24630
                     /locus_tag="Rahaq2_5018"
                     /note="IMG reference gene:2506712041"
                     /db_xref="GeneID:11789657"
     CDS             24142..24630
                     /locus_tag="Rahaq2_5018"
                     /note="PFAM: Domain of unknown function (DUF892)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202459.1"
                     /db_xref="GI:383192332"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR010287"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="GeneID:11789657"
                     /translation="MAITTLKDLFIHDLSDVYSAERQITKALPKMARAATDPKLAEAF
                     KLHLEETQGQIERLDQVVESNDDLRIKRMKCHALEGLVAEAQELIDSVEKGEVLDAGL
                     IGAAQKVEHYEIATYGTLVAMAKKLGYTDAAKLLHETLEEEKSTDEKLTVLAESGQAS
                     KG"
     misc_feature    24160..24603
                     /locus_tag="Rahaq2_5018"
                     /note="YciF bacterial stress response protein,
                     ferritin-like iron-binding domain; Region: YciF; cd07909"
                     /db_xref="CDD:153118"
     misc_feature    order(24175..24177,24187..24189,24364..24372,24379..24381,
                     24391..24393,24406..24408,24451..24456,24460..24462,
                     24475..24477,24487..24489,24496..24498)
                     /locus_tag="Rahaq2_5018"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153118"
     misc_feature    order(24202..24204,24280..24282,24292..24294,24301..24303,
                     24469..24471,24478..24480,24490..24492,24568..24570)
                     /locus_tag="Rahaq2_5018"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153118"
     gene            24693..25208
                     /locus_tag="Rahaq2_5019"
                     /note="IMG reference gene:2506712042"
                     /db_xref="GeneID:11789658"
     CDS             24693..25208
                     /locus_tag="Rahaq2_5019"
                     /note="PFAM: Domain of unknown function (DUF892)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202460.1"
                     /db_xref="GI:383192333"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR010287"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="GeneID:11789658"
                     /translation="MATSEAYENYIDWVRDAHAMEQQAETMLTKMADRLEHYPVLQQR
                     IKQHITETQGQQRLVEGVLKSLDTSRSVLKDTAGKMSAMGQAFGGMFASDEVIKGGIS
                     GYVFEHFEIASYSALIAAAEHVGDLEGARVFREIKIQEEEMAKWLAEHMPDLTKQFLS
                     REEDPDAEAKR"
     misc_feature    24714..25181
                     /locus_tag="Rahaq2_5019"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3685"
                     /db_xref="CDD:226210"
     gene            complement(25284..25793)
                     /locus_tag="Rahaq2_5020"
                     /note="IMG reference gene:2506712043"
                     /db_xref="GeneID:11789659"
     CDS             complement(25284..25793)
                     /locus_tag="Rahaq2_5020"
                     /note="PFAM: Competence-damaged protein;
                     TIGRFAM: competence/damage-inducible protein CinA
                     C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="competence/damage-inducible protein CinA-like
                     protein"
                     /protein_id="YP_005202461.1"
                     /db_xref="GI:383192334"
                     /db_xref="InterPro:IPR008136"
                     /db_xref="GeneID:11789659"
                     /translation="MDETLLNAAKRAVQSLKKRNLTLSSAESCTAGMISMALCAASDD
                     GVPYASGFITYDDRAKNQLLHVSADTLTKFTAVSAETVKEMAQGACEVAGTDTGVSVS
                     GYAGPEGGKDGTPAGTVWFGWYLGPGSQQQEVRHFDGDCEAVILQASIFALERLASQV
                     EELPDKFSK"
     misc_feature    complement(25326..25790)
                     /locus_tag="Rahaq2_5020"
                     /note="Competence-damaged protein; Region: CinA;
                     pfam02464"
                     /db_xref="CDD:251312"
     gene            complement(25849..26022)
                     /locus_tag="Rahaq2_5021"
                     /note="IMG reference gene:2506712044"
                     /pseudo
                     /db_xref="GeneID:11789660"
     gene            26338..26601
                     /locus_tag="Rahaq2_5022"
                     /note="IMG reference gene:2506712045"
                     /db_xref="GeneID:11789661"
     CDS             26338..26601
                     /locus_tag="Rahaq2_5022"
                     /note="PFAM: Sodium/hydrogen exchanger family"
                     /codon_start=1
                     /transl_table=11
                     /product="Sodium/hydrogen exchanger family"
                     /protein_id="YP_005202462.1"
                     /db_xref="GI:383192335"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="GeneID:11789661"
                     /translation="MNFLGWMTATGILLLIMSMLTGWLNRTPVPMFGLYLVVGIACGQ
                     WGLGLVNPDIFSHTTMISRATEIAMAASLFTAKVIQRTVRDII"
     gene            26618..28246
                     /locus_tag="Rahaq2_5023"
                     /note="IMG reference gene:2506712046"
                     /db_xref="GeneID:11789662"
     CDS             26618..28246
                     /locus_tag="Rahaq2_5023"
                     /note="PFAM: Alpha amylase, catalytic domain;
                     TIGRFAM: trehalose synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosidase"
                     /protein_id="YP_005202463.1"
                     /db_xref="GI:383192336"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11789662"
                     /translation="MNSDWYKKAIIYQVDTAYFFDANNDGIGDISGILKHLDYIRGLG
                     ANALWLTPFYLTPFRDDGYDVKDHLTVDPRFGDIADMVMLLEQAEEMGLRVIVELVLQ
                     HTSSEHRWFQEARKDRHSPYRNYYIWADEPPENDDPPMFPGVEKSVWSWDEEAQQYYR
                     HMFYHDEPDLNLACPDLINEIERVIMYWLRLGVSGFRLDAASHMIKQAGKGDVKKGLS
                     LLNHLRDFIAVRHPETILLGEVDVPPQHYNDYFGNNDRLHMLLSFSINKHMFLSFAHK
                     DARPLVKALKEIPAPPSRACLTHWLRNHDELDLGDLSPAERRDVIKEFGPAENMQIYQ
                     RGLRRRLASMFENDIARIAMAYSVLFSLPGTPVIRYGDEIGMSENLSLNERNAIRTPM
                     QWDTTRNAGFSQADRDNLIAPVNVRGPGRYWRVNVSKSQIEDHSLLHLVSKMTRTRLG
                     CKEIGSGTYRIIDLKIPSLFAIRYDYDGEALLMMTNLSDKKVQVELNEPETMMLTELL
                     ADKEYARSGMLKASARFPVNGYGYRWFSVKHIDG"
     misc_feature    26630..28231
                     /locus_tag="Rahaq2_5023"
                     /note="trehalose synthase; Region: treS_nterm; TIGR02456"
                     /db_xref="CDD:233874"
     misc_feature    26630..27961
                     /locus_tag="Rahaq2_5023"
                     /note="Alpha amylase catalytic domain found in Trehalose
                     synthetase; Region: AmyAc_TreS; cd11334"
                     /db_xref="CDD:200473"
     misc_feature    order(27206..27208,27212..27217,27332..27334,27527..27532)
                     /locus_tag="Rahaq2_5023"
                     /note="active site"
                     /db_xref="CDD:200473"
     misc_feature    order(27212..27214,27332..27334,27530..27532)
                     /locus_tag="Rahaq2_5023"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200473"
     gene            complement(28269..29235)
                     /locus_tag="Rahaq2_5024"
                     /note="IMG reference gene:2506712047"
                     /db_xref="GeneID:11789663"
     CDS             complement(join(28269..29096,29095..29235))
                     /locus_tag="Rahaq2_5024"
                     /artificial_location="low-quality sequence region"
                     /note="PFAM: short chain dehydrogenase;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain alcohol dehydrogenase"
                     /protein_id="YP_005202464.1"
                     /db_xref="GI:383192337"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11789663"
                     /translation="MVTGGTAGVGRATALCFAQHGYDVAVIARSQKGLTATIKEIESA
                     GVRGMSADVADTRQMEEAATQIVNALGPVNVWINAAMCTVISPFAEMSPSEYQRVTDV
                     TYHGVINGTREALKIMSSQNVGHIIQIGSALAYRSVPLQSAYCGAKAAIRGFTDALRS
                     ELIHSRSNIRLTMVHLPAVNTPQFEWSRNKLPRATRPVAPVYQPEAIAEAVYKASLLA
                     PRELWVGLSTVQSIIGNIFVPGWLDKLMSKKAWDGQMQAELQPINAADNLYIPVEGHH
                     RSKGNFNSEAKDKVIAIDPARSGKVALTMLSAITCAILWRKRFRKH"
     misc_feature    complement(join(28278..29096,29095..29235))
                     /locus_tag="Rahaq2_5024"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK07109"
                     /db_xref="CDD:235935"
     misc_feature    complement(join(28554..29096,29095..29232))
                     /locus_tag="Rahaq2_5024"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(28701..28712,28794..28796,28806..28808,
                     28845..28853,28995..29003,29146..29154,29209..29211,
                     29215..29220,29224..29226))
                     /locus_tag="Rahaq2_5024"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(28794..28796,28806..28808,28845..28847,
                     28929..28931))
                     /locus_tag="Rahaq2_5024"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(29320..30225)
                     /locus_tag="Rahaq2_5025"
                     /note="IMG reference gene:2506712048"
                     /db_xref="GeneID:11789664"
     CDS             complement(29320..30225)
                     /locus_tag="Rahaq2_5025"
                     /note="PFAM: Manganese containing catalase"
                     /codon_start=1
                     /transl_table=11
                     /product="Mn-containing catalase"
                     /protein_id="YP_005202465.1"
                     /db_xref="GI:383192338"
                     /db_xref="InterPro:IPR007760"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="GeneID:11789664"
                     /translation="MFKHIKQLQYTVRVAGPNPGLANLLLEQFGGPQGELAAACRYFT
                     QGIGEDDAGRKDLLLDIATEELSHLEIIGTIVGMLNKGAKGELAEGTEKEAELYRSLT
                     GGGNDSHITSLLYGGGPALVNSAGVPWSAAYIDTIGEPTADLRSNIAAEARAKIVYER
                     LINVTDDPGIKDALSFLMTREVAHQQSFEKALYAIQDNFPPGKLPPLPQFSQVYYNMS
                     EGGTVRGSWNSDKTFEYVDQPQPAVDGGTGEASVSLDAAQQSQLDAMKARTTSDPSIN
                     PVTGAELGSTGPIENTKPDIIKPKT"
     misc_feature    complement(29638..30225)
                     /locus_tag="Rahaq2_5025"
                     /note="Manganese catalase, ferritin-like diiron-binding
                     domain; Region: Mn_catalase; cd01051"
                     /db_xref="CDD:153110"
     misc_feature    complement(order(29674..29676,29773..29775,30022..30024,
                     30031..30033,30121..30123))
                     /locus_tag="Rahaq2_5025"
                     /note="dimanganese center [ion binding]; other site"
                     /db_xref="CDD:153110"
     gene            complement(30380..30751)
                     /locus_tag="Rahaq2_5026"
                     /note="IMG reference gene:2506712049"
                     /db_xref="GeneID:11789665"
     CDS             complement(30380..30751)
                     /locus_tag="Rahaq2_5026"
                     /note="PFAM: Fic/DOC family;
                     TIGRFAM: death-on-curing family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="death-on-curing family protein"
                     /protein_id="YP_005202466.1"
                     /db_xref="GI:383192339"
                     /db_xref="InterPro:IPR003812"
                     /db_xref="GeneID:11789665"
                     /translation="MIYFLSSKDIISIHERMIAAYGGLAGYADPGRIDSMATRILNRH
                     IYEGENDIYVLAAAYLLAIARGHCFNDANKRTAFASTVLFLRRNGISLRFSPDHEELT
                     VAAAQGSLDVWHIAETLKQSI"
     misc_feature    complement(30392..30751)
                     /locus_tag="Rahaq2_5026"
                     /note="Fic/DOC family; Region: Fic; cl00960"
                     /db_xref="CDD:260722"
     gene            complement(30748..30969)
                     /locus_tag="Rahaq2_5027"
                     /note="IMG reference gene:2506712050"
                     /db_xref="GeneID:11789666"
     CDS             complement(30748..30969)
                     /locus_tag="Rahaq2_5027"
                     /note="PFAM: Phd_YefM;
                     TIGRFAM: prevent-host-death family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="YP_005202467.1"
                     /db_xref="GI:383192340"
                     /db_xref="InterPro:IPR006442"
                     /db_xref="GeneID:11789666"
                     /translation="MQAINFTTARNELAAVLDGVTGGEPIMITRRSAKPVIIIDAEQY
                     EKMQKIQAESDFDWLFTEHGQTLEALKNR"
     misc_feature    complement(<30811..30969)
                     /locus_tag="Rahaq2_5027"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; pfam02604"
                     /db_xref="CDD:251410"
     gene            31093..31761
                     /locus_tag="Rahaq2_5028"
                     /note="IMG reference gene:2506712051"
                     /db_xref="GeneID:11789667"
     CDS             31093..31761
                     /locus_tag="Rahaq2_5028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202468.1"
                     /db_xref="GI:383192341"
                     /db_xref="GeneID:11789667"
                     /translation="MFSKAQRVAFPALVIAVFLLTGCPPAAEFTQWERPSTTEEGVKA
                     AMTQCGDPVGYTLNNLPRNEQALQFLCMQRLGFTRKDGFDFCEVMGKLPACVEKKQGH
                     PLSQSQLEALPFEADEGFYPIKPDSSRYEDMQVTWRKVGAPGGGLSTQVANDREALPV
                     MYACGYPKPLGSNLAVASIGRTAKAQRCMIDHGFEPKNKMMLVCRPYPQVTGCERAVK
                     SSPL"
     gene            complement(32009..33409)
                     /locus_tag="Rahaq2_5029"
                     /note="IMG reference gene:2506712052"
                     /db_xref="GeneID:11789668"
     CDS             complement(32009..33409)
                     /locus_tag="Rahaq2_5029"
                     /note="PFAM: Amino acid permease"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="YP_005202469.1"
                     /db_xref="GI:383192342"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="GeneID:11789668"
                     /translation="MSNINGLRKNSLGLFSLVFFVVAAASPLTGVIGGLPVAIFTGNG
                     GGVPAVYIMACIILMLFSVGYIAMSRYVNDAGAFYTYISKGLGENWGASASVLALIAY
                     LSIQIAIISMLGFFSQEFLAQHLALHIPWWALSMLFTIIAWIFGIKRVEVGGKLLGVL
                     MIAEVAIVLLTDVSLLIKKPGPLNFSSFDPAVFSHGNLGIAFIFCIASFIGFESTAIY
                     AEECRDPHKTVPRATLCALLMITVFFGFTSWSLVQAYSFDQIVEIARKDPGNFIFDIT
                     REYVGQWAVETMSVLLITSLFAAALAFHNNISRYIFSISRDGLIWKELCQTHPANGTP
                     HKASHAHSVILLLLLMGMGGTNMDPLVQIFAFGSAIATLSILILQVGVSAAVIRFFRR
                     VGKHNHSAWQVLWAPMGALITMSVTIIMAINNLQLLTGGGDAKLVEFIPWFLVVCAGA
                     GYLLSARRKMHAVKSK"
     misc_feature    complement(32072..33409)
                     /locus_tag="Rahaq2_5029"
                     /note="Amino acid transporters [Amino acid transport and
                     metabolism]; Region: PotE; COG0531"
                     /db_xref="CDD:223605"
     misc_feature    complement(<32408..>32857)
                     /locus_tag="Rahaq2_5029"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     gene            complement(33549..34364)
                     /locus_tag="Rahaq2_5030"
                     /note="IMG reference gene:2506712053"
                     /db_xref="GeneID:11789669"
     CDS             complement(33549..34364)
                     /locus_tag="Rahaq2_5030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202470.1"
                     /db_xref="GI:383192343"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="GeneID:11789669"
                     /translation="MSCTNIINPEQPWFVLSAARQYSLMNAENSAISHFYSFEVSPSA
                     PLTLAVPDGCVDIVFDCDTIHPMARVCGTTLEARSAKLIPNHRYFGVRFAPGVIPDFL
                     DVMAEDLTDREFNFLDVVPDARPACEQILRTELFAQQITLFNNYFTPRLARKTSTVTA
                     SIIRTILQQKGNFRVGQLEALTGYTCRTIQRQFRQDTGMSPKAFGRIMRCQSALNSLH
                     QGASVSFSELALNLGFSDQSHFLREFKKLISTTPLDFQRRMLLAAHAERISYH"
     misc_feature    complement(33591..33833)
                     /locus_tag="Rahaq2_5030"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     gene            34543..35682
                     /locus_tag="Rahaq2_5031"
                     /note="IMG reference gene:2506712054"
                     /db_xref="GeneID:11789670"
     CDS             34543..35682
                     /locus_tag="Rahaq2_5031"
                     /note="PFAM: Ornithine cyclodeaminase/mu-crystallin
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ornithine cyclodeaminase,
                     mu-crystallin"
                     /protein_id="YP_005202471.1"
                     /db_xref="GI:383192344"
                     /db_xref="InterPro:IPR003462"
                     /db_xref="GeneID:11789670"
                     /translation="MSDAAKIDFIYLSEQDMIRAGVTDMTACVDTMEKMFALLYQGDY
                     RMAGANNDSHGAMVTFPNDSPFPNMPKPTADRRFMAMPAYLGGDFCTAGMKWYGSNIA
                     NRQKGLPRSILMFTLNDADTGAPLAYMSANLLSAYRTGAVPGVGARHLARRDAQVIGL
                     LGPGVMGKTTVAAFMAVCPQINTIKVKGRGQKNLDSFIVWARNTFPQITNIQAVDSLE
                     QVVRDSDIVTYCSSGEVGDPATYPLVKREWVKPGAFLAMPALCNLDEGMEQPDVRKVL
                     DNTGLYHAWYEEVPKPAHHTIPVIGVRFMDMLAAGKLSADQLEDIGKIVAGDAPGRQS
                     DDEIIIMSVGGMPVEDVAWGTVVYRNALEKGIGLKLNLWDAPVLF"
     misc_feature    34543..35676
                     /locus_tag="Rahaq2_5031"
                     /note="ornithine cyclodeaminase; Validated; Region:
                     PRK06199"
                     /db_xref="CDD:235738"
     misc_feature    34573..35661
                     /locus_tag="Rahaq2_5031"
                     /note="Predicted ornithine cyclodeaminase, mu-crystallin
                     homolog [Amino acid transport and metabolism]; Region:
                     COG2423"
                     /db_xref="CDD:225280"
     gene            35736..36158
                     /locus_tag="Rahaq2_5032"
                     /note="IMG reference gene:2506712055"
                     /db_xref="GeneID:11789671"
     CDS             35736..36158
                     /locus_tag="Rahaq2_5032"
                     /note="PFAM: Endoribonuclease L-PSP"
                     /codon_start=1
                     /transl_table=11
                     /product="putative translation initiation inhibitor, yjgF
                     family"
                     /protein_id="YP_005202472.1"
                     /db_xref="GI:383192345"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="GeneID:11789671"
