GenomeNet

Database: RefSeq
Entry: NC_016835
LinkDB: NC_016835
Original site: NC_016835 
LOCUS       NC_016835             463906 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201,
            complete sequence.
ACCESSION   NC_016835
VERSION     NC_016835.1  GI:379703932
DBLINK      Project: 86855
            BioProject: PRJNA86855
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Rahnella aquatilis CIP 78.65 = ATCC 33071
  ORGANISM  Rahnella aquatilis CIP 78.65 = ATCC 33071
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Rahnella.
REFERENCE   1  (bases 1 to 463906)
  AUTHORS   Martinez,R.J., Bruce,D., Detter,C., Goodwin,L.A., Han,J., Han,C.S.,
            Held,B., Land,M.L., Mikhailova,N., Nolan,M., Pennacchio,L.,
            Pitluck,S., Tapia,R., Woyke,T. and Sobecky,P.A.
  TITLE     Complete genome sequence of Rahnella aquatilis CIP 78.65
  JOURNAL   J. Bacteriol. 194 (11), 3020-3021 (2012)
   PUBMED   22582378
REFERENCE   2  (bases 1 to 463906)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 463906)
  AUTHORS   Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
            Peters,L., Ovchinnikova,G., Held,B., Detter,J.C., Han,C., Tapia,R.,
            Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Sobecky,P.,
            Martinez,R. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003245.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4089211
            Source DNA and organism available from Robert Martinez
            (rmartinez@bama.ua.edu)
            Contacts: Robert Martinez (rmartinez@bama.ua.edu)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Rahnella aquatilis CIP 78.65
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Host
            num_replicons       :: 4
            ref_biomaterial     :: Missing
            biotic_relationship :: Missing
            trophic_level       :: Missing
            rel_to_oxygen       :: Facultative
            isol_growth_condt   :: Missing
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi06369
            Type Strain         :: Yes
            Funding Program     :: DOE-CSP 2010
            Gene Calling Method :: Prodigal 1.4, GenePRIMP
            Isolation Site      :: drinking water
            Host Name           :: Water, humans
            Cell Shape          :: Rod-shaped
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram-
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..463906
                     /organism="Rahnella aquatilis CIP 78.65 = ATCC 33071"
                     /mol_type="genomic DNA"
                     /strain="CIP 78.65"
                     /isolation_source="drinking water"
                     /culture_collection="ATCC:33071"
                     /db_xref="taxon:745277"
                     /plasmid="pRahaq201"
     gene            22..2739
                     /locus_tag="Rahaq2_4567"
                     /note="IMG reference gene:2506711591"
                     /db_xref="GeneID:11818502"
     CDS             22..2739
                     /locus_tag="Rahaq2_4567"
                     /note="PFAM: AAA domain (Cdc48 subfamily); C-terminal,
                     D2-small domain, of ClpB protein; ATPase family associated
                     with various cellular activities (AAA);
                     TIGRFAM: type VI secretion ATPase, ClpV1 family;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion ATPase, ClpV1 family"
                     /protein_id="YP_005220307.1"
                     /db_xref="GI:379703933"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR023150"
                     /db_xref="GeneID:11818502"
                     /translation="MGLGFLQRKWLRAVAYPKKELSMEHQSAVLLRRLNPYCAKALEA
                     AATLCQTRAHSEITVEHWLLKLLELGEGDITVLARRYEWDMDTLWQSLLAHLDALPRS
                     VHSRPQLSQDLQALMKAGWLAASLQDDNQNIRSVNLLEALIEQPRLLHCEGLWPLFSL
                     SEEHIRRLKPVLDTLSEERPELQQQESLKRMSSSLSDNTAISKHDAGMGGQSLSEALQ
                     AALDKFTLDVTAKAKAGQIDPVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALV
                     EGLALRIAEGNVPDSLKTVSLRTLDLGLLQAGAGVKGEFEQRLKNIIDAVQQSPTPVL
                     LFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYFERDAALERR
                     FQIVKVDEPDDEMACLMLRGLKSRYAQHHGVHITDEAVKAAVSLSRRYITGRQLPDKA
                     VDLLDTASARVRMSLDTLPEDLIRLKAQITALEMEEQALLEDIVLGNKTHGDRLEQIE
                     QQADNLCEQLTALNTQYHAEKNLTQQLLETRQDISRQEEIASLQEQLSDLQGNTPLLS
                     LDVDVRTVANVIADWTGVPLTSLLKDEQTDLLQLEDHLNKRVVGQDHVLTDMAQRLRA
                     AKTGLTSENGPLGVFLLVGPSGVGKTETALSLADCLFGGEKSLITINLSEYQEAHTVS
                     QLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVINLFYQVFDRGFMRDG
                     EGREIDFRNTVILMTANLGSDHLMQLLDERPEATDSDLQELLRPILRDHFQPALLARF
                     QTLIYRPLNAVALRTIVEMKLAQVAKRLNKHYGLTCSIEESLYNTLVTACLLPDTGAR
                     NIDSLLNQQILPVLSQQLLQRKAGQQCTTALALGWDEEEGITLEFDGEE"
     misc_feature    121..2667
                     /locus_tag="Rahaq2_4567"
                     /note="type VI secretion ATPase, ClpV1 family; Region:
                     VI_ClpV1; TIGR03345"
                     /db_xref="CDD:234172"
     misc_feature    742..1224
                     /locus_tag="Rahaq2_4567"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    817..840
                     /locus_tag="Rahaq2_4567"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(820..843,1033..1035,1144..1146)
                     /locus_tag="Rahaq2_4567"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    1021..1038
                     /locus_tag="Rahaq2_4567"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    1195..1197
                     /locus_tag="Rahaq2_4567"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1846..2310
                     /locus_tag="Rahaq2_4567"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    1948..1971
                     /locus_tag="Rahaq2_4567"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(1951..1974,2164..2166,2290..2292)
                     /locus_tag="Rahaq2_4567"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    2152..2169
                     /locus_tag="Rahaq2_4567"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    2437..2658
                     /locus_tag="Rahaq2_4567"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     gene            2739..5126
                     /locus_tag="Rahaq2_4568"
                     /note="IMG reference gene:2506711592"
                     /db_xref="GeneID:11818503"
     CDS             2739..5126
                     /locus_tag="Rahaq2_4568"
                     /note="PFAM: Phage-related baseplate assembly protein;
                     Uncharacterized protein conserved in bacteria (DUF2345);
                     TIGRFAM: Rhs element Vgr protein; type VI secretion system
                     Vgr family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhs element Vgr protein"
                     /protein_id="YP_005220308.1"
                     /db_xref="GI:379703934"
                     /db_xref="InterPro:IPR006531"
                     /db_xref="InterPro:IPR018769"
                     /db_xref="GeneID:11818503"
                     /translation="MSTSDVINRLLNQSRYRLDVSQSPAFLDVLRFEGEEQLSKPFEY
                     IIHVTSTATDLTAEQLVLKPATFTMQAPVFDIAGVAEPVRAVHGVIQHFSRISTSADQ
                     TIYRLVLVPRVALLDHTAKCALYLNQSVQEVVEKVLRAHGLEGPDFEFQLSRSYPARE
                     LITQWRETDLAFIQRLLAEVGIYWHLEMDTRLEHDVIIFADSQQQYKFGIRLPLRNQA
                     GMSDSGTESVWGLSTKHQVVTQQVSTRDYNYREALSPMDTTASAAGSDETTIGEVYQY
                     AEPFLQSGSEDGVETGAFYARLRHERILNAQKSVTGHSSCPHLAPGQVLEVDGTLPAV
                     LNEGILLTGIKTYGSRKSRFTAHLTGQPYSETVCFRPALPQRPVIAGTLPARVESTTK
                     GDIYSWLDNQGRYRVKLDFDRDEQEQGYAYLWLRMAKPYAGDTYGWHAPLIDGTEVAI
                     AFDSGDCDRPYIAYALHDSAHSDHVTDDNHTRNVLRTPSFNKLRMEDKRSEEHIKLAT
                     EFGKTQLNMGHLVDAGRAQRGAGFEIRTDEHGVMRAGKGIFVSAEEQLKAQGKVLDMD
                     PALGQIHQANNEMQALSDAATQATALASDIQKQLSFVDNRLTQLQSAAILASAPMGVA
                     LTSGEHLQLAARQNLMVNAGNNADVGVMKNLFIGAGEAMSMFVHKQDATLIANQGQVT
                     IQAQNNVMSLTARQTLTITSSDDEIIITTPKKMTLNGGGSYLTLEASKIEHGSSGDMT
                     IKCTNYLVPMVGAVLGYHVPSFSKVNLSLNSPNDQSKPDEQNEQDSQNTGNPASE"
     misc_feature    2817..4271
                     /locus_tag="Rahaq2_4568"
                     /note="Rhs element Vgr protein; Region: vgr_GE; TIGR01646"
                     /db_xref="CDD:233505"
     misc_feature    2841..3788
                     /locus_tag="Rahaq2_4568"
                     /note="Phage late control gene D protein (GPD); Region:
                     Phage_GPD; pfam05954"
                     /db_xref="CDD:253474"
     misc_feature    3915..4169
                     /locus_tag="Rahaq2_4568"
                     /note="Phage-related baseplate assembly protein; Region:
                     Phage_base_V; pfam04717"
                     /db_xref="CDD:252757"
     misc_feature    4179..4496
                     /locus_tag="Rahaq2_4568"
                     /note="Putative type VI secretion system Rhs element Vgr;
                     Region: T6SS_Vgr; pfam13296"
                     /db_xref="CDD:205476"
     misc_feature    4425..>4976
                     /locus_tag="Rahaq2_4568"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4253"
                     /db_xref="CDD:226704"
     gene            5143..7794
                     /locus_tag="Rahaq2_4569"
                     /note="IMG reference gene:2506711593"
                     /db_xref="GeneID:11818504"
     CDS             5143..7794
                     /locus_tag="Rahaq2_4569"
                     /note="PFAM: Chitinase class I"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chitinase"
                     /protein_id="YP_005220309.1"
                     /db_xref="GI:379703935"
                     /db_xref="InterPro:IPR000726"
                     /db_xref="InterPro:IPR018249"
                     /db_xref="GeneID:11818504"
                     /translation="MAETTSPVIPKISFPVPAGATGTEFSTAADLLQRLDREASGLYL
                     VGGKGMWHGGIHITDTTAPWCALTGNAPPELTYAPTPHKGEQHLRCMADGDIVAFRVC
                     KEYPTIPWEKGTLYLSGSFVLVRHYVQPGTTAASGLTFYTLYMHLAPFSAYASQTGPR
                     QRTTKGGVKFYLTKEDVASNKVAGKFSAGNVVTLCDETMVRRSDNHQFSQVKMQDGRL
                     VWTVSDGGFLKMADSTGASPPPWWSQCSPAYPVTPSTAAVYKNKTALNYYRCSEDVTF
                     ETVVSGQNKKWGKPAGKLLPVNTPMTMETDNAAQTITRPDKRVFKLMTMTADVAGTPL
                     KRGERVWVVADGGNLEAVAAQSGSSPKFDEVITDQTIPVQAGAALGHLGFFQIPTETG
                     FRSRYMVHIECLTSDSKVASFLTNPEAAGRESPAFLKYPADAKLFSKDAKGAMAESTR
                     KTKAPGILTLSNVPAVSADGIPTHYQIRPEGGFLAAASVEVLSQFDLGKLGFSIIKDD
                     PESFQLLDAENQPQNVVKGIFEKLKAAAEDDPVFSNVLASHKYKQLLDVIDQNHDGYY
                     SVDEYRNAVHNPAYRDRLYQLIVQHPSEWYYEKTDGKWTKYLEKLEPDASKWKKYTEA
                     FLDKMIWMKKVAGMGPAPWHMHPVMFMGNLVGKQELIRVDEFMAGYEKLHSSFAPNTP
                     PLKSVSKENLRKIVNRLNSFYAEQIEYKPNLYKLAYMLATTRHETYHFTDQEYFSEQP
                     EVGNEAYFNKYDPIRADTQIRKDAAKANENTVEGDGFKYRGRGCVHLTWKINYRKAMV
                     KYGVNFVATPDLAGDFNYAVPIMIWGMENGVFTGRKLSSYINETTIDYLNARKIINGN
                     DQKSLIASYAEKFQLILEETSSAPQGF"
     misc_feature    7285..7707
                     /locus_tag="Rahaq2_4569"
                     /note="lysozyme_like domain.  This contains several
                     members including Soluble Lytic Transglycosylases (SLT),
