GenomeNet

Database: RefSeq
Entry: NC_016819
LinkDB: NC_016819
Original site: NC_016819 
LOCUS       NC_016819             115487 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq202,
            complete sequence.
ACCESSION   NC_016819
VERSION     NC_016819.1  GI:383192311
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02261385
            Assembly: GCF_000241955.1
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Rahnella aquatilis CIP 78.65 = ATCC 33071
  ORGANISM  Rahnella aquatilis CIP 78.65 = ATCC 33071
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Rahnella.
REFERENCE   1  (bases 1 to 115487)
  AUTHORS   Martinez,R.J., Bruce,D., Detter,C., Goodwin,L.A., Han,J., Han,C.S.,
            Held,B., Land,M.L., Mikhailova,N., Nolan,M., Pennacchio,L.,
            Pitluck,S., Tapia,R., Woyke,T. and Sobecky,P.A.
  TITLE     Complete genome sequence of Rahnella aquatilis CIP 78.65
  JOURNAL   J. Bacteriol. 194 (11), 3020-3021 (2012)
   PUBMED   22582378
REFERENCE   2  (bases 1 to 115487)
  AUTHORS   Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
            Peters,L., Ovchinnikova,G., Held,B., Detter,J.C., Han,C., Tapia,R.,
            Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Sobecky,P.,
            Martinez,R. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4089211
            Source DNA and organism available from Robert Martinez
            (rmartinez@bama.ua.edu)
            Contacts: Robert Martinez (rmartinez@bama.ua.edu)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Rahnella aquatilis CIP 78.65
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Host
            num_replicons       :: 4
            ref_biomaterial     :: Missing
            biotic_relationship :: Missing
            trophic_level       :: Missing
            rel_to_oxygen       :: Facultative
            isol_growth_condt   :: Missing
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi06369
            Type Strain         :: Yes
            Funding Program     :: DOE-CSP 2010
            Gene Calling Method :: Prodigal 1.4, GenePRIMP
            Isolation Site      :: drinking water
            Host Name           :: Water, humans
            Cell Shape          :: Rod-shaped
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram-
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/07/2014 02:16:28
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,923
            CDS                          :: 4,796
            Pseudo Genes                 :: 26
            CRISPR Arrays                :: 2
            rRNAs                        :: 22 ( 5S, 16S, 23S )
            tRNAs                        :: 76
            ncRNA                        :: 3
            Frameshifted Genes           :: 17
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..115487
                     /organism="Rahnella aquatilis CIP 78.65 = ATCC 33071"
                     /mol_type="genomic DNA"
                     /strain="CIP 78.65"
                     /isolation_source="drinking water"
                     /culture_collection="ATCC:33071"
                     /db_xref="taxon:745277"
                     /plasmid="pRahaq202"
     gene            complement(60..>563)
                     /locus_tag="RAHAQ2_RS24050"
     CDS             complement(60..>563)
                     /locus_tag="RAHAQ2_RS24050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001561258.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041260.1"
                     /db_xref="GI:739177316"
                     /translation="IIPFGGVAEANKIAWPPDREVLMAVDGFEEAFRHTVLITMQSGE
                     EIPFFSVPGLALLKLFAWRDRGAANGKDAADLYKIMSEYGQIENERAFENPAECDKRD
                     WDIDRMGAFLLGNDIAMMSSRDSMDELFKIDADKLTDAIVRQTSTESAEVIEQICFDF
                     WTGLHRE"
     gene            complement(584..1585)
                     /locus_tag="RAHAQ2_RS24055"
                     /old_locus_tag="Rahaq2_4995"
     CDS             complement(584..1585)
                     /locus_tag="RAHAQ2_RS24055"
                     /old_locus_tag="Rahaq2_4995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333816.1"
                     /db_xref="GI:504099822"
                     /translation="MKPQRLVTKAAENMPYGIRLDYELTEGEGGTDGSATLTTSYGQK
                     THFTLEVKTVHRMETLSGVERRTLTPVNNLPVLLICNRLSPALVDYCSQNRINFIDSA
                     GNARIDVPGLCIMIQGKQEEKKVTAAGGIFPAGVMKLLFVVLSEPDALNKTYRQLAEL
                     SGISLGMVSKAFDVLEQRRHYRKAKSGRRLMDTDGLCAMWIKDYARSLKPRLDLLTVE
                     APKSWDHLPLEPGEYAGGELAAALLSGGYLAPATGIIYTPYSLLERRNKLALKPAREP
                     GLQIMASFWGSLTLNSRAKAMLCLGDLLDGGDDRSREVARIINDQYLNLKDSALFSD"
     gene            complement(2464..2739)
                     /locus_tag="RAHAQ2_RS24060"
                     /old_locus_tag="Rahaq2_4997"
     CDS             complement(2464..2739)
                     /locus_tag="RAHAQ2_RS24060"
                     /old_locus_tag="Rahaq2_4997"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333818.1"
                     /db_xref="GI:504099824"
                     /translation="MALKKPPFSNRRVVTEAEADALANRLADRPYGDEKVVEPAQEIL
                     TRTTISIPQNTLREIEDLALHNKRIGVAPKSVSAIIRDALEAYLKKV"
     gene            complement(2739..3374)
                     /locus_tag="RAHAQ2_RS24065"
                     /old_locus_tag="Rahaq2_4998"
     CDS             complement(2739..3374)
                     /locus_tag="RAHAQ2_RS24065"
                     /old_locus_tag="Rahaq2_4998"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein ParA"
                     /protein_id="WP_014333819.1"
                     /db_xref="GI:504099825"
                     /translation="MITIIGCNKGGAAKTTTAINLAVGLALRGEDVCLVDADVQRSAS
                     RWYAEREAAGITPSITLIEKRDNISQTLRSLDEKFAHVIVDVAGRNSRELITGGTVAH
                     QIIAPHQCSQLDLDTMVELQQQLESMRDLNPELKAYCYQSMATTNPLLQGNERHEFLE
                     YVREFEGLIPLTATACYRKVYRDVMSEGKSVLETTNEKAKAEVLALMNEVF"
     gene            3728..3970
                     /locus_tag="RAHAQ2_RS24070"
     CDS             3728..3970
                     /locus_tag="RAHAQ2_RS24070"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041237.1"
                     /db_xref="GI:739177293"
                     /translation="MGTLYLTLGWEHPMTAITAVVVGVILNLALFFGYHVLWPKSFDG
                     GTDWVATVIALAAAVALFRFKIYVVAGCARYSQTGN"
     gene            complement(4092..4499)
                     /locus_tag="RAHAQ2_RS24075"
                     /old_locus_tag="Rahaq2_5000"
     CDS             complement(4092..4499)
                     /locus_tag="RAHAQ2_RS24075"
                     /old_locus_tag="Rahaq2_5000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333820.1"
                     /db_xref="GI:504099826"
                     /translation="MVTTEHLDAYLNAMGNRHVEGLEAYMADNVILSSPIVPVPFEGK
                     ELVFQIVSRLLETIDDFELKLLFRDGADFVAVFTIKFGDHIIDGMDHMHLDDMGFIDS
                     MTVAWRPLASVVAVQQKLAPKLGGKPMQLVPLE"
     gene            4660..5610
                     /locus_tag="RAHAQ2_RS24080"
                     /old_locus_tag="Rahaq2_5001"
     CDS             4660..5610
                     /locus_tag="RAHAQ2_RS24080"
                     /old_locus_tag="Rahaq2_5001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014333821.1"
                     /db_xref="GI:504099827"
                     /translation="MDSFSALGGLEVFVQTARTRSFAEAGRTLGISASAVSKSISRLE
                     ERVGVRLFQRSTRSVRLTSEGEMFLERCGRIFGEIQAAEDELSAMTQHPRGRLRVGLA
                     LSAGLPLPVLSAFMARYPEIELDLDFTDRLVDVIDEGFDVVIRGNSLRDSRLVSRPLG
                     PYRACLVAAPSYLKEKGMPTKPDDLLNHACLHYRWTPTGKIYQWPLEHTVGTTAISSL
                     PLSMVCNSLDALLYMALAGRGIACVPDFSVRTPVAEGRLKTLLDAYITDANTIHIMWP
                     SNRKMTPKVRVFVDFMHANFCDYLATPMNDPKRKRERYPT"
     gene            complement(6252..7301)
                     /locus_tag="RAHAQ2_RS24085"
                     /old_locus_tag="Rahaq2_5002"
     CDS             complement(6252..7301)
                     /locus_tag="RAHAQ2_RS24085"
                     /old_locus_tag="Rahaq2_5002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein RepA"
                     /protein_id="WP_014333822.1"
                     /db_xref="GI:504099828"
                     /translation="MSGNEPKNIEIAKAFAETDKRTGELVTLVPNSNNTVQPVALMRL
                     GLFVPTLKSTARGRKGQMNSMDVTSELKQLSIVKSEGYENIKITGARLDMDNDFKTWV
                     GIIHAFAKHKVLGDSVYLPFVEFAKLCGIPSARSSAKLRARLEASLERIATNTLSFSN
                     KEGDYYVTHLVQSAKYSPKKDVVELQADPKIFELYQFDKKVLLQLRAINELSRKESAQ
                     ALYTFIESLPTDPAPISMSRLRARLNLTSRAITQNATVRKAMEQLKAIGYLDYTEVKR
                     GKAVYFCIHYRRPKLRPAQIPTGIGDDVYDVLDDEHIIDIPAEKDVDSGAPREMVMLT
                     KEELELLEQLRQAKK"
     gene            complement(8095..8802)
                     /locus_tag="RAHAQ2_RS24090"
                     /old_locus_tag="Rahaq2_5003"
     CDS             complement(8095..8802)
                     /locus_tag="RAHAQ2_RS24090"
                     /old_locus_tag="Rahaq2_5003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_014333823.1"
                     /db_xref="GI:504099829"
                     /translation="MTELNAYGQTLGKELPDWQPRALPQKIILRGKYCYLEPIDVKHS
                     RDLFDAWHSIDDERDWTYFHIKRPVTIKQCDYYIASLAASKDPLFYAVINISTGKAVG
                     FLALQRMDPDNGSVEIGWINWSPLMKRTFCSTEAIFLLLYYTLETLQYRRCGWKCDSL
                     HEAAISAAERLGFTYEGTLRQTQVSKGHSRDVRWYSIIDSEWDGIRQAMELWLSPSNL
                     DERRKQKHRLAEFMPHL"
     gene            complement(8877..9251)
                     /locus_tag="RAHAQ2_RS24095"
                     /old_locus_tag="Rahaq2_5004"
     CDS             complement(8877..9251)
                     /locus_tag="RAHAQ2_RS24095"
                     /old_locus_tag="Rahaq2_5004"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333824.1"
                     /db_xref="GI:504099830"
                     /translation="MFNNLAFRNFSIGKKLFSGFIILIILISGMSVYSIYSFKIIQAN
                     AEKTDVVNKIGHLLDIARRNRLLFQQTGDEQAMKANGEAISNMQSLTRKSEDRRCLRP
                     RMVRSMMTGLHFKFSNSGSPQY"
     gene            complement(10255..11262)
                     /locus_tag="RAHAQ2_RS24100"
                     /old_locus_tag="Rahaq2_5007"
     CDS             complement(10255..11262)
                     /locus_tag="RAHAQ2_RS24100"
                     /old_locus_tag="Rahaq2_5007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcription regulator"
                     /protein_id="WP_014333825.1"
                     /db_xref="GI:504099831"
                     /translation="MASLKDVAKLANVSLMTVSRALNSPERLKPETLSRVQSAIDATN
                     YVPDLSAKKIRGAHAIAKTIGVLALDTVTTPFSVEITLSIEETARAHGWNSFVVNMFS
                     DDSPENIVDLLLSHRPDGIIYTTMGLRQVPLPEKLLNLPCVLANCESLHQQVASYIPD
                     DEHGQYAAVRALLSAGYRRPLCLHLPATHLATVRRRKGLEQACMEAGLAPETLDHYYM
                     EYGDEHYRDIPAVVQAHIYQQKPLFDSVICGNDRIAFMVYQTLLAQGLRIPEDVAIIG
                     YDNMVGIGDLFLPSLSTVQLPHYEIGRLSALHIIEGKSHRDIIKVDSPLLLRQSMNTV
                     K"
     gene            11507..12748
                     /locus_tag="RAHAQ2_RS24105"
                     /old_locus_tag="Rahaq2_5008"
     CDS             11507..12748
                     /locus_tag="RAHAQ2_RS24105"
                     /old_locus_tag="Rahaq2_5008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015689639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactoside permease"
                     /protein_id="WP_014333826.1"
                     /db_xref="GI:504099832"
                     /translation="MMKTRHSQSYLILSALLFFFFVTWSSTGSLLSIWLHQEVGLKAG
                     DTGIIFSVVSFSTLFVQICYGFIQDKLGLRKNLLWFITALLIFSGPAYLLFGHLLKIN