                     /translation="MTQITKVKTGSKFEERGSYSRIVAVDNWIFVSNTAGRDPRSNEI
                     PDDVTEQTLQVFANIEMALAAVDATLSDVVFSRVYIQDPKDVASVMEIIGAKFRGINP
                     ATTVTCPPLGSTVYKVELEVTAWRGAGKAEVEEITVGS"
     misc_feature    35754..36107
                     /locus_tag="Rahaq2_5032"
                     /note="This group of proteins belong to a large family of
                     YjgF/YER057c/UK114-like proteins present in bacteria,
                     archaea, and eukaryotes with no definitive function.  The
                     conserved domain is similar in structure to chorismate
                     mutase but there is no sequence...; Region:
                     YjgF_YER057c_UK114_like_6; cd06154"
                     /db_xref="CDD:100011"
     misc_feature    order(35790..35795,35802..35804,35808..35810,35817..35819,
                     35823..35825,35829..35834,35949..35951,35955..35960,
                     35964..35966,35970..35972,36003..36005,36012..36014,
                     36024..36026,36036..36050,36051..36059,36090..36092,
                     36096..36098,36102..36104)
                     /locus_tag="Rahaq2_5032"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100011"
     misc_feature    order(35790..35792,35991..35993,36003..36005,36045..36047,
                     36090..36092)
                     /locus_tag="Rahaq2_5032"
                     /note="putative active site [active]"
                     /db_xref="CDD:100011"
     gene            36212..37504
                     /locus_tag="Rahaq2_5033"
                     /note="IMG reference gene:2506712056"
                     /db_xref="GeneID:11789672"
     CDS             36212..37504
                     /locus_tag="Rahaq2_5033"
                     /note="PFAM: FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/D-amino acid oxidase, deaminating"
                     /protein_id="YP_005202473.1"
                     /db_xref="GI:383192346"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:11789672"
                     /translation="MAPAITPVQTSATFPAATTVVVIGGGIVGLTAALALAERKIPVV
                     LLEKGAIAGEQSSRNLGWVRKTSRLAEDIPLALASDRLWAMMPHRLGSDVGYRQAGIM
                     FVARTQAQMALYEGWLKSVAHLSLDSRLLSRHEIAAMVPGGRGQWAGGIYTPSDGRAE
                     PTLAASAIAKAAIARGAFIVENCAVRSLTLSAGKVSGVVTERGEIRCDQVLLAGGLWS
                     RRFLGNHGVSLPTLPLICSVLRTRPMAGPTDIAVGAPDFSFRKHQDGGFIITQRGALD
                     ASLVPDHLLLGLRYLPQLRAQRDNLRISLGKNFLHDLTLARHWGAKSITPFEKVRMMD
                     PPANRALNQEAMDNLMAAWPAFAKAEIADTWAGAIDVTPDSNPVIGPVTRIPGLTVAT
                     GFSGHGFGTSPAAGQLAADLVSGCQPIIDPAPYRFERF"
     misc_feature    36299..37501
                     /locus_tag="Rahaq2_5033"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     misc_feature    36317..37456
                     /locus_tag="Rahaq2_5033"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(37666..37884)
                     /locus_tag="Rahaq2_5034"
                     /note="IMG reference gene:2506712057"
                     /pseudo
                     /db_xref="GeneID:11789673"
     gene            complement(37994..39241)
                     /locus_tag="Rahaq2_5035"
                     /note="IMG reference gene:2506712058"
                     /db_xref="GeneID:11789674"
     CDS             complement(37994..39241)
                     /locus_tag="Rahaq2_5035"
                     /note="PFAM: Levansucrase/Invertase"
                     /codon_start=1
                     /transl_table=11
                     /product="Levansucrase/Invertase"
                     /protein_id="YP_005202474.1"
                     /db_xref="GI:383192347"
                     /db_xref="InterPro:IPR003469"
                     /db_xref="GeneID:11789674"
                     /translation="MTNLNYTPTIWTRADALKVNENDPTTTQPIVDADFPVMSDEVFI
                     WDTMPLRSLDGTVVSVDGWSVIFTLTAQRNNNNSEYLDAEGNYDITSDWNNRHGRARI
                     CYWYSRTGKDWIFGGRVMAEGVSPTSREWAGTPILLNEDGDIDLYYTCVTPGATIAKV
                     RGKVLTSEEGVTLAGFNEVKSLFSADGVYYQTESQNPYWNFRDPSPFIDPHDGKLYMV
                     FEGNVAGERGSHVIGKQEMGTLPPGHRDVGNARYQAGCIGMAVAKDLSGDEWEILPPL
                     VTAVGVNDQTERPHFVFQDGKYYLFTISHKFTYADGLTGPDGVYGFLSDNLTGPYSPM
                     NGSGLVLGNPPSQPFQTYSHCVMPNGLVTSFIDNVPTSDGNYRIGGTEAPTVKIVLKG
                     NRSFVERVFDYGYIPPMKNIILN"
     misc_feature    complement(38051..39112)
                     /locus_tag="Rahaq2_5035"
                     /note="Glycosyl hydrolase family 68, includes
                     levansucrase, beta-fructofuranosidase and inulosucrase;
                     Region: GH68; cd08997"
                     /db_xref="CDD:185738"
     misc_feature    complement(order(38381..38383,38633..38635,39104..39106))
                     /locus_tag="Rahaq2_5035"
                     /note="active site"
                     /db_xref="CDD:185738"
     gene            39882..40094
                     /locus_tag="Rahaq2_5036"
                     /note="IMG reference gene:2506712059"
                     /db_xref="GeneID:11789675"
     CDS             39882..40094
                     /locus_tag="Rahaq2_5036"
                     /note="PFAM: Ogr/Delta-like zinc finger"
                     /codon_start=1
                     /transl_table=11
                     /product="Ogr/Delta-like zinc finger"
                     /protein_id="YP_005202475.1"
                     /db_xref="GI:383192348"
                     /db_xref="InterPro:IPR007684"
                     /db_xref="GeneID:11789675"
                     /translation="MMRCPLCNHSAHIRTSRYLSQQTKESYYQCQNIECSCTFKTIET
                     VSKILCSPTFEKTEGAGCNQEESYLK"
     misc_feature    39882..>40037
                     /locus_tag="Rahaq2_5036"
                     /note="Ogr/Delta-like zinc finger; Region: Ogr_Delta;
                     cl19592"
                     /db_xref="CDD:267945"
     gene            complement(40613..41503)
                     /locus_tag="Rahaq2_5037"
                     /note="IMG reference gene:2506712060"
                     /db_xref="GeneID:11789676"
     CDS             complement(40613..41503)
                     /locus_tag="Rahaq2_5037"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005202476.1"
                     /db_xref="GI:383192349"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789676"
                     /translation="MDRFHELNAFIAVVEAGGFTAAARRTGDSQSAISKAIGALERRL
                     GVALFNRSTRSVTLTDQGQRYYERAKPLLDEMDDADSELTSSTHNVSGLIRIAASGTF
                     GRLHILPLIPDLLSLNPGLQVDLILSDFVRNMVEDGIDLAIRVGPVNDPDAIVRRVAS
                     TPLVCVGSRRYFEQRGMPKTPAELVDHNCLVYRGLAEPTQWSFVGPEGQFSVSVHGNL
                     TSNSVETIRAGVLAGVGIGRFAKVSLADDLRHPDVLTVLDEFTGDARDISLVWPRRRF
                     VPARVRRITDFFAEAIPQRI"
     misc_feature    complement(40619..41497)
                     /locus_tag="Rahaq2_5037"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(41315..41494)
                     /locus_tag="Rahaq2_5037"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(40643..41230)
                     /locus_tag="Rahaq2_5037"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(40703..40705,40784..40786,40835..40837,
                     41021..41023,41027..41029,41069..41071,41186..41188,
                     41198..41200))
                     /locus_tag="Rahaq2_5037"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(40808..40810,40817..40822,40841..40855,
                     40940..40942,41123..41143,41147..41149,41159..41161,
                     41168..41173,41177..41182,41192..41197))
                     /locus_tag="Rahaq2_5037"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            41608..42402
                     /locus_tag="Rahaq2_5038"
                     /note="IMG reference gene:2506712061"
                     /db_xref="GeneID:11789677"
     CDS             41608..42402
                     /locus_tag="Rahaq2_5038"
                     /note="PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005202477.1"
                     /db_xref="GI:383192350"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11789677"
                     /translation="MNIDLTGRKAVVTGSTAGIGRAIAEGLARAGAAVVINGRGKERV
                     DAVLRELRELYPKGEFTGVSADLATPEGAAELFARVPDADILVNNVGTGRMKPFFEIG
                     DSEWTDLFELNVMSGIRASRHYVPNMMKRGWGRVVFISSESALAIPVDLIDYAMTKTA
                     QLAISRGLAEVVGGTGVTVNAVLPGPTNSEIMGGWMKAAAEAQGITQEEAEQQFLNTT
                     RPTTLIKRFATTEEVANLVIYVCSEQASATTGTSLRVDGGVVRTIA"
     misc_feature    41614..42387
                     /locus_tag="Rahaq2_5038"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    41626..42390
                     /locus_tag="Rahaq2_5038"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(41647..41649,41653..41658,41662..41664,41719..41727,
                     41872..41880,42022..42030,42067..42069,42079..42081,
                     42157..42168)
                     /locus_tag="Rahaq2_5038"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(41944..41946,42028..42030,42067..42069,42079..42081)
                     /locus_tag="Rahaq2_5038"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(42479..43588)
                     /locus_tag="Rahaq2_5039"
                     /note="IMG reference gene:2506712062"
                     /db_xref="GeneID:11789678"
     CDS             complement(42479..43588)
                     /locus_tag="Rahaq2_5039"
                     /note="PFAM: Epoxide hydrolase N terminus"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="YP_005202478.1"
                     /db_xref="GI:383192351"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="InterPro:IPR010497"
                     /db_xref="InterPro:IPR016292"
                     /db_xref="GeneID:11789678"
                     /translation="MQTFRINVPEDTLIDLSSRLKQTRWPCEVKGQGWLQGTDLTFLQ
                     RLCTYWAESFDWRSAEARLNELPQFRTIVSGTGLYVIHARAERKNAVPLLLCNGWPSS
                     VFEYVDVIPRLTAAGFDVIAPAMPGYGFSDKPEAPGMNGTRIASLYATLMHNLGYNKF
                     FAHGSDLGSHIVDMMRRNHPERLLGIHMSNVRSDYPRPDDASPEEQAFLEQAQRWMFE
                     EGAYAMIQRTRPQSLAYGLNDSPAGLAGWIIEKFQAWSDGDIEQVYGLDAICANLTLY
                     WITETACSSVRLYSEVARDHEMQTSPERGNVPAGVIMFPADNLPAPRVWGERWLNIIH
                     WTEAPHGGHFAAWEAPDIFVNDICEFARKVLPARE"
     misc_feature    complement(43259..43579)
                     /locus_tag="Rahaq2_5039"
                     /note="Epoxide hydrolase N terminus; Region: EHN;
                     pfam06441"
                     /db_xref="CDD:253733"
     misc_feature    complement(42497..43348)
                     /locus_tag="Rahaq2_5039"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     gene            complement(43640..45202)
                     /locus_tag="Rahaq2_5040"
                     /note="IMG reference gene:2506712063"
                     /db_xref="GeneID:11789679"
     CDS             complement(43640..45202)
                     /locus_tag="Rahaq2_5040"
                     /note="PFAM: Cache domain; GGDEF domain;
                     TIGRFAM: diguanylate cyclase (GGDEF) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase domain-containing protein"
                     /protein_id="YP_005202479.1"
                     /db_xref="GI:383192352"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="GeneID:11789679"
                     /translation="MNASSNDSDRYLIRLSGMKRPVTTLVILATALVCLLLLVLAGAF
                     ISASRTAQLGDAEVANTNIARMIAVQMESTLKTASVALTDLSERLEVDGTGAHELDRL
                     QAHLVETAKANSELHGLFAYGADGTWLATSLNRPVKGNNADREYFTYHRANRSLAVHV
                     GPPIKSRSTGVWIIPVSRRINLPDGSFGGVVLVTLKINFFERIYNEIDIGKTGTVLLA
                     LTDGTLVYRRPFEEKLIGTDISKGPVLQALSTHYAGSSTLVSKIDRIERLYSYRHVDG
                     YPFIVAVGRTKTELLSQWQRSSFFLGGTVLVICAMFISLASKLVRQIGIRDTLAQKLH
                     DRSEGLEQYNIGLQVLANTDKLTSIANRLMFDKILDQELKRAQRGDDCLSLILLDVDL
                     FKKFNDRYGHVAGDAVLHSIGRVMSEQVTRAGDLVARYGGEEFVVILPGTDIKGAIEV
                     AERIREGILALTIPHVDTPWGQVSASFGVTTVYPGQHRGLVSADVVNRADQQLYEAKR
                     TGRNRVCAEGSV"
     misc_feature    complement(44525..44719)
                     /locus_tag="Rahaq2_5040"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:251508"
     misc_feature    complement(43658..44149)
                     /locus_tag="Rahaq2_5040"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(43904..43906,44036..44038))
                     /locus_tag="Rahaq2_5040"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(43901..43912,43916..43918,43985..43987,
                     43997..43999,44009..44014,44021..44023))
                     /locus_tag="Rahaq2_5040"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(43844..43846,43928..43930))
                     /locus_tag="Rahaq2_5040"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(45418..45942)
                     /locus_tag="Rahaq2_5041"
                     /note="IMG reference gene:2506712064"
                     /db_xref="GeneID:11789680"
     CDS             complement(45418..45942)
                     /locus_tag="Rahaq2_5041"
                     /note="PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_005202480.1"
                     /db_xref="GI:383192353"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11789680"
                     /translation="MDGLIIDILNEDAEYNLADFDCGETSLNVFLSDHLRRQHNGKIL
                     RGYVLQTQDNVPKVLGYYTLSGSCFERATLPSKTQQKKVPYHNVPSVTLGRLAIDKSL
                     HKQGYGSMLVTHAMRVVYRASLAVGVHGLFVEALNDKAKNFYISLGFTALVGENENSL
                     FYPTTSIEKLFPEG"
     misc_feature    complement(45493..45699)
                     /locus_tag="Rahaq2_5041"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:249979"
     misc_feature    complement(45493..>45657)
                     /locus_tag="Rahaq2_5041"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     gene            complement(45946..46215)
                     /locus_tag="Rahaq2_5042"
                     /note="IMG reference gene:2506712065"
                     /db_xref="GeneID:11789681"
     CDS             complement(45946..46215)
                     /locus_tag="Rahaq2_5042"
                     /note="PFAM: Protein of unknown function (DUF1778)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202481.1"
                     /db_xref="GI:383192354"
                     /db_xref="InterPro:IPR010985"
                     /db_xref="InterPro:IPR014795"
                     /db_xref="GeneID:11789681"
                     /translation="MSALKKQRIDLRLNDEDKRMIEEAAAMTNQSVTQFMLSSASERA
                     AEVIEQHRRLILNEESWELVMNAISNPAIPNERLKQAAKRLQSME"
     misc_feature    complement(45955..46194)
                     /locus_tag="Rahaq2_5042"
                     /note="Protein of unknown function (DUF1778); Region:
                     DUF1778; pfam08681"
                     /db_xref="CDD:254971"
     gene            46471..46770
                     /locus_tag="Rahaq2_5043"
                     /note="IMG reference gene:2506712066"
                     /db_xref="GeneID:11789682"
     CDS             46471..46770
                     /locus_tag="Rahaq2_5043"
                     /note="PFAM: Transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005202482.1"
                     /db_xref="GI:383192355"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="GeneID:11789682"
                     /translation="MTGRNRRNFSPEFRLEAAQLVLDQHYTVAAAATAMNVGKSTMDK
                     WVRQLKDERAGKSPIASPMTPEQIEIRELKKRLQRVEMERDILWKFTEYMVLPDV"
     misc_feature    46471..>46743
                     /locus_tag="Rahaq2_5043"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    46486..46707
                     /locus_tag="Rahaq2_5043"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            complement(46830..47363)
                     /locus_tag="Rahaq2_5044"
                     /note="IMG reference gene:2506712067"
                     /db_xref="GeneID:11789683"
     CDS             complement(46830..47363)
                     /locus_tag="Rahaq2_5044"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202483.1"
                     /db_xref="GI:383192356"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="GeneID:11789683"
                     /translation="MKHYFLASLFTIMTLPMATSAMALTPEASVKEIADNLVELNPIT
                     WTAPAEKYHMVVFIDNQCSYCSDVVKKVQQYTDAGLTMSFLTVAPPAIHDKVISDMAR
                     VWCSNSPRESLRNAMAGFLPNNDTSPACIRTIEQQSALANRVGIEVTPVMVVMQPSPV
                     VFIGNVKPAEILKALKH"
     misc_feature    complement(46839..>47297)
                     /locus_tag="Rahaq2_5044"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(47415..47786)
                     /locus_tag="Rahaq2_5045"
                     /note="IMG reference gene:2506712068"
                     /db_xref="GeneID:11789684"
     CDS             complement(47415..47786)
                     /locus_tag="Rahaq2_5045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202484.1"
                     /db_xref="GI:383192357"
                     /db_xref="GeneID:11789684"
                     /translation="MRLLTKSEVENISGGYNGNGPSSGMTDGGGVVSGSSGGSSFYLT
                     LVCMKKSSPVFIFVTTFFCGLLTFAILSRIGVYFTFSILEIPLWLANWIAGVAMIVGL
                     VRIVEIIYYVLLPKISGRLKN"
     gene            48213..48412
                     /locus_tag="Rahaq2_5046"
                     /note="IMG reference gene:2506712069"
                     /pseudo
                     /db_xref="GeneID:11789685"
     gene            complement(48472..50007)
                     /locus_tag="Rahaq2_5047"
                     /note="IMG reference gene:2506712070"
                     /db_xref="GeneID:11789686"
     CDS             complement(48472..50007)
                     /locus_tag="Rahaq2_5047"
                     /note="PFAM: Major Facilitator Superfamily;
                     TIGRFAM: drug resistance transporter, EmrB/QacA subfamily;
                     Multidrug resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EmrB/QacA subfamily drug resistance transporter"
                     /protein_id="YP_005202485.1"
                     /db_xref="GI:383192358"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11789686"
                     /translation="MQDKAAFTPPTMWLAVLALSLATFMQVLDSTIANVALPTIAGNL
                     GVSADQGTWVITSFAVCNAIALPLTGWFTRRFGQLKLFLGSVVMFTLSSFLCGLAHSM
                     TELIIFRALQGFFAGPMFPMCQTLLLVIFPPSKRSMALALLSMVTVVAPIVGPITGGW
                     ITDNYSWPWIFYINVPIGIFATLVVWTQLRAREETTSHVPIDYIGIALLVMGVGLLQV