                     Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes
                     (HEWL), chitinases, bacteriophage lambda lysozymes,
                     endolysins, autolysins, and chitosanases; Region:
                     lysozyme_like; cl00222"
                     /db_xref="CDD:260275"
     gene            7796..8731
                     /locus_tag="Rahaq2_4570"
                     /note="IMG reference gene:2506711594"
                     /db_xref="GeneID:11818505"
     CDS             7796..8731
                     /locus_tag="Rahaq2_4570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220310.1"
                     /db_xref="GI:379703936"
                     /db_xref="GeneID:11818505"
                     /translation="MLKIILSSILLMVFQFSYAANSPVSYGYDKDHKQIYAKIGSDKK
                     TLYFEENYTGNPIVMFSFFNGNPSIVLSGRSVNDYTAYATLNYINDTFSIDCIYIDMK
                     SKENGISSKNGICGLDKKITDEYQDVIEGFVEDKGNRINNIETSYVINGGTKKLPILI
                     FRNNDNFLYQLYKNKNDFLNDKYSILSISNKTTCQSYEGTVWVVENFSNKGLPQVLNE
                     ITKNGVVFLEDAITNSHRPSEEGSCQSFQMFSVKSEKSFFYNENNEIKKSYLVHGDFV
                     NLLNMSEGEKWCEISYLNKANKKVNGRVLCATLKL"
     gene            8991..9200
                     /locus_tag="Rahaq2_4571"
                     /note="IMG reference gene:2506711595"
                     /pseudo
                     /db_xref="GeneID:11818506"
     gene            9315..9830
                     /locus_tag="Rahaq2_4572"
                     /note="IMG reference gene:2506711596"
                     /db_xref="GeneID:11818507"
     CDS             9315..9830
                     /locus_tag="Rahaq2_4572"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220311.1"
                     /db_xref="GI:379703937"
                     /db_xref="GeneID:11818507"
                     /translation="MKNKTIWKSFLYLSMLILLPFGVNASANIKEDPVKITQSFYTQY
                     MQLYFKIVPPEAPAFKKLMQNNITPSFLKKIKSAKICQEGKDPVCTIEEVRPKDGYVY
                     IIRAQDAYDDWTHVIVEPIKISSGLSVVKVSLGGLHEKAHVLTVSLKKINTHWKIDSV
                     SDLSPAKYRFQ"
     misc_feature    9411..9806
                     /locus_tag="Rahaq2_4572"
                     /note="Protein of unknown function (DUF3828); Region:
                     DUF3828; pfam12883"
                     /db_xref="CDD:257374"
     gene            9847..11844
                     /locus_tag="Rahaq2_4573"
                     /note="IMG reference gene:2506711597"
                     /db_xref="GeneID:11818508"
     CDS             9847..11844
                     /locus_tag="Rahaq2_4573"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220312.1"
                     /db_xref="GI:379703938"
                     /db_xref="GeneID:11818508"
                     /translation="MLNVESALAHLNSNASEKSHGNCAKFVRLAIKAGGVNIISPPLR
                     PNYDYPAAADYGASLLAKGFTIVFTHNTGGSELTDTTTIPGQQAGDVVVVQDIPGHRY
                     GHMAMFNGTQWVSDFRQPMGFYPARAYSSLKSAFKMYRYGETEKNTPSDQSSADNKDL
                     HICYPITKNPKGNEFGNAEEILAHLGGEPAGFYLVGRNGMWHGGIHISSVTTPWSALS
                     GKGTSESVDFPVPYKGEQPLRCMADGEVVAYRVCKDYLEAPWTSGILSYSGSFVLIRH
                     YLQPGDDKKSSLTFYTLYMHLAPWSAYQAGKGEKTWKVNERKGLSAYEDAGRTVRKGT
                     LPNGTKVRWDETDEGFKTQTDKGRIYGNVTLEEDVIVKARGNTPEKKLFSQGDQVWVV
                     ADRTNLKTTEPVVIPPAWWAHFQPQIEEKLEFEQVTCPVPFRINAKDPVGHLGYYQNP
                     VAMGYVPRYQSHIECFSIDENLPTFLTNPEKLEQEDRPLFLKYTPGLPRYNKNLTTGK
                     FVKEAEATRSTGIATLKKVKSVNEKAADDKSAETYFQIYPETAWLAKKDVKLLSRYDL
                     AELGFTLTDDSPGNFDKLDGKTPPETLIRKILDILHNAAKQETRVDYALIPQNYQRLI
                     DMIGTNPDGHYSPDEYRQAIHNPVLRDTLFRIIAKHPSEWL"
     gene            12145..12621
                     /locus_tag="Rahaq2_4574"
                     /note="IMG reference gene:2506711598"
                     /db_xref="GeneID:11818509"
     CDS             12145..12621
                     /locus_tag="Rahaq2_4574"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220313.1"
                     /db_xref="GI:379703939"
                     /db_xref="GeneID:11818509"
                     /translation="MKKISVFLFGALFSFMSIDSMASGGNSTEIISCTLPGELSRKVS
                     LSIDNKTKEINYSFEKEGKVELAVLFNEENKLKRLTDSKMGVTYYGFKRGAYSYIVDI
                     INGAEQEEYTISFDIKKNNKVVQSDDCLHSSFRSADITSKYISDVPYVDDDNFAFP"
     gene            12812..13252
                     /locus_tag="Rahaq2_4575"
                     /note="IMG reference gene:2506711599"
                     /db_xref="GeneID:11818510"
     CDS             12812..13252
                     /locus_tag="Rahaq2_4575"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220314.1"
                     /db_xref="GI:379703940"
                     /db_xref="GeneID:11818510"
                     /translation="MHKIIFYLLMAISFSSMASSDVTGRWSPSCDDEEGITLTNGNSP
                     VFFVVNHNQIVISMQTKTTKESIDFFLVKPVDLGSGGMKLSWSNFSKKSKIATLKLHE
                     QSANFEWYGFYDEIKKVHSWVNDPDIIINNEIVGGGVVFYRCIK"
     gene            13273..15705
                     /locus_tag="Rahaq2_4576"
                     /note="IMG reference gene:2506711600"
                     /db_xref="GeneID:11818511"
     CDS             13273..15705
                     /locus_tag="Rahaq2_4576"
                     /note="PFAM: Chitinase class I"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chitinase"
                     /protein_id="YP_005220315.1"
                     /db_xref="GI:379703941"
                     /db_xref="InterPro:IPR000726"
                     /db_xref="InterPro:IPR018249"
                     /db_xref="GeneID:11818511"
                     /translation="MGVKITPNIKFAFKFCSVLEFVCPTIPWEKGTLYLSGSFVLVRH
                     YIQPGTTAASGLTFYTLYMHLAPFSAYASQTGPRQRTTKGGVKFYLTKEDVASNKVAG
                     KFSTGNVVTLCDETMVRRSDNHQFSQVKMQDGRLVWTVSDGGFLKMADSTRASPPPWW
                     SQCSPAYPVTPSTAAVYKNKTALNYYRCSEDVTFETVVSGQHKKWGKPAGKLLPVNTQ
                     MTMETGNAAQTITRPDKRVFKLMTMTADVAGTPLKRGERVWVVADGGNLEAVAAQSGS
                     SPKFDEVITGQTIPVQAGAALGHLGFFQIPTETGFRSRYMVHIECLTSDSKVASFLTN
                     PEAAGRESPAFLKYPADAKLFSKDAKGAMAESTRKTKAPGILTLSNVPAVSADGIPTH
                     YQIRPEGGFLAAASVEVLSQFDLGKLGFSIIKDDPESFQLLDAENQPQNVVKGIFEKL
                     KAAAEDDPVFSNVLASHKYKQLLDVIDQNHDGYYSVDEYRNAVHNPAYRDRLYQLIVQ
                     HPSEWYYEKTDGKWTKYLEKLEPDASKWKKYTEAFLDKMIWMKKVAGMGPAPWHMHPV
                     MFMGNLDRKPTNLVSCSFCQSGIEINPELLIHCFGISKEKADLYAPLLTTGFIKYEIN
                     NCLRISHFLGQIGIETQRLTKLKESLYYTNGDRLWGIYYSLLNAGLKRRFPTYSEEQR
                     KQYTKDHLVRNEDELAQTLFPSNYEGMDYRGRGLIHLTHEENYNKYKIFSENDVITNP
                     KIIETNSALAVDSACWYWSKFANINPLADADNLSMVTYKINAARLEMAARGTIKDLAI
                     NYIKQNNIGCKK"
     misc_feature    15037..15642
                     /locus_tag="Rahaq2_4576"
                     /note="lysozyme_like domain.  This contains several
                     members including Soluble Lytic Transglycosylases (SLT),
                     Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes
                     (HEWL), chitinases, bacteriophage lambda lysozymes,
                     endolysins, autolysins, and chitosanases; Region:
                     lysozyme_like; cl00222"
                     /db_xref="CDD:260275"
     gene            15702..16244
                     /locus_tag="Rahaq2_4577"
                     /note="IMG reference gene:2506711601"
                     /db_xref="GeneID:11818512"
     CDS             15702..16244
                     /locus_tag="Rahaq2_4577"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220316.1"
                     /db_xref="GI:379703942"
                     /db_xref="GeneID:11818512"
                     /translation="MILRKLVLLIALISGNCLACDNGKISDYINNNQGFLVQALSSDR
                     ISSGSTIFFHYTSKNDEHPDIIASYASDRCVASQSITFDTYSYDGSVANIESVFWGRG
                     KYKKNLFIIVSWNYNADGVSTVGKYYSVFAYDYEKTKITKNENLTIKFKEGHDGFVDG
                     KVVKYRFKTASDVLSYLEKN"
     gene            16428..18251
                     /locus_tag="Rahaq2_4578"
                     /note="IMG reference gene:2506711602"
                     /db_xref="GeneID:11818087"
     CDS             16428..18251
                     /locus_tag="Rahaq2_4578"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220317.1"
                     /db_xref="GI:379703943"
                     /db_xref="InterPro:IPR018249"
                     /db_xref="GeneID:11818087"
                     /translation="MTFETVVSGQHKKWGKPAGKLLPVNTQMTMETDNAAQTITRPDK
                     RVFKLMTMTADVAGTPLKRGERVWVVADGGNLEAVAAQSGSSPKFDEVITDQTIPVQA
                     GAALGHLGFFQIPTETGFRSRYMVHIECLTTDSKVASFLTNPEAAGRESPAFLKYPAD
                     AKLFSKDAKGAMAESTRKTKAPGILTLSNVPAVSADGIPTHYQIRPEGGFLAADSVEK
                     LSQFDLGKLGFSIIKDDPESFQLLDAENQPQNVVKGLFEKLKAAAEDDPVFSNVLASH
                     KYKQLLDVIDQNHDGYYSVDEYRNAVHNPAYRDRLYQLIVQHPSEWYYEKTDAKWTKY
                     LEKLEPDASKWKKYTEAFLDKMIWMKKVAGMGPAPWHMHPVMFMNTIRDSENDEMDTK
                     WLKVPKGQLTFNVEGNDIENSIYFSRHPHVPNNKGVVIGISGVTFGRGLDLDQQSKTY
                     INTLFMDMERDAKPLPPALQKWLLGSVGLKGSTALTYCLDIDKFVPRTEQYLTRKQQH
                     FLFNAVYENLYDVTKRVISNGAKVDGVQISAELGSYSQKVQDVLVDLTFRGDNSPRTR
                     RYFMKDLKAGEDQFKSNISNSHWKSSFGVPEQRFNERKGYL"
     gene            18251..18622
                     /locus_tag="Rahaq2_4579"
                     /note="IMG reference gene:2506711603"
                     /db_xref="GeneID:11818088"
     CDS             18251..18622
                     /locus_tag="Rahaq2_4579"
                     /note="PFAM: Protein of unknown function (DUF1311)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220318.1"
                     /db_xref="GI:379703944"
                     /db_xref="InterPro:IPR009739"
                     /db_xref="GeneID:11818088"
                     /translation="MNKYFALMLAVSSLSTVVYADSSSEQGNYLKIKSEYAKADSELN
                     NIYRQQILEYKNVGAEFYGQRESKDIYLKKSQIAWIKIRDADCDYETYESRTGTAFSS
                     IYEQCLLDKTSERIKYLNENN"
     misc_feature    18260..18613
                     /locus_tag="Rahaq2_4579"
                     /note="Protein of unknown function (DUF1311); Region:
                     DUF1311; cl01530"
                     /db_xref="CDD:260983"
     gene            18723..19331
                     /locus_tag="Rahaq2_4580"
                     /note="IMG reference gene:2506711604"
                     /pseudo
                     /db_xref="GeneID:11818089"
     gene            19315..19557
                     /locus_tag="Rahaq2_4581"
                     /note="IMG reference gene:2506711605"
                     /db_xref="GeneID:11818090"
     CDS             19315..19557
                     /locus_tag="Rahaq2_4581"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220319.1"
                     /db_xref="GI:379703945"
                     /db_xref="GeneID:11818090"
                     /translation="MISFINKRTGHALHESFTAYGAELEGSKPVGEEILYINKASKLL
                     VTYEINEYSRKHFYNYYALQNQILTLIKKVPSGKLH"
     gene            19621..19884
                     /locus_tag="Rahaq2_4582"
                     /note="IMG reference gene:2506711606"
                     /db_xref="GeneID:11818091"
     CDS             19621..19884
                     /locus_tag="Rahaq2_4582"
                     /note="PFAM: PAAR motif"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220320.1"