                     VFLGSFFGGIYIGLTFNGGIGVLESYTERVARQSQFEFGKARMWGSLGWAVATFFAGL
                     LFNINPKLNFAVASCSGLVFFILLMRLRVSSAPHAMQEAVAGGKVTLEDALRLLTLPR
                     FWALVFFVVGTCIYGVYDQQFPVYFSSQFPTQHEGNAMYGYLNSFQVFLEAAGMFCAP
                     WLVNRLGAKNGLIFAGMVMAMRMVASGLVEGPLLISITKLLHAVELPILLISIFKYNS
                     LNFDKRLSSTLYLVGFACTGSVIATVLSPLAGYSYEKYGFAQSYLFMGLMVFCITFIS
                     IFLLRSGKPSMDPQIPQLSTI"
     gene            12767..14200
                     /locus_tag="RAHAQ2_RS24110"
                     /old_locus_tag="Rahaq2_5009"
     CDS             12767..14200
                     /locus_tag="RAHAQ2_RS24110"
                     /old_locus_tag="Rahaq2_5009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 32"
                     /protein_id="WP_014333827.1"
                     /db_xref="GI:504099833"
                     /translation="MTYTIANAEQELQAKREMLNLRWYPRYHLAARAGWVNDPNGLIW
                     FDGWYHAFYQHHPYSPQWGAMHWGHARSKDLLHWEHLPVALAPEGPEDKDGCFSGSAV
                     VDGDTLALIYTGHKFHGDAGNDENLYQVQCLATSRDGVHFKREGIIIDTPADLHHFRD
                     PKVWREGDSWYMVVGARVGDTGQIRLYRSADLRQWQDEGILDEAQAGMGFMWECPDFF
                     TLNGKRVLMFSPQGIAAQGFENRNLFQSGYLVGDWQPGEPFVRAGEFAEMDHGHDFYA
                     PQSFLTPDGRRIVIGWLNMWESPMPEQQDGWSGMLSLPRELTLTEDNRLQMRPAKEVE
                     ALRQAWFPWPVSTLKNQQTLMADKGEAMEVVLHWDCANSDAEQYGLSLGQGLRVYVDT
                     QMQRLVLERRYPQYGLCGTRSVPLVPGVPLVLRMFIDSSSVEVFVNDGEACLSSRIYP
                     DADRRELSLFAWHGTATLSDAGAWQLE"
     gene            14323..15675
                     /locus_tag="RAHAQ2_RS24115"
                     /old_locus_tag="Rahaq2_5010"
     CDS             14323..15675
                     /locus_tag="RAHAQ2_RS24115"
                     /old_locus_tag="Rahaq2_5010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013574940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoporin"
                     /protein_id="WP_014333828.1"
                     /db_xref="GI:504099834"
                     /translation="MNKIWVGCILTSVCTSVAHAQGTLSLEQRLEQMEQRLKVTEQRA
                     AGAEAEIRALRQEKQLPPVVNNTPAAPAAPALQLTGNGNIKFYGDVEFNMDGASRTGS
                     LTSIKTSTNKNWAPGNKERWDMNGRILLGFDGLRNGVNGKYAGFSVQPLADIKGKMNL
                     DDAAFFFGQQDDWKIKIGRFEAWDMFPLNQDTFIEYSGNTANDLYSDGYGYIYMMKEG
                     RGRSSSGGNFLLSKTLDNWYFELNTLIEDGSSLFVDNNYHGNALDNRKNVVYARPVMA
                     WQSGEWSVAAAVESNLVNNAYGYQNTQGVWVDQSNRTGYGMTMSWNTLKTDAENGAVV
                     NLSTAYLDAADEKDFSAGINALWHRVEVGYIYAHNNIDKFNMAGVAGDCDNDCAILAP
                     GKYDIHTLHTSWHLPDIMDMPNFNIYLGAYASWLETPSVKTGNTDDRYGARVRFKYLF
                     "
     gene            15743..16300
                     /locus_tag="RAHAQ2_RS24120"
                     /old_locus_tag="Rahaq2_5011"
     CDS             15743..16300
                     /locus_tag="RAHAQ2_RS24120"
                     /old_locus_tag="Rahaq2_5011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose O-acetyltransferase"
                     /protein_id="WP_014333829.1"
                     /db_xref="GI:504099835"
                     /translation="MTLSIEKQKMIAGELYESGDALLISERRRARQLLHGYNHSSPDD
                     EELRKQWLSELLGSHQGAYIEPTFRCDYGYNIHVGKNFYANFDCVILDVCEVRIGDNC
                     MLAPGVHIYTATHPLDAQMRISGKEFGKPVTIGNNVWIGGRAVINPGVTLGDNVVVAS
                     GAVVTKDVPFNCVVGGNPARIIKRL"
     gene            complement(16342..16665)
                     /locus_tag="RAHAQ2_RS24125"
                     /old_locus_tag="Rahaq2_5012"
     CDS             complement(16342..16665)
                     /locus_tag="RAHAQ2_RS24125"
                     /old_locus_tag="Rahaq2_5012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007879024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333830.1"
                     /db_xref="GI:504099836"
                     /translation="MAPYKNYTVRDRHLPYFSCLMLTGVLIIAPITSARAEAVPPFIH
                     PGLLHTRKDFERMHTKVTQGAQPYIDGWQKLRGNKHASLDWHPNPQAVIYRGNFDRGV
                     TRQNG"
     gene            16995..17867
                     /locus_tag="RAHAQ2_RS24130"
                     /old_locus_tag="Rahaq2_5013"
     CDS             16995..17867
                     /locus_tag="RAHAQ2_RS24130"
                     /old_locus_tag="Rahaq2_5013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_037041257.1"
                     /db_xref="GI:739177313"
                     /translation="MVLKKLEYKLKLVRTFFISDLRYRKRKHLEEFRRVPDFENPQSL
                     NEKINNRMIFERDPFFTMLADKVAVREYVKTKIGEDYLVPLLGCYERAELIDLSELPE
                     QFVLKCSHDSGSAIICKNKHQFDERAAKKKLNAHLNKNMYYVTREWHYKNIKPYIICE
                     KFIDVFGGEPLHLIPEVYRVHCFSGKAHITEADFTDAMNNEYVNVYDPHWKLLPLTMG
                     YNNAPHKITEPIFYRHMITLAEKLAEGIAYCRVDFIANKHQVFFSEITLTPCNGRIQI
                     SPVHWDYFLGELWV"
     gene            complement(18132..18917)
                     /locus_tag="RAHAQ2_RS24135"
                     /old_locus_tag="Rahaq2_5014"
     CDS             complement(18132..18917)
                     /locus_tag="RAHAQ2_RS24135"
                     /old_locus_tag="Rahaq2_5014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein V"
                     /protein_id="WP_014333832.1"
                     /db_xref="GI:504099838"
                     /translation="MISRKLMLQMTCFSLSATVLQAMADNTPPAPTFTVGMGAQSAPR
                     YSGSDQRHWLVAPVIQARDGAFFFDSLKGVGYDLQADNGLYLEHTLGYSLGRTDRNST
                     WRDGSNKLKGMGNIDVTMNTALAVGWSATPWLSFEGKATLPLTDGQGVHYQTSVTVLP
                     LQNDTDTVALQSAALFGDQRYMNTFYGVSREQSNRTDFAPYQSAGGFYGVDSSLTWSH
                     QFTSHWGGVVSADYTWLDDKAGNSPIVVKRGGTTYNFGVLYTF"
     gene            19237..20379
                     /locus_tag="RAHAQ2_RS24140"
                     /old_locus_tag="Rahaq2_5015"
     CDS             19237..20379
                     /locus_tag="RAHAQ2_RS24140"
                     /old_locus_tag="Rahaq2_5015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter, MFP subunit"
                     /protein_id="WP_014333833.1"
                     /db_xref="GI:504099839"
                     /translation="MAVTFTDYARHAVRHLSASGRMLPFIPAACLIIVAIVLTGCGEK
                     AHKQAPSVRPVRAIIAPPPVALGSLIQTGEIRPHEEVTLGFRLDGRILTRQAEVGDRV
                     IAGQVLATQESDTSRNQLSSAQADLNSARAAEQVAALNLRRMQLLMPSGAIARTQLDS
                     AQADWQAARAKRQSSEDALKNAQENVSWTKLTAPADGVITQVSASAGQVVSAGQSVIT
                     LASGSIRDAVFDVADPQSVPQQADSQFNVSLLSAPSVVAQGHFRDVSPQADPQTRTWR
                     LRITLDNPPPAMALGASVQLTLNASGPRLIALPASALTRTGNKPAVFVVDEKTLTLHL
                     RPVVVGRYSTSEIFISAGVQPGERVVIAGVSKLREGEKVMPGEESE"
     gene            20376..23450
                     /locus_tag="RAHAQ2_RS24145"
                     /old_locus_tag="Rahaq2_5016"
                     /note="ACR family transporter; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(23631..23798)
                     /locus_tag="RAHAQ2_RS24150"
                     /old_locus_tag="Rahaq2_5017"
     CDS             complement(23631..23798)
                     /locus_tag="RAHAQ2_RS24150"
                     /old_locus_tag="Rahaq2_5017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333835.1"
                     /db_xref="GI:504099841"
                     /translation="MAEHRGGSGNFAEDHEKASEAGKKGGQKSGGNFANDRERASEAG
                     KKGGQHSHDND"
     gene            24142..24630
                     /locus_tag="RAHAQ2_RS24155"
                     /old_locus_tag="Rahaq2_5018"
     CDS             24142..24630
                     /locus_tag="RAHAQ2_RS24155"
                     /old_locus_tag="Rahaq2_5018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333836.1"
                     /db_xref="GI:504099842"
                     /translation="MAITTLKDLFIHDLSDVYSAERQITKALPKMARAATDPKLAEAF
                     KLHLEETQGQIERLDQVVESNDDLRIKRMKCHALEGLVAEAQELIDSVEKGEVLDAGL
                     IGAAQKVEHYEIATYGTLVAMAKKLGYTDAAKLLHETLEEEKSTDEKLTVLAESGQAS
                     KG"
     gene            24693..25208
                     /locus_tag="RAHAQ2_RS24160"
                     /old_locus_tag="Rahaq2_5019"
     CDS             24693..25208
                     /locus_tag="RAHAQ2_RS24160"
                     /old_locus_tag="Rahaq2_5019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333837.1"
                     /db_xref="GI:504099843"
                     /translation="MATSEAYENYIDWVRDAHAMEQQAETMLTKMADRLEHYPVLQQR
                     IKQHITETQGQQRLVEGVLKSLDTSRSVLKDTAGKMSAMGQAFGGMFASDEVIKGGIS
                     GYVFEHFEIASYSALIAAAEHVGDLEGARVFREIKIQEEEMAKWLAEHMPDLTKQFLS
                     REEDPDAEAKR"
     gene            complement(25284..25793)
                     /locus_tag="RAHAQ2_RS24165"
                     /old_locus_tag="Rahaq2_5020"
     CDS             complement(25284..25793)
                     /locus_tag="RAHAQ2_RS24165"
                     /old_locus_tag="Rahaq2_5020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333838.1"
                     /db_xref="GI:504099844"
                     /translation="MDETLLNAAKRAVQSLKKRNLTLSSAESCTAGMISMALCAASDD
                     GVPYASGFITYDDRAKNQLLHVSADTLTKFTAVSAETVKEMAQGACEVAGTDTGVSVS
                     GYAGPEGGKDGTPAGTVWFGWYLGPGSQQQEVRHFDGDCEAVILQASIFALERLASQV
                     EELPDKFSK"
     gene            complement(25786..26034)
                     /locus_tag="RAHAQ2_RS24170"
     CDS             complement(25786..26034)
                     /locus_tag="RAHAQ2_RS24170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018906869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041232.1"
                     /db_xref="GI:739177288"
                     /translation="MRTGIIFDLTSYKFFIKKSAFDPCLFILLNLFLSFQSTYTAPTI
                     MMNQKRQKKNDHIRREIDGQQPLGPSLSLHHVKENRNG"
     gene            26338..26601
                     /locus_tag="RAHAQ2_RS24175"
                     /old_locus_tag="Rahaq2_5022"
     CDS             26338..26601
                     /locus_tag="RAHAQ2_RS24175"
                     /old_locus_tag="Rahaq2_5022"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="Sodium/hydrogen exchanger family"
                     /protein_id="WP_014333839.1"
                     /db_xref="GI:504099845"
                     /translation="MNFLGWMTATGILLLIMSMLTGWLNRTPVPMFGLYLVVGIACGQ
                     WGLGLVNPDIFSHTTMISRATEIAMAASLFTAKVIQRTVRDII"
     gene            26618..28246
                     /locus_tag="RAHAQ2_RS24180"
                     /old_locus_tag="Rahaq2_5023"
     CDS             26618..28246
                     /locus_tag="RAHAQ2_RS24180"
                     /old_locus_tag="Rahaq2_5023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosidase"
                     /protein_id="WP_014333840.1"
                     /db_xref="GI:504099846"
                     /translation="MNSDWYKKAIIYQVDTAYFFDANNDGIGDISGILKHLDYIRGLG
                     ANALWLTPFYLTPFRDDGYDVKDHLTVDPRFGDIADMVMLLEQAEEMGLRVIVELVLQ
                     HTSSEHRWFQEARKDRHSPYRNYYIWADEPPENDDPPMFPGVEKSVWSWDEEAQQYYR
                     HMFYHDEPDLNLACPDLINEIERVIMYWLRLGVSGFRLDAASHMIKQAGKGDVKKGLS
                     LLNHLRDFIAVRHPETILLGEVDVPPQHYNDYFGNNDRLHMLLSFSINKHMFLSFAHK
                     DARPLVKALKEIPAPPSRACLTHWLRNHDELDLGDLSPAERRDVIKEFGPAENMQIYQ
                     RGLRRRLASMFENDIARIAMAYSVLFSLPGTPVIRYGDEIGMSENLSLNERNAIRTPM
                     QWDTTRNAGFSQADRDNLIAPVNVRGPGRYWRVNVSKSQIEDHSLLHLVSKMTRTRLG
                     CKEIGSGTYRIIDLKIPSLFAIRYDYDGEALLMMTNLSDKKVQVELNEPETMMLTELL
                     ADKEYARSGMLKASARFPVNGYGYRWFSVKHIDG"
     gene            complement(28269..29247)
                     /locus_tag="RAHAQ2_RS24185"
                     /old_locus_tag="Rahaq2_5024"