                     VLDKGNDLDWFASLQIVIMTVISAISLVSFVIWELGERHPIVNLRLFKERNFAVGTLS
                     LTLGYAAFFAINIILPQWLQTQMGYTAIWAGLAAAPMGVLPLLMTPFIGRYANKVDLR
                     ILASLSFLTMGASCLIRAQFNTDVDFRTIAQVQLFMGIGVAFFFMPVTTIVLSNLNGA
                     EIAEGSGLATFFRVLGGSFASSLTTWIWSRREVFHHANLTESVSAYNPAAVNYIEKMG
                     GLTQQNMASVDKTIEQQAYMMSTIDYFWILGWGFMALIVVIWFTRPPFSRSGPSGAPA
                     AGH"
     misc_feature    complement(48526..49968)
                     /locus_tag="Rahaq2_5047"
                     /note="drug resistance transporter, EmrB/QacA subfamily;
                     Region: efflux_EmrB; TIGR00711"
                     /db_xref="CDD:129794"
     misc_feature    complement(48745..49962)
                     /locus_tag="Rahaq2_5047"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(48781..48783,48790..48795,48802..48807,
                     48814..48819,48850..48852,48859..48864,48874..48876,
                     48883..48888,48895..48897,49045..49047,49057..49059,
                     49066..49068,49078..49080,49090..49092,49132..49134,
                     49141..49146,49153..49158,49165..49167,49555..49557,
                     49573..49578,49585..49590,49624..49626,49633..49638,
                     49645..49650,49657..49662,49798..49803,49807..49812,
                     49822..49824,49831..49836,49843..49845,49894..49899,
                     49903..49911,49918..49920))
                     /locus_tag="Rahaq2_5047"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(50018..51196)
                     /locus_tag="Rahaq2_5048"
                     /note="IMG reference gene:2506712071"
                     /db_xref="GeneID:11789687"
     CDS             complement(50018..51196)
                     /locus_tag="Rahaq2_5048"
                     /note="PFAM: HlyD family secretion protein;
                     TIGRFAM: efflux pump membrane protein (multidrug
                     resistance protein A)"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance efflux pump"
                     /protein_id="YP_005202486.1"
                     /db_xref="GI:383192359"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:11789687"
                     /translation="METTPAQDVERGSKRKRNFIILFFILVIAAGGILAWYLLYARFY
                     ESTDDAYVNGNQVTLTPQIGGTVTQVTVDEGDFVQKGQPLVLLDPSDTEIALQQAEAN
                     LANTVRQVRGLYSTADNYRAQVAAKKVALQTAQNDYTRRQKIFSSGAISSEDLSHYRD
                     AVTSAQSDLAAAQEALRTNTAMVDDTVIDSHPEIKSAVATLRQRFLDNARTTIVAPVS
                     GYVAKRAVQLGMRVDSGTTLLAIVPLSEVWVDANFKESQMYSMRLGQKVTLNADLYGD
                     NVEYHGTIESLGIGTGSAFSLLPAQNASGNWIKIVQRLPVRITLDPRDMQKHPLRVGL
                     SMNVRVDIRDDGGHLLPQQTVSTPRFSTDVYQNPLAEADKLVAKILHDNSKTVATGSR
                     "
     misc_feature    complement(50045..51187)
                     /locus_tag="Rahaq2_5048"
                     /note="multidrug efflux system protein EmrA; Provisional;
                     Region: PRK15136"
                     /db_xref="CDD:185090"
     misc_feature    complement(50885..51034)
                     /locus_tag="Rahaq2_5048"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    complement(50651..>50929)
                     /locus_tag="Rahaq2_5048"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    complement(50198..50563)
                     /locus_tag="Rahaq2_5048"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(51221..51676)
                     /locus_tag="Rahaq2_5049"
                     /note="IMG reference gene:2506712072"
                     /db_xref="GeneID:11789688"
     CDS             complement(51221..51676)
                     /locus_tag="Rahaq2_5049"
                     /note="PFAM: MarR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005202487.1"
                     /db_xref="GI:383192360"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789688"
                     /translation="MHNTSAISGDKLPLGLLIHLANQFKDQIISEYFAGANITAQQFK
                     VLISIYKGFYSPVEISKNLVMDAGGMSRMVDRMVKRELIARTPNPQDKRQVILTLTDE
                     GQALCERFEKDAQTSIMGNLTARLTPGESRLLVELITKMLPDDITAPHR"
     misc_feature    complement(51248..51676)
                     /locus_tag="Rahaq2_5049"
                     /note="MarR family; Region: MarR_2; cl17246"
                     /db_xref="CDD:266584"
     misc_feature    complement(51251..51619)
                     /locus_tag="Rahaq2_5049"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     gene            complement(52099..52251)
                     /locus_tag="Rahaq2_5050"
                     /note="IMG reference gene:2506712073"
                     /pseudo
                     /db_xref="GeneID:11789689"
     gene            52604..53653
                     /locus_tag="Rahaq2_5051"
                     /note="IMG reference gene:2506712074"
                     /db_xref="GeneID:11789690"
     CDS             52604..53653
                     /locus_tag="Rahaq2_5051"
                     /note="PFAM: Phage integrase family"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase XerD"
                     /protein_id="YP_005202488.1"
                     /db_xref="GI:383192361"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR010998"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="InterPro:IPR023109"
                     /db_xref="GeneID:11789690"
                     /translation="MGKLSPINPILPVIQAEEDVLARLKEFVQDKEAFSPNTWRQLMS
                     VMRICHRWSTENSRSFLPMLASDLRDYLNWLQENGRASSTIATHGSLISMLHRNAGLT
                     PPNTSPLVFRAVKKINRVAVVEGERTGQAVPFRLEDLLKLDALWSDSILLRQKRDLAF
                     LHVAYSTLLRISELARLRVRDISRAPDGRIILNVSYTKTIVQTGGLIKSLSSQSSRRL
                     SEWLSVSGISAEPDAFLFCPVHRSGSATLSIARPLSTPAMESIFAQAWRTIGAGEAII
                     PNKGRYTAWTGHSARVGAAQDMAGRGYAVAQIMQEGTWKKPETLMRYIRNLQAHEGAM
                     IDIMEKSTLHHNDKK"
     misc_feature    52709..53605
                     /locus_tag="Rahaq2_5051"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    order(53111..53116,53195..53197,53459..53467,53570..53572)
                     /locus_tag="Rahaq2_5051"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    order(53111..53113,53195..53197,53465..53467,53474..53476,
                     53543..53545,53570..53572)
                     /locus_tag="Rahaq2_5051"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    order(53111..53113,53465..53467,53474..53476,53543..53545,
                     53570..53572)
                     /locus_tag="Rahaq2_5051"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(53743..54222)
                     /locus_tag="Rahaq2_5052"
                     /note="IMG reference gene:2506712075"
                     /db_xref="GeneID:11789691"
     CDS             complement(53743..54222)
                     /locus_tag="Rahaq2_5052"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202489.1"
                     /db_xref="GI:383192362"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11789691"
                     /translation="MSLKLSAPEPLTTEHILDAFGCGESTLDEWLKRRALTNHLNGAS
                     RTFVVATHDKSIVGYYALAAGAVLHREATGSVRRNMPDPVPVIVLGRLAVDLRTQGLK
                     LGASLLQDAVLRVHSIAENTGVRALLVHALHEPAKQFYEHYGFTSSPINPMTLMLRI"
     misc_feature    complement(53785..53991)
                     /locus_tag="Rahaq2_5052"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            complement(54219..54479)
                     /locus_tag="Rahaq2_5053"
                     /note="IMG reference gene:2506712076"
                     /db_xref="GeneID:11789692"
     CDS             complement(54219..54479)
                     /locus_tag="Rahaq2_5053"
                     /note="PFAM: Protein of unknown function (DUF1778)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202490.1"
                     /db_xref="GI:383192363"
                     /db_xref="InterPro:IPR010985"
                     /db_xref="InterPro:IPR014795"
                     /db_xref="GeneID:11789692"
                     /translation="MRDAAINLRALPEQRDLIDQAASLLGKNRSDFMLEVACERAQAI
                     LLDQVFFQLDTEKFHEFTAMLDAPQKANQGLERLMAVKAPWA"
     misc_feature    complement(54225..54479)
                     /locus_tag="Rahaq2_5053"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4453"
                     /db_xref="CDD:226860"
     gene            complement(54696..54863)
                     /locus_tag="Rahaq2_5054"
                     /note="IMG reference gene:2506712077"
                     /pseudo
                     /db_xref="GeneID:11789693"
     gene            complement(54906..55511)
                     /locus_tag="Rahaq2_5055"
                     /note="IMG reference gene:2506712078"
                     /db_xref="GeneID:11789694"
     CDS             complement(54906..55511)
                     /locus_tag="Rahaq2_5055"
                     /note="PFAM: Bacterial regulatory proteins, tetR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005202491.1"
                     /db_xref="GI:383192364"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011075"
                     /db_xref="InterPro:IPR015893"
                     /db_xref="GeneID:11789694"
                     /translation="MNTTTQLHNNEIREHILATGQRIMAGKGFSAVGLNEILKDAGVP
                     KGSFYHYFSSKEAFGADMLAHYFDDYLADIDRTLGQPGLNMAQRLMNYWQQWRESQSF
                     SDCQGKCLAVKLGAEVADLSDTMRLTLEAGTSGIISRLAQALETGVAEGSLTIDDTPR
                     TVAESLYQLWVGASVMVKIVRNTGPFDSALITTRKIIHITP"
     misc_feature    complement(54984..55511)
                     /locus_tag="Rahaq2_5055"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(55341..55466)
                     /locus_tag="Rahaq2_5055"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(55580..55666)
                     /locus_tag="Rahaq2_5056"
                     /note="IMG reference gene:2506712079"
                     /pseudo
                     /db_xref="GeneID:11789695"
     gene            complement(55667..56488)
                     /locus_tag="Rahaq2_5057"
                     /note="IMG reference gene:2506712080"
                     /db_xref="GeneID:11789696"
     CDS             complement(55667..56488)
                     /locus_tag="Rahaq2_5057"
                     /note="PFAM: alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="YP_005202492.1"
                     /db_xref="GI:383192365"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="GeneID:11789696"
                     /translation="MKTIQVKDGSKIAYKDFGKGQTIIFSHGWPLSSDAWDAQMLFFG
                     QQGFRVIAHDRRSHGNSSQTWDGNDMDTYAEDLSSLIEQLDLKDVVLVGHSTGGGEVA
                     RYIGTYGSARVSKAVLIGAVPPVMLQSEKNPGGLPMEVFDGIRAAVEKDRSQFYKDLT
                     TPFFNYNRSSETPSEGVRESFWLQGMRGGIKGQYDCIKQFSEVDFTDDLKKIDVPTLI
                     MHGDDDQIVPLADSAILSAQLVKDAQLKVYAGFGHGMTITQAGTINEDLLRFIEE"
     misc_feature    complement(55673..56473)
                     /locus_tag="Rahaq2_5057"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    complement(<56027..56356)
                     /locus_tag="Rahaq2_5057"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(55727..>55861)
                     /locus_tag="Rahaq2_5057"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            complement(56622..57377)
                     /locus_tag="Rahaq2_5058"
                     /note="IMG reference gene:2506712081"
                     /db_xref="GeneID:11789697"
     CDS             complement(56622..57377)
                     /locus_tag="Rahaq2_5058"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202493.1"
                     /db_xref="GI:383192366"
                     /db_xref="GeneID:11789697"
                     /translation="MFKKSFTTLALSLVLSVYAQSSMAAPVKNIVLVHGAFVDGSGWD
                     PVARILNKAGYNVSIVQEPQTSLADDVAATRRVLALQSGKSLLVGHSYAGMIISDAGN
                     DPSVAGLVYIAAFQPEQGESLLSLAKKYPPAAQSITETPDHFLYIKPENFHADFAADL
                     PVKETNLLAQSQLMPAVAAFTAPAGVPAWKTKPSWAVVATQDRAINPELERFMAKRAH
                     STVTELKGNHAIYASQPEKIATLIEKAALSLSQ"
     misc_feature    complement(56625..57302)
                     /locus_tag="Rahaq2_5058"
                     /note="Probable pheophorbidase; Region: PLN02965; cl17657"
                     /db_xref="CDD:248211"
     misc_feature    complement(56655..57290)
                     /locus_tag="Rahaq2_5058"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(57533..58213)
                     /locus_tag="Rahaq2_5059"
                     /note="IMG reference gene:2506712082"
                     /db_xref="GeneID:11789698"
     CDS             complement(57533..58213)
                     /locus_tag="Rahaq2_5059"
                     /note="PFAM: DJ-1/PfpI family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative intracellular protease/amidase"
                     /protein_id="YP_005202494.1"
                     /db_xref="GI:383192367"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="GeneID:11789698"
                     /translation="MKILMVLTSHDKLGDTGRKTGFWLEELAAPYYAFKDAGAEITLA
                     SPKGGNPPLDPKSNEPDFQTEQTHRFEADAEATAHLASTVRLDSVSHADYDAVFYPGG
                     HGPLWDLAEDKHSIALIEAFLAANKHVALVCHAPGVLRHVKTPEGKPLVAGRKVTGFT
                     NSEEDAVGLTQIVPFLVEDELIAKGGIYSKGADWSSYVVTDGLLITGQNPTSSTEAAE
                     ELIKQLGA"
     misc_feature    complement(57536..58213)
                     /locus_tag="Rahaq2_5059"
                     /note="Putative intracellular protease/amidase [General
                     function prediction only]; Region: ThiJ; COG0693"
                     /db_xref="CDD:223765"
     misc_feature    complement(57542..58207)
                     /locus_tag="Rahaq2_5059"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in proteins similar to Escherichia coli Hsp31
                     protein; Region: GATase1_Hsp31_like; cd03141"
                     /db_xref="CDD:153235"
     misc_feature    complement(order(57722..57724,57812..57817))
                     /locus_tag="Rahaq2_5059"
                     /note="potential catalytic triad [active]"
                     /db_xref="CDD:153235"
     misc_feature    complement(57815..57817)
                     /locus_tag="Rahaq2_5059"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153235"
     gene            complement(58542..59957)
                     /locus_tag="Rahaq2_5060"
                     /note="IMG reference gene:2506712083"
                     /db_xref="GeneID:11789699"
     CDS             complement(58542..59957)
                     /locus_tag="Rahaq2_5060"
                     /note="PFAM: Aldehyde dehydrogenase family"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent aldehyde dehydrogenase"
                     /protein_id="YP_005202495.1"
                     /db_xref="GI:383192368"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="GeneID:11789699"
                     /translation="MSSQHVTQNMLSIDVATSRNPATDELIATYAFQTADEVEGMLAG
                     NNAAFRLWRATPMSKRVEAYRRLSAILRERSENLAGIITAEMGKTLAAARAEVEKCAA
                     TIDWIASNGPAILADEPVSVENDDQVHVSYLPIGSILAVMPWNFPLWQVIRASGPIML
                     SGNGFILKHAPNVMGSAYALQDAYESAGFPKGLFANLIADNETVAKVIEDDRIAAVTL
                     TGSMRAGSAVSAIAGKALKKSLLELGGSDAFIVLADANIDLAVKAGVEARFQNAGQVC
                     LAAKRFILEKPIAEEFTQKFIAAVRLLKVGDPLDPQNRIGPMARKDLRDELHHQVERT
                     LAAGATLLLGGNKISGPGNFYEPTVLGEVGPGMAAFDEETFGPVAAITVADDVEHAIE
                     LANTSDYGLGGNLWTSDVSRAQRIARRLETGGVFINGFSATNARIPVGGVKKSGYGRE
                     LSHFGLREFTNAQAVWAKQVD"
     misc_feature    complement(58560..59846)
                     /locus_tag="Rahaq2_5060"
                     /note="Mycobacterium tuberculosis succinate-semialdehyde
                     dehydrogenase 1-like; Region: ALDH_SSADH1_GabD1; cd07100"
                     /db_xref="CDD:143418"
     misc_feature    complement(order(58641..58643,58755..58757,58833..58835,
                     58839..58841,59130..59132,59226..59234,59274..59279,
                     59286..59288,59295..59306,59445..59450,59454..59456,
                     59499..59501,59523..59537))
                     /locus_tag="Rahaq2_5060"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143418"
     misc_feature    complement(order(59130..59132,59139..59141,59232..59234,
                     59523..59525))
                     /locus_tag="Rahaq2_5060"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143418"
     gene            complement(60057..60869)
                     /locus_tag="Rahaq2_5061"
                     /note="IMG reference gene:2506712084"
                     /db_xref="GeneID:11789700"
     CDS             complement(60057..60869)
                     /locus_tag="Rahaq2_5061"
                     /note="PFAM: Helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005202496.1"
                     /db_xref="GI:383192369"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11789700"
                     /translation="MVKKTTSEQRRELGAFLVSRRARLNPQDFGMQQGTRRTPGLRRE
                     EVAVLAGVSVSWYTWLEQGREIKPSADALQRIAKVLKLNRIESSHLFALSPREEPVPH
                     PLADGVSDGLKSLVRAIDPIPAYVRNARLDILAWNDAIADLFIDYGSLEPHERNTLRL
                     LFLYRPYRTQILDWEQMARGMISVFRASRAHAQDKKPFDHLIKELSEKSPEFKEWWLD
                     TEVKGMGEGSKRLLHPTSGHIEFTYVALTPEGRPDLSLVTYIPRHVACDSRS"
     misc_feature    complement(60621..60764)
                     /locus_tag="Rahaq2_5061"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(60687..60689,60762..60764))
                     /locus_tag="Rahaq2_5061"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(60684..60686,60759..60761))
                     /locus_tag="Rahaq2_5061"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(60429..60752)
                     /locus_tag="Rahaq2_5061"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(order(60681..60686,60696..60698,60705..60707,
                     60738..60743))
                     /locus_tag="Rahaq2_5061"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(60969..61103)
                     /locus_tag="Rahaq2_5062"
                     /note="IMG reference gene:2506712085"
                     /pseudo
                     /db_xref="GeneID:11789701"
     gene            complement(61254..62177)
                     /locus_tag="Rahaq2_5063"
                     /note="IMG reference gene:2506712086"
                     /db_xref="GeneID:11789702"
     CDS             complement(61254..62177)
                     /locus_tag="Rahaq2_5063"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005202497.1"