                     /db_xref="GI:379703946"
                     /db_xref="InterPro:IPR008727"
                     /db_xref="GeneID:11818091"
                     /translation="MLPIIRIGDKTTHGGAVMTGSGTMSFGNIPVARKGDKVSCPIPF
                     HGPTFITEGNPNYLDNGIPVAFHGHKCACGCTLISSLATAQVG"
     misc_feature    19633..19860
                     /locus_tag="Rahaq2_4582"
                     /note="PAAR motif; Region: PAAR_motif; pfam05488"
                     /db_xref="CDD:253216"
     gene            19887..21089
                     /locus_tag="Rahaq2_4583"
                     /note="IMG reference gene:2506711607"
                     /db_xref="GeneID:11818092"
     CDS             19887..21089
                     /locus_tag="Rahaq2_4583"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220321.1"
                     /db_xref="GI:379703947"
                     /db_xref="GeneID:11818092"
                     /translation="MPVNLDVIPDKAPGIARPRTRRWLLFLPFMLLAGATSTLWFWKN
                     EHTGIAFWFTAIGLPAATWGILFSLRRIGYKCDQIWATSWNRERDQLIEEETQRGQRY
                     LWWHGGVSFTSVGKSTEKLLSAVLKNTPLMSSVIPRAGGFAVRHTRLGSITNTIPVLL
                     QEWHDHLKQRISALLDTLPAGMPCYVLLDVHIDQDPQVNAKHAQEVMAMFSRPLRQIN
                     GAGFVALDQWIDMTWGIPSALLVIGTQINNRPEINSGEAATAMLLTNCPMPDERKTVR
                     IHRPECGTNAALTKTLSRALLWANVQPASVAQAWLTGGALLTDSEWSTACEKNTLGMN
                     IQKQCSVIDNVTGYTGCTAPWLALLMAATQCGEDGITQTVAVQIATDKIWVGCVSAPA
                     SDIQDTSL"
     gene            21086..24502
                     /locus_tag="Rahaq2_4584"
                     /note="IMG reference gene:2506711608"
                     /db_xref="GeneID:11818093"
     CDS             21086..24502
                     /locus_tag="Rahaq2_4584"
                     /note="PFAM: Protein of unknown function (DUF1215);
                     Intracellular multiplication and human macrophage-killing"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220322.1"
                     /db_xref="GI:379703948"
                     /db_xref="InterPro:IPR009612"
                     /db_xref="InterPro:IPR010623"
                     /db_xref="GeneID:11818093"
                     /translation="MTIRSLIGSAFLFLIFTVIVVGGILTFYPQWAASSVGVGPLSPS
                     GIWTLCLSIAAGLGAIFWLIERMFDRLGKAGVRIQWRKRKNQQTEAPTVSDTVNPSPS
                     FFTGLDEQMRFRYGRFWRRKVQILWLNGETELVEKIVPGLTEQNWQEGDDTLLLWGGL
                     PDVPVDPERAMAARQLRPRRPLDGIVHVLDGNQLPGTTSLDETLRQRQKTDALLGWQA
                     PVYFWVLDTCKWSQEGRETQPVGCLLSGKTSAESVITALDALIPALREQGMSQLAQDT
                     RYDFLLRLTERLRKEWRAGLSNVLTTVSRGSSPMMLRGLMFSLPSGADKGSSHSWGAL
                     PEWQGILQDCRNAQGKRTGWPWEKILQCALLSLAVVWGTGVLLSLFINQHQIADSHKQ
                     ATIAADTSQPLASRLNNQLALQQEIAKLQYRATAGSPWYTRFGLNQNTVQLAALWPLY
                     QANNNVLIRDVSATKLKAKLTDFIRLPPGSPQRDALTQQTYAELKAYLMMSRPDKADA
                     PFLNQTLMTLWPKRTGVPDGQWQHVGPKLIAFWGQNLPAHPEWKIAQDKNLVTAVRQI
                     LLKQIGQRNAEASLYQAMLKKVANNYPDMTLTDMVGDTDASYLFNTDEVVPGMFTRQA
                     WEEQVQDAIDQVVTTRRNEIDWVLTSKSQPASEDISPEALKARLTERYFTDFSNAWLN
                     MVNSLRWQEPGSLSGAISQLTLMADVRQSPMVALMNTLAWQGKTGQKNEALADTLVNS
                     AKVLVGKKQQPVIKQTGGPQGPLDAAFGPLLTIMDGKSNGLNNGNLSFQAYLTRVTQV
                     RLKLQQVTTAPDPQAMTQMLAQTVFQGKAVDLTDTRDYGSLVAASLGQEWSGFGKAMF
                     VEPMELAWRQVLQPAAGSLNAQWQSTVVNQWDTSFAGRYPFASTGSDASLPVVAQYLR
                     SDSGRISQFLKTQLGGILHQEGNRWVPDAITSQGLTFNPAFLDAINQLGQLSDIVFAE
                     GDAGLRFELMARPSKNVVRTQLAIDGQNLDYFNQMESWQSFKWPGNSYYAGVQLSWRS
                     VSSGMQLFGDFSGNWGLIRLLEKAQVTQLDSSRYQLVWKTPDGLPLKYILRTEMGNGP
                     LALLALRNFSLPKKVFLDDAPVSSVVAADPGPVLTDDQDIPAGTGSAGDE"
     misc_feature    21098..24397
                     /locus_tag="Rahaq2_4584"
                     /note="Type VI protein secretion system component VasK
                     [Intracellular trafficking, secretion, and    vesicular
                     transport]; Region: IcmF; COG3523"
                     /db_xref="CDD:226054"
     misc_feature    22319..23260
                     /locus_tag="Rahaq2_4584"
                     /note="Intracellular multiplication and human
                     macrophage-killing; Region: IcmF-related; pfam06761"
                     /db_xref="CDD:253899"
     misc_feature    23609..23980
                     /locus_tag="Rahaq2_4584"
                     /note="Protein of unknown function (DUF1215); Region:
                     DUF1215; pfam06744"
                     /db_xref="CDD:253889"
     gene            24602..26371
                     /locus_tag="Rahaq2_4585"
                     /note="IMG reference gene:2506711609"
                     /db_xref="GeneID:11818094"
     CDS             24602..26371
                     /locus_tag="Rahaq2_4585"
                     /note="PFAM: Bacterial protein of unknown function
                     (DUF879);
                     TIGRFAM: type VI secretion protein, VC_A0110 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="YP_005220323.1"
                     /db_xref="GI:379703949"
                     /db_xref="InterPro:IPR010272"
                     /db_xref="GeneID:11818094"
                     /translation="MDDLTLRYYEAEMRYLREAGREFAHAHPDRAAMLNLDKSGARDP
                     YVERLFEGFAFLMGRLREKLDDDLPELTEGLVSLLWPHYMRTIPSLAIVELKPDYRQL
                     KQVEIVPRGFSVLSQPVGQKHTCCQYQVTRDMPLMPINISQAKLHTETDGRSTVRLRF
                     DCGPLADWRKIDLSRVAIYLDADSPVSSALHLALTRKVQAMYIRQPELGQDRRAIDGW
                     FKPMGFEENERLWPKGSSAFSGYQLLLEYFTFRPKFMFVELNGLQNVHLVPGTTWFEL
                     DIVLSELWPYDLPFDTDTFRLHCVPVINLFSLEADPLQIDPLANEYLLRPLRMQDGHV
                     EIYSVDQVHGSVKNGKHDYVPFTSFRHRGGMMRHDAPERYFHTRVKRGPSGLHDTWLI
                     LGGKSFEAEQLAEQREALSLRITGTNGQLPRKALESTLLNRVVKAGKVPVQVRNLTTP
                     TMPVYPPANDRFHWRVMSHLGSSFLSMMDNPEVLRGTLALYDWTDDEMNCRRLEAIVA
                     VEHHLIQRFEKGFMLRGVDIEITLNTDNFAGEGDVNLFGEMLHRFFALYADIHLFNQL
                     TLVLQPTGKRLRWNENHSQHVPG"
     misc_feature    24617..26359
                     /locus_tag="Rahaq2_4585"
                     /note="Bacterial protein of unknown function (DUF879);
                     Region: DUF879; pfam05947"
                     /db_xref="CDD:253471"
     gene            26335..27417
                     /locus_tag="Rahaq2_4586"
                     /note="IMG reference gene:2506711610"
                     /db_xref="GeneID:11818095"
     CDS             26335..27417
                     /locus_tag="Rahaq2_4586"
                     /note="PFAM: Protein of unknown function (DUF1305);
                     TIGRFAM: type VI secretion protein, VC_A0111 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="YP_005220324.1"
                     /db_xref="GI:379703950"
                     /db_xref="InterPro:IPR010732"
                     /db_xref="GeneID:11818095"
                     /translation="MERESQPTRTGLIDALSPRASYLNFYRFCQLLEQAGGDAPLLGT
                     TSTPATDPIRFRPHPGMGFPVSEIRVIEADREHVHATPTVRTTFMGLYGVDAPLPTGY
                     LDDISQRREGYESVEHFLDIFNHRLMTQFYRIWRKYAYPASFQAGGTDETSQCLLGLI
                     GLGIPGTAKHIATPISRFLALLSTMRLPTRTAEGIRALVNLLAPLTQAYIQGHDPVSV
                     EMRSRSGFCAENRIALAQRSVLGRKGKDGNSRVLVSLMTSDPEEAEGWLPGGHLHTDL
                     LVLMRVYLGYRCNARLQLTVPTRLLPEPRLGGSRRIQLGRTGVLGLQESKRDSLPQSL
                     TVSLGTYQGVHEEPLLPAESGEYRFR"
     misc_feature    26404..27297
                     /locus_tag="Rahaq2_4586"
                     /note="Protein of unknown function (DUF1305); Region:
                     DUF1305; pfam06996"
                     /db_xref="CDD:254012"
     gene            27481..28023
                     /locus_tag="Rahaq2_4587"
                     /note="IMG reference gene:2506711611"
                     /db_xref="GeneID:11818096"
     CDS             27481..28023
                     /locus_tag="Rahaq2_4587"
                     /note="TIGRFAM: type VI secretion lipoprotein, VC_A0113
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion lipoprotein"
                     /protein_id="YP_005220325.1"
                     /db_xref="GI:379703951"
                     /db_xref="GeneID:11818096"
                     /translation="MAKIIPSHTGWQYGSLFLLVVLLSGCGLTQKVVDGTKGVTKAIF
                     YKQIKTLHLDFSPRTSMNTDEGDQSSLATMVRVYQLKDRKAFDAADYEKLLLQSDDLL
                     KADSLASKEVLVMPGGDVSLDMPMEPDAQFVAVVALFRNPDRQHDTWRVVLKREEFDP
                     DKPRTLELSNGQLTLLPLKD"
     misc_feature    27592..27999
                     /locus_tag="Rahaq2_4587"
                     /note="Type VI secretion lipoprotein; Region: T6SS-SciN;
                     pfam12790"
                     /db_xref="CDD:257298"
     gene            28036..30391
                     /locus_tag="Rahaq2_4588"
                     /note="IMG reference gene:2506711612"
                     /db_xref="GeneID:11818097"
     CDS             join(28036..29919,29921..30391)
                     /locus_tag="Rahaq2_4588"
                     /artificial_location="low-quality sequence region"
                     /note="PFAM: Phage-related baseplate assembly protein;
                     Uncharacterized protein conserved in bacteria (DUF2345);
                     TIGRFAM: Rhs element Vgr protein; type VI secretion system
                     Vgr family protein;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhs element Vgr protein"
                     /protein_id="YP_005220326.1"
                     /db_xref="GI:379703952"
                     /db_xref="InterPro:IPR006531"
                     /db_xref="InterPro:IPR018769"
                     /db_xref="GeneID:11818097"
                     /translation="MVDILKNLLPDAAGLSRYSLAIWNSPYALDVLNFRGEEQLSETF
                     SYTVDVTCPEPDIDAAQMLRQFASFTMGTPFQPERAVYGVIRDFQRLSTSADETLYRL
                     ELVPRLRLLENSTNSFIFQNQSVPEVVEFILRKHGLEGQDFEFRLSHTYPDRELITQW
                     GETDLQFIKRILAEVGIWFRFEADTRLTCEKVLFGDGPEQYRFGVTLPYCEPSGMSDA
                     HAESVWGLKIHWNAVTGKIFKRDYNYREATTPLDTSAQVRSAAPVTGESYLYARPYRE
                     AGGDMDAAAETGAFYARIRHERQLNHQCRIFARTTGSGLAPGQVLEPQAYPFSDLPDG
                     ILITRIVAKGSRTDHFRLNIWGMAYRETIGFRPEPPARPVLSGTIPARVESPAKGDTY
                     AWLDNQGRYRVRIDGDRASADAGYAYLWVRLAKPYGGDGYGWHMPLTDGTDVAIAFDG
                     GDPDRPYIAAALHDSEHPDHVTERNHTRNVLRTPSNNTLRMEDRRGEEHIRLATEYGK
                     TQLNSGHIVDAQNAPRGQGFELRTDEHGALRGGKGVFLSADAQPQAQGQVPDNRAAMA
                     EIEYLQGQVKALSQAAAEAKALEADIAAQIAMFSERLKPINQVVLASAPQGMALTSGE
                     HLQLQLAAAKNMILNAGNNADIGVIKNLTVNTGEKMGLFALKGEMSLKASEGRVDVQA
                     QNNRLALAAGKKVSITAVDGDILFSAKKRITLIGGGSYLILQDGKIEYGTAGEYFRKT
                     PHTVLTVANTMAAELAAMTGGGICLSCLMKAAMSGNAFVIRGES"
     misc_feature    28120..29556
                     /locus_tag="Rahaq2_4588"
                     /note="Rhs element Vgr protein; Region: vgr_GE; TIGR01646"
                     /db_xref="CDD:233505"
     misc_feature    28144..29073
                     /locus_tag="Rahaq2_4588"
                     /note="Phage late control gene D protein (GPD); Region:
                     Phage_GPD; pfam05954"
                     /db_xref="CDD:253474"
     misc_feature    29212..29451
                     /locus_tag="Rahaq2_4588"
                     /note="Phage-related baseplate assembly protein; Region:
                     Phage_base_V; pfam04717"
                     /db_xref="CDD:252757"
     misc_feature    29464..29775
                     /locus_tag="Rahaq2_4588"
                     /note="Putative type VI secretion system Rhs element Vgr;
                     Region: T6SS_Vgr; pfam13296"
                     /db_xref="CDD:205476"
     misc_feature    join(29860..29919,29921..30244)
                     /locus_tag="Rahaq2_4588"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2345); Region: DUF2345; pfam10106"
                     /db_xref="CDD:255759"
     gene            30412..30897
                     /locus_tag="Rahaq2_4589"
                     /note="IMG reference gene:2506711613"
                     /db_xref="GeneID:11818098"
     CDS             30412..30897
                     /locus_tag="Rahaq2_4589"
                     /note="manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220327.1"
                     /db_xref="GI:379703953"
                     /db_xref="GeneID:11818098"
                     /translation="MMNQLISHPECGGFALVDGLQYERHFGEEIKTEKGIVAPLFDSG
                     PDSRIQFAGPWLFSLNTTIEYREKLQQLECIYPSVSWFLSCWTMENVVNHFKPFLNLQ
                     LPDGRGALFRFYDPRILKDIELLLAEKDYEELIAGIECWFLTLNGETYDIKSKGKYFW
                     D"
     misc_feature    30451..30768
                     /locus_tag="Rahaq2_4589"
                     /note="Domain of unknown function (DUF4123); Region:
                     DUF4123; pfam13503"
                     /db_xref="CDD:257823"
     gene            30926..31282
                     /locus_tag="Rahaq2_4590"
                     /note="IMG reference gene:2506711614"
                     /db_xref="GeneID:11818099"
     CDS             30926..31282
                     /locus_tag="Rahaq2_4590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220328.1"
                     /db_xref="GI:379703954"
                     /db_xref="GeneID:11818099"
                     /translation="MVVKISTEQLSNLRELESNNYINSLHQIIIKHSPSLADDGGLKF
                     HLIDAEQFVNENGFTDKKIKTEFLIMNAYEPGFYKTNTMQNWILNGTESPEREYVKYQ
                     QIRSNFLKRNSGVENE"
     gene            31275..31946
                     /locus_tag="Rahaq2_4591"
                     /note="IMG reference gene:2506711615"
                     /db_xref="GeneID:11818100"
     CDS             31275..31946
                     /locus_tag="Rahaq2_4591"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220329.1"
                     /db_xref="GI:379703955"
                     /db_xref="GeneID:11818100"
                     /translation="MSNVGATMPVPAGRTGTIPGTRGRLGGVVGILSDLEAHRQEYLA
                     YMAEMENVKEEAASLTKELSEEGCDQCVYTQGEVTLQNIKGWSDISIAYQFYICKLPI
                     HFQVMKIMEWTYGVAFDGFVPKECLLIETKANYDQFFDMNEELKFFMNITKGTDGLFL
                     KQARSQNSCALKGMPPGRLHWYFMQPISARYARSEFAEEGLDISVIDKPMPTEYVRTI
                     ITNKQ"
     misc_feature    31539..31832
                     /locus_tag="Rahaq2_4591"
                     /note="Restriction endonuclease fold toxin 5; Region:
                     Tox-REase-5; pfam15648"
                     /db_xref="CDD:259778"
     gene            31955..32647
                     /locus_tag="Rahaq2_4592"
                     /note="IMG reference gene:2506711616"
                     /db_xref="GeneID:11818101"
     CDS             31955..32647
                     /locus_tag="Rahaq2_4592"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220330.1"
                     /db_xref="GI:379703956"
                     /db_xref="GeneID:11818101"
                     /translation="MFYKIQGLIYRKNKVTSENIFNELIKFINTLPNWSEKPKLWFIA
                     TPKGSVKGIENGQTSQDALSYVDEMIKSNNSISVILADENEDDSILTLWFKNTQAISE
                     DRYTFSLTIKSLSKLNDFNVFLDIFNKLTSLDEWKFKYIFLDTEQYRRKELSVFEDRL
                     AVGWILFLPQLISSEHARSAFKVIQRKEINGTIIISSEIFDGKNPLHISHANNVEIEL
                     AADGFLPLLKGL"
     misc_feature    32342..32626
                     /locus_tag="Rahaq2_4592"
                     /note="Immunity protein 32; Region: Imm32; pfam15579"
                     /db_xref="CDD:259710"
     gene            32729..32875
                     /locus_tag="Rahaq2_4593"
                     /note="IMG reference gene:2506711617"
                     /pseudo
                     /db_xref="GeneID:11818102"
     gene            32945..33568
                     /locus_tag="Rahaq2_4594"
                     /note="IMG reference gene:2506711618"
                     /pseudo
                     /db_xref="GeneID:11818103"
     gene            33642..35246
                     /locus_tag="Rahaq2_4595"
                     /note="IMG reference gene:2506711619"
                     /db_xref="GeneID:11818104"
     CDS             33642..35246
                     /locus_tag="Rahaq2_4595"
                     /note="PFAM: ImpA-related N-terminal;
                     TIGRFAM: type VI secretion-associated protein, VC_A0119
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion-associated protein"
                     /protein_id="YP_005220331.1"
                     /db_xref="GI:379703957"
                     /db_xref="InterPro:IPR010657"
                     /db_xref="GeneID:11818104"
                     /translation="MATLHTLLALCPQENPDILMQKAKVQTALWEKWLNPVSSDNATG
                     EDPGYDDDFQRMREEVNKLSGADTELVCQLAEKLLTTVCKDVRVATYYLWARLHRDGE
                     SGLAEGLELLSGLVSRYGDQLLPSRKNSRRAAMEWLAGSKVLDSLSLYPEVDKPKFER
                     ILAALTLFEDVITSWEDVNRPQLGGLYDALESRLAQSGGFDAVVPQNSGGQATSDSRS
                     LSPDMPTLKVIQSGRELLDQAKALAQYLRDQPQGWLSGHRLMTTIRWDTVDQLPPLDA
                     KGCTRLAPPRTEYRAQLKRLYLQQSWTELLENADRMFTEGVNHFWLDIQWYLHQALSK
                     SGAPYDSWAEFIEQDLRLLLLRLPGLETLAYSDGTPFADEVTAGWITRDIQDNDGRWQ
                     SEPNAVSASGDEDVLQLETEALAQADSEGIEAALNWLQIRPGITTPRQRWLIRLLMAR
                     VAEQYGKNEMALHLLGELDSTGNRLTLKQWEPALLFEVKARRLKLLRMQFQRGDTDKA
                     KLTLEMDKLLAGLVSIDPARAAVLCA"
     misc_feature    33738..34910
                     /locus_tag="Rahaq2_4595"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3515"
                     /db_xref="CDD:226046"
     misc_feature    33840..34025
                     /locus_tag="Rahaq2_4595"
                     /note="ImpA-related N-terminal; Region: ImpA-rel_N;
                     pfam06812"
                     /db_xref="CDD:253924"
     misc_feature    34224..35120
                     /locus_tag="Rahaq2_4595"
                     /note="type VI secretion-associated protein, VC_A0119
                     family; Region: VI_chp_7; TIGR03362"
                     /db_xref="CDD:234184"
     gene            35265..35696
                     /locus_tag="Rahaq2_4596"
                     /note="IMG reference gene:2506711620"
                     /db_xref="GeneID:11818105"
     CDS             35265..35696
                     /locus_tag="Rahaq2_4596"
                     /note="PFAM: Gene 25-like lysozyme;
                     TIGRFAM: type VI secretion system lysozyme-related
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system lysozyme-like protein"
                     /protein_id="YP_005220332.1"
                     /db_xref="GI:379703958"
                     /db_xref="InterPro:IPR007048"
                     /db_xref="InterPro:IPR015801"
                     /db_xref="GeneID:11818105"
                     /translation="MNSKSPSLYEILTGNFAGGLDLHNVSEENQVILSVLDNMQRILN
                     CRAGTLSHLPDYGLPDMSKILQGMPGTAHSLLDVLSETLLKYEPRIKKLHVILLPQSS
                     PGHLEYAIDAELKELGLVRFGTEFMPEGRVLMRHMKQQNYV"
     misc_feature    35265..35690
                     /locus_tag="Rahaq2_4596"
                     /note="Gene 25-like lysozyme; Region: GPW_gp25; cl01403"
                     /db_xref="CDD:260920"
     gene            35857..36666
                     /locus_tag="Rahaq2_4597"
                     /note="IMG reference gene:2506711621"
                     /db_xref="GeneID:11818106"
     CDS             35857..36666
                     /locus_tag="Rahaq2_4597"
                     /note="PFAM: Protein of unknown function (DUF1311)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220333.1"
                     /db_xref="GI:379703959"
                     /db_xref="InterPro:IPR009739"
                     /db_xref="GeneID:11818106"
                     /translation="MFKGIFLLTTASLFSLSAQAGLFGGEDFKCGRNDAVKAVQDYIK
                     SEAGAKLQNDYITSPEIFHKKDIQEFQSKIDSIPMTISNVSTTSTTDGMLNCSATIAA
                     QLPPETLEVLKNNPEYLSGIISDNGKMNNGKVVWSNYPYSLSLADNKKDISVNRINYI
                     QNSLYQMSTLAVNKDYIITSKFTVKLSSSKNNYARSDRNLNDIWKSLPDSIKTSMKKS
                     QQAWVNDKALKCGKLSDADMETTPIQNRINTYDCQTKMTNERIAFLGGDNY"
     misc_feature    36433..36648
                     /locus_tag="Rahaq2_4597"
                     /note="Protein of unknown function (DUF1311); Region:
                     DUF1311; pfam07007"
                     /db_xref="CDD:254020"
     gene            36749..38146
                     /locus_tag="Rahaq2_4598"
                     /note="IMG reference gene:2506711622"
                     /db_xref="GeneID:11818107"
     CDS             36749..38146
                     /locus_tag="Rahaq2_4598"
                     /note="PFAM: ImpA-related N-terminal; ImpA domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220334.1"
                     /db_xref="GI:379703960"
                     /db_xref="InterPro:IPR010657"
                     /db_xref="InterPro:IPR021069"
                     /db_xref="GeneID:11818107"
                     /translation="MMAQDINRQLRTGGDPRALADYAVLREELSKLTHPARPDVDWKK
                     VEQLCLNLFQQNGIELQTASWYTQARTRLTGMSGLNEGLAILEALISRQWPGLWPQPV
                     HARMEILSGLSQRLQQTLRSMTLDYHDLSQIYQAEKLINALCEVLQRLELKHVSQLEA
                     LSSFMHGAAVRLENMHAASDTTIVLPAAATENTEKRWATQAREQWVYVAQAEPAEPQV
                     TITPPAPVKHPVQWKGFIAGIMATLLAGGGVCAAITAFYHPPSGEQLMATLPVMPKPL
                     NAQTLETLKNRQAEMLHREAPAYLAAMQQQTRQLATLSPRWAQDTGSHLVSQALILWP
                     DNPATAALAKSWTQQLNANAVPLENLSGWQQANTQLQQLADKLNGLDEQRGKYMTVSQ
                     LKSSVFAIQQALNGSPPVEESLRKLAQDKQQNKDVSPQLMMQLDNQFTQLLNRYVLLT
                     QTLPATAGKNGQADN"
     misc_feature    36749..37786
                     /locus_tag="Rahaq2_4598"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3515"
                     /db_xref="CDD:226046"
     misc_feature    36869..37051
                     /locus_tag="Rahaq2_4598"
                     /note="ImpA-related N-terminal; Region: ImpA-rel_N;
                     pfam06812"
                     /db_xref="CDD:253924"
     misc_feature    37658..38101
                     /locus_tag="Rahaq2_4598"
                     /note="ImpA domain protein; Region: DUF3702; pfam12486"
                     /db_xref="CDD:193049"
     gene            38212..38682
                     /locus_tag="Rahaq2_4599"
                     /note="IMG reference gene:2506711623"
                     /db_xref="GeneID:11818108"
     CDS             38212..38682
                     /locus_tag="Rahaq2_4599"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220335.1"
                     /db_xref="GI:379703961"
                     /db_xref="GeneID:11818108"
                     /translation="MSAKERFLKKLQDSQPRTGSFENKGQADIAEFRQRITLLQENIE
                     EWLEGTGIRVESTTVSLVECLIGGKSFSIPGIRLTYEDSQVTFTPVFLYGQGVTGCVE