                     /note="short-chain dehydrogenase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(29320..30225)
                     /locus_tag="RAHAQ2_RS24190"
                     /old_locus_tag="Rahaq2_5025"
     CDS             complement(29320..30225)
                     /locus_tag="RAHAQ2_RS24190"
                     /old_locus_tag="Rahaq2_5025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mn-containing catalase"
                     /protein_id="WP_014333842.1"
                     /db_xref="GI:504099848"
                     /translation="MFKHIKQLQYTVRVAGPNPGLANLLLEQFGGPQGELAAACRYFT
                     QGIGEDDAGRKDLLLDIATEELSHLEIIGTIVGMLNKGAKGELAEGTEKEAELYRSLT
                     GGGNDSHITSLLYGGGPALVNSAGVPWSAAYIDTIGEPTADLRSNIAAEARAKIVYER
                     LINVTDDPGIKDALSFLMTREVAHQQSFEKALYAIQDNFPPGKLPPLPQFSQVYYNMS
                     EGGTVRGSWNSDKTFEYVDQPQPAVDGGTGEASVSLDAAQQSQLDAMKARTTSDPSIN
                     PVTGAELGSTGPIENTKPDIIKPKT"
     gene            complement(30380..30751)
                     /locus_tag="RAHAQ2_RS24195"
                     /old_locus_tag="Rahaq2_5026"
     CDS             complement(30380..30751)
                     /locus_tag="RAHAQ2_RS24195"
                     /old_locus_tag="Rahaq2_5026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin"
                     /protein_id="WP_014333843.1"
                     /db_xref="GI:504099849"
                     /translation="MIYFLSSKDIISIHERMIAAYGGLAGYADPGRIDSMATRILNRH
                     IYEGENDIYVLAAAYLLAIARGHCFNDANKRTAFASTVLFLRRNGISLRFSPDHEELT
                     VAAAQGSLDVWHIAETLKQSI"
     gene            complement(30748..30969)
                     /locus_tag="RAHAQ2_RS24200"
                     /old_locus_tag="Rahaq2_5027"
     CDS             complement(30748..30969)
                     /locus_tag="RAHAQ2_RS24200"
                     /old_locus_tag="Rahaq2_5027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death protein"
                     /protein_id="WP_014333844.1"
                     /db_xref="GI:504099850"
                     /translation="MQAINFTTARNELAAVLDGVTGGEPIMITRRSAKPVIIIDAEQY
                     EKMQKIQAESDFDWLFTEHGQTLEALKNR"
     gene            31093..31761
                     /locus_tag="RAHAQ2_RS24205"
                     /old_locus_tag="Rahaq2_5028"
     CDS             31093..31761
                     /locus_tag="RAHAQ2_RS24205"
                     /old_locus_tag="Rahaq2_5028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333845.1"
                     /db_xref="GI:504099851"
                     /translation="MFSKAQRVAFPALVIAVFLLTGCPPAAEFTQWERPSTTEEGVKA
                     AMTQCGDPVGYTLNNLPRNEQALQFLCMQRLGFTRKDGFDFCEVMGKLPACVEKKQGH
                     PLSQSQLEALPFEADEGFYPIKPDSSRYEDMQVTWRKVGAPGGGLSTQVANDREALPV
                     MYACGYPKPLGSNLAVASIGRTAKAQRCMIDHGFEPKNKMMLVCRPYPQVTGCERAVK
                     SSPL"
     gene            complement(32009..33409)
                     /locus_tag="RAHAQ2_RS24210"
                     /old_locus_tag="Rahaq2_5029"
     CDS             complement(32009..33409)
                     /locus_tag="RAHAQ2_RS24210"
                     /old_locus_tag="Rahaq2_5029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_014333846.1"
                     /db_xref="GI:504099852"
                     /translation="MSNINGLRKNSLGLFSLVFFVVAAASPLTGVIGGLPVAIFTGNG
                     GGVPAVYIMACIILMLFSVGYIAMSRYVNDAGAFYTYISKGLGENWGASASVLALIAY
                     LSIQIAIISMLGFFSQEFLAQHLALHIPWWALSMLFTIIAWIFGIKRVEVGGKLLGVL
                     MIAEVAIVLLTDVSLLIKKPGPLNFSSFDPAVFSHGNLGIAFIFCIASFIGFESTAIY
                     AEECRDPHKTVPRATLCALLMITVFFGFTSWSLVQAYSFDQIVEIARKDPGNFIFDIT
                     REYVGQWAVETMSVLLITSLFAAALAFHNNISRYIFSISRDGLIWKELCQTHPANGTP
                     HKASHAHSVILLLLLMGMGGTNMDPLVQIFAFGSAIATLSILILQVGVSAAVIRFFRR
                     VGKHNHSAWQVLWAPMGALITMSVTIIMAINNLQLLTGGGDAKLVEFIPWFLVVCAGA
                     GYLLSARRKMHAVKSK"
     gene            complement(33549..34364)
                     /locus_tag="RAHAQ2_RS24215"
                     /old_locus_tag="Rahaq2_5030"
     CDS             complement(33549..34364)
                     /locus_tag="RAHAQ2_RS24215"
                     /old_locus_tag="Rahaq2_5030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014333847.1"
                     /db_xref="GI:504099853"
                     /translation="MSCTNIINPEQPWFVLSAARQYSLMNAENSAISHFYSFEVSPSA
                     PLTLAVPDGCVDIVFDCDTIHPMARVCGTTLEARSAKLIPNHRYFGVRFAPGVIPDFL
                     DVMAEDLTDREFNFLDVVPDARPACEQILRTELFAQQITLFNNYFTPRLARKTSTVTA
                     SIIRTILQQKGNFRVGQLEALTGYTCRTIQRQFRQDTGMSPKAFGRIMRCQSALNSLH
                     QGASVSFSELALNLGFSDQSHFLREFKKLISTTPLDFQRRMLLAAHAERISYH"
     gene            34543..35682
                     /locus_tag="RAHAQ2_RS24220"
                     /old_locus_tag="Rahaq2_5031"
     CDS             34543..35682
                     /locus_tag="RAHAQ2_RS24220"
                     /old_locus_tag="Rahaq2_5031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333848.1"
                     /note="catalyzes the formation of L-proline from
                     L-ornithine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase"
                     /protein_id="WP_014333848.1"
                     /db_xref="GI:504099854"
                     /translation="MSDAAKIDFIYLSEQDMIRAGVTDMTACVDTMEKMFALLYQGDY
                     RMAGANNDSHGAMVTFPNDSPFPNMPKPTADRRFMAMPAYLGGDFCTAGMKWYGSNIA
                     NRQKGLPRSILMFTLNDADTGAPLAYMSANLLSAYRTGAVPGVGARHLARRDAQVIGL
                     LGPGVMGKTTVAAFMAVCPQINTIKVKGRGQKNLDSFIVWARNTFPQITNIQAVDSLE
                     QVVRDSDIVTYCSSGEVGDPATYPLVKREWVKPGAFLAMPALCNLDEGMEQPDVRKVL
                     DNTGLYHAWYEEVPKPAHHTIPVIGVRFMDMLAAGKLSADQLEDIGKIVAGDAPGRQS
                     DDEIIIMSVGGMPVEDVAWGTVVYRNALEKGIGLKLNLWDAPVLF"
     gene            35736..36158
                     /locus_tag="RAHAQ2_RS24225"
                     /old_locus_tag="Rahaq2_5032"
     CDS             35736..36158
                     /locus_tag="RAHAQ2_RS24225"
                     /old_locus_tag="Rahaq2_5032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease"
                     /protein_id="WP_014333849.1"
                     /db_xref="GI:504099855"
                     /translation="MTQITKVKTGSKFEERGSYSRIVAVDNWIFVSNTAGRDPRSNEI
                     PDDVTEQTLQVFANIEMALAAVDATLSDVVFSRVYIQDPKDVASVMEIIGAKFRGINP
                     ATTVTCPPLGSTVYKVELEVTAWRGAGKAEVEEITVGS"
     gene            36212..37504
                     /locus_tag="RAHAQ2_RS24230"
                     /old_locus_tag="Rahaq2_5033"
     CDS             36212..37504
                     /locus_tag="RAHAQ2_RS24230"
                     /old_locus_tag="Rahaq2_5033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid oxidase"
                     /protein_id="WP_014333850.1"
                     /db_xref="GI:504099856"
                     /translation="MAPAITPVQTSATFPAATTVVVIGGGIVGLTAALALAERKIPVV
                     LLEKGAIAGEQSSRNLGWVRKTSRLAEDIPLALASDRLWAMMPHRLGSDVGYRQAGIM
                     FVARTQAQMALYEGWLKSVAHLSLDSRLLSRHEIAAMVPGGRGQWAGGIYTPSDGRAE
                     PTLAASAIAKAAIARGAFIVENCAVRSLTLSAGKVSGVVTERGEIRCDQVLLAGGLWS
                     RRFLGNHGVSLPTLPLICSVLRTRPMAGPTDIAVGAPDFSFRKHQDGGFIITQRGALD
                     ASLVPDHLLLGLRYLPQLRAQRDNLRISLGKNFLHDLTLARHWGAKSITPFEKVRMMD
                     PPANRALNQEAMDNLMAAWPAFAKAEIADTWAGAIDVTPDSNPVIGPVTRIPGLTVAT
                     GFSGHGFGTSPAAGQLAADLVSGCQPIIDPAPYRFERF"
     gene            complement(37570..37860)
                     /locus_tag="RAHAQ2_RS24235"
     CDS             complement(37570..37860)
                     /locus_tag="RAHAQ2_RS24235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004171404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041228.1"
                     /db_xref="GI:739177284"
                     /translation="MLFLTLFFRQDSPASGVMMSMLMALLRTIYLKGSRREMICEALL
                     CGALTMTAISVGLYFGASKNMMISIGGIIGFIGVRKIWEYLTSYIQKKLLGK"
     gene            complement(37994..39241)
                     /locus_tag="RAHAQ2_RS24240"
                     /old_locus_tag="Rahaq2_5035"
     CDS             complement(37994..39241)
                     /locus_tag="RAHAQ2_RS24240"
                     /old_locus_tag="Rahaq2_5035"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O54435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrase"
                     /protein_id="WP_014333851.1"
                     /db_xref="GI:504099857"
                     /translation="MTNLNYTPTIWTRADALKVNENDPTTTQPIVDADFPVMSDEVFI
                     WDTMPLRSLDGTVVSVDGWSVIFTLTAQRNNNNSEYLDAEGNYDITSDWNNRHGRARI
                     CYWYSRTGKDWIFGGRVMAEGVSPTSREWAGTPILLNEDGDIDLYYTCVTPGATIAKV
                     RGKVLTSEEGVTLAGFNEVKSLFSADGVYYQTESQNPYWNFRDPSPFIDPHDGKLYMV
                     FEGNVAGERGSHVIGKQEMGTLPPGHRDVGNARYQAGCIGMAVAKDLSGDEWEILPPL
                     VTAVGVNDQTERPHFVFQDGKYYLFTISHKFTYADGLTGPDGVYGFLSDNLTGPYSPM
                     NGSGLVLGNPPSQPFQTYSHCVMPNGLVTSFIDNVPTSDGNYRIGGTEAPTVKIVLKG
                     NRSFVERVFDYGYIPPMKNIILN"
     gene            complement(40613..41503)
                     /locus_tag="RAHAQ2_RS24245"
                     /old_locus_tag="Rahaq2_5037"
     CDS             complement(40613..41503)
                     /locus_tag="RAHAQ2_RS24245"
                     /old_locus_tag="Rahaq2_5037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014333853.1"
                     /db_xref="GI:504099859"
                     /translation="MDRFHELNAFIAVVEAGGFTAAARRTGDSQSAISKAIGALERRL
                     GVALFNRSTRSVTLTDQGQRYYERAKPLLDEMDDADSELTSSTHNVSGLIRIAASGTF
                     GRLHILPLIPDLLSLNPGLQVDLILSDFVRNMVEDGIDLAIRVGPVNDPDAIVRRVAS
                     TPLVCVGSRRYFEQRGMPKTPAELVDHNCLVYRGLAEPTQWSFVGPEGQFSVSVHGNL
                     TSNSVETIRAGVLAGVGIGRFAKVSLADDLRHPDVLTVLDEFTGDARDISLVWPRRRF
                     VPARVRRITDFFAEAIPQRI"
     gene            41608..42402
                     /locus_tag="RAHAQ2_RS24250"
                     /old_locus_tag="Rahaq2_5038"
     CDS             41608..42402
                     /locus_tag="RAHAQ2_RS24250"
                     /old_locus_tag="Rahaq2_5038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014333854.1"
                     /db_xref="GI:504099860"
                     /translation="MNIDLTGRKAVVTGSTAGIGRAIAEGLARAGAAVVINGRGKERV
                     DAVLRELRELYPKGEFTGVSADLATPEGAAELFARVPDADILVNNVGTGRMKPFFEIG
                     DSEWTDLFELNVMSGIRASRHYVPNMMKRGWGRVVFISSESALAIPVDLIDYAMTKTA
                     QLAISRGLAEVVGGTGVTVNAVLPGPTNSEIMGGWMKAAAEAQGITQEEAEQQFLNTT
                     RPTTLIKRFATTEEVANLVIYVCSEQASATTGTSLRVDGGVVRTIA"
     gene            complement(42479..43588)
                     /locus_tag="RAHAQ2_RS24255"
                     /old_locus_tag="Rahaq2_5039"
     CDS             complement(42479..43588)
                     /locus_tag="RAHAQ2_RS24255"
                     /old_locus_tag="Rahaq2_5039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013935126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_014333855.1"
                     /db_xref="GI:504099861"
                     /translation="MQTFRINVPEDTLIDLSSRLKQTRWPCEVKGQGWLQGTDLTFLQ
                     RLCTYWAESFDWRSAEARLNELPQFRTIVSGTGLYVIHARAERKNAVPLLLCNGWPSS
                     VFEYVDVIPRLTAAGFDVIAPAMPGYGFSDKPEAPGMNGTRIASLYATLMHNLGYNKF
                     FAHGSDLGSHIVDMMRRNHPERLLGIHMSNVRSDYPRPDDASPEEQAFLEQAQRWMFE
                     EGAYAMIQRTRPQSLAYGLNDSPAGLAGWIIEKFQAWSDGDIEQVYGLDAICANLTLY
                     WITETACSSVRLYSEVARDHEMQTSPERGNVPAGVIMFPADNLPAPRVWGERWLNIIH