                     /db_xref="GI:383192370"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789702"
                     /translation="MVINMAAGNPLQLGSIEQFCRAAETGSFTSAAETLGLTPAAVSR
                     SISRLEQRLGVRLFLRTTRAVKLTTEGELYWKECHLALEQIAEAERAITGSQTVPSGP
                     LRISVSAAYGTFRLLPLMPKFTDLYPQIDIEISISDKIIDFVEEGFDLAIRLGVPQDS
                     RLVAFKLEDASLGVFGTPTYLAKKGEPYRIDELNQHDCIQYISPNTGRPLQWLFTDEL
                     GTSIEKQITSRMRVLNDALGAVAWVNAGGGLYQTYRFAVGDALRRGDLVEVLQKYGGC
                     SRPFSILYPQNRHLSARVRAFVEFLRSAVKS"
     misc_feature    complement(61257..62141)
                     /locus_tag="Rahaq2_5063"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(61962..62141)
                     /locus_tag="Rahaq2_5063"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(61275..61877)
                     /locus_tag="Rahaq2_5063"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(61338..61340,61419..61421,61470..61472,
                     61668..61670,61674..61676,61716..61718,61833..61835,
                     61845..61847))
                     /locus_tag="Rahaq2_5063"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(61443..61445,61452..61457,61476..61478,
                     61482..61493,61587..61589,61770..61790,61794..61796,
                     61806..61808,61815..61820,61824..61829,61839..61844))
                     /locus_tag="Rahaq2_5063"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            62331..63029
                     /locus_tag="Rahaq2_5064"
                     /note="IMG reference gene:2506712087"
                     /db_xref="GeneID:11789703"
     CDS             62331..63029
                     /locus_tag="Rahaq2_5064"
                     /note="PFAM: Glutathione S-transferase, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_005202498.1"
                     /db_xref="GI:383192371"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017933"
                     /db_xref="GeneID:11789703"
                     /translation="MTSKLNVFTSPSAFPNPQRLRLFMHEKGIADQFQETIYDMTPVG
                     EQRGWRHLKMNAWGETPTLELADGSYISETAAVVRYLDQSYPGRKIMGDTPLEQGLDN
                     MWDNRIWVHILYRIVTAFHVLHTGLGFKLELTKNEAWGEHCRKEALAHAALVNKHLSD
                     GRQWLLGGDEPTFADITLATAIAFSKFPVNATPLDERFEFLDAYWQRWQQRPSFQAAY
                     ADRSSGIPELENKA"
     misc_feature    62352..62576
                     /locus_tag="Rahaq2_5064"
                     /note="GST_N family, Saccharomyces cerevisiae GTT2-like
                     subfamily; composed of predominantly uncharacterized
                     proteins with similarity to the S. cerevisiae GST protein,
                     GTT2. GSTs are cytosolic dimeric proteins involved in
                     cellular detoxification by catalyzing...; Region:
                     GST_N_GTT2_like; cd03051"
                     /db_xref="CDD:239349"
     misc_feature    62373..62981
                     /locus_tag="Rahaq2_5064"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    order(62376..62378,62382..62387,62391..62396,62403..62408,
                     62553..62555,62562..62567)
                     /locus_tag="Rahaq2_5064"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239349"
     misc_feature    order(62376..62378,62505..62513,62547..62552)
                     /locus_tag="Rahaq2_5064"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239349"
     misc_feature    order(62505..62507,62544..62549,62553..62558,62565..62567)
                     /locus_tag="Rahaq2_5064"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239349"
     misc_feature    62610..62972
                     /locus_tag="Rahaq2_5064"
                     /note="C-terminal, alpha helical domain of the Glutathione
                     S-transferase family; Region: GST_C_family; cl02776"
                     /db_xref="CDD:261442"
     misc_feature    order(62634..62636,62655..62657,62847..62849,62856..62861,
                     62868..62870,62880..62882)
                     /locus_tag="Rahaq2_5064"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198286"
     misc_feature    order(62634..62639,62646..62651,62658..62660,62787..62789)
                     /locus_tag="Rahaq2_5064"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198286"
     misc_feature    order(62655..62657,62667..62672,62871..62873,62880..62882)
                     /locus_tag="Rahaq2_5064"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198286"
     gene            complement(63296..66280)
                     /locus_tag="Rahaq2_5065"
                     /note="IMG reference gene:2506712088"
                     /db_xref="GeneID:11789704"
     CDS             complement(63296..66280)
                     /locus_tag="Rahaq2_5065"
                     /note="PFAM: Transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, TnpA family"
                     /protein_id="YP_005202499.1"
                     /db_xref="GI:383192372"
                     /db_xref="InterPro:IPR002513"
                     /db_xref="GeneID:11789704"
                     /translation="MPRRQILSSEEKERLLIVPDDDVFLTRMCFLSEHDLALINKHRR
                     PANRLGFAVLLCYLRGPGFPPDKSISPHDGVVFRLAAHLKVQSDLWAEYASREVTRWE
                     HLAELYRYLELSPFNRALQKTCIRHLYPHAMRTDRGFLLAEEMLSWLHNNKVIFPSVE
                     VIERTLAEATTLADRAVFSALTAQLEPGHKAALDRLLVSEGEQPSRLAWLLQPPGKIN
                     GKNVLQHIDRLNAIESLVLPDGIALSVHQNRLLKLAREGRKMNSRDLARFTDVRRYAS
                     LVCIISEARSTLTDEVIDLHERILSSLFSRAKRTQAERLQQTGKLIQSKLKQYATVGQ
                     ALLNARESGEDPWAAIEDVLPWQEFINSVEETRFLSRKDNFDPLHLITEKYSTLRKYA
                     PRMLSVLQFRAAPAAMQLSDALDTVRDMYRKQLRKVPPSAPIGFIPESWRKVVITPTG
                     IDRKYYEFCVLNELKGALRSGDIWVKGSRRYRNFDDYLIPSGDFEKSLRDNQLPLAVP
                     ADCHEYIKSRLTLLASRLEEVNAMALAGDLPDVDISDKGVKITPLDNSVPSAASPFGD
                     LVYGMLPHPKITEMLDEVDGWTGFTRHFTHLKNNHVRPKDRKLLLTTILADGINLGLT
                     KMAESCPGTTKSSLEGIQAWYIRDETYSAALAELVNAQKKRPLAAFWGDGTTSSSDGQ
                     NFRVGSHGRYAGQVNLKYGQEPGMQIYTHISDQYSPFYTKVISRVRDSTHVLDGLLYH
                     ETDLEITEHYTDTAGFTEHVFALMHLLGFAFAPRIRDLHDKRLFIHGKAELYQGLQSI
                     ISTTSLNLKEIETHWHEVLRLASSIKQGTVTASLMMKKLASYPKQNGLAKALREFGRI
                     ERSLFMLDWFRDPSLRRRVQAGLNKGEARNALARAVFMHRLGEIRDRRLENQSYRASG
                     LTLLTAAISLWNTVYIERAIDSLRRKGIAINEQLISHLSPLGWEHINLSGDYVWRTNL
                     KLGQGKYRALRSVDSSLYKKHA"
     misc_feature    complement(65774..66265)
                     /locus_tag="Rahaq2_5065"
                     /note="Domain of unknown function (DUF4158); Region:
                     DUF4158; pfam13700"
                     /db_xref="CDD:257998"
     misc_feature    complement(63383..64546)
                     /locus_tag="Rahaq2_5065"
                     /note="Tn3 transposase DDE domain; Region: DDE_Tnp_Tn3;
                     pfam01526"
                     /db_xref="CDD:250685"
     gene            66440..67024
                     /locus_tag="Rahaq2_5066"
                     /note="IMG reference gene:2506712089"
                     /db_xref="GeneID:11789705"
     CDS             66440..67024
                     /locus_tag="Rahaq2_5066"
                     /note="PFAM: Resolvase, N terminal domain;
                     Helix-turn-helix domain of resolvase"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase, DNA invertase Pin"
                     /protein_id="YP_005202500.1"
                     /db_xref="GI:383192373"
                     /db_xref="InterPro:IPR006118"
                     /db_xref="InterPro:IPR006119"
                     /db_xref="InterPro:IPR006120"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="GeneID:11789705"
                     /translation="MSRVFAYCRVSTLEQTTENQRREIEAAGFIVRPQRLIEEKISGS
                     VAASERPGFARLLDRMENGDVLIVTKLDRLGRNAMDIRKTVEQLADSDIRVHCLALGG
                     VDLTSPAGKMTMQVISAVAEFERDLLLERTHVGIARAKASGKRFGRPPVLSEEQKRVV
                     TERLNTGISTSAIAREFNTTRQTILRVKVGKRQS"
     misc_feature    66449..66997
                     /locus_tag="Rahaq2_5066"
                     /note="multiple promoter invertase; Provisional; Region:
                     mpi; PRK13413"
                     /db_xref="CDD:184041"
     misc_feature    66449..66844
                     /locus_tag="Rahaq2_5066"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    order(66464..66466,66470..66472,66653..66658,66665..66667)
                     /locus_tag="Rahaq2_5066"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    66470..66472
                     /locus_tag="Rahaq2_5066"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    order(66650..66652,66785..66790,66794..66799,66809..66811)
                     /locus_tag="Rahaq2_5066"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(66668..66670,66683..66688,66773..66775,66782..66787,
                     66794..66799,66806..66808,66815..66817)
                     /locus_tag="Rahaq2_5066"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(66740..66748,66773..66778,66785..66790,66797..66799,
                     66809..66811,66818..66820,66830..66832)
                     /locus_tag="Rahaq2_5066"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(66740..66742,66788..66790,66797..66799,66809..66811,
                     66818..66820,66830..66832)
                     /locus_tag="Rahaq2_5066"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(66812..66814,66830..66835)
                     /locus_tag="Rahaq2_5066"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    66878..67000
                     /locus_tag="Rahaq2_5066"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cd00569"
                     /db_xref="CDD:259851"
     misc_feature    order(66881..66889,66983..66988,66992..67000)
                     /locus_tag="Rahaq2_5066"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            complement(67137..67706)
                     /locus_tag="Rahaq2_5067"
                     /note="IMG reference gene:2506712090"
                     /db_xref="GeneID:11789706"
     CDS             complement(67137..67706)
                     /locus_tag="Rahaq2_5067"
                     /note="PFAM: Bacterial regulatory proteins, tetR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005202501.1"
                     /db_xref="GI:383192374"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011075"
                     /db_xref="InterPro:IPR015893"
                     /db_xref="GeneID:11789706"
                     /translation="MGSSKADKAASHDRIVEIAAARMRSSGINGVGVAELMREAGLTH
                     GGFYRHFASRDELVGAAVERALAQGSARTVATSGQGGRRALEAIIDDYLSPAHRSHPE
                     AGCAVAGLAEDVSRADDRTRSAYRRQVKQYLELLAELTPSTDAADDRRRSCLVLSALV
                     GALVMARAIGEGSLSDEILFETATALKEF"
     misc_feature    complement(67173..67706)
                     /locus_tag="Rahaq2_5067"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(67524..67664)
                     /locus_tag="Rahaq2_5067"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(67812..68648)
                     /locus_tag="Rahaq2_5068"
                     /note="IMG reference gene:2506712091"
                     /db_xref="GeneID:11789707"
     CDS             complement(67812..68648)
                     /locus_tag="Rahaq2_5068"
                     /note="PFAM: Enoyl-CoA hydratase/isomerase family"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/carnithine racemase"
                     /protein_id="YP_005202502.1"
                     /db_xref="GI:383192375"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="GeneID:11789707"
                     /translation="MSAPLTQFTITEAVPGYWRITFNNPPLNFCDPETLIELQQIVGL
                     IESDDTLRVVVFDSADPDFFVNHYDVSRFSDFPLTPGPTGLPTFIDTTTRLTDSPVVT
                     IALIRGRTRGGGSEIALACDMRFASLERAIFAQIEVGAGVFPGGGGTERLPLLVGRAR
                     ALEIVLGSDDFDAATAANYGWVNRALPDDQLDAHVDNLARRIASFDKPALAEAKRLIN
                     RRTLPSADDLMETQGAFLNAFSWPTVSERGARIAQKRDEVGSDFEARMGYHLGNLSTD
                     TQ"
     misc_feature    complement(68043..68621)
                     /locus_tag="Rahaq2_5068"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(67875..68591)
                     /locus_tag="Rahaq2_5068"
                     /note="carnitinyl-CoA dehydratase; Provisional; Region:
                     PRK03580"
                     /db_xref="CDD:179599"
     misc_feature    complement(order(68229..68231,68238..68243,68310..68318,
                     68322..68324,68439..68453,68463..68465,68562..68564,
                     68568..68570))
                     /locus_tag="Rahaq2_5068"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(68310..68312,68445..68447))
                     /locus_tag="Rahaq2_5068"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(68043..68048,68055..68057,68100..68102,
                     68109..68111,68142..68144,68151..68156,68160..68165,
                     68169..68174,68187..68192,68196..68204,68208..68210,
                     68226..68237,68274..68285,68346..68348,68370..68372))
                     /locus_tag="Rahaq2_5068"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            complement(69400..69726)
                     /locus_tag="Rahaq2_5069"
                     /note="IMG reference gene:2506712092"
                     /db_xref="GeneID:11789708"
     CDS             complement(69400..69726)
                     /locus_tag="Rahaq2_5069"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202503.1"
                     /db_xref="GI:383192376"
                     /db_xref="GeneID:11789708"
                     /translation="MNISNQEIIDECYQCAEACDHCAASCLNEEDIGMMKACIRLDIQ
                     CAAMCRLAAQFLAIQSGYAQQICYLCADICTACAEECSQHQHDHCQNCAQRCRQCADM
                     CSKVAA"
     misc_feature    complement(69409..69711)
                     /locus_tag="Rahaq2_5069"
                     /note="Cysteine-rich 4 helical bundle widely conserved in
                     bacteria; Region: DUF326; cd08026"
                     /db_xref="CDD:153434"
     misc_feature    complement(order(69508..69513,69520..69522,69532..69534,
                     69541..69546,69562..69567,69574..69576,69583..69588,
                     69595..69600,69604..69609))
                     /locus_tag="Rahaq2_5069"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153434"
     gene            69970..70122
                     /locus_tag="Rahaq2_5070"
                     /note="IMG reference gene:2506712093"
                     /db_xref="GeneID:11789709"
     CDS             69970..70122
                     /locus_tag="Rahaq2_5070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202504.1"
                     /db_xref="GI:383192377"
                     /db_xref="GeneID:11789709"
                     /translation="MSVISAQDKSKPGHDHERDKDIHKRERDNPQPDYQKDHPSDAPE
                     SGDKKL"
     gene            70481..73453
                     /locus_tag="Rahaq2_5071"
                     /note="IMG reference gene:2506712094"
                     /db_xref="GeneID:11789710"
     CDS             70481..73453
                     /locus_tag="Rahaq2_5071"
                     /note="PFAM: Molybdopterin oxidoreductase; NADH-ubiquinone
                     oxidoreductase-G iron-sulfur binding region; Molydopterin
                     dinucleotide binding domain; Molybdopterin oxidoreductase
                     Fe4S4 domain;
                     TIGRFAM: formate dehydrogenase, alpha subunit,
                     archaeal-type"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase, alpha subunit,
                     archaeal-type"
                     /protein_id="YP_005202505.1"
                     /db_xref="GI:383192378"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR006655"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR019574"
                     /db_xref="GeneID:11789710"
                     /translation="MNQQTCTIMYNGEPLTGSINQPLIDFLDEHGKKLPHVCYHPALP
                     PLETCDVCWVEADGEKVRGCTLTTYDGLAVNSQSEAMRAAQEEGMDRILNRHELYCTV
                     CEHNTGDCTLHNTVADMHIPIQYYPFERKPYGKDHSNPFYTYDPDQCILCGRCVEACQ
                     NVEVNETLTIDYTEAHPRVRWDGGTQIAGSSCVSCGHCVTVCPCNALMEKTMQPDAGP
                     FTAMPEPVKRPLIDFVKALENSIGAEPVTAISLIDNALRQAEIKRTKTVCTYCGVGCS
                     FEMWTRDRHILKVQPVAQAPANGISTCVKGKFGWDFVNSPQRLTTPLIRENGRFRPAS
                     WDEALETVARRLREIAQRHGGDAIGFIGSSKASNEEAYLTQKIARLIFGTNNVDNSSR
                     YCQNPATQGLFRTVGYGGDAGTIKDMQQADLIITIGSNLAENHPVIASHIKQSHKHRS
                     QKLLVVDPRRHEMADRADLFLQITPGTDLVWASAMSRYMFDHGYADEEFLNRRVNQVD
                     EYYASLAPFTLEYASEITDLSVEALVAAAEMIGQAKSVCLLWAMGITQHSHGADTSTA
                     LSNLLLVTGNYGRPGTGGYPMRGHNNVQGASDFGCLSNVYPGYEKVTDPAMREKWAKA
                     WGVDPAALSDKAGADNYKMVQQADEGTLKAMYIIGEETAFSDADSTKVHEAFSKLEFM
                     VVQDIFMSRTAEFADVVLPGCPSVEKEGTFVNTERRIQRFYEVMKPLGESLPDWKILT
                     MLASKLGHPWYYQHPGQIMQEAAGIAGIFAGVSYERLAGWQSQLWPVSADGKSTPLLY
                     TDKFKFPDGKARLYPLEWHPPMEQADSEYDLLLDNGRMLEHFQSTNQTGKGGRITSLS
                     PNWYVEVGSQLAAERQLREGDWVRLTSRRGSLEVPVVITDRVAGNVLFIPIHHGKPGV
                     NGLTGEHHDPVVNTPAYKEIAVRMTKLDRAPQSDPLPRENFRHGQRNPINHVPAEDKW
                     RQDGYRLPPEHVEHPEKF"
     misc_feature    70481..73420
                     /locus_tag="Rahaq2_5071"
                     /note="Uncharacterized anaerobic dehydrogenase [General
                     function prediction only]; Region: COG3383"
                     /db_xref="CDD:225918"
     misc_feature    70499..70717
                     /locus_tag="Rahaq2_5071"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_4; pfam13510"
                     /db_xref="CDD:257830"
     misc_feature    70733..70858
                     /locus_tag="Rahaq2_5071"
                     /note="NADH-ubiquinone oxidoreductase-G iron-sulfur
                     binding region; Region: NADH-G_4Fe-4S_3; smart00929"
                     /db_xref="CDD:214918"
     misc_feature    70919..71095
                     /locus_tag="Rahaq2_5071"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    71273..72934
                     /locus_tag="Rahaq2_5071"
                     /note="Formate dehydrogenase H (Formate-Dh-H) catalyzes
                     the reversible oxidation of formate to CO2 with the
                     release of a proton and two electrons. It is a component
                     of the anaerobic formate hydrogen lyase complex. The E.