                     TSLCTQGRVTVLCRLFMRAGENRDWTWRPANPFTAQERTFGEELFFELIEGLLP"
     gene            39230..40654
                     /locus_tag="Rahaq2_4600"
                     /note="IMG reference gene:2506711624"
                     /db_xref="GeneID:11818109"
     CDS             39230..40654
                     /locus_tag="Rahaq2_4600"
                     /note="PFAM: Bacterial Cytochrome Ubiquinol Oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome bd-type quinol oxidase subunit 1"
                     /protein_id="YP_005220336.1"
                     /db_xref="GI:379703962"
                     /db_xref="InterPro:IPR002585"
                     /db_xref="GeneID:11818109"
                     /translation="MFGLDALELARIQFAFTVSFHIIFPAITIGLASFLAVLEGMWLK
                     TKKEAYRDLYHFWSKIFAVNFGMGVVSGLVMAYQFGTNWSMFSSFAGSITGPLLTYEV
                     LTAFFLEAGFLGVMLFGWNRVGPGLHFFSTCMVALGTLMSTFWILASNSWMQTPQGYE
                     IVNNLVVPVSWMKVIFNPSFPFRLMHMTTAAFLASAFFVGSAAAWHLLRGRDTPAIRT
                     MLSMAMWMALIVSPIQAFLGDAHGLNTLKYQPAKIAAIEGHWENKDNKPSPLVLIGYP
                     DMNREETRYAIEIPYLGSLILTHSLTHQIPALKSFPKEDRPNSSVIFYTFRIMAGLGM
                     LMILLGVLSLILRRGGKMYTSKAFLRFAFLMGPSGLLALLAGWITTEMGRQPWVVYGL
                     LRTKDAVSNHNVLQMSVSLILFIVIYCSVFGVGYGYMMRLIRKGPQAHEGESVDHGGP
                     GQHRTPARPLSAISESLTDENKGA"
     misc_feature    39254..40540
                     /locus_tag="Rahaq2_4600"
                     /note="Bacterial Cytochrome Ubiquinol Oxidase; Region:
                     Bac_Ubq_Cox; pfam01654"
                     /db_xref="CDD:250773"
     gene            40657..41664
                     /locus_tag="Rahaq2_4601"
                     /note="IMG reference gene:2506711625"
                     /db_xref="GeneID:11818110"
     CDS             40657..41664
                     /locus_tag="Rahaq2_4601"
                     /note="PFAM: Cytochrome oxidase subunit II;
                     TIGRFAM: cytochrome d oxidase, subunit II (cydB)"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome d oxidase cyd subunit II"
                     /protein_id="YP_005220337.1"
                     /db_xref="GI:379703963"
                     /db_xref="InterPro:IPR003317"
                     /db_xref="GeneID:11818110"
                     /translation="MGIDLPLIWFLIIIFGVMMYIVMDGFDLGIGLLFPLVKKEHDRD
                     VMMNTVAPVWDGNETWLVLGGAALYGAFPLAYSVILDALTIPLTLMLFGLIFRGVAFE
                     FRFKASPAKRHVWDKSFICGSVIATFCQGVVLGAVINGIPVVNRTYAGGALDWLTPFT
                     LFCGFALVVAYALLGCTWLIMKTEGELQEAMHKIAKPLLMVFLLVTLAVSLWTPLTHS
                     DIATRWFSRPNLYWFLPVPVLVVLVSAWMYRAISKNAHHAPFLLTLALVFLGYTGLGI
                     SIWPNIIPPSISIWEAASPPQSQGFILVGALFIIPIILVYTFWSYYVFRGKVTPDQGY
                     H"
     misc_feature    40657..41661
                     /locus_tag="Rahaq2_4601"
                     /note="Cytochrome bd-type quinol oxidase, subunit 2
                     [Energy production and conversion]; Region: AppB; COG1294"
                     /db_xref="CDD:224213"
     misc_feature    40666..41631
                     /locus_tag="Rahaq2_4601"
                     /note="Cytochrome oxidase subunit II; Region: Cyto_ox_2;
                     pfam02322"
                     /db_xref="CDD:251222"
     gene            41676..41840
                     /locus_tag="Rahaq2_4602"
                     /note="IMG reference gene:2506711626"
                     /db_xref="GeneID:11818111"
     CDS             41676..41840
                     /locus_tag="Rahaq2_4602"
                     /note="PFAM: Protein of unknown function (DUF2474)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220338.1"
                     /db_xref="GI:379703964"
                     /db_xref="InterPro:IPR018895"
                     /db_xref="GeneID:11818111"
                     /translation="MNLIRKMDDSNITKAPFLKRVGWMAVIWGGSVLALFVVASVFHL
                     LMFAAGMRSH"
     misc_feature    41715..41834
                     /locus_tag="Rahaq2_4602"
                     /note="Protein of unknown function (DUF2474); Region:
                     DUF2474; pfam10617"
                     /db_xref="CDD:256093"
     gene            complement(42034..43548)
                     /locus_tag="Rahaq2_4603"
                     /note="IMG reference gene:2506711627"
                     /db_xref="GeneID:11818112"
     CDS             complement(42034..43548)
                     /locus_tag="Rahaq2_4603"
                     /note="PFAM: Bacterial extracellular solute-binding
                     proteins, family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005220339.1"
                     /db_xref="GI:379703965"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="GeneID:11818112"
                     /translation="MKQKHFNVVAAGVLLALSLVSEVAQAAGVLTIGRREDSTTFDPI
                     RSAQNADNWVFSNVFDPLVRVDNTGTQLLPGLAESWTISPDGKTYTLKMRDAKFSDGT
                     PVTASDAVFSLTRIRDDAGSLWKDSYSIIDTLKAPDAHTLVITLKTPSAAFLSQLALP
                     NASVISQQALTRQGADDFAEHPVGSGAFSVKEWTRGEKVELVKNPYYWDAAKVKLDGV
                     EWLTLPDDNTRMLKVQAGEIDAALSIPFSRISSLQKDPKLAVELDTSTREDHLLINHS
                     HGDLGKVEVRQALDFAIDKKAIIDTVTFGYGKIANSYIPDGALYHYAGNLQRPYDPEK
                     ARQLLAAAGVKNLTLKYLVNAGDEVDEQIAVLLQQQLAKAGITANLQKVDPSQSWDML
                     VAGDYDISVMYWTNDILDPDQKTTFTLGHDSNMNYMTRYHNDKVKALVAAARVEMDPK
                     KREQMYIDLQKMAKADVNWIDLYYSPYRNVTRKNIKDFHQNPLGRFTLEETVKE"
     misc_feature    complement(42037..43527)
                     /locus_tag="Rahaq2_4603"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(42085..43464)
                     /locus_tag="Rahaq2_4603"
                     /note="The substrate-binding domain of an ABC-type
                     nickel/oligopeptide-like import system contains the type 2
                     periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like; cd00995"
                     /db_xref="CDD:173853"
     gene            complement(43529..44578)
                     /locus_tag="Rahaq2_4604"
                     /note="IMG reference gene:2506711628"
                     /db_xref="GeneID:11818113"
     CDS             complement(43529..44578)
                     /locus_tag="Rahaq2_4604"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter,
                     ATP-binding protein, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_005220340.1"
                     /db_xref="GI:379703966"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818113"
                     /translation="MSHLPDLKPQPYPLLEVEALCVTFPVSGLGFTKRHVQAVNDVSL
                     HIRAGETLGLVGESGSGKSTLGRAMLQLENVSAGRVRFNGQLITGGMKPDIARLRQQT
                     AMIFQDPFSSLNPRQTIGESIGEVLRVHRKVTKAEIPARINTLLTLVGLSPEHATRRP
                     QALSGGQCQRAGIARALAIEPRLIVADECVAALDVSIQAQIINLLMDLRESMGLAILF
                     IAHDLAIVRRLCDRVAVMYLGRIVESGPTQTVFNAPRHPYTAALVAAIPEIDPDRPLP
                     EHPLQGEPPSPVSLPAGCAFHPRCAFALPECRHGAVPETRHIADHAFACVLENHKSDG
                     INPMTEGMLHETKAF"
     misc_feature    complement(43655..44542)
                     /locus_tag="Rahaq2_4604"
                     /note="ABC-type oligopeptide transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     AppF; COG4608"
                     /db_xref="CDD:226967"
     misc_feature    complement(43844..44539)
                     /locus_tag="Rahaq2_4604"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(44390..44413)
                     /locus_tag="Rahaq2_4604"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(43916..43918,44015..44020,44258..44260,
                     44387..44395,44399..44404))
                     /locus_tag="Rahaq2_4604"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(44258..44269)
                     /locus_tag="Rahaq2_4604"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(44063..44092)
                     /locus_tag="Rahaq2_4604"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(44015..44032)
                     /locus_tag="Rahaq2_4604"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(43997..44008)
                     /locus_tag="Rahaq2_4604"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(43910..43930)
                     /locus_tag="Rahaq2_4604"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(43598..43861)
                     /locus_tag="Rahaq2_4604"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(44562..45539)
                     /locus_tag="Rahaq2_4605"
                     /note="IMG reference gene:2506711629"
                     /db_xref="GeneID:11818114"
     CDS             complement(44562..45539)
                     /locus_tag="Rahaq2_4605"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter,
                     ATP-binding protein, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_005220341.1"
                     /db_xref="GI:379703967"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818114"
                     /translation="MTLMQVSGLTIEDRQGVALVDRLSLTLNAGDILGLVGESGSGKT
                     LSCRAMMRLLPGEGLHIRAGEIRLNGTDLLTLNDKRMTAIRGREIGMIFQNPASHLNP
                     VMTIGQQIAESRRLHFGASRREAQRQAVELLRQVGIPDPQRRADNYPHEFSGGMRQRA
                     MIAVALACEPKMLIADEPTTALDVTVQMQILHLLRDLRDRLGIAIILITHDLGVVAQT
                     CDRIAVMYGGRLCETGDKRPVLAQAQHPYTRGLIDCQPVSEGGAGRLITLPGQPPVAA
                     RFPSGCRFHPRCTQATALCRDSQPAMQTGSHATACHHPLIHGRENESFA"
     misc_feature    complement(44598..45533)
                     /locus_tag="Rahaq2_4605"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppD; COG0444"
                     /db_xref="CDD:223521"
     misc_feature    complement(44838..45533)
                     /locus_tag="Rahaq2_4605"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(45408..45431)
                     /locus_tag="Rahaq2_4605"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(44910..44912,45009..45014,45258..45260,
                     45405..45413,45417..45422))
                     /locus_tag="Rahaq2_4605"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(45258..45269)
                     /locus_tag="Rahaq2_4605"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(45057..45086)
                     /locus_tag="Rahaq2_4605"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(45009..45026)
                     /locus_tag="Rahaq2_4605"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(44991..45002)
                     /locus_tag="Rahaq2_4605"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(44904..44924)
                     /locus_tag="Rahaq2_4605"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(44604..44855)
                     /locus_tag="Rahaq2_4605"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(45536..46396)
                     /locus_tag="Rahaq2_4606"
                     /note="IMG reference gene:2506711630"
                     /db_xref="GeneID:11818115"
     CDS             complement(45536..46396)
                     /locus_tag="Rahaq2_4606"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220342.1"
                     /db_xref="GI:379703968"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818115"
                     /translation="MSMTGKIATQRMGYFHLRGLPRQQALRLGIVMLSVWVLIALLSP
                     WIAPFDPIAQDATVTLSPPSFTHPFGTDNFGRDILSRVMWGARIDLQICLIGVIFPFT
                     FGTLTGAFAGYLGGAVDTFFMRVIDVVLAFPFLVLMLSIIAILGPGLGSFYIAMAMVG
                     WVSYARLVRSQVLTLKHRDFILAARSLGYSHPRILLLHLLPNALTSSLVFSMSDCVLV