                     WTEAPHGGHFAAWEAPDIFVNDICEFARKVLPARE"
     gene            complement(43640..45202)
                     /locus_tag="RAHAQ2_RS24260"
                     /old_locus_tag="Rahaq2_5040"
     CDS             complement(43640..45202)
                     /locus_tag="RAHAQ2_RS24260"
                     /old_locus_tag="Rahaq2_5040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014333856.1"
                     /db_xref="GI:504099862"
                     /translation="MNASSNDSDRYLIRLSGMKRPVTTLVILATALVCLLLLVLAGAF
                     ISASRTAQLGDAEVANTNIARMIAVQMESTLKTASVALTDLSERLEVDGTGAHELDRL
                     QAHLVETAKANSELHGLFAYGADGTWLATSLNRPVKGNNADREYFTYHRANRSLAVHV
                     GPPIKSRSTGVWIIPVSRRINLPDGSFGGVVLVTLKINFFERIYNEIDIGKTGTVLLA
                     LTDGTLVYRRPFEEKLIGTDISKGPVLQALSTHYAGSSTLVSKIDRIERLYSYRHVDG
                     YPFIVAVGRTKTELLSQWQRSSFFLGGTVLVICAMFISLASKLVRQIGIRDTLAQKLH
                     DRSEGLEQYNIGLQVLANTDKLTSIANRLMFDKILDQELKRAQRGDDCLSLILLDVDL
                     FKKFNDRYGHVAGDAVLHSIGRVMSEQVTRAGDLVARYGGEEFVVILPGTDIKGAIEV
                     AERIREGILALTIPHVDTPWGQVSASFGVTTVYPGQHRGLVSADVVNRADQQLYEAKR
                     TGRNRVCAEGSV"
     gene            complement(45418..45942)
                     /locus_tag="RAHAQ2_RS24265"
                     /old_locus_tag="Rahaq2_5041"
     CDS             complement(45418..45942)
                     /locus_tag="RAHAQ2_RS24265"
                     /old_locus_tag="Rahaq2_5041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_014333857.1"
                     /db_xref="GI:504099863"
                     /translation="MDGLIIDILNEDAEYNLADFDCGETSLNVFLSDHLRRQHNGKIL
                     RGYVLQTQDNVPKVLGYYTLSGSCFERATLPSKTQQKKVPYHNVPSVTLGRLAIDKSL
                     HKQGYGSMLVTHAMRVVYRASLAVGVHGLFVEALNDKAKNFYISLGFTALVGENENSL
                     FYPTTSIEKLFPEG"
     gene            complement(45946..46215)
                     /locus_tag="RAHAQ2_RS24270"
                     /old_locus_tag="Rahaq2_5042"
     CDS             complement(45946..46215)
                     /locus_tag="RAHAQ2_RS24270"
                     /old_locus_tag="Rahaq2_5042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004109769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333858.1"
                     /db_xref="GI:504099864"
                     /translation="MSALKKQRIDLRLNDEDKRMIEEAAAMTNQSVTQFMLSSASERA
                     AEVIEQHRRLILNEESWELVMNAISNPAIPNERLKQAAKRLQSME"
     gene            46471..46770
                     /locus_tag="RAHAQ2_RS24275"
                     /old_locus_tag="Rahaq2_5043"
     CDS             46471..46770
                     /locus_tag="RAHAQ2_RS24275"
                     /old_locus_tag="Rahaq2_5043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014333859.1"
                     /db_xref="GI:504099865"
                     /translation="MTGRNRRNFSPEFRLEAAQLVLDQHYTVAAAATAMNVGKSTMDK
                     WVRQLKDERAGKSPIASPMTPEQIEIRELKKRLQRVEMERDILWKFTEYMVLPDV"
     gene            complement(46830..47363)
                     /locus_tag="RAHAQ2_RS24280"
                     /old_locus_tag="Rahaq2_5044"
     CDS             complement(46830..47363)
                     /locus_tag="RAHAQ2_RS24280"
                     /old_locus_tag="Rahaq2_5044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333860.1"
                     /db_xref="GI:504099866"
                     /translation="MKHYFLASLFTIMTLPMATSAMALTPEASVKEIADNLVELNPIT
                     WTAPAEKYHMVVFIDNQCSYCSDVVKKVQQYTDAGLTMSFLTVAPPAIHDKVISDMAR
                     VWCSNSPRESLRNAMAGFLPNNDTSPACIRTIEQQSALANRVGIEVTPVMVVMQPSPV
                     VFIGNVKPAEILKALKH"
     gene            complement(47936..48130)
                     /locus_tag="RAHAQ2_RS24285"
     CDS             complement(47936..48130)
                     /locus_tag="RAHAQ2_RS24285"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041254.1"
                     /db_xref="GI:739177310"
                     /translation="MANTNIARMIAVQMESTLKTASVALTDLSERLEVDGTGAHELGR
                     LQTHLVETAKANAELHGLFA"
     gene            complement(48472..50007)
                     /gene="emrB"
                     /locus_tag="RAHAQ2_RS24290"
                     /old_locus_tag="Rahaq2_5047"
     CDS             complement(48472..50007)
                     /gene="emrB"
                     /locus_tag="RAHAQ2_RS24290"
                     /old_locus_tag="Rahaq2_5047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333862.1"
                     /note="multidrug MFS transporte; with EmrA is involved in
                     resistance to hydrophobic antibiotics such as nalidixic
                     acid; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance protein B"
                     /protein_id="WP_014333862.1"
                     /db_xref="GI:504099868"
                     /translation="MQDKAAFTPPTMWLAVLALSLATFMQVLDSTIANVALPTIAGNL
                     GVSADQGTWVITSFAVCNAIALPLTGWFTRRFGQLKLFLGSVVMFTLSSFLCGLAHSM
                     TELIIFRALQGFFAGPMFPMCQTLLLVIFPPSKRSMALALLSMVTVVAPIVGPITGGW
                     ITDNYSWPWIFYINVPIGIFATLVVWTQLRAREETTSHVPIDYIGIALLVMGVGLLQV
                     VLDKGNDLDWFASLQIVIMTVISAISLVSFVIWELGERHPIVNLRLFKERNFAVGTLS
                     LTLGYAAFFAINIILPQWLQTQMGYTAIWAGLAAAPMGVLPLLMTPFIGRYANKVDLR
                     ILASLSFLTMGASCLIRAQFNTDVDFRTIAQVQLFMGIGVAFFFMPVTTIVLSNLNGA
                     EIAEGSGLATFFRVLGGSFASSLTTWIWSRREVFHHANLTESVSAYNPAAVNYIEKMG
                     GLTQQNMASVDKTIEQQAYMMSTIDYFWILGWGFMALIVVIWFTRPPFSRSGPSGAPA
                     AGH"
     gene            complement(50018..51196)
                     /locus_tag="RAHAQ2_RS24295"
                     /old_locus_tag="Rahaq2_5048"
     CDS             complement(50018..51196)
                     /locus_tag="RAHAQ2_RS24295"
                     /old_locus_tag="Rahaq2_5048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_014333863.1"
                     /db_xref="GI:504099869"
                     /translation="METTPAQDVERGSKRKRNFIILFFILVIAAGGILAWYLLYARFY
                     ESTDDAYVNGNQVTLTPQIGGTVTQVTVDEGDFVQKGQPLVLLDPSDTEIALQQAEAN
                     LANTVRQVRGLYSTADNYRAQVAAKKVALQTAQNDYTRRQKIFSSGAISSEDLSHYRD
                     AVTSAQSDLAAAQEALRTNTAMVDDTVIDSHPEIKSAVATLRQRFLDNARTTIVAPVS
                     GYVAKRAVQLGMRVDSGTTLLAIVPLSEVWVDANFKESQMYSMRLGQKVTLNADLYGD
                     NVEYHGTIESLGIGTGSAFSLLPAQNASGNWIKIVQRLPVRITLDPRDMQKHPLRVGL
                     SMNVRVDIRDDGGHLLPQQTVSTPRFSTDVYQNPLAEADKLVAKILHDNSKTVATGSR
                     "
     gene            complement(51221..51676)
                     /locus_tag="RAHAQ2_RS24300"
                     /old_locus_tag="Rahaq2_5049"
     CDS             complement(51221..51676)
                     /locus_tag="RAHAQ2_RS24300"
                     /old_locus_tag="Rahaq2_5049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_014333864.1"
                     /db_xref="GI:504099870"
                     /translation="MHNTSAISGDKLPLGLLIHLANQFKDQIISEYFAGANITAQQFK
                     VLISIYKGFYSPVEISKNLVMDAGGMSRMVDRMVKRELIARTPNPQDKRQVILTLTDE
                     GQALCERFEKDAQTSIMGNLTARLTPGESRLLVELITKMLPDDITAPHR"
     gene            complement(<52093..>52215)
                     /locus_tag="RAHAQ2_RS24305"
     CDS             complement(<52093..>52215)
                     /locus_tag="RAHAQ2_RS24305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333843.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin"
                     /protein_id="WP_037041272.1"
                     /db_xref="GI:739177328"
                     /translation="LFLRRNGVLLRFSHDHEELTVSAAQGNLDVWHIAEVLKRRS"
     gene            52604..53653
                     /locus_tag="RAHAQ2_RS24310"
                     /old_locus_tag="Rahaq2_5051"
     CDS             52604..53653
                     /locus_tag="RAHAQ2_RS24310"
                     /old_locus_tag="Rahaq2_5051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase XerD"
                     /protein_id="WP_014333865.1"
                     /db_xref="GI:504099871"
                     /translation="MGKLSPINPILPVIQAEEDVLARLKEFVQDKEAFSPNTWRQLMS
                     VMRICHRWSTENSRSFLPMLASDLRDYLNWLQENGRASSTIATHGSLISMLHRNAGLT
                     PPNTSPLVFRAVKKINRVAVVEGERTGQAVPFRLEDLLKLDALWSDSILLRQKRDLAF
                     LHVAYSTLLRISELARLRVRDISRAPDGRIILNVSYTKTIVQTGGLIKSLSSQSSRRL
                     SEWLSVSGISAEPDAFLFCPVHRSGSATLSIARPLSTPAMESIFAQAWRTIGAGEAII
                     PNKGRYTAWTGHSARVGAAQDMAGRGYAVAQIMQEGTWKKPETLMRYIRNLQAHEGAM
                     IDIMEKSTLHHNDKK"
     gene            complement(54219..54479)
                     /locus_tag="RAHAQ2_RS24315"
                     /old_locus_tag="Rahaq2_5053"
     CDS             complement(54219..54479)
                     /locus_tag="RAHAQ2_RS24315"
                     /old_locus_tag="Rahaq2_5053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015765463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333867.1"
                     /db_xref="GI:504099873"
                     /translation="MRDAAINLRALPEQRDLIDQAASLLGKNRSDFMLEVACERAQAI
                     LLDQVFFQLDTEKFHEFTAMLDAPQKANQGLERLMAVKAPWA"
     gene            complement(54906..55511)
                     /locus_tag="RAHAQ2_RS24320"
                     /old_locus_tag="Rahaq2_5055"
     CDS             complement(54906..55511)
                     /locus_tag="RAHAQ2_RS24320"
                     /old_locus_tag="Rahaq2_5055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014333868.1"
                     /db_xref="GI:504099874"
                     /translation="MNTTTQLHNNEIREHILATGQRIMAGKGFSAVGLNEILKDAGVP
                     KGSFYHYFSSKEAFGADMLAHYFDDYLADIDRTLGQPGLNMAQRLMNYWQQWRESQSF
                     SDCQGKCLAVKLGAEVADLSDTMRLTLEAGTSGIISRLAQALETGVAEGSLTIDDTPR
                     TVAESLYQLWVGASVMVKIVRNTGPFDSALITTRKIIHITP"
     gene            complement(55667..56488)
                     /locus_tag="RAHAQ2_RS24325"
                     /old_locus_tag="Rahaq2_5057"
     CDS             complement(55667..56488)
                     /locus_tag="RAHAQ2_RS24325"
                     /old_locus_tag="Rahaq2_5057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chloroperoxidase"
                     /protein_id="WP_014333869.1"
                     /db_xref="GI:504099875"
                     /translation="MKTIQVKDGSKIAYKDFGKGQTIIFSHGWPLSSDAWDAQMLFFG
                     QQGFRVIAHDRRSHGNSSQTWDGNDMDTYAEDLSSLIEQLDLKDVVLVGHSTGGGEVA
                     RYIGTYGSARVSKAVLIGAVPPVMLQSEKNPGGLPMEVFDGIRAAVEKDRSQFYKDLT
                     TPFFNYNRSSETPSEGVRESFWLQGMRGGIKGQYDCIKQFSEVDFTDDLKKIDVPTLI
                     MHGDDDQIVPLADSAILSAQLVKDAQLKVYAGFGHGMTITQAGTINEDLLRFIEE"
     gene            complement(56622..57377)
                     /locus_tag="RAHAQ2_RS24330"
                     /old_locus_tag="Rahaq2_5058"
     CDS             complement(56622..57377)
                     /locus_tag="RAHAQ2_RS24330"
                     /old_locus_tag="Rahaq2_5058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014333870.1"
                     /db_xref="GI:504099876"
                     /translation="MFKKSFTTLALSLVLSVYAQSSMAAPVKNIVLVHGAFVDGSGWD
                     PVARILNKAGYNVSIVQEPQTSLADDVAATRRVLALQSGKSLLVGHSYAGMIISDAGN
                     DPSVAGLVYIAAFQPEQGESLLSLAKKYPPAAQSITETPDHFLYIKPENFHADFAADL
                     PVKETNLLAQSQLMPAVAAFTAPAGVPAWKTKPSWAVVATQDRAINPELERFMAKRAH
                     STVTELKGNHAIYASQPEKIATLIEKAALSLSQ"
     gene            complement(57533..58213)
                     /locus_tag="RAHAQ2_RS24335"
                     /old_locus_tag="Rahaq2_5059"
     CDS             complement(57533..58213)