                     coli formate dehydrogenase H (Fdh-H) is...; Region:
                     MopB_Formate-Dh-H; cd02753"
                     /db_xref="CDD:239154"
     misc_feature    order(71282..71284,71288..71293,71297..71299,71303..71305,
                     71387..71389)
                     /locus_tag="Rahaq2_5071"
                     /note="[4Fe-4S] binding site [ion binding]; other site"
                     /db_xref="CDD:239154"
     misc_feature    order(71393..71395,71573..71575,71657..71662,71759..71770,
                     71777..71782,71846..71851,71855..71857,71906..71908,
                     71912..71914,72131..72139,72146..72151,72245..72250,
                     72455..72457,72461..72463,72473..72475,72533..72544,
                     72548..72550,72584..72589,72683..72685)
                     /locus_tag="Rahaq2_5071"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239154"
     misc_feature    72956..73300
                     /locus_tag="Rahaq2_5071"
                     /note="Molybdopterin-Binding, C-terminal (MopB_CT) domain
                     of the MopB superfamily of proteins, a  large, diverse,
                     heterogeneous superfamily of enzymes that, in general,
                     bind molybdopterin as a cofactor. The MopB domain is found
                     in a wide variety of molybdenum-...; Region: MopB_CT;
                     cl09929"
                     /db_xref="CDD:263923"
     misc_feature    order(72986..72991,72995..73006,73199..73201,73223..73225,
                     73271..73276)
                     /locus_tag="Rahaq2_5071"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239176"
     gene            73453..73944
                     /locus_tag="Rahaq2_5072"
                     /note="IMG reference gene:2506712095"
                     /db_xref="GeneID:11789711"
     CDS             73453..73944
                     /locus_tag="Rahaq2_5072"
                     /note="PFAM: Protein of unknown function (DUF1641)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202506.1"
                     /db_xref="GI:383192379"
                     /db_xref="InterPro:IPR012440"
                     /db_xref="GeneID:11789711"
                     /translation="MAERQEYQVPPARTETTAQDMLHTLTESLHEHGFLRLLNDVVRA
                     NTDIASILVSGLNQPGGQNAMQNLSLLFMTLSKIPPEHFNHLLQALKSGVMAVRQDNS
                     HDEPKKEETAPGVLGMMKLLNDEDLWRGLMPIVNGLKAFGEEIQKEEQKPVTRNTGKE
                     THE"
     misc_feature    <73576..73893
                     /locus_tag="Rahaq2_5072"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2427"
                     /db_xref="CDD:225283"
     gene            73937..75304
                     /locus_tag="Rahaq2_5073"
                     /note="IMG reference gene:2506712096"
                     /db_xref="GeneID:11789712"
     CDS             73937..75304
                     /locus_tag="Rahaq2_5073"
                     /note="PFAM: Bacterial Cytochrome Ubiquinol Oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome bd-type quinol oxidase subunit 1"
                     /protein_id="YP_005202507.1"
                     /db_xref="GI:383192380"
                     /db_xref="InterPro:IPR002585"
                     /db_xref="GeneID:11789712"
                     /translation="MSETDWVLLLSRGQFALTMAMHITLAALTLGLAPFLVWFEARWL
                     WGKQEAARTALHFWLKIFAITVAVGAVSGVVMEFQFGTNWSVFSQKAGGIIGPLLFYE
                     VLIAFFLESGLTGVMLFGMGKIRPKWHFVITCLVAAGALFSAFWILAANSWMQTPAGF
                     VRDANGIFHPTSWLALLSAPSFPLRFFHMVLASLIAVAFMIAGISAWRLLHHPAETAS
                     RIMIKAALWFALIATPVQIVVGDQHGENTLHYQPQKVAAMEGSWHQPVTGEGEPLRLF
                     AWPDQQSQHNRLEVAIPTIGSLYLRHNLTGHIKSLSEFPAQERPPVAAVFFSFRIMVG
                     LGLLMVITSGIAAYRLQRSRLFYARPLLWWLVWMSPSGFIALLAGWLVTELGRQPWTI
                     YGMLRTAESVSLIPLSWVITSCCGVILVYGLVFGFGLRHFLRYASAPLPQGPDVVVTA
                     IPTST"
     misc_feature    73964..75244
                     /locus_tag="Rahaq2_5073"
                     /note="Bacterial Cytochrome Ubiquinol Oxidase; Region:
                     Bac_Ubq_Cox; pfam01654"
                     /db_xref="CDD:250773"
     gene            75315..76274
                     /locus_tag="Rahaq2_5074"
                     /note="IMG reference gene:2506712097"
                     /db_xref="GeneID:11789713"
     CDS             75315..76274
                     /locus_tag="Rahaq2_5074"
                     /note="PFAM: Cytochrome oxidase subunit II"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome bd-type quinol oxidase, subunit 2"
                     /protein_id="YP_005202508.1"
                     /db_xref="GI:383192381"
                     /db_xref="InterPro:IPR003317"
                     /db_xref="GeneID:11789713"
                     /translation="MEWLADLSAAVLLFSLLMYLMLDGTDLGAGMLLFFFEDEEQKRS
                     IVKSMLPIWDANETWLVLLAGGLFALFPAAYALLFSALYIPVFVMLFCLILRAVALEY
                     RETVSVETRRWLDKLLPVSSALAAYCQGACAGLIVSGRFSADAFSWLGLYPVLSGLGL
                     IFVYLLLGCGWIRWRVGDGKVKGTLRFSRYFLLLNLGLFLVVQCINPAPWQHVWQLAW
                     GKGLIILIILLWLFLLSALQKLSPFIQLALSLILLAAIVIQTAAGIYPELIPGRMNLH
                     QAASGDITQMFILTGIAFVIPVTLIYHSWAFWVFRGKIKSEGK"
     misc_feature    75315..76265
                     /locus_tag="Rahaq2_5074"
                     /note="Cytochrome bd-type quinol oxidase, subunit 2
                     [Energy production and conversion]; Region: AppB; COG1294"
                     /db_xref="CDD:224213"
     misc_feature    75321..76247
                     /locus_tag="Rahaq2_5074"
                     /note="Cytochrome oxidase subunit II; Region: Cyto_ox_2;
                     pfam02322"
                     /db_xref="CDD:251222"
     gene            76467..76592
                     /locus_tag="Rahaq2_5075"
                     /note="IMG reference gene:2506712098"
                     /db_xref="GeneID:11789714"
     CDS             76467..76592
                     /locus_tag="Rahaq2_5075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202509.1"
                     /db_xref="GI:383192382"
                     /db_xref="GeneID:11789714"
                     /translation="MLKNSDPDNTQSDHKRDKENPQPDYKKDDPHNAPESGDKRI"
     gene            76870..77037
                     /locus_tag="Rahaq2_5076"
                     /note="IMG reference gene:2506712099"
                     /db_xref="GeneID:11789715"
     CDS             76870..77037
                     /locus_tag="Rahaq2_5076"
                     /note="PFAM: Stress-induced bacterial acidophilic repeat
                     motif"
                     /codon_start=1
                     /transl_table=11
                     /product="stress-induced acidophilic repeat
                     motif-containing protein"
                     /protein_id="YP_005202510.1"
                     /db_xref="GI:383192383"
                     /db_xref="InterPro:IPR019626"
                     /db_xref="GeneID:11789715"
                     /translation="MAEHRGGSGNFAEDPERASEAGKKGGQKSGGNFANDRERASEAG
                     KKGGKHSHDND"
     misc_feature    76870..77025
                     /locus_tag="Rahaq2_5076"
                     /note="General stress protein [General function prediction
                     only]; Region: GsiB; COG3729"
                     /db_xref="CDD:226252"
     gene            complement(77280..78638)
                     /locus_tag="Rahaq2_5077"
                     /note="IMG reference gene:2506712100"
                     /db_xref="GeneID:11789716"
     CDS             complement(77280..78638)
                     /locus_tag="Rahaq2_5077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202511.1"
                     /db_xref="GI:383192384"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="GeneID:11789716"
                     /translation="MSSQNYYDVTDWNQGNPYEDIGEVINSIIADIKSRQTDTNVNQG
                     GKPGAVIYIPPGDYPLLTQVVIDISYLKIMGSGHGFTSSSIRFNTPESEWVNWHEVWP
                     GGSRILVELPAGVGTEESDGAAFYIARSGDPRISSVEFADFCIDGLHFVDDGSGNDDP
                     ENTYLNGKTGIYIASAQDSFRISGMGLVYLEHGVTVYNADALAIHNNFIAECGNCIEL
                     RGSGQASKVTDNLIGAGYRGYSIYAQNFGGLLITANNIFPRGKSSIHFSGVVRSSVSS
                     NRFHSFYPGMLVFEGSCSENLVSANHFFREREPWGPMQPYNNGLDDLYGLLYISGDHN
                     SIIANHISETIDTQYITPPGAKPVIIRVVSGQGNYISDNHVVATTEASQVQAATGSCF
                     STQVSALLATQGLQALDVTTVQIEKESLQNIILDSGHDAQVVADKTVNAFRPTPVPDL
                     PV"
     misc_feature    complement(77979..78581)
                     /locus_tag="Rahaq2_5077"
                     /note="Pectate lyase superfamily protein; Region:
                     Pectate_lyase_3; cl19188"
                     /db_xref="CDD:267541"
     gene            complement(78722..80143)
                     /locus_tag="Rahaq2_5078"
                     /note="IMG reference gene:2506712101"
                     /db_xref="GeneID:11789717"
     CDS             complement(78722..80143)
                     /locus_tag="Rahaq2_5078"
                     /note="TIGRFAM: sugar (Glycoside-Pentoside-Hexuronide)
                     transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/melibiose symporter-like transporter"
                     /protein_id="YP_005202512.1"
                     /db_xref="GI:383192385"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="GeneID:11789717"
                     /translation="MSATVMEKQSAYAKLSLKEKIGYGMGDAGSCMIWSVLALYLTWF
                     YTDVYGLAPGIVGTLFLVIRIFDAFSDPIMGAICDRTHSKWGKFRPWLLWMAVPFGLG
                     AILMFTTPDLSMNGKIIYAWVTYLIMSLIYTAINIPYCSVAGVITLNQKERLGCLSWR
                     FFLNGLATLIVSSTILPLTDWLGNGSRASGFQLTMTIMGGAATLMFLFCFSSIKERVV
                     SLKPNDSLLKDLKDIARNDQWLLMISITFLNVFPAFIRGAVTIYYATYVMHASVGFIT
                     LFMALGVACNMLGSVIAKPLTDRFDKIKLFRIINIILGILSFALWFVDPSSLTPLLTL
                     FIIINILHLIQSGPILWAMMSDVDDYGDWKFGKRLTGISFAGNLFMLKMGLAVAGAIV
                     AWILSFTGYVANKPEQNAQTIQGIVIMFSLLPMISYFISAFIVRYFKLNNTLLERIKV
                     DLAKRELENGPDQSQGLKDIPVH"
     misc_feature    complement(78776..80125)
                     /locus_tag="Rahaq2_5078"
                     /note="Na+/melibiose symporter and related transporters
                     [Carbohydrate transport and metabolism]; Region: MelB;
                     COG2211"
                     /db_xref="CDD:225121"
     misc_feature    complement(78782..80107)
                     /locus_tag="Rahaq2_5078"
                     /note="putative symporter YagG; Provisional; Region:
                     PRK09669; cl15392"
                     /db_xref="CDD:265685"
     gene            complement(80270..81280)
                     /locus_tag="Rahaq2_5079"
                     /note="IMG reference gene:2506712102"
                     /db_xref="GeneID:11789718"
     CDS             complement(80270..81280)
                     /locus_tag="Rahaq2_5079"
                     /note="PFAM: Bacterial regulatory proteins, lacI family;
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005202513.1"
                     /db_xref="GI:383192386"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11789718"
                     /translation="MASIKDVAKKAGVSTATVSRVLNNHPSVIPETRKAVRDAMDYLC
                     YVPSKSAFQLSGKCSGLIAVVVPNLVNPHFCELLATFEEEARYIGKSVIVKTHQNQAQ
                     QDKQIIHTLIGMGIDSLLWVPTEAEAELSEWLTATHIPVAVVTQVSRFFNSVSINQSK
                     GAESIAEHFIQTGHTTFGFVAQEGVDNRKVSAWSKKITSQGLTFNKENQFWIAKGEGE
                     RTSGHISILDKIIEKLALRRNECSCLWVYNDVAASYIIDGLKKQGISVPQDIAIASFD
                     NTLLAQTKGITSVAQPIHEIAHLAFQMVKNQSKQEGIEMYEIVSRLIIRESSVNMDIT
                     TF"
     misc_feature    complement(80300..81277)
                     /locus_tag="Rahaq2_5079"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(81128..81268)
                     /locus_tag="Rahaq2_5079"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(81128..81130,81137..81139,81146..81148,
                     81185..81187,81194..81199,81212..81214,81221..81226,
                     81230..81244,81266..81268))
                     /locus_tag="Rahaq2_5079"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(81128..81148)
                     /locus_tag="Rahaq2_5079"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(80312..81100)
                     /locus_tag="Rahaq2_5079"
                     /note="Ligand binding domain of the LacI tanscriptional
                     regulator family belonging to the type I
                     periplasmic-binding fold protein superfamily; Region:
                     PBP1_LacI_sugar_binding_like; cd06267"
                     /db_xref="CDD:107262"
     misc_feature    complement(order(80498..80503,80510..80512,80522..80524,
                     80621..80623,80936..80944,80951..80953,80960..80962,
                     80993..80995,80999..81013,81032..81037,81041..81046,
                     81053..81061,81098..81100))
                     /locus_tag="Rahaq2_5079"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107262"
     misc_feature    complement(order(80408..80410,80453..80455,80630..80632,
                     80813..80815,80846..80848,80915..80917,81050..81052,
                     81059..81064))
                     /locus_tag="Rahaq2_5079"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107262"
     gene            complement(81446..81787)
                     /locus_tag="Rahaq2_5080"
                     /note="IMG reference gene:2506712103"
                     /db_xref="GeneID:11789719"
     CDS             complement(81446..81787)
                     /locus_tag="Rahaq2_5080"
                     /note="PFAM: HxlR-like helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005202514.1"
                     /db_xref="GI:383192387"
                     /db_xref="InterPro:IPR002577"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789719"
                     /translation="MTTQQERNYRCTVEATIAVAGGKWKPLIIYYLLTGTKRFGELRK
                     LIGGVTQRSLTLQLRELEAHGIISREIFAEVPPRVEYSLTELGFTLAPVLDTMKSWGD
                     TYISWQQRNDK"
     misc_feature    complement(81473..81787)
                     /locus_tag="Rahaq2_5080"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1733"
                     /db_xref="CDD:224647"
     misc_feature    complement(order(81545..81553,81566..81568,81578..81583,
                     81599..81604,81608..81613,81620..81625,81629..81640,
                     81668..81676))
                     /locus_tag="Rahaq2_5080"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(81665..81667,81674..81676))
                     /locus_tag="Rahaq2_5080"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            81937..82920
                     /locus_tag="Rahaq2_5081"
                     /note="IMG reference gene:2506712104"
                     /db_xref="GeneID:11789720"
     CDS             81937..82920
                     /locus_tag="Rahaq2_5081"
                     /note="PFAM: Alcohol dehydrogenase GroES-like domain;
                     Zinc-binding dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent oxidoreductase"
                     /protein_id="YP_005202515.1"
                     /db_xref="GI:383192388"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11789720"
                     /translation="MKAAFYETQGPAHEVLKIGEVSKPTPGPDEVLVRISVSGINPTD
                     IKARTGFSAKMPYPRIIPHQDGAGVIEAVGGNVSSERLGERVWLYEAQYGRATGTAAE
                     FVAVPAHQAVRLPDNVSFETGASLGIPALTAHRCLFSDGDLKGCRVLIHGGAGAVGTA
                     AISLAKWAGAWVATTVSNAKQAEIARTRGADLVLNRSTDDVARTILANTENLGVDHIV
                     DVALKENFDTNLACLSQGGVISAYATNSATEEISVPLLKAMTHGCVLRFVYIYNVPRE
                     LKQASAADINACLETGNYSPVIGLNLPLEQIADAHYAVEYSEVIGKVLVHL"
     misc_feature    81937..82911
                     /locus_tag="Rahaq2_5081"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    81937..82911
                     /locus_tag="Rahaq2_5081"
                     /note="Zeta-crystallin with NADP-dependent quinone
                     reductase activity (QOR); Region: zeta_crystallin;
                     cd08253"
                     /db_xref="CDD:176215"
     misc_feature    order(82060..82062,82072..82074,82318..82320,82330..82332,
                     82387..82407,82462..82467,82522..82527,82594..82599,
                     82609..82611,82660..82665,82684..82686,82738..82746,
                     82876..82878,82888..82893)
                     /locus_tag="Rahaq2_5081"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176215"
     gene            complement(83021..83296)
                     /locus_tag="Rahaq2_5082"
                     /note="IMG reference gene:2506712105"
                     /db_xref="GeneID:11789721"
     CDS             complement(83021..83296)
                     /locus_tag="Rahaq2_5082"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202516.1"
                     /db_xref="GI:383192389"
                     /db_xref="GeneID:11789721"
                     /translation="MPDYCFFKKGKQTVVLERSDADGAFQLTQQGFEKQFEEVSAIDE
                     KHALNRFSDIRREKRIDQHNFLAGAIAMPLIGVYTAIAGFLFRKKQP"
     gene            complement(83490..84869)
                     /locus_tag="Rahaq2_5083"
                     /note="IMG reference gene:2506712106"
                     /db_xref="GeneID:11789722"
     CDS             complement(83490..84869)
                     /locus_tag="Rahaq2_5083"
                     /note="PFAM: Bacterial regulatory proteins, gntR family;
                     Aminotransferase class I and II"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator with HTH domain and
                     aminotransferase domain"
                     /protein_id="YP_005202517.1"
                     /db_xref="GI:383192390"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11789722"
                     /translation="MGYKEIYARYRQQILDGRLKPGDRVPAIRVLASELQVARKTVET
                     AYEILIGEGYFVSQGAKGTRVNPSLRVASAASMHTAAPSRLLGQPVIESKGELRLGIP
                     ALDEFPHKKWLLISGKTVRSLRPEEMIIPPVMGYQPLREAIASYLNISRGLNCQPEQI
                     FITSGYRANLRLILSVLAQPNDKVLFEDPGYFFGQQLLRRIAPNLHYVPVDRQGVDVD
                     YLQRYHADARFAIVTPTHQSPLAVSLSLPRKHQLLAWAQQNSSWIIEDDYDGEFHYTR
                     KVIPALKSLDMHDRVIYTGTFSKTMMPAMRIGYLVMPQETVVRFSELGEILETGLPLL
                     PQKILAQFLSEGHFYRHLKKMRILYQQRRRIMFEAIETSFPGLFEFELTDGGMHIVAF
                     LRRGIQDNALAALWRQHELYVRPLSNWYAQTQKRYGLVIGYTNIRSFEQAQQILQRVA
                     AETRALMQS"
     misc_feature    complement(83493..84863)
                     /locus_tag="Rahaq2_5083"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(84672..84863)
                     /locus_tag="Rahaq2_5083"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(84681..84692,84696..84701,84729..84731,
                     84738..84743,84747..84761,84783..84788,84792..84794,
                     84861..84863))
                     /locus_tag="Rahaq2_5083"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(83610..84572)
                     /locus_tag="Rahaq2_5083"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(83952..83954,83973..83978,83982..83984,
                     84063..84065,84156..84158,84297..84299,84369..84377))
                     /locus_tag="Rahaq2_5083"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(83856..83858,83865..83867,83952..83960,
                     84084..84086,84267..84269,84366..84368))
                     /locus_tag="Rahaq2_5083"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(83973..83975)
                     /locus_tag="Rahaq2_5083"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            85015..85494
                     /locus_tag="Rahaq2_5084"
                     /note="IMG reference gene:2506712107"
                     /db_xref="GeneID:11789723"
     CDS             85015..85494
                     /locus_tag="Rahaq2_5084"