                     LLSGASVSYLGLGVQPPVAEWGVMVAEGQSFITTAWWITTFPGLAIVVLAMSFSLLAD
                     GLGDKLGERP"
     misc_feature    complement(45542..46390)
                     /locus_tag="Rahaq2_4606"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(46205..>46315)
                     /locus_tag="Rahaq2_4606"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    complement(45596..46141)
                     /locus_tag="Rahaq2_4606"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(45596..45601,45608..45613,45620..45625,
                     45629..45634,45641..45646,45674..45679,45716..45721,
                     45728..45739,45758..45760,45767..45772,45812..45814,
                     45863..45865,45872..45877,45887..45889,45893..45898,
                     45905..45907,45911..45913,45917..45922,45971..45973,
                     45977..45982,45989..46018,46022..46033,46061..46063,
                     46076..46081,46088..46093))
                     /locus_tag="Rahaq2_4606"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(45722..45739,45971..46015))
                     /locus_tag="Rahaq2_4606"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(45644..45646,45674..45676,45683..45685,
                     45719..45721,45935..45937,45971..45973))
                     /locus_tag="Rahaq2_4606"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(45791..45793,45803..45808,45824..45862))
                     /locus_tag="Rahaq2_4606"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(46393..47331)
                     /locus_tag="Rahaq2_4607"
                     /note="IMG reference gene:2506711631"
                     /db_xref="GeneID:11818116"
     CDS             complement(46393..47331)
                     /locus_tag="Rahaq2_4607"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220343.1"
                     /db_xref="GI:379703969"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818116"
                     /translation="MHRYRFLLWRPLQLLPVLLGISILTFVMVRAIPGDPARILLGVR
                     STPEAIARIRVQYGLDLPVWQQYLYFLRNLFHGEMGKSLIYRVDTLKLIMSRIEPTLY
                     LVLGSVVLAMLFTVPLAAGAARHRGRLADQVIRLLSTIGLGLPAFWLAIMMILLFSLS
                     LGWFPVSGYGSDFGERVHHLFLPCLTVALALSAVLTRNLRASLLMELQNDYVTAARAR
                     GQNENRIFWRHVMPNSLVPTVNLLAVNIGWLIGSTVVIESVFAIPGMGQLLVKAIISR
                     DYMVVQGVVLVFALATVAVNLLADLLTVALDPRVKL"
     misc_feature    complement(46396..47319)
                     /locus_tag="Rahaq2_4607"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(46441..47034)
                     /locus_tag="Rahaq2_4607"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(46441..46446,46453..46458,46465..46470,
                     46474..46479,46486..46491,46519..46524,46558..46563,
                     46570..46581,46600..46602,46609..46614,46654..46656,
                     46705..46707,46714..46719,46729..46731,46735..46740,
                     46747..46749,46753..46755,46759..46764,46870..46872,
                     46876..46881,46888..46917,46921..46932,46963..46965,
                     46978..46983,46990..46995))
                     /locus_tag="Rahaq2_4607"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(46564..46581,46870..46914))
                     /locus_tag="Rahaq2_4607"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(46489..46491,46519..46521,46528..46530,
                     46561..46563,46777..46779,46870..46872))
                     /locus_tag="Rahaq2_4607"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(46633..46635,46645..46650,46666..46704))
                     /locus_tag="Rahaq2_4607"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            47560..48315
                     /locus_tag="Rahaq2_4608"
                     /note="IMG reference gene:2506711632"
                     /db_xref="GeneID:11818117"
     CDS             47560..48315
                     /locus_tag="Rahaq2_4608"
                     /note="PFAM: Bacterial regulatory proteins, luxR family;
                     Autoinducer binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator containing a CheY-like
                     receiver domain and an HTH DNA-binding domain"
                     /protein_id="YP_005220344.1"
                     /db_xref="GI:379703970"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR005143"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="GeneID:11818117"
                     /translation="MKLAVQESAVSLRETTVDGAFDQLFAQTSRLGFDALIYDYTPVP
                     RTLEGELITPSLLRMCNVPGDMQRLWLENGYYQVDPVQHYALESCAPFVWSYQRPDNT
                     SLQNRLSDLNKPVTHYMCDNNMPSGATVPLHLPNGGFVTVTGIHTGAGHELDIHDVLA
                     ELSLLALTFQECVFPLFDSSILTCRHVRLSKRERECLTWAAEGLTAKEIARKLNRSIA
                     TVTLHLNTAARKLGASNRVQAVVRAMHYRLLDS"
     misc_feature    47578..48291
                     /locus_tag="Rahaq2_4608"
                     /note="LuxR family transcriptional regulatory, chaperone
                     HchA-associated; Region: reg_near_HchA; TIGR03541"
                     /db_xref="CDD:132580"
     misc_feature    47605..48078
                     /locus_tag="Rahaq2_4608"
                     /note="Autoinducer binding domain; Region: Autoind_bind;
                     pfam03472"
                     /db_xref="CDD:251983"
     misc_feature    48124..48288
                     /locus_tag="Rahaq2_4608"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(48127..48135,48172..48180,48202..48207,48211..48216,
                     48220..48234,48265..48267)
                     /locus_tag="Rahaq2_4608"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(48160..48162,48166..48168,48172..48174,48265..48273,
                     48280..48282)
                     /locus_tag="Rahaq2_4608"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            48406..49305
                     /locus_tag="Rahaq2_4609"
                     /note="IMG reference gene:2506711633"
                     /db_xref="GeneID:11818118"
     CDS             48406..49305
                     /locus_tag="Rahaq2_4609"
                     /note="PFAM: alpha/beta hydrolase fold;
                     TIGRFAM: proline-specific peptidases, Bacillus
                     coagulans-type subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="proline-specific peptidase"
                     /protein_id="YP_005220345.1"
                     /db_xref="GI:379703971"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR002410"
                     /db_xref="InterPro:IPR005945"
                     /db_xref="GeneID:11818118"
                     /translation="MYNITEGYAPFQEYQTWYRICGDLHNGKTPLVIAHGGPGCTHDY
                     VDAFRDIAGTGRAVIHYDQIGNGRSTHLPDKPADFWQPSFFLAELDNLLHHLGIGQNY
                     ALLGQSWGGMLGAEHAVTQPPGLKALVIANSPASMALWLQAAARLRSELPPDVQETLL
                     AHEAAGTLDSAEYKAASQVFYARHVCRLDPWPEEVKRTFAAMDADPTVYLAMNGPTEF
                     HVIGSMKNWTVIDRLPAINVPVLLISGRYDEAAPEVVQPFADLIKGAEWVIFENSSHM
                     PHVEEREACMKCVEAFLASHGSL"
     misc_feature    48415..49284
                     /locus_tag="Rahaq2_4609"
                     /note="proline-specific peptidase, Bacillus coagulans-type
                     subfamily; Region: pro_imino_pep_2; TIGR01250"
                     /db_xref="CDD:188121"
     misc_feature    48445..49161
                     /locus_tag="Rahaq2_4609"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(49384..50370)
                     /locus_tag="Rahaq2_4610"
                     /note="IMG reference gene:2506711634"
                     /db_xref="GeneID:11818119"
     CDS             complement(49384..50370)
                     /locus_tag="Rahaq2_4610"
                     /note="PFAM: Bacterial regulatory helix-turn-helix
                     proteins, AraC family"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding domain-containing protein"
                     /protein_id="YP_005220346.1"
                     /db_xref="GI:379703972"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="GeneID:11818119"
                     /translation="MIHNPCFLTITPEMTQHDPFALSSDLISELLTGMRLRGVQYRRI
                     QTGPEFGMAFKPRPGHAYFHYLAVGSAVLKTGDGVLHPLSAGDVVFMPHGMAHQLLSE
                     PDNTAQDIDDFDVAPLGDAVSGVDTCPSRDTIPGVILFYGCMEFDLGGMQSLGKLMPD
                     TMVADAKGERYPGLLPVIDAMKREICSGRIGFAGILARLAEVAAAMIVRGWVECGCEN
                     ASGIAAALREPRLARAILALHRQPGRNWTVAELAAESHISRSVFAARFQSMIGVSPLR
                     YVTELRMQLATQWLADSKIPIETVAFRLGYTSQAAFSRAYKRISGQSPGASR"
     misc_feature    complement(49732..50298)
                     /locus_tag="Rahaq2_4610"
                     /note="Cupin; Region: Cupin_6; pfam12852"
                     /db_xref="CDD:257350"
     misc_feature    complement(49534..49659)
                     /locus_tag="Rahaq2_4610"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(49387..49638)
                     /locus_tag="Rahaq2_4610"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    complement(49399..49494)
                     /locus_tag="Rahaq2_4610"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            50431..51669
                     /locus_tag="Rahaq2_4611"
                     /note="IMG reference gene:2506711635"
                     /db_xref="GeneID:11818120"
     CDS             50431..51669
                     /locus_tag="Rahaq2_4611"
                     /note="PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005220347.1"
                     /db_xref="GI:379703973"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818120"
                     /translation="MNHKTQGSTPAIQRDVQQAPPAWMAVFSLTMGVFGLLTAEYLPA
                     SLLTPMASDLQVTEALAGQAVTVTAVIALFAGLLVPGLTRKLDRRTVLLSFTVLMIAS
                     NLLVALSSSLVVLLAMRILLGVALGGFWSMAAAVAMRLVPEKFVPRALSVIFSGIAVG
                     TVVSVPLGSFLGELYGWRSAFIAAALVGGVTLAFQWFTLPRMAPRQVTHTESVLTLLR
                     RPGIATGMFGCVLAHTGQYALFTYIRPSLESVSHVDAGGLALLLLGFGVANFAGTLLA
                     GWVMTYSLRLTLIVMPCLVGIAALGMILLPVQITGLTLLVLLWGLAFGGVPVAWSNWV
                     TRSVPDQAESAGGMVVAAVQSSIAAGAALGGVMFGLGGISGVFITAGIVMLSAALIIA
                     LCVRVGLPGYGAETASLQQG"
     misc_feature    50485..51621
                     /locus_tag="Rahaq2_4611"
                     /note="ribonucleoside transporter; Reviewed; Region: nepI;
                     PRK10213"
                     /db_xref="CDD:182309"
     misc_feature    50506..51615
                     /locus_tag="Rahaq2_4611"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(50548..50550,50557..50565,50569..50574,50623..50625,
                     50632..50637,50644..50646,50656..50661,50665..50670,
                     50806..50811,50818..50823,50830..50835,50842..50844,
                     50878..50883,50890..50895,50911..50913,51127..51129,
                     51136..51141,51148..51153,51160..51162,51202..51204,
                     51214..51216,51226..51228,51235..51237,51247..51249,
                     51391..51393,51400..51405,51412..51414,51424..51426,
                     51430..51432,51463..51468,51475..51480,51487..51492,
                     51499..51501)
                     /locus_tag="Rahaq2_4611"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            52204..53637
                     /locus_tag="Rahaq2_4612"
                     /note="IMG reference gene:2506711636"
                     /db_xref="GeneID:11818121"
     CDS             52204..53637