                     /locus_tag="RAHAQ2_RS24335"
                     /old_locus_tag="Rahaq2_5059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylallyltransferase"
                     /protein_id="WP_014333871.1"
                     /db_xref="GI:504099877"
                     /translation="MKILMVLTSHDKLGDTGRKTGFWLEELAAPYYAFKDAGAEITLA
                     SPKGGNPPLDPKSNEPDFQTEQTHRFEADAEATAHLASTVRLDSVSHADYDAVFYPGG
                     HGPLWDLAEDKHSIALIEAFLAANKHVALVCHAPGVLRHVKTPEGKPLVAGRKVTGFT
                     NSEEDAVGLTQIVPFLVEDELIAKGGIYSKGADWSSYVVTDGLLITGQNPTSSTEAAE
                     ELIKQLGA"
     gene            complement(58542..59930)
                     /locus_tag="RAHAQ2_RS24340"
                     /old_locus_tag="Rahaq2_5060"
     CDS             complement(58542..59930)
                     /locus_tag="RAHAQ2_RS24340"
                     /old_locus_tag="Rahaq2_5060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_037041269.1"
                     /db_xref="GI:739177325"
                     /translation="MLSIDVATSRNPATDELIATYAFQTADEVEGMLAGNNAAFRLWR
                     ATPMSKRVEAYRRLSAILRERSENLAGIITAEMGKTLAAARAEVEKCAATIDWIASNG
                     PAILADEPVSVENDDQVHVSYLPIGSILAVMPWNFPLWQVIRASGPIMLSGNGFILKH
                     APNVMGSAYALQDAYESAGFPKGLFANLIADNETVAKVIEDDRIAAVTLTGSMRAGSA
                     VSAIAGKALKKSLLELGGSDAFIVLADANIDLAVKAGVEARFQNAGQVCLAAKRFILE
                     KPIAEEFTQKFIAAVRLLKVGDPLDPQNRIGPMARKDLRDELHHQVERTLAAGATLLL
                     GGNKISGPGNFYEPTVLGEVGPGMAAFDEETFGPVAAITVADDVEHAIELANTSDYGL
                     GGNLWTSDVSRAQRIARRLETGGVFINGFSATNARIPVGGVKKSGYGRELSHFGLREF
                     TNAQAVWAKQVD"
     gene            complement(60057..60869)
                     /locus_tag="RAHAQ2_RS24345"
                     /old_locus_tag="Rahaq2_5061"
     CDS             complement(60057..60869)
                     /locus_tag="RAHAQ2_RS24345"
                     /old_locus_tag="Rahaq2_5061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014333873.1"
                     /db_xref="GI:504099879"
                     /translation="MVKKTTSEQRRELGAFLVSRRARLNPQDFGMQQGTRRTPGLRRE
                     EVAVLAGVSVSWYTWLEQGREIKPSADALQRIAKVLKLNRIESSHLFALSPREEPVPH
                     PLADGVSDGLKSLVRAIDPIPAYVRNARLDILAWNDAIADLFIDYGSLEPHERNTLRL
                     LFLYRPYRTQILDWEQMARGMISVFRASRAHAQDKKPFDHLIKELSEKSPEFKEWWLD
                     TEVKGMGEGSKRLLHPTSGHIEFTYVALTPEGRPDLSLVTYIPRHVACDSRS"
     gene            complement(61254..62165)
                     /locus_tag="RAHAQ2_RS24350"
                     /old_locus_tag="Rahaq2_5063"
     CDS             complement(61254..62165)
                     /locus_tag="RAHAQ2_RS24350"
                     /old_locus_tag="Rahaq2_5063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_037041252.1"
                     /db_xref="GI:739177308"
                     /translation="MAAGNPLQLGSIEQFCRAAETGSFTSAAETLGLTPAAVSRSISR
                     LEQRLGVRLFLRTTRAVKLTTEGELYWKECHLALEQIAEAERAITGSQTVPSGPLRIS
                     VSAAYGTFRLLPLMPKFTDLYPQIDIEISISDKIIDFVEEGFDLAIRLGVPQDSRLVA
                     FKLEDASLGVFGTPTYLAKKGEPYRIDELNQHDCIQYISPNTGRPLQWLFTDELGTSI
                     EKQITSRMRVLNDALGAVAWVNAGGGLYQTYRFAVGDALRRGDLVEVLQKYGGCSRPF
                     SILYPQNRHLSARVRAFVEFLRSAVKS"
     gene            62331..63029
                     /locus_tag="RAHAQ2_RS24355"
                     /old_locus_tag="Rahaq2_5064"
     CDS             62331..63029
                     /locus_tag="RAHAQ2_RS24355"
                     /old_locus_tag="Rahaq2_5064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_014333875.1"
                     /db_xref="GI:504099881"
                     /translation="MTSKLNVFTSPSAFPNPQRLRLFMHEKGIADQFQETIYDMTPVG
                     EQRGWRHLKMNAWGETPTLELADGSYISETAAVVRYLDQSYPGRKIMGDTPLEQGLDN
                     MWDNRIWVHILYRIVTAFHVLHTGLGFKLELTKNEAWGEHCRKEALAHAALVNKHLSD
                     GRQWLLGGDEPTFADITLATAIAFSKFPVNATPLDERFEFLDAYWQRWQQRPSFQAAY
                     ADRSSGIPELENKA"
     gene            complement(63296..66280)
                     /locus_tag="RAHAQ2_RS24360"
                     /old_locus_tag="Rahaq2_5065"
     CDS             complement(63296..66280)
                     /locus_tag="RAHAQ2_RS24360"
                     /old_locus_tag="Rahaq2_5065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014333876.1"
                     /db_xref="GI:504099882"
                     /translation="MPRRQILSSEEKERLLIVPDDDVFLTRMCFLSEHDLALINKHRR
                     PANRLGFAVLLCYLRGPGFPPDKSISPHDGVVFRLAAHLKVQSDLWAEYASREVTRWE
                     HLAELYRYLELSPFNRALQKTCIRHLYPHAMRTDRGFLLAEEMLSWLHNNKVIFPSVE
                     VIERTLAEATTLADRAVFSALTAQLEPGHKAALDRLLVSEGEQPSRLAWLLQPPGKIN
                     GKNVLQHIDRLNAIESLVLPDGIALSVHQNRLLKLAREGRKMNSRDLARFTDVRRYAS
                     LVCIISEARSTLTDEVIDLHERILSSLFSRAKRTQAERLQQTGKLIQSKLKQYATVGQ
                     ALLNARESGEDPWAAIEDVLPWQEFINSVEETRFLSRKDNFDPLHLITEKYSTLRKYA
                     PRMLSVLQFRAAPAAMQLSDALDTVRDMYRKQLRKVPPSAPIGFIPESWRKVVITPTG
                     IDRKYYEFCVLNELKGALRSGDIWVKGSRRYRNFDDYLIPSGDFEKSLRDNQLPLAVP
                     ADCHEYIKSRLTLLASRLEEVNAMALAGDLPDVDISDKGVKITPLDNSVPSAASPFGD
                     LVYGMLPHPKITEMLDEVDGWTGFTRHFTHLKNNHVRPKDRKLLLTTILADGINLGLT
                     KMAESCPGTTKSSLEGIQAWYIRDETYSAALAELVNAQKKRPLAAFWGDGTTSSSDGQ
                     NFRVGSHGRYAGQVNLKYGQEPGMQIYTHISDQYSPFYTKVISRVRDSTHVLDGLLYH
                     ETDLEITEHYTDTAGFTEHVFALMHLLGFAFAPRIRDLHDKRLFIHGKAELYQGLQSI
                     ISTTSLNLKEIETHWHEVLRLASSIKQGTVTASLMMKKLASYPKQNGLAKALREFGRI
                     ERSLFMLDWFRDPSLRRRVQAGLNKGEARNALARAVFMHRLGEIRDRRLENQSYRASG
                     LTLLTAAISLWNTVYIERAIDSLRRKGIAINEQLISHLSPLGWEHINLSGDYVWRTNL
                     KLGQGKYRALRSVDSSLYKKHA"
     gene            66440..67024
                     /locus_tag="RAHAQ2_RS24365"
                     /old_locus_tag="Rahaq2_5066"
     CDS             66440..67024
                     /locus_tag="RAHAQ2_RS24365"
                     /old_locus_tag="Rahaq2_5066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA invertase"
                     /protein_id="WP_014333877.1"
                     /db_xref="GI:504099883"
                     /translation="MSRVFAYCRVSTLEQTTENQRREIEAAGFIVRPQRLIEEKISGS
                     VAASERPGFARLLDRMENGDVLIVTKLDRLGRNAMDIRKTVEQLADSDIRVHCLALGG
                     VDLTSPAGKMTMQVISAVAEFERDLLLERTHVGIARAKASGKRFGRPPVLSEEQKRVV
                     TERLNTGISTSAIAREFNTTRQTILRVKVGKRQS"
     gene            complement(67137..67706)
                     /locus_tag="RAHAQ2_RS24370"
                     /old_locus_tag="Rahaq2_5067"
     CDS             complement(67137..67706)
                     /locus_tag="RAHAQ2_RS24370"
                     /old_locus_tag="Rahaq2_5067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014333878.1"
                     /db_xref="GI:504099884"
                     /translation="MGSSKADKAASHDRIVEIAAARMRSSGINGVGVAELMREAGLTH
                     GGFYRHFASRDELVGAAVERALAQGSARTVATSGQGGRRALEAIIDDYLSPAHRSHPE
                     AGCAVAGLAEDVSRADDRTRSAYRRQVKQYLELLAELTPSTDAADDRRRSCLVLSALV
                     GALVMARAIGEGSLSDEILFETATALKEF"
     gene            complement(67812..68648)
                     /locus_tag="RAHAQ2_RS24375"
                     /old_locus_tag="Rahaq2_5068"
     CDS             complement(67812..68648)
                     /locus_tag="RAHAQ2_RS24375"
                     /old_locus_tag="Rahaq2_5068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_014333879.1"
                     /db_xref="GI:504099885"
                     /translation="MSAPLTQFTITEAVPGYWRITFNNPPLNFCDPETLIELQQIVGL
                     IESDDTLRVVVFDSADPDFFVNHYDVSRFSDFPLTPGPTGLPTFIDTTTRLTDSPVVT
                     IALIRGRTRGGGSEIALACDMRFASLERAIFAQIEVGAGVFPGGGGTERLPLLVGRAR
                     ALEIVLGSDDFDAATAANYGWVNRALPDDQLDAHVDNLARRIASFDKPALAEAKRLIN
                     RRTLPSADDLMETQGAFLNAFSWPTVSERGARIAQKRDEVGSDFEARMGYHLGNLSTD
                     TQ"
     gene            complement(69400..69726)
                     /locus_tag="RAHAQ2_RS24380"
                     /old_locus_tag="Rahaq2_5069"
     CDS             complement(69400..69726)
                     /locus_tag="RAHAQ2_RS24380"
                     /old_locus_tag="Rahaq2_5069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_014333880.1"
                     /db_xref="GI:504099886"
                     /translation="MNISNQEIIDECYQCAEACDHCAASCLNEEDIGMMKACIRLDIQ
                     CAAMCRLAAQFLAIQSGYAQQICYLCADICTACAEECSQHQHDHCQNCAQRCRQCADM
                     CSKVAA"
     gene            70481..73453
                     /locus_tag="RAHAQ2_RS24385"
                     /old_locus_tag="Rahaq2_5071"
     CDS             70481..73453
                     /locus_tag="RAHAQ2_RS24385"
                     /old_locus_tag="Rahaq2_5071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014333882.1"
                     /db_xref="GI:504099888"
                     /translation="MNQQTCTIMYNGEPLTGSINQPLIDFLDEHGKKLPHVCYHPALP
                     PLETCDVCWVEADGEKVRGCTLTTYDGLAVNSQSEAMRAAQEEGMDRILNRHELYCTV
                     CEHNTGDCTLHNTVADMHIPIQYYPFERKPYGKDHSNPFYTYDPDQCILCGRCVEACQ
                     NVEVNETLTIDYTEAHPRVRWDGGTQIAGSSCVSCGHCVTVCPCNALMEKTMQPDAGP
                     FTAMPEPVKRPLIDFVKALENSIGAEPVTAISLIDNALRQAEIKRTKTVCTYCGVGCS
                     FEMWTRDRHILKVQPVAQAPANGISTCVKGKFGWDFVNSPQRLTTPLIRENGRFRPAS
                     WDEALETVARRLREIAQRHGGDAIGFIGSSKASNEEAYLTQKIARLIFGTNNVDNSSR
                     YCQNPATQGLFRTVGYGGDAGTIKDMQQADLIITIGSNLAENHPVIASHIKQSHKHRS
                     QKLLVVDPRRHEMADRADLFLQITPGTDLVWASAMSRYMFDHGYADEEFLNRRVNQVD
                     EYYASLAPFTLEYASEITDLSVEALVAAAEMIGQAKSVCLLWAMGITQHSHGADTSTA
                     LSNLLLVTGNYGRPGTGGYPMRGHNNVQGASDFGCLSNVYPGYEKVTDPAMREKWAKA
                     WGVDPAALSDKAGADNYKMVQQADEGTLKAMYIIGEETAFSDADSTKVHEAFSKLEFM
                     VVQDIFMSRTAEFADVVLPGCPSVEKEGTFVNTERRIQRFYEVMKPLGESLPDWKILT
                     MLASKLGHPWYYQHPGQIMQEAAGIAGIFAGVSYERLAGWQSQLWPVSADGKSTPLLY
                     TDKFKFPDGKARLYPLEWHPPMEQADSEYDLLLDNGRMLEHFQSTNQTGKGGRITSLS
                     PNWYVEVGSQLAAERQLREGDWVRLTSRRGSLEVPVVITDRVAGNVLFIPIHHGKPGV
                     NGLTGEHHDPVVNTPAYKEIAVRMTKLDRAPQSDPLPRENFRHGQRNPINHVPAEDKW
                     RQDGYRLPPEHVEHPEKF"
     gene            73453..73944
                     /locus_tag="RAHAQ2_RS24390"
                     /old_locus_tag="Rahaq2_5072"
     CDS             73453..73944
                     /locus_tag="RAHAQ2_RS24390"
                     /old_locus_tag="Rahaq2_5072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333883.1"
                     /db_xref="GI:504099889"
                     /translation="MAERQEYQVPPARTETTAQDMLHTLTESLHEHGFLRLLNDVVRA
                     NTDIASILVSGLNQPGGQNAMQNLSLLFMTLSKIPPEHFNHLLQALKSGVMAVRQDNS
                     HDEPKKEETAPGVLGMMKLLNDEDLWRGLMPIVNGLKAFGEEIQKEEQKPVTRNTGKE
                     THE"
     gene            73937..75304
                     /locus_tag="RAHAQ2_RS24395"
                     /old_locus_tag="Rahaq2_5073"
     CDS             73937..75304
                     /locus_tag="RAHAQ2_RS24395"
                     /old_locus_tag="Rahaq2_5073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome D ubiquinol oxidase subunit I"
                     /protein_id="WP_014333884.1"
                     /db_xref="GI:504099890"
                     /translation="MSETDWVLLLSRGQFALTMAMHITLAALTLGLAPFLVWFEARWL
                     WGKQEAARTALHFWLKIFAITVAVGAVSGVVMEFQFGTNWSVFSQKAGGIIGPLLFYE
                     VLIAFFLESGLTGVMLFGMGKIRPKWHFVITCLVAAGALFSAFWILAANSWMQTPAGF