                     /note="PFAM: Carboxymuconolactone decarboxylase family;
                     TIGRFAM: alkylhydroperoxidase AhpD family core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase"
                     /protein_id="YP_005202518.1"
                     /db_xref="GI:383192391"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="GeneID:11789723"
                     /translation="MSSRVNHFKTIPALAKTLGEASMTLGKASLDKKIKYLVDIRASQ
                     LNHCAFCLDMHVKEAKLHGERELRLYHVAIWRESPLFSAKEKAALALTEALTRIGEQG
                     VSEALYSELREHFSEVEISELTFSIALINAWNRLQILSQMVPGALDSAYGLDRAELH"
     misc_feature    85048..85296
                     /locus_tag="Rahaq2_5084"
                     /note="Carboxymuconolactone decarboxylase family; Region:
                     CMD; pfam02627"
                     /db_xref="CDD:251430"
     misc_feature    <85051..85446
                     /locus_tag="Rahaq2_5084"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2128"
                     /db_xref="CDD:225039"
     gene            complement(85681..86694)
                     /locus_tag="Rahaq2_5085"
                     /note="IMG reference gene:2506712108"
                     /db_xref="GeneID:11789724"
     CDS             complement(85681..86694)
                     /locus_tag="Rahaq2_5085"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005202519.1"
                     /db_xref="GI:383192392"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11789724"
                     /translation="MPGGLSAQNERTILTLYALIKLIKIMTLINPNDFSRIDLNLLVV
                     LIVMYEERNVTQAAQRLHLGQPAVSAALKRLRSMFNEALFVRTTQGMMPTPRTCELIQ
                     ALTPLMAQLQAVVLNPPRFNPEKDKLTFHIGMSDWIEHWLMPDLLAGIMREAPQVSIN
                     AVATDPWKVVSALEQNKVDLSITVGQETSRDLRREKLTSAGFKTLWDPGQIDITKPLT
                     VAQFVHHEHLLISYRGASQSAMDSSLEKAGVSRRVRYVSSHFSTLPLMLSQMPLFATV
                     PMMLVDDWCRQYGFQSDSVPVHMPPFELALLWHRNRDSDAATLWMLNKIRQLIAKKLS
                     AIR"
     misc_feature    complement(85690..86586)
                     /locus_tag="Rahaq2_5085"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(86407..86580)
                     /locus_tag="Rahaq2_5085"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(85711..86310)
                     /locus_tag="Rahaq2_5085"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     similar to DntR, which is involved in the catabolism of
                     dinitrotoluene; contains the type 2 periplasmic binding
                     fold; Region: PBP2_DntR_like_2; cd08464"
                     /db_xref="CDD:176153"
     misc_feature    complement(order(85783..85785,85984..85986,86095..86097,
                     86269..86271,86281..86286,86290..86292))
                     /locus_tag="Rahaq2_5085"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176153"
     misc_feature    complement(order(85846..85848,85888..85890,85897..85902,
                     85909..85914,85921..85935,86017..86019,86206..86208,
                     86212..86226,86230..86235,86242..86247,86251..86256,
                     86263..86268,86275..86280,86287..86289))
                     /locus_tag="Rahaq2_5085"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176153"
     gene            86725..87561
                     /locus_tag="Rahaq2_5086"
                     /note="IMG reference gene:2506712109"
                     /db_xref="GeneID:11789725"
     CDS             86725..87561
                     /locus_tag="Rahaq2_5086"
                     /note="PFAM: Metallo-beta-lactamase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase"
                     /protein_id="YP_005202520.1"
                     /db_xref="GI:383192393"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="GeneID:11789725"
                     /translation="MRITVGQCQVEKITEQTTSFPLRQLFPDHIDEMINYPEDAAVGL
                     SIHSWLVKTPKDIILIDTATGNGRNRGGIPLFDHLNSDYLERLKQTGIAAEQVSLVLM
                     THIHTDHVGWNTHWNEGEWQPLFPHARYVCSARELAKCQADPGRQELYRDSILPLIKS
                     GQLDAIDIEQSPLFSGVLRYMPTPGHSDDHGSLLLVSDQQHAIFTGDLMHHEVQFEHP
                     HWNSVFCENKPQASLSRRKAIDWALEHQAIWFSSHFAGASFGRVRYDGNQRYQWQTPE
                     EE"
     misc_feature    86863..87372
                     /locus_tag="Rahaq2_5086"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            87561..88904
                     /locus_tag="Rahaq2_5087"
                     /note="IMG reference gene:2506712110"
                     /db_xref="GeneID:11789726"
     CDS             87561..88904
                     /locus_tag="Rahaq2_5087"
                     /note="PFAM: Amidase"
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="YP_005202521.1"
                     /db_xref="GI:383192394"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="GeneID:11789726"
                     /translation="MFQQEDYAKASVTELLQKLQNGETRAAALTEFALAIIAEREPAL
                     NAITWLYADEAKQAAIASDEKRRRGHPCGRLEGIPLLVKDNIDVAGWPTTAGSKALLG
                     IIADHDAPLVKRLREEGAILLGKTAMHELAAGITGASSLSGYTHNAYRPGYNPGGSSS
                     GSAVAVAAGYVPFAVGTDTAGSVRIPAAFNLLYGLRPTRGSVPMAGIVPLSPTQDIAG
                     PLVRHAKDLRWVTEIMTGKSFPSRGETLRIGWLDSAFNDISDTSRNKMRAAVQNIGAE
                     VVTVGVTSLDSLAEAANIIAFEFAESLNAFLSARPQASFTSLQEIVAANIHHPQLDAV
                     FRARAEHAGTNSPEYRGVQQRQRDFYNLLKALFAGHDINLLAYPVMRHPPVKHGEIQT
                     GSNALLAATSGTPALTFPVGFDDQGFPLGLELLALRDREDLLLNVCLKSLNGPAG"
     misc_feature    87576..88871
                     /locus_tag="Rahaq2_5087"
                     /note="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
                     and related amidases [Translation, ribosomal structure and
                     biogenesis]; Region: GatA; COG0154"
                     /db_xref="CDD:223232"
     gene            complement(89197..89820)
                     /locus_tag="Rahaq2_5088"
                     /note="IMG reference gene:2506712111"
                     /db_xref="GeneID:11789727"
     CDS             complement(89197..89820)
                     /locus_tag="Rahaq2_5088"
                     /note="PFAM: Pyridoxamine 5'-phosphate oxidase;
                     TIGRFAM: PPOX class probable FMN-dependent enzyme, DR_2398
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="PPOX class F420-dependent protein"
                     /protein_id="YP_005202522.1"
                     /db_xref="GI:383192395"
                     /db_xref="InterPro:IPR009002"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="GeneID:11789727"
                     /translation="MADENMLITDSDELEQLYGAIAKPSLTKVTDHIHPAYRPFIEAS
                     PFVALATSGPEGLDVSPRGDPAGFIHIEDAKTILLPDRRGNNRIDSLRNILNDNRVAL
                     LFLIPGIGETLRITGTAEIRKDPALLAKFSINNHPPKTVLRISVNSVFFQCSRAIIRS
                     KLWDPATQIERQTLPSTGSILSMISQSEIDGLAYDEALPGRLKTTLY"
     misc_feature    complement(89323..89805)
                     /locus_tag="Rahaq2_5088"
                     /note="Predicted flavin-nucleotide-binding protein
                     structurally related to pyridoxine 5'-phosphate oxidase
                     [General function prediction only]; Region: COG3576"
                     /db_xref="CDD:226105"
     misc_feature    complement(89200..89787)
                     /locus_tag="Rahaq2_5088"
                     /note="PPOX class probable FMN-dependent enzyme, DR_2398
                     family; Region: PPOX_FMN_DR2398; TIGR04025"
                     /db_xref="CDD:188540"
     gene            90091..90879
                     /locus_tag="Rahaq2_5089"
                     /note="IMG reference gene:2506712112"
                     /db_xref="GeneID:11789728"
     CDS             90091..90879
                     /locus_tag="Rahaq2_5089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202523.1"
                     /db_xref="GI:383192396"
                     /db_xref="GeneID:11789728"
                     /translation="MPILHTEHGDIDYQDIGTGDTTLFLMPGWCQPKTVFNDFSELAA
                     VFFRVVIIDWRGHGKSSTDGQDFDGAALLTDALTLIEHLGLSRVVPVSVAHASWIAVD
                     LVESLKERVPAVIFLDWIMNQPAAAFFTSIKEMQHEDRWQYARDHLYEFWLAGSDSPI
                     MNHHLKTEMAGSSYQLWRLAGQVIADAYHKYGSPLQRLEKLKNPPKATHIYSLDRNDE
                     YLALQQRFATTHDFFKVKRLENARTHLAVLERPGDVLAGIMASI"
     misc_feature    90157..90858
                     /locus_tag="Rahaq2_5089"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(91049..91249)
                     /locus_tag="Rahaq2_5090"
                     /note="IMG reference gene:2506712113"
                     /pseudo
                     /db_xref="GeneID:11789729"
     gene            91483..95007
                     /locus_tag="Rahaq2_5091"
                     /note="IMG reference gene:2506712114"
                     /db_xref="GeneID:11789730"
     CDS             91483..95007
                     /locus_tag="Rahaq2_5091"
                     /note="PFAM: domain; Domain of unknown function; Pyruvate
                     ferredoxin/flavodoxin oxidoreductase; Thiamine
                     pyrophosphate enzyme, C-terminal TPP binding domain;
                     TIGRFAM: pyruvate:ferredoxin (flavodoxin) oxidoreductase,
                     homodimeric"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate:ferredoxin (flavodoxin) oxidoreductase,
                     homodimeric"
                     /protein_id="YP_005202524.1"
                     /db_xref="GI:383192397"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR002880"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR011895"
                     /db_xref="InterPro:IPR015941"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR019456"
                     /db_xref="InterPro:IPR019752"
                     /db_xref="GeneID:11789730"
                     /translation="MPGKMKTMDGNTAAAYVSYAFTDVTAIYPITPSTPMAESVDEWA
                     AQGKKNLFGQTVKIMEMQSESGAAGAIHGALQAGALATTYTASQGLLLMTPNMYKIAG
                     ELLPAVFHVSARALATNSLNIFGDHQDVMAVRQTGCAMLAESSVQQVMDLAAVAHLTA
                     IKGRIPFINFFDGFRTSHEIQKIEVLDYEDLGALLDRDAVARFRQNALHPDHPVVRGT
                     AQNPDIYFQEREASNKFYMALPEMVESYMAKISALTGREYHLFNYYGAPDAGRMIIAM
                     GSVCETIQETVDYLNARGEKVGVLTVHLYRPFSLKHFFKYIPKSVSNIAVLDRTKEPG
                     SLAEPLYLDVKSAFYNSDWRPVIVGGRYALGGKDILPSHIISIFDNLAAERPRDGFTV
                     GINDDVTFTSLPLSDRDIDTSSSGTTACKFWGLGSDGTVGANKSAIKIIGDKTDMYAQ
                     AYFAYDSKKSGGVTMSHLRFGHNPIRSPYLIDKADFISCSQQSYVNKYHLLAGLKPGG
                     TFLLNCSWDVAELDEKLPVAMKRYIAANDIQFYIVNAVGIAQKLGLGGRFNMIMQSAF
                     FKLADIIPLTRAVEYLKHSIEHAYGNKGQKIVDMNNLAVDSGIESVVKISVPQAWKHL
                     EDKVVSPKKLPAFIKDILIPMNRQEGDSLPVSIFDGIEDGTFPSGTSAYEKRGVAINV
                     PVWQTDKCTQCNQCAFICPHAAIRPVLISEEERQNAPAGFSAKRASGTEDAWYRLAVS
                     PLDCSGCGNCADVCPVKGKALSMQPLESQEHEIELWEHALSLTPKANPQNKFTVKGSQ
                     FEQPLLEFSGACGGCGETPYAKLVTQLFGDRMMIANATGCSSIWGASAPSIPYTTNHK
                     GQGPTWANSLFEDNAEFGLGMLLGVDAIRDTLATQVKAALDNAPDVPLDAELSACLSD
                     WLANKDQGEGTRERAEKVVTLLASQTPGKNPHTDSIYAHRDYLAKRSHWIFGGDGWAY
                     DIGFGGLDHVLASGKDVNVLVFDTEVYSNTGGQSSKSTPAAAIAQFAASGKKTRKKDL
                     GMMAMSYGYVYVAQIAMGADKNQTLRAIAEAEAYPGPSLIIAYAACINHGLRIGMGCS
                     QREARRAVEAGYWANYRYHPELKEAGKNPFILDSEEPEEDFQAFLAGEVRYSSLKKLY
                     PEFAEFLFKKTEDDARERLEGYKKLASS"
     misc_feature    91495..94998
                     /locus_tag="Rahaq2_5091"
                     /note="pyruvate:ferredoxin (flavodoxin) oxidoreductase,
                     homodimeric; Region: pyruv_ox_red; TIGR02176"
                     /db_xref="CDD:131231"
     misc_feature    91510..92001
                     /locus_tag="Rahaq2_5091"
                     /note="Pyrimidine (PYR) binding domain of pyruvate
                     ferredoxin oxidoreductase (PFOR), indolepyruvate
                     ferredoxin oxidoreductase alpha subunit (IOR-alpha), and
                     related proteins; Region: TPP_PYR_PFOR_IOR-alpha_like;
                     cd07034"
                     /db_xref="CDD:132917"
     misc_feature    order(91552..91557,91573..91575,91585..91587,91594..91596,
                     91657..91668,91687..91692,91696..91704,91711..91713,
                     91717..91719,91768..91770,91777..91779,91789..91791,
                     91828..91833,91882..91887)
                     /locus_tag="Rahaq2_5091"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(91552..91557,91564..91569,91573..91575,91591..91596,
                     91657..91668,91687..91692,91696..91704,91711..91713,
                     91717..91719,91768..91770,91777..91779)
                     /locus_tag="Rahaq2_5091"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(91567..91569,91672..91674)
                     /locus_tag="Rahaq2_5091"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(91573..91575,91822..91824)
                     /locus_tag="Rahaq2_5091"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:132917"
     misc_feature    92740..93351
                     /locus_tag="Rahaq2_5091"
                     /note="Pyruvate:ferredoxin oxidoreductase and related
                     2-oxoacid:ferredoxin oxidoreductases, gamma subunit
                     [Energy production and conversion]; Region: PorG; COG1014"
                     /db_xref="CDD:223946"
     misc_feature    93352..93522
                     /locus_tag="Rahaq2_5091"
                     /note="Domain of unknown function; Region: EKR; pfam10371"
                     /db_xref="CDD:255944"
     misc_feature    93547..93747
                     /locus_tag="Rahaq2_5091"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     misc_feature    93886..95001
                     /locus_tag="Rahaq2_5091"
                     /note="Thiamine pyrophosphate (TPP family), PFOR_PNO
                     subfamily, TPP-binding module; composed of proteins
                     similar to the single subunit pyruvate ferredoxin
                     oxidoreductase (PFOR) of Desulfovibrio Africanus, present
                     in bacteria and amitochondriate eukaryotes. This...;
                     Region: TPP_PFOR_PNO; cd03377"
                     /db_xref="CDD:239472"
     misc_feature    order(93925..93927,93994..93996,94081..94086,94381..94392,
                     94468..94470,94474..94476,94480..94488)
                     /locus_tag="Rahaq2_5091"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:239472"
     misc_feature    order(93964..93972,94012..94014,94027..94029,94051..94059,
                     94063..94080,94087..94089,94096..94101,94108..94113,
                     94117..94122,94129..94134,94141..94143,94150..94152,
                     94345..94347,94360..94362,94408..94410,94420..94425,
                     94441..94443,94486..94491,94504..94506,94525..94527,
                     94531..94533,94540..94542,94552..94554,94564..94566,
                     94576..94581,94588..94590,94711..94716,94732..94743,
                     94891..94893,94903..94905,94912..94914,94918..94920,
                     94927..94929,94981..94983)
                     /locus_tag="Rahaq2_5091"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239472"
     gene            95073..95606
                     /locus_tag="Rahaq2_5092"
                     /note="IMG reference gene:2506712115"
                     /db_xref="GeneID:11789731"
     CDS             95073..95606
                     /locus_tag="Rahaq2_5092"
                     /note="PFAM: Flavodoxin;
                     TIGRFAM: flavodoxin, long chain"
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin, long chain"
                     /protein_id="YP_005202525.1"
                     /db_xref="GI:383192398"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001226"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="GeneID:11789731"
                     /translation="MATIGIFFGSDTGQTRKVAKLIHQKLDGIADAPLDIRRATREQF
                     LSYPVLLLGTPTLGDGELPGVEAGSQYDSWQEFTNTLSEADLTGKTVALFGLGDQLNY
                     SKNFVSAMRILYDLVIARGACVVGNWPREGYKFSFSAALLENNEFVGLPLDQENQYDL
                     TEERIDSWLEKLKPAVL"
     misc_feature    95073..95597
                     /locus_tag="Rahaq2_5092"
                     /note="flavodoxin FldA; Validated; Region: PRK09267"
                     /db_xref="CDD:236439"
     gene            complement(95743..96258)
                     /locus_tag="Rahaq2_5093"
                     /note="IMG reference gene:2506712116"
                     /db_xref="GeneID:11789732"
     CDS             complement(95743..96258)
                     /locus_tag="Rahaq2_5093"
                     /note="PFAM: NifQ"
                     /codon_start=1
                     /transl_table=11
                     /product="protein NifQ"
                     /protein_id="YP_005202526.1"
                     /db_xref="GI:383192399"
                     /db_xref="InterPro:IPR006975"
                     /db_xref="GeneID:11789732"
                     /translation="MNGAQGWLSRLLSLHLTGRSRFPPQMGLGDVAWQALLQHTGRAA
                     PVLSTLQFEQQKLLGLLQQARTCEREQLAQWLAQSQVPEAAPMHELIATASMGFDHLW
                     QDLGLDSRAELRDLMTDCFPELVRMNHQNMRWKKFFYRQQCLQSLGEIVCRSPSCNEC
                     CEWHTCFAPED"
     misc_feature    complement(95755..96243)
                     /locus_tag="Rahaq2_5093"
                     /note="NifQ; Region: NifQ; pfam04891"
                     /db_xref="CDD:252860"
     gene            complement(96258..97652)
                     /locus_tag="Rahaq2_5094"
                     /note="IMG reference gene:2506712117"
                     /db_xref="GeneID:11789733"
     CDS             complement(96258..97652)
                     /locus_tag="Rahaq2_5094"
                     /note="PFAM: Radical SAM superfamily; Dinitrogenase
                     iron-molybdenum cofactor;
                     TIGRFAM: nitrogenase cofactor biosynthesis protein NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase cofactor biosynthesis protein NifB"
                     /protein_id="YP_005202527.1"
                     /db_xref="GI:383192400"
                     /db_xref="InterPro:IPR000385"
                     /db_xref="InterPro:IPR003731"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:11789733"
                     /translation="MTSCPSSAGCSGQSPSRVNEQLARKAAQHPCYSVSGHHRFARMH
                     LAVAPACNLQCHYCNRKYDCSNESRPGVVSELLLPEQAVAKARQVAAAIPQLSVVGIA
                     GPGDPLANIGRTFQTLELLRQQLPDLKLCLSTNGLMLPDVVDRLVDIGVDHVTVTMNA
                     LDPAVAEKIYAWLWYEGERYTGRMAADLLIERQAEGIRKLIEKGVLVKINSVLIPGIN
                     DQHMQAVSQQAGEWGAFLHNIMPLISRPEHGTVFGLNGQAEPDADMVASVRKSCGMSM
                     PQMTHCHQCRADAIGMLGEDRNAAFPLASVPVNPPPYLPVLHQRAQLHASIVSQGGSE
                     EADACLVAVATSQGQAVDQHFGHADRFTLYSLSAAGVMQVGQRFTPRYCRSPDDCEPE
                     DAAQNMDALLELLADVKAVFCARIGLTPWKRLEAAGIEPQVDGAWQPVETALAQWWQQ
                     RKLAGGEISIRGVA"
     misc_feature    complement(96315..97601)
                     /locus_tag="Rahaq2_5094"
                     /note="nitrogenase cofactor biosynthesis protein NifB;
                     Region: nifB; TIGR01290"
                     /db_xref="CDD:233344"
     misc_feature    complement(96930..97520)
                     /locus_tag="Rahaq2_5094"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(96936..96941,97017..97019,97182..97184,
                     97248..97256,97335..97340,97356..97358,97476..97484,
                     97488..97490,97494..97496,97500..97502))
                     /locus_tag="Rahaq2_5094"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(96309..96635)
                     /locus_tag="Rahaq2_5094"
                     /note="NifB belongs to a family of iron-molybdenum
                     cluster-binding proteins that includes NifX, and NifY, all
                     of which are involved in the synthesis of an
                     iron-molybdenum cofactor (FeMo-co) that binds the active