                     /locus_tag="Rahaq2_4612"
                     /note="PFAM: Bacterial Cytochrome Ubiquinol Oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome bd-type quinol oxidase subunit 1"
                     /protein_id="YP_005220348.1"
                     /db_xref="GI:379703974"
                     /db_xref="InterPro:IPR002585"
                     /db_xref="GeneID:11818121"
                     /translation="MFGLDAFHLARIQFAFTVSFHIIFPAITIGLASFLAVLEGMWLK
                     TGNRSYRDLYHFWSKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGGITGPLLTYEV
                     LTAFFLEAGFLGVMLFGWNRVGPGLHFFATCMVALGTLISTFWILASNSWMHTPQGYE
                     IVNGVVVPTDWFKVIFNPSFPYRLFHMSIAAFLASAFFVGASGAWHLLRGNDTPAVRT
                     MFSMALWMALIVAPIQAMVGDAHGLNTLEHQPAKIAAIEGHWENPPGEATPLILFGMP
                     DMEQERTKYALEIPYLGSLILTHSLQKQVPALKSFPKEDRPFSPVIFWSFRIMVALGL
                     LMITAGVLGAWLRYKKRLYQSRPFLWFTLLMGPSGLIALLAGWFTTEIGRQPWVVYGV
                     QRTRDAVSAHGEMHMSLSLLAFLLVYSSVFGIGYVYLMRLIKKGPVTGEGDEVSHGGP
                     GKKSTPARPLSAAHEGLSNPEGSKKYD"
     misc_feature    52228..53517
                     /locus_tag="Rahaq2_4612"
                     /note="Bacterial Cytochrome Ubiquinol Oxidase; Region:
                     Bac_Ubq_Cox; pfam01654"
                     /db_xref="CDD:250773"
     gene            53630..54634
                     /locus_tag="Rahaq2_4613"
                     /note="IMG reference gene:2506711637"
                     /db_xref="GeneID:11818122"
     CDS             53630..54634
                     /locus_tag="Rahaq2_4613"
                     /note="PFAM: Cytochrome oxidase subunit II;
                     TIGRFAM: cytochrome d oxidase, subunit II (cydB)"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome d oxidase cyd subunit II"
                     /protein_id="YP_005220349.1"
                     /db_xref="GI:379703975"
                     /db_xref="InterPro:IPR003317"
                     /db_xref="GeneID:11818122"
                     /translation="MIDYTIIWFGIIVFANLMYIVMDGFDLGIGILFPFNKDKTERDM
                     MVNTVAPVWDGNETWLVLGGAALYGAFPLAYSVIADALTIPLTLMLFGLIFRGVAFEF
                     RFKATEKHRPFWDKSFITGSVVATFSQGVAVGAVLNGFEVTGRTFTGSALSWLAPFPL
                     FCGVGLVVAYALLGCTWLIMKTENSLHQKMCRLAKPLVITLLVIMGIISIWTPLTHAD
                     IAHRWFSMPNLIAFLPVPVLVLASTWGILRAIKSNAHYMPFLLTLALVFLGFSGLGIS
                     IWPNIIPPAISIWDAASSQKSLAFMLVGAALIIPVILIYTFWSYYVFRGKIKENEGYH
                     "
     misc_feature    53630..54631
                     /locus_tag="Rahaq2_4613"
                     /note="Cytochrome bd-type quinol oxidase, subunit 2
                     [Energy production and conversion]; Region: AppB; COG1294"
                     /db_xref="CDD:224213"
     misc_feature    53636..54601
                     /locus_tag="Rahaq2_4613"
                     /note="Cytochrome oxidase subunit II; Region: Cyto_ox_2;
                     pfam02322"
                     /db_xref="CDD:251222"
     gene            54696..54845
                     /locus_tag="Rahaq2_4614"
                     /note="IMG reference gene:2506711638"
                     /db_xref="GeneID:11818123"
     CDS             54696..54845
                     /locus_tag="Rahaq2_4614"
                     /note="PFAM: Protein of unknown function (DUF2474)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220350.1"
                     /db_xref="GI:379703976"
                     /db_xref="GeneID:11818123"
                     /translation="MKSLTVNSKKPFWKRVVWLIIIYTLSVLSLAVVAFLFRMMMTAA
                     GMKSH"
     misc_feature    54720..54839
                     /locus_tag="Rahaq2_4614"
                     /note="Protein of unknown function (DUF2474); Region:
                     DUF2474; pfam10617"
                     /db_xref="CDD:256093"
     gene            complement(54874..55635)
                     /locus_tag="Rahaq2_4615"
                     /note="IMG reference gene:2506711639"
                     /db_xref="GeneID:11818124"
     CDS             complement(54874..55635)
                     /locus_tag="Rahaq2_4615"
                     /note="PFAM: Bacterial regulatory proteins, gntR family;
                     FCD domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220351.1"
                     /db_xref="GI:379703977"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818124"
                     /translation="MPIKKLENPRIYRQIADQLKTLIDNKEFPPGSRLPSERELASQL
                     QVSRASVREALIALEVIGLVDVRVGNGVIVRQPPAVPLTPSQEPVMSQAGRNQWTDVD
                     DELNIALDFTAELPPFSLLQTRRLIEPETAALAARNATDAELAAIRQAYEQNCRDNRN
                     GSATHPGDRLFHIRIAQASGNPAYAFIIAHLLGHRYGTMFRSLQLHYTPQDMPHRSEI
                     EHLEILTALEARDSRAAKKAMKEHLDAVIKIFGQG"
     misc_feature    complement(54889..55635)
                     /locus_tag="Rahaq2_4615"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(55411..55605)
                     /locus_tag="Rahaq2_4615"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(55420..55431,55435..55440,55468..55470,
                     55477..55482,55486..55500,55522..55527,55531..55533,
                     55600..55602))
                     /locus_tag="Rahaq2_4615"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(54901..55278)
                     /locus_tag="Rahaq2_4615"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            55859..56599
                     /locus_tag="Rahaq2_4616"
                     /note="IMG reference gene:2506711640"
                     /db_xref="GeneID:11818125"
     CDS             55859..56599
                     /locus_tag="Rahaq2_4616"
                     /note="PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005220352.1"
                     /db_xref="GI:379703978"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11818125"
                     /translation="MNLAGKKVLITAAGQGIGFNTATLFALEGAEVIATDINIEALHN
                     IPGITPRLLDVTDPQAIAALAEETGALDVLFNCAGVVHSGDILTCTEREWQFALDLNV
                     TAMFRMIRAFLPAMLERNSGSVINMSSVASSIKGVPNRFAYSASKAAVIGLTRSVAAD
                     YVTRGIRCNAICPGTVESPSLRQRIAAQAKAEGRSEAEVYAAFVSRQPIGRIGKTEEI
                     AQLALYLASDASSYTTGTVQIIDGGWSN"
     misc_feature    55859..56593
                     /locus_tag="Rahaq2_4616"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    55868..56596
                     /locus_tag="Rahaq2_4616"
                     /note="human DHRS6-like, classical (c) SDRs; Region:
                     DHRS6_like_SDR_c; cd05368"
                     /db_xref="CDD:187626"
     misc_feature    order(55892..55894,55898..55909,55964..55972,56015..56023,
                     56087..56095,56156..56158,56237..56242,56285..56287,
                     56297..56299,56375..56386,56390..56398,56408..56410)
                     /locus_tag="Rahaq2_4616"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187626"
     misc_feature    order(56030..56032,56111..56119,56123..56131,56138..56143,
                     56150..56152,56162..56167,56174..56176,56183..56188,
                     56195..56200,56207..56209,56252..56254,56258..56266,
                     56270..56275,56279..56281,56288..56293,56300..56305,
                     56309..56317,56321..56326,56330..56344,56381..56383,
                     56480..56485,56489..56497,56507..56509,56519..56521,
                     56528..56530,56552..56560,56564..56566,56573..56587,
                     56594..56596)
                     /locus_tag="Rahaq2_4616"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187626"
     misc_feature    order(56030..56032,56111..56119,56123..56131,56138..56143,
                     56150..56152,56162..56167,56174..56176,56183..56188,
                     56195..56200,56207..56209,56252..56254,56258..56260,
                     56264..56266,56270..56275,56279..56281,56288..56293,
                     56300..56305,56309..56317,56321..56326,56333..56341)
                     /locus_tag="Rahaq2_4616"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187626"
     misc_feature    order(56159..56161,56243..56245,56285..56287,56297..56299)
                     /locus_tag="Rahaq2_4616"
                     /note="active site"
                     /db_xref="CDD:187626"
     gene            56663..57505
                     /locus_tag="Rahaq2_4617"
                     /note="IMG reference gene:2506711641"
                     /db_xref="GeneID:11818126"
     CDS             56663..57505
                     /locus_tag="Rahaq2_4617"
                     /note="PFAM: Fumarylacetoacetate (FAA) hydrolase family"
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-4-pentenoate hydratase"
                     /protein_id="YP_005220353.1"
                     /db_xref="GI:379703979"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="GeneID:11818126"
                     /translation="MKLLRYGNPGSERPGLLDDHGKLRDLSAHVADISGEFLQSETLD
                     KLRQLDPQNLPLVSGEPRLGPCVGKVGKFICIGLNYADHAAETGAEIPKEPVVFSKWT
                     SAIVGPNDDVEIPRDSVKTDWEVELGVVIGTGGRYISEADALSHVAGYCVINDVSERE
                     FQIERGGTWDKGKGCDTFGPTGPWLVTADEIPDPHQLNLWLEVDGKRYQNGNTRTMIF
                     RIPEIISYLSRFMSLQPGDIISTGTPPGVGLGQKPPVYLKAGQVMRLGIEGLGEQRQK
                     TVQA"
     misc_feature    56690..57502
                     /locus_tag="Rahaq2_4617"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    56876..57496
                     /locus_tag="Rahaq2_4617"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            57532..58809
                     /locus_tag="Rahaq2_4618"
                     /note="IMG reference gene:2506711642"
                     /db_xref="GeneID:11818127"
     CDS             57532..58809
                     /locus_tag="Rahaq2_4618"
                     /note="PFAM: Mandelate racemase / muconate lactonizing
                     enzyme, C-terminal domain; Mandelate racemase / muconate
                     lactonizing enzyme, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="L-alanine-DL-glutamate epimerase-like protein"
                     /protein_id="YP_005220354.1"
                     /db_xref="GI:379703980"
                     /db_xref="InterPro:IPR001354"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="InterPro:IPR015654"
                     /db_xref="InterPro:IPR018110"
                     /db_xref="GeneID:11818127"
                     /translation="MTTITALRVEDVRFPTSLALDGSDAMNPDPDYSAAYVILDTDNP
                     ALKGHGLTFTIGRGNEICCVAIKALEHLIVGRELAAIIADMGQFWRDFTSDSQLRWIG
                     PDKGAIHLATGAVVNAVWDLWSKAAGKPLWQLVADMSPEELVRCIDFRYITDCITPQE
                     ALALLRQRADNKAQRREKLLAEGYPCYTTSAGWLGYPDDKLRRLCQEAVNAGFDYLKL
                     KVGRDLEDDIRRVRIAREVIGPDRKLMIDANQVWETDEAIPWVNALAFAKPWFIEEPT
                     SPDDIEGHRKIRQGVAPVKVATGEMCQNRIMFKQFIMREAIDVVQIDACRMGGVNEVL
                     AVMLMAAKYNLPVCPHAGGVGLCEYVQHLSMIDYLCIAGTHEGRVIEYVDHLHEHFVH
                     PCDIRGAAYMPPQAPGFSIEMHQASVERYRHHT"
     misc_feature    57535..58797
                     /locus_tag="Rahaq2_4618"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    57535..58773
                     /locus_tag="Rahaq2_4618"
                     /note="Human rTS beta is encoded by the rTS gene which,
                     through alternative RNA splicing, also encodes rTS alpha
                     whose mRNA is complementary to thymidylate synthase mRNA.