                     VRDANGIFHPTSWLALLSAPSFPLRFFHMVLASLIAVAFMIAGISAWRLLHHPAETAS
                     RIMIKAALWFALIATPVQIVVGDQHGENTLHYQPQKVAAMEGSWHQPVTGEGEPLRLF
                     AWPDQQSQHNRLEVAIPTIGSLYLRHNLTGHIKSLSEFPAQERPPVAAVFFSFRIMVG
                     LGLLMVITSGIAAYRLQRSRLFYARPLLWWLVWMSPSGFIALLAGWLVTELGRQPWTI
                     YGMLRTAESVSLIPLSWVITSCCGVILVYGLVFGFGLRHFLRYASAPLPQGPDVVVTA
                     IPTST"
     gene            75315..76274
                     /locus_tag="RAHAQ2_RS24400"
                     /old_locus_tag="Rahaq2_5074"
     CDS             75315..76274
                     /locus_tag="RAHAQ2_RS24400"
                     /old_locus_tag="Rahaq2_5074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003180978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome bd-type quinol oxidase, subunit 2"
                     /protein_id="WP_014333885.1"
                     /db_xref="GI:504099891"
                     /translation="MEWLADLSAAVLLFSLLMYLMLDGTDLGAGMLLFFFEDEEQKRS
                     IVKSMLPIWDANETWLVLLAGGLFALFPAAYALLFSALYIPVFVMLFCLILRAVALEY
                     RETVSVETRRWLDKLLPVSSALAAYCQGACAGLIVSGRFSADAFSWLGLYPVLSGLGL
                     IFVYLLLGCGWIRWRVGDGKVKGTLRFSRYFLLLNLGLFLVVQCINPAPWQHVWQLAW
                     GKGLIILIILLWLFLLSALQKLSPFIQLALSLILLAAIVIQTAAGIYPELIPGRMNLH
                     QAASGDITQMFILTGIAFVIPVTLIYHSWAFWVFRGKIKSEGK"
     gene            76287..76592
                     /locus_tag="RAHAQ2_RS24405"
     CDS             76287..76592
                     /locus_tag="RAHAQ2_RS24405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041246.1"
                     /db_xref="GI:739177302"
                     /translation="MKADEITLSGNDLIYQSVNFIKQNINTSLIRVILFSIISEQEFI
                     IHNYTYDFLVRLIGGGMLKNSDPDNTQSDHKRDKENPQPDYKKDDPHNAPESGDKRI"
     gene            76870..77037
                     /locus_tag="RAHAQ2_RS24410"
                     /old_locus_tag="Rahaq2_5076"
     CDS             76870..77037
                     /locus_tag="RAHAQ2_RS24410"
                     /old_locus_tag="Rahaq2_5076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333887.1"
                     /db_xref="GI:504099893"
                     /translation="MAEHRGGSGNFAEDPERASEAGKKGGQKSGGNFANDRERASEAG
                     KKGGKHSHDND"
     gene            complement(77280..78638)
                     /locus_tag="RAHAQ2_RS24415"
                     /old_locus_tag="Rahaq2_5077"
     CDS             complement(77280..78638)
                     /locus_tag="RAHAQ2_RS24415"
                     /old_locus_tag="Rahaq2_5077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructotransferase"
                     /protein_id="WP_014333888.1"
                     /db_xref="GI:504099894"
                     /translation="MSSQNYYDVTDWNQGNPYEDIGEVINSIIADIKSRQTDTNVNQG
                     GKPGAVIYIPPGDYPLLTQVVIDISYLKIMGSGHGFTSSSIRFNTPESEWVNWHEVWP
                     GGSRILVELPAGVGTEESDGAAFYIARSGDPRISSVEFADFCIDGLHFVDDGSGNDDP
                     ENTYLNGKTGIYIASAQDSFRISGMGLVYLEHGVTVYNADALAIHNNFIAECGNCIEL
                     RGSGQASKVTDNLIGAGYRGYSIYAQNFGGLLITANNIFPRGKSSIHFSGVVRSSVSS
                     NRFHSFYPGMLVFEGSCSENLVSANHFFREREPWGPMQPYNNGLDDLYGLLYISGDHN
                     SIIANHISETIDTQYITPPGAKPVIIRVVSGQGNYISDNHVVATTEASQVQAATGSCF
                     STQVSALLATQGLQALDVTTVQIEKESLQNIILDSGHDAQVVADKTVNAFRPTPVPDL
                     PV"
     gene            complement(78722..80143)
                     /locus_tag="RAHAQ2_RS24420"
                     /old_locus_tag="Rahaq2_5078"
     CDS             complement(78722..80143)
                     /locus_tag="RAHAQ2_RS24420"
                     /old_locus_tag="Rahaq2_5078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/melibiose symporter-like transporter"
                     /protein_id="WP_014333889.1"
                     /db_xref="GI:504099895"
                     /translation="MSATVMEKQSAYAKLSLKEKIGYGMGDAGSCMIWSVLALYLTWF
                     YTDVYGLAPGIVGTLFLVIRIFDAFSDPIMGAICDRTHSKWGKFRPWLLWMAVPFGLG
                     AILMFTTPDLSMNGKIIYAWVTYLIMSLIYTAINIPYCSVAGVITLNQKERLGCLSWR
                     FFLNGLATLIVSSTILPLTDWLGNGSRASGFQLTMTIMGGAATLMFLFCFSSIKERVV
                     SLKPNDSLLKDLKDIARNDQWLLMISITFLNVFPAFIRGAVTIYYATYVMHASVGFIT
                     LFMALGVACNMLGSVIAKPLTDRFDKIKLFRIINIILGILSFALWFVDPSSLTPLLTL
                     FIIINILHLIQSGPILWAMMSDVDDYGDWKFGKRLTGISFAGNLFMLKMGLAVAGAIV
                     AWILSFTGYVANKPEQNAQTIQGIVIMFSLLPMISYFISAFIVRYFKLNNTLLERIKV
                     DLAKRELENGPDQSQGLKDIPVH"
     gene            complement(80270..81280)
                     /locus_tag="RAHAQ2_RS24425"
                     /old_locus_tag="Rahaq2_5079"
     CDS             complement(80270..81280)
                     /locus_tag="RAHAQ2_RS24425"
                     /old_locus_tag="Rahaq2_5079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcription regulator"
                     /protein_id="WP_014333890.1"
                     /db_xref="GI:504099896"
                     /translation="MASIKDVAKKAGVSTATVSRVLNNHPSVIPETRKAVRDAMDYLC
                     YVPSKSAFQLSGKCSGLIAVVVPNLVNPHFCELLATFEEEARYIGKSVIVKTHQNQAQ
                     QDKQIIHTLIGMGIDSLLWVPTEAEAELSEWLTATHIPVAVVTQVSRFFNSVSINQSK
                     GAESIAEHFIQTGHTTFGFVAQEGVDNRKVSAWSKKITSQGLTFNKENQFWIAKGEGE
                     RTSGHISILDKIIEKLALRRNECSCLWVYNDVAASYIIDGLKKQGISVPQDIAIASFD
                     NTLLAQTKGITSVAQPIHEIAHLAFQMVKNQSKQEGIEMYEIVSRLIIRESSVNMDIT
                     TF"
     gene            complement(81446..81787)
                     /locus_tag="RAHAQ2_RS24430"
                     /old_locus_tag="Rahaq2_5080"
     CDS             complement(81446..81787)
                     /locus_tag="RAHAQ2_RS24430"
                     /old_locus_tag="Rahaq2_5080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_014333891.1"
                     /db_xref="GI:504099897"
                     /translation="MTTQQERNYRCTVEATIAVAGGKWKPLIIYYLLTGTKRFGELRK
                     LIGGVTQRSLTLQLRELEAHGIISREIFAEVPPRVEYSLTELGFTLAPVLDTMKSWGD
                     TYISWQQRNDK"
     gene            81937..82920
                     /locus_tag="RAHAQ2_RS24435"
                     /old_locus_tag="Rahaq2_5081"
     CDS             81937..82920
                     /locus_tag="RAHAQ2_RS24435"
                     /old_locus_tag="Rahaq2_5081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_014333892.1"
                     /db_xref="GI:504099898"
                     /translation="MKAAFYETQGPAHEVLKIGEVSKPTPGPDEVLVRISVSGINPTD
                     IKARTGFSAKMPYPRIIPHQDGAGVIEAVGGNVSSERLGERVWLYEAQYGRATGTAAE
                     FVAVPAHQAVRLPDNVSFETGASLGIPALTAHRCLFSDGDLKGCRVLIHGGAGAVGTA
                     AISLAKWAGAWVATTVSNAKQAEIARTRGADLVLNRSTDDVARTILANTENLGVDHIV
                     DVALKENFDTNLACLSQGGVISAYATNSATEEISVPLLKAMTHGCVLRFVYIYNVPRE
                     LKQASAADINACLETGNYSPVIGLNLPLEQIADAHYAVEYSEVIGKVLVHL"
     gene            complement(83021..83296)
                     /locus_tag="RAHAQ2_RS24440"
                     /old_locus_tag="Rahaq2_5082"
     CDS             complement(83021..83296)
                     /locus_tag="RAHAQ2_RS24440"
                     /old_locus_tag="Rahaq2_5082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333893.1"
                     /db_xref="GI:504099899"
                     /translation="MPDYCFFKKGKQTVVLERSDADGAFQLTQQGFEKQFEEVSAIDE
                     KHALNRFSDIRREKRIDQHNFLAGAIAMPLIGVYTAIAGFLFRKKQP"
     gene            complement(83490..84869)
                     /locus_tag="RAHAQ2_RS24445"
                     /old_locus_tag="Rahaq2_5083"
     CDS             complement(83490..84869)
                     /locus_tag="RAHAQ2_RS24445"
                     /old_locus_tag="Rahaq2_5083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014333894.1"
                     /db_xref="GI:504099900"
                     /translation="MGYKEIYARYRQQILDGRLKPGDRVPAIRVLASELQVARKTVET
                     AYEILIGEGYFVSQGAKGTRVNPSLRVASAASMHTAAPSRLLGQPVIESKGELRLGIP
                     ALDEFPHKKWLLISGKTVRSLRPEEMIIPPVMGYQPLREAIASYLNISRGLNCQPEQI
                     FITSGYRANLRLILSVLAQPNDKVLFEDPGYFFGQQLLRRIAPNLHYVPVDRQGVDVD
                     YLQRYHADARFAIVTPTHQSPLAVSLSLPRKHQLLAWAQQNSSWIIEDDYDGEFHYTR
                     KVIPALKSLDMHDRVIYTGTFSKTMMPAMRIGYLVMPQETVVRFSELGEILETGLPLL
                     PQKILAQFLSEGHFYRHLKKMRILYQQRRRIMFEAIETSFPGLFEFELTDGGMHIVAF
                     LRRGIQDNALAALWRQHELYVRPLSNWYAQTQKRYGLVIGYTNIRSFEQAQQILQRVA
                     AETRALMQS"
     gene            85015..85494
                     /locus_tag="RAHAQ2_RS24450"
                     /old_locus_tag="Rahaq2_5084"
     CDS             85015..85494
                     /locus_tag="RAHAQ2_RS24450"
                     /old_locus_tag="Rahaq2_5084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005131815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase"
                     /protein_id="WP_014333895.1"
                     /db_xref="GI:504099901"
                     /translation="MSSRVNHFKTIPALAKTLGEASMTLGKASLDKKIKYLVDIRASQ
                     LNHCAFCLDMHVKEAKLHGERELRLYHVAIWRESPLFSAKEKAALALTEALTRIGEQG
                     VSEALYSELREHFSEVEISELTFSIALINAWNRLQILSQMVPGALDSAYGLDRAELH"
     gene            complement(85681..86619)
                     /locus_tag="RAHAQ2_RS24455"
                     /old_locus_tag="Rahaq2_5085"
     CDS             complement(85681..86619)
                     /locus_tag="RAHAQ2_RS24455"
                     /old_locus_tag="Rahaq2_5085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_037041266.1"
                     /db_xref="GI:739177322"
                     /translation="MTLINPNDFSRIDLNLLVVLIVMYEERNVTQAAQRLHLGQPAVS
                     AALKRLRSMFNEALFVRTTQGMMPTPRTCELIQALTPLMAQLQAVVLNPPRFNPEKDK
                     LTFHIGMSDWIEHWLMPDLLAGIMREAPQVSINAVATDPWKVVSALEQNKVDLSITVG
                     QETSRDLRREKLTSAGFKTLWDPGQIDITKPLTVAQFVHHEHLLISYRGASQSAMDSS
                     LEKAGVSRRVRYVSSHFSTLPLMLSQMPLFATVPMMLVDDWCRQYGFQSDSVPVHMPP
                     FELALLWHRNRDSDAATLWMLNKIRQLIAKKLSAIR"
     gene            86725..87561
                     /locus_tag="RAHAQ2_RS24460"
                     /old_locus_tag="Rahaq2_5086"
     CDS             86725..87561
                     /locus_tag="RAHAQ2_RS24460"
                     /old_locus_tag="Rahaq2_5086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333897.1"
                     /db_xref="GI:504099903"
                     /translation="MRITVGQCQVEKITEQTTSFPLRQLFPDHIDEMINYPEDAAVGL
                     SIHSWLVKTPKDIILIDTATGNGRNRGGIPLFDHLNSDYLERLKQTGIAAEQVSLVLM
                     THIHTDHVGWNTHWNEGEWQPLFPHARYVCSARELAKCQADPGRQELYRDSILPLIKS
                     GQLDAIDIEQSPLFSGVLRYMPTPGHSDDHGSLLLVSDQQHAIFTGDLMHHEVQFEHP
                     HWNSVFCENKPQASLSRRKAIDWALEHQAIWFSSHFAGASFGRVRYDGNQRYQWQTPE
                     EE"
     gene            87561..88904
                     /locus_tag="RAHAQ2_RS24465"
                     /old_locus_tag="Rahaq2_5087"
     CDS             87561..88904
                     /locus_tag="RAHAQ2_RS24465"
                     /old_locus_tag="Rahaq2_5087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_014333898.1"
                     /db_xref="GI:504099904"
                     /translation="MFQQEDYAKASVTELLQKLQNGETRAAALTEFALAIIAEREPAL
                     NAITWLYADEAKQAAIASDEKRRRGHPCGRLEGIPLLVKDNIDVAGWPTTAGSKALLG
                     IIADHDAPLVKRLREEGAILLGKTAMHELAAGITGASSLSGYTHNAYRPGYNPGGSSS
                     GSAVAVAAGYVPFAVGTDTAGSVRIPAAFNLLYGLRPTRGSVPMAGIVPLSPTQDIAG
                     PLVRHAKDLRWVTEIMTGKSFPSRGETLRIGWLDSAFNDISDTSRNKMRAAVQNIGAE