                     site of the dinitrogenase enzyme as part of...; Region:
                     NifB; cd00852"
                     /db_xref="CDD:238432"
     gene            complement(97846..99402)
                     /locus_tag="Rahaq2_5095"
                     /note="IMG reference gene:2506712118"
                     /db_xref="GeneID:11789734"
     CDS             complement(97846..99402)
                     /locus_tag="Rahaq2_5095"
                     /note="PFAM: GAF domain; Bacterial regulatory protein, Fis
                     family; Sigma-54 interaction domain;
                     TIGRFAM: Nif-specific regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Nif-specific regulatory protein"
                     /protein_id="YP_005202528.1"
                     /db_xref="GI:383192401"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR010113"
                     /db_xref="InterPro:IPR020441"
                     /db_xref="GeneID:11789734"
                     /translation="MTQLPTAGPVIRRFDMSAQFTALYRISVALSQESNTARALAAIL
                     EVLHDHAFMQYGMVCLFDKERNALFVESLHGIDGERKKETRHVRYRMGEGVIGAVMSQ
                     RQALVLPRISDDQRFLDRLNIYDYSLPLIGVPIPGADNQPAGVLVAQPMALHEDRLAA
                     STRFLEMVANLISQPLRSATPPESLPAQTPVRCSVPRQFGFEQMVGKSQAMRQTMDIL
                     RQVSKWDTTVLVRGESGTGKELIANAIHYNSPRAAAPFVKFNCAALPDNLLESELFGH
                     EKGAFTGAIRTRKGRFELADGGTLFLDEIGESSASFQAKLLRILQEGEMERVGGDTTL
                     KVDVRIIAATNRNLEEEVRAGNFREDLYYRLNVMPVSLPALRERLDDIADLAPFLVKK
                     IALRQGRELRISDGAVRLLMTYSWPGNVRELENCLERASVMTDEGLIDRDVILFNHHE
                     SPALSVKPGLPLATDESWLDQELDERQRVIAALEKTGWVQAKAARLLGMTPRQIAYRI
                     QIMDINMHRI"
     misc_feature    complement(97849..99348)
                     /locus_tag="Rahaq2_5095"
                     /note="Nif-specific regulatory protein; Region: nifA;
                     TIGR01817"
                     /db_xref="CDD:233584"
     misc_feature    complement(98848..99300)
                     /locus_tag="Rahaq2_5095"
                     /note="Domain present in phytochromes and cGMP-specific
                     phosphodiesterases; Region: GAF; smart00065"
                     /db_xref="CDD:214500"
     misc_feature    complement(98305..98772)
                     /locus_tag="Rahaq2_5095"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(98686..98709)
                     /locus_tag="Rahaq2_5095"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(98368..98370,98494..98496,98683..98706))
                     /locus_tag="Rahaq2_5095"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(98491..98508)
                     /locus_tag="Rahaq2_5095"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(98311..98313)
                     /locus_tag="Rahaq2_5095"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(97870..97980)
                     /locus_tag="Rahaq2_5095"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(99399..100886)
                     /locus_tag="Rahaq2_5096"
                     /note="IMG reference gene:2506712119"
                     /db_xref="GeneID:11789735"
     CDS             complement(99399..100886)
                     /locus_tag="Rahaq2_5096"
                     /note="PFAM: PAS fold;
                     TIGRFAM: PAS domain S-box; nitrogen fixation negative
                     regulator NifL"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation negative regulator NifL"
                     /protein_id="YP_005202529.1"
                     /db_xref="GI:383192402"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="InterPro:IPR014285"
                     /db_xref="GeneID:11789735"
                     /translation="MSITALSASFPEGNIASRLSLQHPSLFYTVVEQSSVAISLTDPQ
                     ARICYANPAFCRQTGFALETLLGENHRLLASQQTPKHIYDEMWRTLLQGKSWNGQLIN
                     RRNNRSLYLADVTITPVLGADGQVEHYLGMHKDISEKYALEQRLRNHITLFTEVLNNI
                     PAAVVVVDEQDNVVMDNLAYKTLCADCGGKELLAEMGYPQLKEMLNSGEPVPVSMRGN
                     VRWFSFGQWSLQGVNEEASRFFTGITAPGKLIVLTDCTDQHHRQQQGYLDRLKQKLTN
                     GKLLAAIRESLDAALIQLNGPINMLAAARRLNGEEGNNMALEFAWREGEQAVSRLQAC
                     RPSLDFEPQAEWPVSEFFDDLSALYDSHFLSDGELRYVVMPSDLHAVGQRTQILTALS
                     LWIDHTLSQAQAMPSLKLSVNIVAKQDASWLCFDITDNVPRERVRYARPEAAFSRPGN
                     GMELRLIQTLIAHHRGSLDLSVRPDGGTLLTLRLPVQQVITGGLK"
     misc_feature    complement(99429..100817)
                     /locus_tag="Rahaq2_5096"
                     /note="nitrogen fixation negative regulator NifL; Region:
                     nifL_nitrog; TIGR02938"
                     /db_xref="CDD:131984"
     misc_feature    complement(100479..100787)
                     /locus_tag="Rahaq2_5096"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(100566..100568,100581..100583,
                     100659..100670,100707..100709,100725..100727,
                     100737..100739))
                     /locus_tag="Rahaq2_5096"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(100539..100541,100545..100547,
                     100629..100634,100641..100643,100665..100667,
                     100677..100679))
                     /locus_tag="Rahaq2_5096"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(99807..100127)
                     /locus_tag="Rahaq2_5096"
                     /note="Protein of unknown function (DUF3209); Region:
                     DUF3209; pfam11483"
                     /db_xref="CDD:151921"
     misc_feature    complement(99435..99731)
                     /locus_tag="Rahaq2_5096"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(99447..99449,99453..99458,99471..99473,
                     99477..99479,99525..99536,99600..99602,99606..99608,
                     99699..99701,99708..99710))
                     /locus_tag="Rahaq2_5096"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(99708..99710)
                     /locus_tag="Rahaq2_5096"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(99528..99530,99534..99536))
                     /locus_tag="Rahaq2_5096"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(101189..101983)
                     /locus_tag="Rahaq2_5097"
                     /note="IMG reference gene:2506712120"
                     /db_xref="GeneID:11789736"
     CDS             complement(101189..101983)
                     /locus_tag="Rahaq2_5097"
                     /note="PFAM: PPIC-type PPIASE domain;
                     TIGRFAM: nitrogen fixation protein NifM"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation protein NifM"
                     /protein_id="YP_005202530.1"
                     /db_xref="GI:383192403"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="InterPro:IPR023058"
                     /db_xref="GeneID:11789736"
                     /translation="MSIPVWHRYSRWKLAKQMKLSEELNPTPAQYQQFIEAWQRQQVI
                     EEAVAQAALEHALNIEPQSVEVTRQALAAELPELELTATETEELLLHQTLLREQLNWV
                     QQQAPLPDDAQVEAWYRGHAQHFVRPEQRYTRHLLLTVEGNSPAVREQIDAIARRLRD
                     GHALFARQALRYSHCPSAMGGGVLGWVGRGILYPQLEDTLFRLEAGQLSSPVETELGW
                     HLLLCEQIRLPQPLPKAEALTRVRQQLIARQQNHYQRQWLQQLINA"
     misc_feature    complement(101198..101962)
                     /locus_tag="Rahaq2_5097"
                     /note="nitrogen fixation protein NifM; Region:
                     nifM_nitrog; TIGR02933"
                     /db_xref="CDD:131979"
     misc_feature    complement(101312..101581)
                     /locus_tag="Rahaq2_5097"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:250020"
     gene            complement(101980..102423)
                     /locus_tag="Rahaq2_5098"
                     /note="IMG reference gene:2506712121"
                     /db_xref="GeneID:11789737"
     CDS             complement(101980..102423)
                     /locus_tag="Rahaq2_5098"
                     /note="PFAM: NifZ domain"
                     /codon_start=1
                     /transl_table=11
                     /product="NifZ domain-containing protein"
                     /protein_id="YP_005202531.1"
                     /db_xref="GI:383192404"
                     /db_xref="InterPro:IPR007415"
                     /db_xref="GeneID:11789737"
                     /translation="MKPVFEVDQQVRVTRIVRDDGTFAGKTCGDLLIRRGSLGYVREW
                     GVFLQDTIVYQVHFLDDDLIIGCREQELIAGDAPWLAGAFQYGDRVSSRRSLVIRGEV
                     VVPQGGMGRVMSCEPLDSIFHYQVLFAQRIFQVPEHALKLEEELA"
     misc_feature    complement(102202..102423)
                     /locus_tag="Rahaq2_5098"
                     /note="NifZ domain; Region: NifZ; pfam04319"
                     /db_xref="CDD:146779"
     gene            complement(102420..102758)
                     /locus_tag="Rahaq2_5099"
                     /note="IMG reference gene:2506712122"
                     /db_xref="GeneID:11789738"
     CDS             complement(102420..102758)
                     /locus_tag="Rahaq2_5099"
                     /note="PFAM: Nitrogen fixation protein NifW"
                     /codon_start=1
                     /transl_table=11
                     /product="Nitrogen fixation protein NifW"
                     /protein_id="YP_005202532.1"
                     /db_xref="GI:383192405"
                     /db_xref="InterPro:IPR004893"
                     /db_xref="GeneID:11789738"
                     /translation="MDWFTRIEGVDELESAQSFFDFFELEVDPVLLRSRHLHIMAQFN
                     QRLTAAVPVHFVDEEESDRADWRLARRLLAESYQHTVAGPLNTQSGLAVYQRNNGSFI
                     DWNDLLEVRP"
     misc_feature    complement(102432..102743)
                     /locus_tag="Rahaq2_5099"
                     /note="Nitrogen fixation protein NifW; Region: NifW;
                     cl03935"
                     /db_xref="CDD:261951"
     gene            complement(102760..103962)
                     /locus_tag="Rahaq2_5100"
                     /note="IMG reference gene:2506712123"
                     /db_xref="GeneID:11789739"
     CDS             complement(102760..103962)
                     /locus_tag="Rahaq2_5100"
                     /note="PFAM: HMGL-like;
                     TIGRFAM: homocitrate synthase NifV"
                     /codon_start=1
                     /transl_table=11
                     /product="homocitrate synthase NifV"
                     /protein_id="YP_005202533.1"
                     /db_xref="GI:383192406"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:11789739"
                     /translation="MAASEAERTGGGNRPVAVTINDTTLRDGEQSPGVAFRASEKMEI
                     AQALVNAGVRELEAGTPALGEEECVRLAILRRQLPDTVMMSWCRMNSAEIHDSARVGM
                     DWVDISVPASDLLREQKLHRPWPAVIASLKPLVQLAHRLGMRVCMGCEDASRSADETL
                     HMLAEVAADLGIERMRFADTLGILDPFSTFTRISALRQHWHGGLEIHAHNDLGMATAN
                     TLAAVRAGATHVNTTVLGLGERAGNAALESVTLSLDRCLHLDCGIDFTELPALCRLVA
                     AAAGRTIDVQHPLVGGQVFTHESGLHVAALLRDPRSYQGIDPSLVGREFNLVLGKHSG
                     RQAVSGICARLGYILSETQTLLMLQEVKRFAEHFKRNPGEDEVIAMCQMRMDDQIPFE
                     GQLQAQGG"
     misc_feature    complement(102820..103914)
                     /locus_tag="Rahaq2_5100"
                     /note="homocitrate synthase NifV; Region: nifV_homocitr;
                     TIGR02660"
                     /db_xref="CDD:233965"
     misc_feature    complement(103129..103905)
                     /locus_tag="Rahaq2_5100"
                     /note="DRE-TIM metallolyase superfamily; Region:
                     DRE_TIM_metallolyase; cl18962"
                     /db_xref="CDD:267315"
     misc_feature    complement(order(103234..103236,103336..103338,
                     103342..103344,103423..103425,103429..103431,
                     103513..103515,103639..103641,103699..103701,
                     103705..103707,103792..103794,103873..103875,
                     103882..103887))
                     /locus_tag="Rahaq2_5100"
                     /note="active site"
                     /db_xref="CDD:163674"
     misc_feature    complement(order(103792..103794,103882..103887))
                     /locus_tag="Rahaq2_5100"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163674"
     misc_feature    complement(order(103336..103338,103342..103344,
                     103429..103431,103882..103884))
                     /locus_tag="Rahaq2_5100"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163674"
     gene            complement(103978..105183)
                     /locus_tag="Rahaq2_5101"
                     /note="IMG reference gene:2506712124"
                     /db_xref="GeneID:11789740"
     CDS             complement(103978..105183)
                     /locus_tag="Rahaq2_5101"
                     /note="PFAM: Aminotransferase class-V;
                     TIGRFAM: cysteine desulfurase NifS"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase NifS"
                     /protein_id="YP_005202534.1"
                     /db_xref="GI:383192407"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR016454"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="GeneID:11789740"
                     /translation="MKNVYLDNNATTRIDPMVLEAMMPYLRDYYGNPSSIHDFGGPCR
                     AGLECAREQVASLLGAAYTSEIIFTSCATEATSTAIYSAIALAPERREIITTAVEHPA
                     TLAVCEHLERQGYMIHRIGVSEEGALDTAHYYDALSENVALVTMMWANNETGVLFPVS
                     EMATAAHERGILFHCDAVQAVGKIPISLRATDIDMLSCSAHKIHGPKGCGCLYLRRNT
                     RFRPLVRGGHQERGRRAGTENIAGIVGMGAACELADVHMPMMASVQEMRDRLETGLLT
                     TIPHTLLMGANQPRTPNTVNIAFEYIEGEAILLLLNHCGIAASSGSACTSGSLESSHV
                     MRAMNIPYTAAHGSIRFSLSRFTREREIEWAIEQMPDIVARLRTLSPYWQQDKVQIAQ
                     GGLFAPTYG"
     misc_feature    complement(104038..105174)
                     /locus_tag="Rahaq2_5101"
                     /note="cysteine desulfurase NifS; Region: FeS_nifS;
                     TIGR03402"
                     /db_xref="CDD:132443"
     misc_feature    complement(order(104578..104580,104587..104589,
                     104647..104649,104656..104658,104740..104742,
                     104956..104958,104965..104970))
                     /locus_tag="Rahaq2_5101"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(104578..104580)
                     /locus_tag="Rahaq2_5101"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(105229..106056)
                     /locus_tag="Rahaq2_5102"
                     /note="IMG reference gene:2506712125"
                     /db_xref="GeneID:11789741"
     CDS             complement(105229..106056)
                     /locus_tag="Rahaq2_5102"
                     /note="PFAM: NifU-like N terminal domain; BFD-like
                     [2Fe-2S] binding domain; NifU-like domain;
                     TIGRFAM: Fe-S cluster assembly protein NifU"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly protein NifU"
                     /protein_id="YP_005202535.1"
                     /db_xref="GI:383192408"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR007419"
                     /db_xref="InterPro:IPR010238"
                     /db_xref="InterPro:IPR016217"
                     /db_xref="GeneID:11789741"
                     /translation="MWNYSEKVKEHFFNPRNAKVVDDANAIGDVGSLSCGDALRLMLK
                     VDPETEIILDAGFQTFGCGSAIASSSALTELIIGRSLTQAQQVSNQQIADYLDGLPPE
                     KMHCSVMGQEALRAAINNFRGEAPDEDHEEGALICKCFAVDEAQIRRAVLANGLTTLE
                     DVINYTKAGGGCTSCHEKIELCLEEILKEHPVKNPVAAKVRDENWLAVEEVVASLRPH
                     IRADGGDMSLVRVDGQEVTVELSGSCSGCMMTDMTLAWLQQKLVERMGRYIRVVSAA"
     misc_feature    complement(105235..106056)
                     /locus_tag="Rahaq2_5102"
                     /note="Fe-S cluster assembly protein NifU; Region:
                     NifU_proper; TIGR02000"
                     /db_xref="CDD:233679"
     misc_feature    complement(105706..106047)
                     /locus_tag="Rahaq2_5102"
                     /note="Iron-sulfur cluster scaffold-like proteins; Region:
                     IscU_like; cd06664"
                     /db_xref="CDD:143480"
     misc_feature    complement(order(105739..105744,105748..105753,
                     105865..105867,105871..105873,105949..105954,
                     106027..106032,106039..106047))
                     /locus_tag="Rahaq2_5102"
                     /note="trimerization site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143480"
     misc_feature    complement(order(105739..105741,105871..105873,
                     105952..105954))
                     /locus_tag="Rahaq2_5102"
                     /note="active site"
                     /db_xref="CDD:143480"
     misc_feature    complement(105496..105657)
                     /locus_tag="Rahaq2_5102"
                     /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
                     pfam04324"
                     /db_xref="CDD:252526"
     misc_feature    complement(105235..105435)
                     /locus_tag="Rahaq2_5102"
                     /note="NifU-like domain; Region: NifU; pfam01106"
                     /db_xref="CDD:144628"
     gene            complement(106074..106412)
                     /locus_tag="Rahaq2_5103"
                     /note="IMG reference gene:2506712126"
                     /db_xref="GeneID:11789742"
     CDS             complement(106074..106412)
                     /locus_tag="Rahaq2_5103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005202536.1"
                     /db_xref="GI:383192409"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="GeneID:11789742"
                     /translation="MMVIEPAVFDRLLALQRQLSPQGGGLRMTLGGDPCGGWKVGLHW
                     SAAFRPRDHVEMINGLRLLADPLHWTLLQHATLSAGEQNSCAGIRVVLPAASACHCES
                     GSCTTSPEPD"
     gene            complement(106567..107031)
                     /locus_tag="Rahaq2_5104"
                     /note="IMG reference gene:2506712127"
                     /db_xref="GeneID:11789743"
     CDS             complement(106567..107031)
                     /locus_tag="Rahaq2_5104"
                     /note="PFAM: Dinitrogenase iron-molybdenum cofactor"
                     /codon_start=1
                     /transl_table=11
                     /product="dinitrogenase iron-molybdenum cofactor
                     biosynthesis protein"
                     /protein_id="YP_005202537.1"
                     /db_xref="GI:383192410"
                     /db_xref="InterPro:IPR003731"
                     /db_xref="GeneID:11789743"
                     /translation="MRRANRYLDTVSVTQWPMQVAFASSDYHHVDQHFGASTRLVVYG
                     VKQDQVQLLRVAEFSAESGHQQEKIACRMAALEDCVTLYCLAIGDSVFRQLLEIGVRA
                     IKVPQDTDIAHLLKQMQQHWSAAERQVTRRGRDPGRFDKLLAGDEWQEEDRP"
     misc_feature    complement(106675..106974)
                     /locus_tag="Rahaq2_5104"
                     /note="NifX belongs to a family of iron-molybdenum
                     cluster-binding proteins that includes NifB,  and NifY,
                     all of which are involved in the synthesis of an
                     iron-molybdenum cofactor (FeMo-co) that binds the active
                     site of the dinitrogenase enzyme.  The protein...; Region:
                     NifX; cd00853"
                     /db_xref="CDD:238433"
     gene            complement(107018..108403)
                     /locus_tag="Rahaq2_5105"
                     /note="IMG reference gene:2506712128"
                     /db_xref="GeneID:11789744"
     CDS             complement(107018..108403)
                     /locus_tag="Rahaq2_5105"
                     /note="PFAM: Nitrogenase component 1 type Oxidoreductase;
                     TIGRFAM: nitrogenase molybdenum-iron cofactor biosynthesis
                     protein NifN"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase molybdenum-iron cofactor
                     biosynthesis protein NifN"