                     VVTVGVTSLDSLAEAANIIAFEFAESLNAFLSARPQASFTSLQEIVAANIHHPQLDAV
                     FRARAEHAGTNSPEYRGVQQRQRDFYNLLKALFAGHDINLLAYPVMRHPPVKHGEIQT
                     GSNALLAATSGTPALTFPVGFDDQGFPLGLELLALRDREDLLLNVCLKSLNGPAG"
     gene            complement(89197..89820)
                     /locus_tag="RAHAQ2_RS24470"
                     /old_locus_tag="Rahaq2_5088"
     CDS             complement(89197..89820)
                     /locus_tag="RAHAQ2_RS24470"
                     /old_locus_tag="Rahaq2_5088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="WP_014333899.1"
                     /db_xref="GI:504099905"
                     /translation="MADENMLITDSDELEQLYGAIAKPSLTKVTDHIHPAYRPFIEAS
                     PFVALATSGPEGLDVSPRGDPAGFIHIEDAKTILLPDRRGNNRIDSLRNILNDNRVAL
                     LFLIPGIGETLRITGTAEIRKDPALLAKFSINNHPPKTVLRISVNSVFFQCSRAIIRS
                     KLWDPATQIERQTLPSTGSILSMISQSEIDGLAYDEALPGRLKTTLY"
     gene            90091..90879
                     /locus_tag="RAHAQ2_RS24475"
                     /old_locus_tag="Rahaq2_5089"
     CDS             90091..90879
                     /locus_tag="RAHAQ2_RS24475"
                     /old_locus_tag="Rahaq2_5089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_014333900.1"
                     /db_xref="GI:504099906"
                     /translation="MPILHTEHGDIDYQDIGTGDTTLFLMPGWCQPKTVFNDFSELAA
                     VFFRVVIIDWRGHGKSSTDGQDFDGAALLTDALTLIEHLGLSRVVPVSVAHASWIAVD
                     LVESLKERVPAVIFLDWIMNQPAAAFFTSIKEMQHEDRWQYARDHLYEFWLAGSDSPI
                     MNHHLKTEMAGSSYQLWRLAGQVIADAYHKYGSPLQRLEKLKNPPKATHIYSLDRNDE
                     YLALQQRFATTHDFFKVKRLENARTHLAVLERPGDVLAGIMASI"
     gene            91483..95007
                     /locus_tag="RAHAQ2_RS24480"
                     /old_locus_tag="Rahaq2_5091"
     CDS             91483..95007
                     /locus_tag="RAHAQ2_RS24480"
                     /old_locus_tag="Rahaq2_5091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate:ferredoxin (flavodoxin) oxidoreductase,
                     homodimeric"
                     /protein_id="WP_014333901.1"
                     /db_xref="GI:504099907"
                     /translation="MPGKMKTMDGNTAAAYVSYAFTDVTAIYPITPSTPMAESVDEWA
                     AQGKKNLFGQTVKIMEMQSESGAAGAIHGALQAGALATTYTASQGLLLMTPNMYKIAG
                     ELLPAVFHVSARALATNSLNIFGDHQDVMAVRQTGCAMLAESSVQQVMDLAAVAHLTA
                     IKGRIPFINFFDGFRTSHEIQKIEVLDYEDLGALLDRDAVARFRQNALHPDHPVVRGT
                     AQNPDIYFQEREASNKFYMALPEMVESYMAKISALTGREYHLFNYYGAPDAGRMIIAM
                     GSVCETIQETVDYLNARGEKVGVLTVHLYRPFSLKHFFKYIPKSVSNIAVLDRTKEPG
                     SLAEPLYLDVKSAFYNSDWRPVIVGGRYALGGKDILPSHIISIFDNLAAERPRDGFTV
                     GINDDVTFTSLPLSDRDIDTSSSGTTACKFWGLGSDGTVGANKSAIKIIGDKTDMYAQ
                     AYFAYDSKKSGGVTMSHLRFGHNPIRSPYLIDKADFISCSQQSYVNKYHLLAGLKPGG
                     TFLLNCSWDVAELDEKLPVAMKRYIAANDIQFYIVNAVGIAQKLGLGGRFNMIMQSAF
                     FKLADIIPLTRAVEYLKHSIEHAYGNKGQKIVDMNNLAVDSGIESVVKISVPQAWKHL
                     EDKVVSPKKLPAFIKDILIPMNRQEGDSLPVSIFDGIEDGTFPSGTSAYEKRGVAINV
                     PVWQTDKCTQCNQCAFICPHAAIRPVLISEEERQNAPAGFSAKRASGTEDAWYRLAVS
                     PLDCSGCGNCADVCPVKGKALSMQPLESQEHEIELWEHALSLTPKANPQNKFTVKGSQ
                     FEQPLLEFSGACGGCGETPYAKLVTQLFGDRMMIANATGCSSIWGASAPSIPYTTNHK
                     GQGPTWANSLFEDNAEFGLGMLLGVDAIRDTLATQVKAALDNAPDVPLDAELSACLSD
                     WLANKDQGEGTRERAEKVVTLLASQTPGKNPHTDSIYAHRDYLAKRSHWIFGGDGWAY
                     DIGFGGLDHVLASGKDVNVLVFDTEVYSNTGGQSSKSTPAAAIAQFAASGKKTRKKDL
                     GMMAMSYGYVYVAQIAMGADKNQTLRAIAEAEAYPGPSLIIAYAACINHGLRIGMGCS
                     QREARRAVEAGYWANYRYHPELKEAGKNPFILDSEEPEEDFQAFLAGEVRYSSLKKLY
                     PEFAEFLFKKTEDDARERLEGYKKLASS"
     gene            95073..95606
                     /locus_tag="RAHAQ2_RS24485"
                     /old_locus_tag="Rahaq2_5092"
     CDS             95073..95606
                     /locus_tag="RAHAQ2_RS24485"
                     /old_locus_tag="Rahaq2_5092"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P28579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="WP_014333902.1"
                     /db_xref="GI:504099908"
                     /translation="MATIGIFFGSDTGQTRKVAKLIHQKLDGIADAPLDIRRATREQF
                     LSYPVLLLGTPTLGDGELPGVEAGSQYDSWQEFTNTLSEADLTGKTVALFGLGDQLNY
                     SKNFVSAMRILYDLVIARGACVVGNWPREGYKFSFSAALLENNEFVGLPLDQENQYDL
                     TEERIDSWLEKLKPAVL"
     gene            complement(95743..96258)
                     /locus_tag="RAHAQ2_RS24490"
                     /old_locus_tag="Rahaq2_5093"
     CDS             complement(95743..96258)
                     /locus_tag="RAHAQ2_RS24490"
                     /old_locus_tag="Rahaq2_5093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014683038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-molybdenum cofactor biosynthesis protein
                     NifQ"
                     /protein_id="WP_014333903.1"
                     /db_xref="GI:504099909"
                     /translation="MNGAQGWLSRLLSLHLTGRSRFPPQMGLGDVAWQALLQHTGRAA
                     PVLSTLQFEQQKLLGLLQQARTCEREQLAQWLAQSQVPEAAPMHELIATASMGFDHLW
                     QDLGLDSRAELRDLMTDCFPELVRMNHQNMRWKKFFYRQQCLQSLGEIVCRSPSCNEC
                     CEWHTCFAPED"
     gene            complement(96258..97652)
                     /locus_tag="RAHAQ2_RS24495"
                     /old_locus_tag="Rahaq2_5094"
     CDS             complement(96258..97652)
                     /locus_tag="RAHAQ2_RS24495"
                     /old_locus_tag="Rahaq2_5094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FeMo cofactor biosynthesis protein NifB"
                     /protein_id="WP_014333904.1"
                     /db_xref="GI:504099910"
                     /translation="MTSCPSSAGCSGQSPSRVNEQLARKAAQHPCYSVSGHHRFARMH
                     LAVAPACNLQCHYCNRKYDCSNESRPGVVSELLLPEQAVAKARQVAAAIPQLSVVGIA
                     GPGDPLANIGRTFQTLELLRQQLPDLKLCLSTNGLMLPDVVDRLVDIGVDHVTVTMNA
                     LDPAVAEKIYAWLWYEGERYTGRMAADLLIERQAEGIRKLIEKGVLVKINSVLIPGIN
                     DQHMQAVSQQAGEWGAFLHNIMPLISRPEHGTVFGLNGQAEPDADMVASVRKSCGMSM
                     PQMTHCHQCRADAIGMLGEDRNAAFPLASVPVNPPPYLPVLHQRAQLHASIVSQGGSE
                     EADACLVAVATSQGQAVDQHFGHADRFTLYSLSAAGVMQVGQRFTPRYCRSPDDCEPE
                     DAAQNMDALLELLADVKAVFCARIGLTPWKRLEAAGIEPQVDGAWQPVETALAQWWQQ
                     RKLAGGEISIRGVA"
     gene            complement(97846..99402)
                     /locus_tag="RAHAQ2_RS24500"
                     /old_locus_tag="Rahaq2_5095"
     CDS             complement(97846..99402)
                     /locus_tag="RAHAQ2_RS24500"
                     /old_locus_tag="Rahaq2_5095"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P54930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_014333905.1"
                     /db_xref="GI:504099911"
                     /translation="MTQLPTAGPVIRRFDMSAQFTALYRISVALSQESNTARALAAIL
                     EVLHDHAFMQYGMVCLFDKERNALFVESLHGIDGERKKETRHVRYRMGEGVIGAVMSQ
                     RQALVLPRISDDQRFLDRLNIYDYSLPLIGVPIPGADNQPAGVLVAQPMALHEDRLAA
                     STRFLEMVANLISQPLRSATPPESLPAQTPVRCSVPRQFGFEQMVGKSQAMRQTMDIL
                     RQVSKWDTTVLVRGESGTGKELIANAIHYNSPRAAAPFVKFNCAALPDNLLESELFGH
                     EKGAFTGAIRTRKGRFELADGGTLFLDEIGESSASFQAKLLRILQEGEMERVGGDTTL
                     KVDVRIIAATNRNLEEEVRAGNFREDLYYRLNVMPVSLPALRERLDDIADLAPFLVKK
                     IALRQGRELRISDGAVRLLMTYSWPGNVRELENCLERASVMTDEGLIDRDVILFNHHE
                     SPALSVKPGLPLATDESWLDQELDERQRVIAALEKTGWVQAKAARLLGMTPRQIAYRI
                     QIMDINMHRI"
     gene            complement(99399..100886)
                     /locus_tag="RAHAQ2_RS24505"
                     /old_locus_tag="Rahaq2_5096"
     CDS             complement(99399..100886)
                     /locus_tag="RAHAQ2_RS24505"
                     /old_locus_tag="Rahaq2_5096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation regulatory protein"
                     /protein_id="WP_014333906.1"
                     /db_xref="GI:504099912"
                     /translation="MSITALSASFPEGNIASRLSLQHPSLFYTVVEQSSVAISLTDPQ
                     ARICYANPAFCRQTGFALETLLGENHRLLASQQTPKHIYDEMWRTLLQGKSWNGQLIN
                     RRNNRSLYLADVTITPVLGADGQVEHYLGMHKDISEKYALEQRLRNHITLFTEVLNNI
                     PAAVVVVDEQDNVVMDNLAYKTLCADCGGKELLAEMGYPQLKEMLNSGEPVPVSMRGN
                     VRWFSFGQWSLQGVNEEASRFFTGITAPGKLIVLTDCTDQHHRQQQGYLDRLKQKLTN
                     GKLLAAIRESLDAALIQLNGPINMLAAARRLNGEEGNNMALEFAWREGEQAVSRLQAC
                     RPSLDFEPQAEWPVSEFFDDLSALYDSHFLSDGELRYVVMPSDLHAVGQRTQILTALS
                     LWIDHTLSQAQAMPSLKLSVNIVAKQDASWLCFDITDNVPRERVRYARPEAAFSRPGN
                     GMELRLIQTLIAHHRGSLDLSVRPDGGTLLTLRLPVQQVITGGLK"
     gene            complement(101189..101983)
                     /locus_tag="RAHAQ2_RS24510"
                     /old_locus_tag="Rahaq2_5097"
     CDS             complement(101189..101983)
                     /locus_tag="RAHAQ2_RS24510"
                     /old_locus_tag="Rahaq2_5097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation protein NifM"
                     /protein_id="WP_014333907.1"
                     /db_xref="GI:504099913"
                     /translation="MSIPVWHRYSRWKLAKQMKLSEELNPTPAQYQQFIEAWQRQQVI
                     EEAVAQAALEHALNIEPQSVEVTRQALAAELPELELTATETEELLLHQTLLREQLNWV
                     QQQAPLPDDAQVEAWYRGHAQHFVRPEQRYTRHLLLTVEGNSPAVREQIDAIARRLRD
                     GHALFARQALRYSHCPSAMGGGVLGWVGRGILYPQLEDTLFRLEAGQLSSPVETELGW
                     HLLLCEQIRLPQPLPKAEALTRVRQQLIARQQNHYQRQWLQQLINA"
     gene            complement(101980..102423)
                     /locus_tag="RAHAQ2_RS24515"
                     /old_locus_tag="Rahaq2_5098"
     CDS             complement(101980..102423)
                     /locus_tag="RAHAQ2_RS24515"
                     /old_locus_tag="Rahaq2_5098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein nifZ"
                     /protein_id="WP_014333908.1"
                     /db_xref="GI:504099914"
                     /translation="MKPVFEVDQQVRVTRIVRDDGTFAGKTCGDLLIRRGSLGYVREW
                     GVFLQDTIVYQVHFLDDDLIIGCREQELIAGDAPWLAGAFQYGDRVSSRRSLVIRGEV
                     VVPQGGMGRVMSCEPLDSIFHYQVLFAQRIFQVPEHALKLEEELA"
     gene            complement(102420..102758)
                     /locus_tag="RAHAQ2_RS24520"
                     /old_locus_tag="Rahaq2_5099"
     CDS             complement(102420..102758)
                     /locus_tag="RAHAQ2_RS24520"
                     /old_locus_tag="Rahaq2_5099"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q52071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation protein NifW"
                     /protein_id="WP_014333909.1"
                     /db_xref="GI:504099915"
                     /translation="MDWFTRIEGVDELESAQSFFDFFELEVDPVLLRSRHLHIMAQFN
                     QRLTAAVPVHFVDEEESDRADWRLARRLLAESYQHTVAGPLNTQSGLAVYQRNNGSFI
                     DWNDLLEVRP"
     gene            complement(102760..103917)
                     /locus_tag="RAHAQ2_RS24525"
                     /old_locus_tag="Rahaq2_5100"
     CDS             complement(102760..103917)
                     /locus_tag="RAHAQ2_RS24525"
                     /old_locus_tag="Rahaq2_5100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014683031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homocitrate synthase"
                     /protein_id="WP_037041263.1"
                     /db_xref="GI:739177319"
                     /translation="MAVTINDTTLRDGEQSPGVAFRASEKMEIAQALVNAGVRELEAG
                     TPALGEEECVRLAILRRQLPDTVMMSWCRMNSAEIHDSARVGMDWVDISVPASDLLRE
                     QKLHRPWPAVIASLKPLVQLAHRLGMRVCMGCEDASRSADETLHMLAEVAADLGIERM
                     RFADTLGILDPFSTFTRISALRQHWHGGLEIHAHNDLGMATANTLAAVRAGATHVNTT
                     VLGLGERAGNAALESVTLSLDRCLHLDCGIDFTELPALCRLVAAAAGRTIDVQHPLVG
                     GQVFTHESGLHVAALLRDPRSYQGIDPSLVGREFNLVLGKHSGRQAVSGICARLGYIL
                     SETQTLLMLQEVKRFAEHFKRNPGEDEVIAMCQMRMDDQIPFEGQLQAQGG"
     gene            complement(103978..105183)
                     /locus_tag="RAHAQ2_RS24530"
                     /old_locus_tag="Rahaq2_5101"
     CDS             complement(103978..105183)
                     /locus_tag="RAHAQ2_RS24530"
                     /old_locus_tag="Rahaq2_5101"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q52069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_014333911.1"
                     /db_xref="GI:504099917"
                     /translation="MKNVYLDNNATTRIDPMVLEAMMPYLRDYYGNPSSIHDFGGPCR
                     AGLECAREQVASLLGAAYTSEIIFTSCATEATSTAIYSAIALAPERREIITTAVEHPA
                     TLAVCEHLERQGYMIHRIGVSEEGALDTAHYYDALSENVALVTMMWANNETGVLFPVS
                     EMATAAHERGILFHCDAVQAVGKIPISLRATDIDMLSCSAHKIHGPKGCGCLYLRRNT
                     RFRPLVRGGHQERGRRAGTENIAGIVGMGAACELADVHMPMMASVQEMRDRLETGLLT
                     TIPHTLLMGANQPRTPNTVNIAFEYIEGEAILLLLNHCGIAASSGSACTSGSLESSHV
                     MRAMNIPYTAAHGSIRFSLSRFTREREIEWAIEQMPDIVARLRTLSPYWQQDKVQIAQ
                     GGLFAPTYG"
     gene            complement(105229..106056)
                     /locus_tag="RAHAQ2_RS24535"
                     /old_locus_tag="Rahaq2_5102"
     CDS             complement(105229..106056)
                     /locus_tag="RAHAQ2_RS24535"
                     /old_locus_tag="Rahaq2_5102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation protein NifU"
                     /protein_id="WP_014333912.1"
                     /db_xref="GI:504099918"
                     /translation="MWNYSEKVKEHFFNPRNAKVVDDANAIGDVGSLSCGDALRLMLK
                     VDPETEIILDAGFQTFGCGSAIASSSALTELIIGRSLTQAQQVSNQQIADYLDGLPPE
                     KMHCSVMGQEALRAAINNFRGEAPDEDHEEGALICKCFAVDEAQIRRAVLANGLTTLE
                     DVINYTKAGGGCTSCHEKIELCLEEILKEHPVKNPVAAKVRDENWLAVEEVVASLRPH
                     IRADGGDMSLVRVDGQEVTVELSGSCSGCMMTDMTLAWLQQKLVERMGRYIRVVSAA"
     gene            complement(106074..106412)
                     /locus_tag="RAHAQ2_RS24540"
                     /old_locus_tag="Rahaq2_5103"
     CDS             complement(106074..106412)
                     /locus_tag="RAHAQ2_RS24540"
                     /old_locus_tag="Rahaq2_5103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014683028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014333913.1"
                     /db_xref="GI:504099919"
                     /translation="MMVIEPAVFDRLLALQRQLSPQGGGLRMTLGGDPCGGWKVGLHW
                     SAAFRPRDHVEMINGLRLLADPLHWTLLQHATLSAGEQNSCAGIRVVLPAASACHCES
                     GSCTTSPEPD"
     gene            complement(106567..107031)
                     /locus_tag="RAHAQ2_RS24545"
                     /old_locus_tag="Rahaq2_5104"
     CDS             complement(106567..107031)
                     /locus_tag="RAHAQ2_RS24545"
                     /old_locus_tag="Rahaq2_5104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014683027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation protein NifX"
                     /protein_id="WP_014333914.1"
                     /db_xref="GI:504099920"
                     /translation="MRRANRYLDTVSVTQWPMQVAFASSDYHHVDQHFGASTRLVVYG
                     VKQDQVQLLRVAEFSAESGHQQEKIACRMAALEDCVTLYCLAIGDSVFRQLLEIGVRA
                     IKVPQDTDIAHLLKQMQQHWSAAERQVTRRGRDPGRFDKLLAGDEWQEEDRP"
     gene            complement(107018..108403)
                     /locus_tag="RAHAQ2_RS24550"
                     /old_locus_tag="Rahaq2_5105"
     CDS             complement(107018..108403)
                     /locus_tag="RAHAQ2_RS24550"
                     /old_locus_tag="Rahaq2_5105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase iron-molybdenum cofactor
                     biosynthesis protein NifN"
                     /protein_id="WP_014333915.1"
                     /db_xref="GI:504099921"
                     /translation="MAQILRNAKPLATTPVKSGQPLGAILASQGLENCIPLVHGAQGC
                     SAFAKVFFIQHFHDPIPLQSTAMESTTTIMGSDGNVSTALTTLCQRSNPKAIVILSTG
                     LSEAQGSDLSMALREFRDKEPRFNAIAILTVNTPDFYGSLENGYSALMESVITQWVPE
                     KPPTGMRNKRVNLLVSHLLTPGDLELLRSYVEAFGLQPVILPDLSQSLDGHLANGDFN
                     PVTQGGTSQRQIEQMGQSLTTITIGSSLNCAASLMAMRSRGMALNLPHLMTLENMDSL
                     IRHLHQVSGREVPAWIERQRGQLLDAMIDCHTWLQSQRIALAAEADLLVAWCDFAQSQ
                     GMRVGPVIAPVNQQSLAGLPVEQVVIGDLEDLQTRLDSYPVSLLVANSHAAPLAEKNG
                     IALVRAGFPLYDRLGEFRRVRQGYAGIRDTLFELANLMQARHHMLTAYHSPLKQVFGL
                     SPVPEASHEAR"
     gene            complement(108453..109826)
                     /locus_tag="RAHAQ2_RS24555"
                     /old_locus_tag="Rahaq2_5106"
     CDS             complement(108453..109826)
                     /locus_tag="RAHAQ2_RS24555"
                     /old_locus_tag="Rahaq2_5106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014683025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase iron-molybdenum cofactor
                     biosynthesis protein NifE"
                     /protein_id="WP_014333916.1"
                     /db_xref="GI:504099922"
                     /translation="MKAKEILALIDEPACEHNHKQKSGCSLPKPGATAGGCAFDGAQI
                     ALLPVADVAHLVHGPIGCTGSSWDNRGSRSSGPSINRMGFTTDMSEQDVIMGRGERRL
                     FHAVQHIVSHYHPVAVFIYNTCVPAMEGDDVEAVCRAASAAAGVPVISVDAAGFYGSK
                     NLGNRIAGDVMVKKVIGQREPAPWPENSPIPAGHRHSISLIGEFNIAGEFWHVLPLLD
                     ELGIRVLCSLSGDSRFAEIQTMHRGEANMLVCSRALINVARKMEERYQIPWFEGSFYG
                     LRSMADSLRTIAVLLKDPDLQARTERLIEREEAATHLALAPYRARLSGRKALLYTGGV
                     KSWSVVSALQDLGITVVATGTRKSTEEDKQRIRELMGEDVLMLDEGNARTLLDTLYRF
                     GGDIMIAGGRNMYTAYKARLPFLDINQEREHAFAGYHGLVNLAEQLCITLESPVWAQV
                     NRLAPWR"
     gene            complement(109998..110672)
                     /locus_tag="RAHAQ2_RS24560"
                     /old_locus_tag="Rahaq2_5107"
     CDS             complement(109998..110672)
                     /locus_tag="RAHAQ2_RS24560"
                     /old_locus_tag="Rahaq2_5107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014683024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein nifY"
                     /protein_id="WP_014333917.1"
                     /db_xref="GI:504099923"
                     /translation="MSKDDLLFWRLFAVVQLFPEIPPPEVLAWLTQGSREGDGNIGLA
                     HLQAMSLEELEATFPGDAGKVTVSRWQSLMSCLQGQLPPHLTLNENRRQPQQLRVAFS
                     SLDGITVNGHFGQSHLFFIYAFDSDGPYLMALRRTPVSPEGEESNETRARLISDCHLL
                     FCEAIGGPAAARVIRHNIHPIKVLPGVSIASQLAALQRMLTENMPPWLARRLGKSNPL
                     ENRLFS"
     gene            complement(110687..110902)
                     /locus_tag="RAHAQ2_RS24565"
                     /old_locus_tag="Rahaq2_5108"
     CDS             complement(110687..110902)
                     /locus_tag="RAHAQ2_RS24565"
                     /old_locus_tag="Rahaq2_5108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein nifT"
                     /protein_id="WP_014333918.1"
                     /db_xref="GI:504099924"
                     /translation="MPMVIFRLRNNSLYCYIAKQDMEAKVVQLEHNHPQQWGGRVCLE
                     GGKAYYVEPQPGIPSFPVSLRATRSEL"
     gene            complement(110978..112546)
                     /locus_tag="RAHAQ2_RS24570"
                     /old_locus_tag="Rahaq2_5109"
     CDS             complement(110978..112546)
                     /locus_tag="RAHAQ2_RS24570"
                     /old_locus_tag="Rahaq2_5109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014683023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase molybdenum-iron protein beta chain"
                     /protein_id="WP_014333919.1"
                     /db_xref="GI:504099925"
                     /translation="MSQDLGTPKSCFPLFEQDEYQNMFTHKRALEEAHGEAKVREVFE
                     WTTTQEYQDLNFSREALTVDPAKACQPLGAVLCALGFTNTLPYVHGSQGCVAYFRTYF
                     NRHFKEPVACVSDSMTEDAAVFGGNNNMNVGLENASALYKPEIIAVSTTCMAEVIGDD
                     LQAFIANAKKDGFVDAGMPIPYAHTPSFLGSHVTGWDNMFEGFARTFTTDATREYQPG
                     KLAKLNVVTGFETYLGNYRVIHRMMSQMGVECSVLSDPSEVLDTPADGQYRMYAGGTT
                     QTEMRDAPDAIDTLLLQPWQLQKTKKVVQGDWNQPGTEVSVPIGLAATDALLMTVSEL
                     TGKPIADALATERGRLVDMMLDSHTWLHGKRFGLYGDPDFVMGMTAFLLELGCEPTTI
                     LSHNGNKRWQKAMKKMLADSPYGQDSEVYVNCDLWHFRSLMFTRKPDFMIGNSYGKFI
                     QRDTLAKGEQFEVPLIRIGFPIFDRHHLHRQTTWGYEGAMSILTQLVNAVLEQLDRET
                     MKLGKTDYNFDLIR"
     gene            complement(112603..114051)
                     /locus_tag="RAHAQ2_RS24575"
                     /old_locus_tag="Rahaq2_5110"
     CDS             complement(112603..114051)
                     /locus_tag="RAHAQ2_RS24575"
                     /old_locus_tag="Rahaq2_5110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase molybdenum-iron protein alpha chain"
                     /protein_id="WP_014333920.1"
                     /db_xref="GI:504099926"
                     /translation="MTSETRERNEALIQEVLEIFPEKALKDRKKHMMTTDPAMESVGK
                     CIVSNRKSQPGVMTVRGCAYAGSKGVVFGPIKDMAHISHGPVGCGQYSRAGRRNYYTG
                     WSGVNSFGTLNFTSDFQERDIVFGGDKKLDKLIDELEMLFPLTKGISVQSECPVGLIG
                     DDISAVAKASSAKIGKPVVPVRCEGFRGVSQSLGHHIANDVIRDWVLDNREGNEFETT
                     PYDVAIIGDYNIGGDAWASRILLEEMGLRVVAQWSGDGTLVEMENTPKVALNLVHCYR
                     SMNYISRHMEEKHGIPWMEYNFFGPTKIAESLREIAARFDDTIRKNAEAVIEKYQAQT
                     QAVIDKYRPRLEGKKVLLYLGGLRPRHIIGAYEDLGMEIIGTGYEFGHNDDYDRTLPM
                     LKEGTLLFDDLSSYELEAFVKALKPDLVGSGIKEKYIFQKMGVPFRQMHSWDYSGPYH
                     GYDGFGIFARDMDMTLNNPGWSQLTAPWLKTA"
     gene            complement(114125..115000)
                     /gene="nifH"
                     /locus_tag="RAHAQ2_RS24580"
                     /old_locus_tag="Rahaq2_5111"
     CDS             complement(114125..115000)
                     /gene="nifH"
                     /locus_tag="RAHAQ2_RS24580"
                     /old_locus_tag="Rahaq2_5111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333921.1"
                     /note="nitrogenase iron protein; nitrogenase component 2;
                     with component 1, an molybdenum-iron protein, catalyzes
                     the fixation of nitrogen to ammonia; nitrogen reductase
                     provides electrons to the nitrogenase complex; in R. etli
                     there are three essentially identical copies of nifH which
                     are actively expressed during symbiosis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase subunit NifH (ATPase)"
                     /protein_id="WP_014333921.1"
                     /db_xref="GI:504099927"
                     /translation="MAMRQCAIYGKGGIGKSTTTQNLVAALAEMNKKVMIVGCDPKAD
                     STRLILHAKAQNTIMEMAAEVGSVEDLELEDVMQIGYGGVRCAESGGPEPGVGCAGRG
                     VITAINFLEEEGAYVPDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMY
                     AANNISKGIVKYAKSGKVRLAGLICNSRQTDREDELIIALAEKLGTQMIHFVPRDNIV
                     QRAEIRRMTVIEYDPTCAQADQYRALANKIVNNTKMVVPTPVTMDELEALLMEFGIME
                     EEDLTIVGRTAAEEA"
CONTIG      join(CP003246.1:1..115487)
//
DBGET integrated database retrieval system