                     /protein_id="YP_005202538.1"
                     /db_xref="GI:383192411"
                     /db_xref="InterPro:IPR000318"
                     /db_xref="InterPro:IPR000510"
                     /db_xref="GeneID:11789744"
                     /translation="MAQILRNAKPLATTPVKSGQPLGAILASQGLENCIPLVHGAQGC
                     SAFAKVFFIQHFHDPIPLQSTAMESTTTIMGSDGNVSTALTTLCQRSNPKAIVILSTG
                     LSEAQGSDLSMALREFRDKEPRFNAIAILTVNTPDFYGSLENGYSALMESVITQWVPE
                     KPPTGMRNKRVNLLVSHLLTPGDLELLRSYVEAFGLQPVILPDLSQSLDGHLANGDFN
                     PVTQGGTSQRQIEQMGQSLTTITIGSSLNCAASLMAMRSRGMALNLPHLMTLENMDSL
                     IRHLHQVSGREVPAWIERQRGQLLDAMIDCHTWLQSQRIALAAEADLLVAWCDFAQSQ
                     GMRVGPVIAPVNQQSLAGLPVEQVVIGDLEDLQTRLDSYPVSLLVANSHAAPLAEKNG
                     IALVRAGFPLYDRLGEFRRVRQGYAGIRDTLFELANLMQARHHMLTAYHSPLKQVFGL
                     SPVPEASHEAR"
     misc_feature    complement(107099..108373)
                     /locus_tag="Rahaq2_5105"
                     /note="Nitrogenase molybdenum-iron protein, alpha and beta
                     chains [Energy production and conversion]; Region: NifD;
                     COG2710"
                     /db_xref="CDD:225335"
     misc_feature    complement(107111..108370)
                     /locus_tag="Rahaq2_5105"
                     /note="Nitrogenase_nifN1: A subgroup of the NifN subunit
                     of the NifEN complex: NifN forms an alpha2beta2 tetramer
                     with NifE.  NifN and nifE are structurally homologous to
                     nitrogenase MoFe protein beta and alpha subunits
                     respectively.  NifEN participates in the...; Region:
                     Nitrogenase_NifN_1; cd01966"
                     /db_xref="CDD:238928"
     gene            complement(108453..109826)
                     /locus_tag="Rahaq2_5106"
                     /note="IMG reference gene:2506712129"
                     /db_xref="GeneID:11789745"
     CDS             complement(108453..109826)
                     /locus_tag="Rahaq2_5106"
                     /note="PFAM: Nitrogenase component 1 type Oxidoreductase;
                     TIGRFAM: nitrogenase molybdenum-iron cofactor biosynthesis
                     protein NifE"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase molybdenum-iron cofactor
                     biosynthesis protein NifE"
                     /protein_id="YP_005202539.1"
                     /db_xref="GI:383192412"
                     /db_xref="InterPro:IPR000318"
                     /db_xref="InterPro:IPR000510"
                     /db_xref="GeneID:11789745"
                     /translation="MKAKEILALIDEPACEHNHKQKSGCSLPKPGATAGGCAFDGAQI
                     ALLPVADVAHLVHGPIGCTGSSWDNRGSRSSGPSINRMGFTTDMSEQDVIMGRGERRL
                     FHAVQHIVSHYHPVAVFIYNTCVPAMEGDDVEAVCRAASAAAGVPVISVDAAGFYGSK
                     NLGNRIAGDVMVKKVIGQREPAPWPENSPIPAGHRHSISLIGEFNIAGEFWHVLPLLD
                     ELGIRVLCSLSGDSRFAEIQTMHRGEANMLVCSRALINVARKMEERYQIPWFEGSFYG
                     LRSMADSLRTIAVLLKDPDLQARTERLIEREEAATHLALAPYRARLSGRKALLYTGGV
                     KSWSVVSALQDLGITVVATGTRKSTEEDKQRIRELMGEDVLMLDEGNARTLLDTLYRF
                     GGDIMIAGGRNMYTAYKARLPFLDINQEREHAFAGYHGLVNLAEQLCITLESPVWAQV
                     NRLAPWR"
     misc_feature    complement(108465..109823)
                     /locus_tag="Rahaq2_5106"
                     /note="nitrogenase molybdenum-iron cofactor biosynthesis
                     protein NifE; Region: nifE; TIGR01283"
                     /db_xref="CDD:188126"
     misc_feature    complement(108459..109787)
                     /locus_tag="Rahaq2_5106"
                     /note="Nitrogenase molybdenum-iron protein, alpha and beta
                     chains [Energy production and conversion]; Region: NifD;
                     COG2710"
                     /db_xref="CDD:225335"
     gene            complement(109998..110672)
                     /locus_tag="Rahaq2_5107"
                     /note="IMG reference gene:2506712130"
                     /db_xref="GeneID:11789746"
     CDS             complement(109998..110672)
                     /locus_tag="Rahaq2_5107"
                     /note="PFAM: Dinitrogenase iron-molybdenum cofactor;
                     TIGRFAM: nitrogen fixation protein NifX"
                     /codon_start=1
                     /transl_table=11
                     /product="dinitrogenase iron-molybdenum cofactor
                     biosynthesis protein"
                     /protein_id="YP_005202540.1"
                     /db_xref="GI:383192413"
                     /db_xref="InterPro:IPR003731"
                     /db_xref="GeneID:11789746"
                     /translation="MSKDDLLFWRLFAVVQLFPEIPPPEVLAWLTQGSREGDGNIGLA
                     HLQAMSLEELEATFPGDAGKVTVSRWQSLMSCLQGQLPPHLTLNENRRQPQQLRVAFS
                     SLDGITVNGHFGQSHLFFIYAFDSDGPYLMALRRTPVSPEGEESNETRARLISDCHLL
                     FCEAIGGPAAARVIRHNIHPIKVLPGVSIASQLAALQRMLTENMPPWLARRLGKSNPL
                     ENRLFS"
     misc_feature    complement(110082..110381)
                     /locus_tag="Rahaq2_5107"
                     /note="NifX belongs to a family of iron-molybdenum
                     cluster-binding proteins that includes NifB,  and NifY,
                     all of which are involved in the synthesis of an
                     iron-molybdenum cofactor (FeMo-co) that binds the active
                     site of the dinitrogenase enzyme.  The protein...; Region:
                     NifX; cd00853"
                     /db_xref="CDD:238433"
     gene            complement(110687..110902)
                     /locus_tag="Rahaq2_5108"
                     /note="IMG reference gene:2506712131"
                     /db_xref="GeneID:11789747"
     CDS             complement(110687..110902)
                     /locus_tag="Rahaq2_5108"
                     /note="PFAM: NifT/FixU protein;
                     TIGRFAM: probable nitrogen fixation protein FixT"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nitrogen fixation protein FixT"
                     /protein_id="YP_005202541.1"
                     /db_xref="GI:383192414"
                     /db_xref="InterPro:IPR009727"
                     /db_xref="GeneID:11789747"
                     /translation="MPMVIFRLRNNSLYCYIAKQDMEAKVVQLEHNHPQQWGGRVCLE
                     GGKAYYVEPQPGIPSFPVSLRATRSEL"
     misc_feature    complement(110705..110896)
                     /locus_tag="Rahaq2_5108"
                     /note="NifT/FixU protein; Region: NifT; pfam06988"
                     /db_xref="CDD:254006"
     gene            complement(110978..112546)
                     /locus_tag="Rahaq2_5109"
                     /note="IMG reference gene:2506712132"
                     /db_xref="GeneID:11789748"
     CDS             complement(110978..112546)
                     /locus_tag="Rahaq2_5109"
                     /note="PFAM: Domain of unknown function (DUF3364);
                     Nitrogenase component 1 type Oxidoreductase;
                     TIGRFAM: nitrogenase molybdenum-iron protein beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase molybdenum-iron protein subunit
                     beta"
                     /protein_id="YP_005202542.1"
                     /db_xref="GI:383192415"
                     /db_xref="InterPro:IPR000318"
                     /db_xref="InterPro:IPR000510"
                     /db_xref="GeneID:11789748"
                     /translation="MSQDLGTPKSCFPLFEQDEYQNMFTHKRALEEAHGEAKVREVFE
                     WTTTQEYQDLNFSREALTVDPAKACQPLGAVLCALGFTNTLPYVHGSQGCVAYFRTYF
                     NRHFKEPVACVSDSMTEDAAVFGGNNNMNVGLENASALYKPEIIAVSTTCMAEVIGDD
                     LQAFIANAKKDGFVDAGMPIPYAHTPSFLGSHVTGWDNMFEGFARTFTTDATREYQPG
                     KLAKLNVVTGFETYLGNYRVIHRMMSQMGVECSVLSDPSEVLDTPADGQYRMYAGGTT
                     QTEMRDAPDAIDTLLLQPWQLQKTKKVVQGDWNQPGTEVSVPIGLAATDALLMTVSEL
                     TGKPIADALATERGRLVDMMLDSHTWLHGKRFGLYGDPDFVMGMTAFLLELGCEPTTI
                     LSHNGNKRWQKAMKKMLADSPYGQDSEVYVNCDLWHFRSLMFTRKPDFMIGNSYGKFI
                     QRDTLAKGEQFEVPLIRIGFPIFDRHHLHRQTTWGYEGAMSILTQLVNAVLEQLDRET
                     MKLGKTDYNFDLIR"
     misc_feature    complement(110981..112543)
                     /locus_tag="Rahaq2_5109"
                     /note="nitrogenase molybdenum-iron protein beta chain;
                     Region: nifK; TIGR01286"
                     /db_xref="CDD:130353"
     misc_feature    complement(112382..112522)
                     /locus_tag="Rahaq2_5109"
                     /note="Domain of unknown function (DUF3364); Region:
                     DUF3364; pfam11844"
                     /db_xref="CDD:152280"
     misc_feature    complement(111041..112375)
                     /locus_tag="Rahaq2_5109"
                     /note="Nitrogenase_MoFe_beta: Nitrogenase MoFe protein,
                     beta subunit. The nitrogenase enzyme catalyzes the
                     ATP-dependent reduction of dinitrogen to ammonia. The
                     Molybdenum (Mo-) nitrogenase is the most widespread and
                     best characterized of these systems; Region:
                     Nitrogenase_MoFe_beta; cd01974"
                     /db_xref="CDD:238934"
     misc_feature    complement(order(111089..111091,111200..111202,
                     111209..111211,111266..111268,111395..111397,
                     111461..111463,111479..111484,111491..111496,
                     111506..111508,111515..111517,111533..111535,
                     111539..111541,111548..111553,111560..111562,
                     111572..111574,111584..111586,111737..111739,
                     111743..111745,111752..111763,111983..111988,
                     112076..112081,112088..112093,112124..112132,
                     112136..112141,112148..112153,112160..112162,
                     112190..112195,112202..112216,112220..112228,
                     112235..112240,112244..112261,112271..112276,
                     112292..112294,112331..112333,112340..112348,
                     112352..112375))
                     /locus_tag="Rahaq2_5109"
                     /note="MoFe protein beta/alpha subunit interactions; other
                     site"
                     /db_xref="CDD:238934"
     misc_feature    complement(order(111986..111988,112091..112096,
                     112253..112258,112265..112270,112274..112276,
                     112334..112336,112340..112342))
                     /locus_tag="Rahaq2_5109"
                     /note="Beta subunit P cluster binding residues; other
                     site"
                     /db_xref="CDD:238934"
     misc_feature    complement(order(111983..111985,111995..111997,
                     112058..112063,112067..112069,112073..112078,
                     112082..112084,112175..112183,112190..112192))
                     /locus_tag="Rahaq2_5109"
                     /note="MoFe protein beta subunit/Fe protein contacts;
                     other site"
                     /db_xref="CDD:238934"
     misc_feature    complement(order(111050..111055,111062..111064,
                     111149..111151))
                     /locus_tag="Rahaq2_5109"
                     /note="MoFe protein dimer/ dimer interactions; other site"
                     /db_xref="CDD:238934"
     gene            complement(112603..114051)
                     /locus_tag="Rahaq2_5110"
                     /note="IMG reference gene:2506712133"
                     /db_xref="GeneID:11789749"
     CDS             complement(112603..114051)
                     /locus_tag="Rahaq2_5110"
                     /note="PFAM: Nitrogenase component 1 type Oxidoreductase;
                     TIGRFAM: nitrogenase component I, alpha chain; nitrogenase
                     molybdenum-iron protein alpha chain"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase molybdenum-iron protein subunit
                     alpha"
                     /protein_id="YP_005202543.1"
                     /db_xref="GI:383192416"
                     /db_xref="InterPro:IPR000318"
                     /db_xref="InterPro:IPR000510"
                     /db_xref="GeneID:11789749"
                     /translation="MTSETRERNEALIQEVLEIFPEKALKDRKKHMMTTDPAMESVGK
                     CIVSNRKSQPGVMTVRGCAYAGSKGVVFGPIKDMAHISHGPVGCGQYSRAGRRNYYTG
                     WSGVNSFGTLNFTSDFQERDIVFGGDKKLDKLIDELEMLFPLTKGISVQSECPVGLIG
                     DDISAVAKASSAKIGKPVVPVRCEGFRGVSQSLGHHIANDVIRDWVLDNREGNEFETT
                     PYDVAIIGDYNIGGDAWASRILLEEMGLRVVAQWSGDGTLVEMENTPKVALNLVHCYR
                     SMNYISRHMEEKHGIPWMEYNFFGPTKIAESLREIAARFDDTIRKNAEAVIEKYQAQT
                     QAVIDKYRPRLEGKKVLLYLGGLRPRHIIGAYEDLGMEIIGTGYEFGHNDDYDRTLPM
                     LKEGTLLFDDLSSYELEAFVKALKPDLVGSGIKEKYIFQKMGVPFRQMHSWDYSGPYH
                     GYDGFGIFARDMDMTLNNPGWSQLTAPWLKTA"
     misc_feature    complement(112612..113985)
                     /locus_tag="Rahaq2_5110"
                     /note="Nitrogenase molybdenum-iron protein, alpha and beta
                     chains [Energy production and conversion]; Region: NifD;
                     COG2710"
                     /db_xref="CDD:225335"
     misc_feature    complement(112648..113916)
                     /locus_tag="Rahaq2_5110"
                     /note="Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe
                     protein, beta subunit. A group of proteins similar to the
                     alpha subunit of the MoFe protein of the molybdenum (Mo-)
                     nitrogenase. The nitrogenase enzyme catalyzes the
                     ATP-dependent reduction of dinitrogen to...; Region:
                     Nitrogenase_MoFe_alpha; cd01976"
                     /db_xref="CDD:238935"
     misc_feature    complement(order(112648..112650,112657..112659,
                     112672..112674,112681..112686,112693..112695,
                     112711..112713,112738..112740,112756..112761,
                     112765..112770,112777..112782,112825..112827,
                     112834..112839,113053..113055,113272..113277,
                     113305..113310,113347..113349,113356..113361,
                     113485..113490,113494..113499,113626..113634,
                     113638..113643,113662..113664,113683..113685,
                     113692..113703,113707..113709,113713..113718,
                     113752..113757,113761..113763,113767..113769,
                     113773..113784,113797..113799,113824..113826,
                     113857..113859,113869..113874,113881..113892,
                     113896..113901))
                     /locus_tag="Rahaq2_5110"
                     /note="MoFe protein alpha/beta subunit interactions; other
                     site"
                     /db_xref="CDD:238935"
     misc_feature    complement(order(113497..113499,113590..113592,
                     113788..113793,113797..113799,113860..113862,
                     113866..113868))
                     /locus_tag="Rahaq2_5110"
                     /note="Alpha subunit P cluster binding residues; other
                     site"
                     /db_xref="CDD:238935"
     misc_feature    complement(order(112729..112731,112912..112914,
                     112978..112980,112984..112992,113230..113232,
                     113362..113364,113368..113370,113467..113469,
                     113764..113766,113842..113844))
                     /locus_tag="Rahaq2_5110"
                     /note="FeMoco binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:238935"
     misc_feature    complement(order(113473..113475,113494..113496,
                     113500..113502,113566..113577,113581..113583,
                     113680..113685,113689..113694))
                     /locus_tag="Rahaq2_5110"
                     /note="MoFe protein alpha subunit/Fe protein contacts;
                     other site"
                     /db_xref="CDD:238935"
     misc_feature    complement(order(112657..112662,112696..112698,
                     112762..112764,112771..112773,113035..113037,
                     113041..113046,113053..113061,113065..113070))
                     /locus_tag="Rahaq2_5110"
                     /note="MoFe protein dimer/ dimer interactions; other site"
                     /db_xref="CDD:238935"
     gene            complement(114125..115000)
                     /locus_tag="Rahaq2_5111"
                     /note="IMG reference gene:2506712134"
                     /db_xref="GeneID:11789750"
     CDS             complement(114125..115000)
                     /locus_tag="Rahaq2_5111"
                     /note="PFAM: 4Fe-4S iron sulfur cluster binding proteins,
                     NifH/frxC family;
                     TIGRFAM: nitrogenase iron protein"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase subunit NifH (ATPase)"
                     /protein_id="YP_005202544.1"
                     /db_xref="GI:383192417"
                     /db_xref="InterPro:IPR000392"
                     /db_xref="InterPro:IPR005977"
                     /db_xref="GeneID:11789750"
                     /translation="MAMRQCAIYGKGGIGKSTTTQNLVAALAEMNKKVMIVGCDPKAD
                     STRLILHAKAQNTIMEMAAEVGSVEDLELEDVMQIGYGGVRCAESGGPEPGVGCAGRG
                     VITAINFLEEEGAYVPDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
                     AANNISKGIVKYAKSGKVRLAGLICNSRQTDREDELIIALAEKLGTQMIHFVPRDNIV
                     QRAEIRRMTVIEYDPTCAQADQYRALANKIVNNTKMVVPTPVTMDELEALLMEFGIME
                     EEDLTIVGRTAAEEA"
     misc_feature    complement(114182..114994)
                     /locus_tag="Rahaq2_5111"
                     /note="NifH gene encodes component II (iron protein) of
                     nitrogenase. Nitrogenase is responsible for the biological
                     nitrogen fixation, i.e. reduction of molecular nitrogen to
                     ammonia. NifH consists of two oxygen-sensitive
                     metallosulfur proteins: the...; Region: NifH; cd02040"
                     /db_xref="CDD:238996"
     misc_feature    complement(114164..114991)
                     /locus_tag="Rahaq2_5111"
                     /note="nitrogenase iron protein; Region: nifH; TIGR01287"
                     /db_xref="CDD:233343"
     misc_feature    complement(order(114611..114616,114623..114625,
                     114869..114871,114875..114877,114881..114883,
                     114950..114958,114962..114964,114971..114973))
                     /locus_tag="Rahaq2_5111"
                     /note="Nucleotide-binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238996"
     misc_feature    complement(114950..114973)
                     /locus_tag="Rahaq2_5111"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238996"
     misc_feature    complement(114866..114886)
                     /locus_tag="Rahaq2_5111"
                     /note="Switch I region of nucleotide binding site; other
                     site"
                     /db_xref="CDD:238996"
     misc_feature    complement(order(114602..114604,114707..114709))
                     /locus_tag="Rahaq2_5111"
                     /note="Fe4S4 binding sites [ion binding]; other site"
                     /db_xref="CDD:238996"
     misc_feature    complement(114611..114625)
                     /locus_tag="Rahaq2_5111"
                     /note="Switch II region of nucleotide binding site; other
                     site"
                     /db_xref="CDD:238996"
     gene            complement(115118..115471)
                     /locus_tag="Rahaq2_5112"
                     /note="IMG reference gene:2506712135;
                     IMG reference gene:2506712031_SP"
                     /pseudo
                     /db_xref="GeneID:11789751"
CONTIG      join(CP003246.1:1..115487)
//
DBGET integrated database retrieval system