                     rTS beta expression is associated with the production of
                     small molecules that appear to...; Region:
                     rTSbeta_L-fuconate_dehydratase; cd03324"
                     /db_xref="CDD:239440"
     misc_feature    order(58090..58092,58180..58182,58186..58188,58270..58272,
                     58342..58344,58348..58350,58429..58431,58498..58500,
                     58579..58581,58672..58674)
                     /locus_tag="Rahaq2_4618"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:239440"
     misc_feature    order(58270..58272,58348..58350,58429..58431)
                     /locus_tag="Rahaq2_4618"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239440"
     gene            58838..59704
                     /locus_tag="Rahaq2_4619"
                     /note="IMG reference gene:2506711643"
                     /db_xref="GeneID:11818128"
     CDS             58838..59704
                     /locus_tag="Rahaq2_4619"
                     /note="PFAM: Amidohydrolase; COG3618"
                     /codon_start=1
                     /transl_table=11
                     /product="putative TIM-barrel fold metal-dependent
                     hydrolase"
                     /protein_id="YP_005220355.1"
                     /db_xref="GI:379703981"
                     /db_xref="InterPro:IPR006992"
                     /db_xref="GeneID:11818128"
                     /translation="MPMIRIDSHQHFWRYTPQDYRWISDEMAVLKQDFLPETLKNTLQ
                     RHDIQGTVLVQACPSAGETRWLLELAEHTDFVRAVTGWVDMSSSALQRDLDAISHPLL
                     RGFRHQVQDEPSPAQWLADPAINAGIRQIQRQDYVYEILVTHRHLRDAVQFAARHDGH
                     FLVLDHLGKPDLSLGAAYWKKQIAPLAALEHVSCKLSGLLTEPRPGGMSARDLLPYFD
                     AALEVFGTGRLMFGSDWPVCLLAGGDENPWNLWQQATGSLSSDEQAALYGGNACTVYR
                     LQEMTDESASAK"
     misc_feature    58838..59668
                     /locus_tag="Rahaq2_4619"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(59246..59248,59333..59335,59537..59539)
                     /locus_tag="Rahaq2_4619"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            59682..60458
                     /locus_tag="Rahaq2_4620"
                     /note="IMG reference gene:2506711644"
                     /db_xref="GeneID:11818129"
     CDS             59682..60458
                     /locus_tag="Rahaq2_4620"
                     /note="PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005220356.1"
                     /db_xref="GI:379703982"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11818129"
                     /translation="MNLHLQNKVVMVTGGGSGIGAAISLTLAEEGAIPVIISNTEPAN
                     ELMHKLQQLSPQASFVLTELRDEASCKAAVNEVLTRYGSIDGLVNNAGANDSVGLEAG
                     REAFVQSLEQNLIHYYLMAHLSLNALRASRGAIVNISSKTALTGQGNTSGYASAKGGI
                     LALTREWAAALLGDGIRVNAVIPAEVMTPLYERWIKSFDHPEEKLQQITSHIPLEQRM
                     TTPQEIANTVVFLLSSRTSHTTGQWLTVDGGYMHLDRALT"
     misc_feature    59682..60455
                     /locus_tag="Rahaq2_4620"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK08628"
                     /db_xref="CDD:181508"
     misc_feature    59709..60422
                     /locus_tag="Rahaq2_4620"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(59721..59723,59727..59738,59793..59801,59865..59873,
                     59949..59957,60015..60017,60093..60101,60138..60140,
                     60150..60152,60228..60239,60243..60248)
                     /locus_tag="Rahaq2_4620"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(60018..60020,60099..60101,60138..60140,60150..60152)
                     /locus_tag="Rahaq2_4620"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            60455..60799
                     /locus_tag="Rahaq2_4621"
                     /note="IMG reference gene:2506711645"
                     /db_xref="GeneID:11818130"
     CDS             60455..60799
                     /locus_tag="Rahaq2_4621"
                     /note="PFAM: Domain of unknown function (DUF718)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220357.1"
                     /db_xref="GI:379703983"
                     /db_xref="InterPro:IPR008000"
                     /db_xref="GeneID:11818130"
                     /translation="MKRRYCQALDLADDPALIEEYQRYHREIWPEITAHLRRYGITEM
                     EIYRLGNRLMMVMETTEDFDSGLFERRSLEDPKVCEWEALMWKYQRPTPWTPAGEKWV
                     EMERIFSLTEQK"
     misc_feature    60461..60784
                     /locus_tag="Rahaq2_4621"
                     /note="Domain of unknown function (DUF718); Region:
                     DUF718; pfam05336"
                     /db_xref="CDD:253156"
     gene            61093..62331
                     /locus_tag="Rahaq2_4622"
                     /note="IMG reference gene:2506711646"
                     /db_xref="GeneID:11818131"
     CDS             61093..62331
                     /locus_tag="Rahaq2_4622"
                     /note="PFAM: Major Facilitator Superfamily;
                     TIGRFAM: L-fucose:H+ symporter permease"
                     /codon_start=1
                     /transl_table=11
                     /product="L-fucose:H+ symporter permease"
                     /protein_id="YP_005220358.1"
                     /db_xref="GI:379703984"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818131"
                     /translation="MLADKTAAPAYAQRKTTSGFRLAFILVTTLFFLWGLSYGLLDVL
                     NKHFQDVLHVNKAQSGLLQAAYFGAYFIIALPAGFFMDRFGYKAGILVGLCLYALGAL
                     LFVPAASAGSFGMFLFALFVIALGLGCLETAANPFATVLGDPAGAERRLNLSQSFNGL
                     GQFIGPIIGGSLFFSATQGTTTDGLSSVKTTYVAIAVLVLLIAFLFGRTKLPDIREQS
                     APEDHGIGKGLWQHGHFTGGVIAQFFYVAAQVGVGAFFINYTTEHWHTLSNQNASYLL
                     SVGMISFMVGRFFSTWLMGFVRPVTLLVVYAIINIVLCGVVVAGIDNVSVIALVAIFF
                     FMSIMFPTIFAMGVKNMGKQTKRASSVMIMAIVGGAVMPYLMGAIADHYNTAVSYALP
                     MVCFAVVLIYAVKQRAKAAI"
     misc_feature    61147..62307
                     /locus_tag="Rahaq2_4622"
                     /note="Fucose permease [Carbohydrate transport and
                     metabolism]; Region: FucP; COG0738"
                     /db_xref="CDD:223809"
     misc_feature    61162..62304
                     /locus_tag="Rahaq2_4622"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(61204..61206,61213..61221,61225..61230,61279..61281,
                     61288..61293,61300..61302,61312..61317,61321..61326,
                     61471..61476,61483..61488,61495..61500,61507..61509,
                     61543..61548,61555..61560,61576..61578,61828..61830,
                     61837..61842,61849..61854,61861..61863,61906..61908,
                     61918..61920,61930..61932,61939..61941,61951..61953,
                     62089..62091,62098..62103,62110..62112,62122..62127,
                     62134..62136,62167..62172,62179..62184,62197..62199)
                     /locus_tag="Rahaq2_4622"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            62551..62631
                     /locus_tag="Rahaq2_4623"
                     /note="IMG reference gene:2506711647"
                     /pseudo
                     /db_xref="GeneID:11818132"
     gene            62963..63946
                     /locus_tag="Rahaq2_4624"
                     /note="IMG reference gene:2506711648"
                     /db_xref="GeneID:11818133"
     CDS             62963..63946
                     /locus_tag="Rahaq2_4624"
                     /note="PFAM: Domain of unknown function (DUF1852)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220359.1"
                     /db_xref="GI:379703985"
                     /db_xref="InterPro:IPR015004"
                     /db_xref="GeneID:11818133"
                     /translation="MNKKLTFTIKSIRFDENYNPSENTRITTNFANLARGEKRQENLR
                     NTLVMIDNRFNSLVHWDNPKKDRYSVELDIITAQLNIDAEGKADSFPVIEILKTTVVD
                     KKTNQRIEGIVGNNFSSYVRDYDFSVLLPEHNKNQPEFSLPDNFGELHGNIFKRFVKS
                     DAYKDNFTKAPVICLSVSSKNTYYRTGNKHPVLGVEYQQDELSLTDEYFAKMGLRARY
                     FMPENSVAPLAFYFSGDLLSDYTHLELISTISTMETFQKIYRPEIYNANSAAGIQYQP
                     SLNYQDYSLTRIVYDREERSHLAIEQGKFTEECFIKPYQNVLEQWSAHSAL"
     misc_feature    62963..63934
                     /locus_tag="Rahaq2_4624"
                     /note="Domain of unknown function (DUF1852); Region:
                     DUF1852; pfam08908"
                     /db_xref="CDD:149846"
     gene            63978..65009
                     /locus_tag="Rahaq2_4625"
                     /note="IMG reference gene:2506711649"
                     /db_xref="GeneID:11818134"
     CDS             63978..65009
                     /locus_tag="Rahaq2_4625"
                     /note="PFAM: Cobalamin-independent synthase, Catalytic
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase II (cobalamin-independent)"
                     /protein_id="YP_005220360.1"
                     /db_xref="GI:379703986"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR016456"
                     /db_xref="GeneID:11818134"
                     /translation="MKKLLPTSTAGSLPKPSWLAQPEVLWSPWKLQDQELIDGKLDAL
                     RLCLEDQQQAGIDIVSDGEQTRQHFVTTFIEHLEGVDFEKRETVKIRNRYEASVPTVV
                     GPVSRKKAVFVEDAKFLRQQTTQPIKWALPGPMTMIDTLYDNHYKSREKLAWEFAKIL
                     NEEARELEAAGVDIIQFDEPAFNVFFDEVNDWGIATLERAIEGLKCETAVHICYGYGI
                     KANTDWKKTLGTEWRQYEEIFPKLQKSNIDIISLECHHSHVPMELMELIRGKKVMVGA
                     IDVATNTIETPEEVAATLRKALQFVDADKLYPCTNCGMIPLPRGVARGKLDALSAGAE
                     IVRKELLAK"
     misc_feature    63993..64982
                     /locus_tag="Rahaq2_4625"
                     /note="CIMS - Cobalamine-independent methonine synthase,
                     or MetE, C-terminal domain_like. Many members have been
                     characterized as
                     5-methyltetrahydropteroyltriglutamate-homocysteine
                     methyltransferases, EC:2.1.1.14, mostly from bacteria and
                     plants. This enzyme...; Region: CIMS_C_terminal_like;
                     cd03311"
                     /db_xref="CDD:239427"
     misc_feature    order(64005..64013,64164..64166,64182..64184,64503..64505,
                     64509..64511,64608..64610,64614..64616,64911..64916)
                     /locus_tag="Rahaq2_4625"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239427"
     misc_feature    order(64254..64262,64395..64397,64515..64517)
                     /locus_tag="Rahaq2_4625"
                     /note="THF binding site; other site"
                     /db_xref="CDD:239427"
     misc_feature    order(64608..64610,64614..64616,64734..64736,64911..64913)
                     /locus_tag="Rahaq2_4625"
                     /note="zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:239427"
     gene            complement(65157..65885)
                     /locus_tag="Rahaq2_4626"
                     /note="IMG reference gene:2506711650"
                     /db_xref="GeneID:11818135"
     CDS             complement(65157..65885)
                     /locus_tag="Rahaq2_4626"
                     /note="PFAM: Peptide methionine sulfoxide reductase;
                     TIGRFAM: methionine-S-sulfoxide reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine-S-sulfoxide reductase"
                     /protein_id="YP_005220361.1"
                     /db_xref="GI:379703987"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="GeneID:11818135"
                     /translation="MKFASKNRRNFRHYSLIAGLMLASAFVFENNAWSWGAGAEPAVV
                     IPAPAKDEPAGTAHSETALFAGGCFWGIQGVFQHVKGVTSAVSGYTGGAAQTARYEQV
                     STGETGHAESVKVTFDPTQVTYGELLQIFFSVGHNPTELNRQGPDTGSQYRSAVFPLS
                     AAQAEVAKAYIAQLDASHSYNEPLVTKVESHAHFYPAEAYHQNFLNDNPDYPYIVVND
                     LPKIKYLKQYFPAQYREQPVLVKE"
     misc_feature    complement(65172..65708)
                     /locus_tag="Rahaq2_4626"
                     /note="methionine sulfoxide reductase A; Provisional;
                     Region: PRK13014"
                     /db_xref="CDD:237269"
     gene            complement(65904..66410)
                     /locus_tag="Rahaq2_4627"
                     /note="IMG reference gene:2506711651"
                     /db_xref="GeneID:11818136"
     CDS             complement(65904..66410)
                     /locus_tag="Rahaq2_4627"
                     /note="PFAM: SelR domain; TAT (twin-arginine
                     translocation) pathway signal sequence;
                     TIGRFAM: methionine-R-sulfoxide reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine-R-sulfoxide reductase"
                     /protein_id="YP_005220362.1"
                     /db_xref="GI:379703988"
                     /db_xref="InterPro:IPR002579"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR019546"
                     /db_xref="GeneID:11818136"
                     /translation="MINRRNFLLGSGAVSAAALMGLVPSLFSRSAGAQTTSEKFEITL
                     TDAQWHQRLSEDQYRILREAGTERPYSSPLNDEHRVGEFACAGCNLALFSSATKFDSH
                     TGWPSFWKPLGNAAQTSRDTSLGMVRDEVHCRRCGGHLGHVFDDGPQPTGLRYCMNGL
                     AMTFTPKA"
     misc_feature    complement(65910..66293)
                     /locus_tag="Rahaq2_4627"
                     /note="methionine sulfoxide reductase B; Provisional;
                     Region: PRK00222"
                     /db_xref="CDD:234692"
     gene            complement(67137..69176)
                     /locus_tag="Rahaq2_4628"
                     /note="IMG reference gene:2506711652"
                     /db_xref="GeneID:11818137"
     CDS             complement(67137..69176)
                     /locus_tag="Rahaq2_4628"
                     /note="PFAM: Glycosyl hydrolases family 31"
                     /codon_start=1
                     /transl_table=11
                     /product="family 31 glycosyl hydrolase, alpha-glucosidase"
                     /protein_id="YP_005220363.1"
                     /db_xref="GI:379703989"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11818137"
                     /translation="MSELIAEKNRILWHFDQQTLVIEPWGEHSLRVRATCRPELNDSL
                     WALLPAGAQPQAEISRSAETLTLRNGNITASVNIKGQLAFYNQRGELILEEFWRQRST
                     VGIGATEKSQDKYISALKMDAREFKAIPGGKHQLTVRFESRPDEKIYGMGQYQQNCLD
                     LKGCTLELAQRNSQASVPFMLSSLGYGMLWNNPAIGEVTFGKNITRWEAQVTEQMDYW
                     ITAGDTPADIMHQYGRATGTAPQMPEYATGFWQCKLRYRTQQEVLEVAREYKRRNLPV
                     SVIVIDFFHWPNQGTWCFDPVDWPDPKAMVAELKSLGIETMVSVWPTVDSRTDNYKEM
                     KSKGYLVNTDRGVSVNLDFLGNCTFFDATHPGARQFVWEKVKQNYYDLGIRTFWLDEA
                     EPEYRAYDFDNYRYHLGPVLEVGNIYPQKFAQGFYDGLQQEGENEIVNLVRCAWAGSQ
                     RYGVLAWSGDIHSSFHALRNQIAAGLNMGLAGIPWWTTDIGGFQGGNVNDPAFQELLI
                     RWFQWGVFCPVMRLHGYREPQIQPPEPWRDGIAQCNSGAANEVWSYGEENYQLMKNGL
                     FLREKLRPYISRVMQEAHEKGDPVMRTMFYQYPAQAESWQVEDQYMLGADILVAPVLY
                     AGQREREVWLPAGETWVALNGERYEGGRTITVATPMSEIPVFVREGADSTARAIL"
     misc_feature    complement(68583..68744)
                     /locus_tag="Rahaq2_4628"
                     /note="Galactose mutarotase-like; Region: Gal_mutarotas_2;
                     pfam13802"
                     /db_xref="CDD:258085"
     misc_feature    complement(67164..68525)
                     /locus_tag="Rahaq2_4628"
                     /note="Glycosyl hydrolases family 31; Region:
                     Glyco_hydro_31; pfam01055"
                     /db_xref="CDD:250327"
     misc_feature    complement(67488..68468)
                     /locus_tag="Rahaq2_4628"
                     /note="XylS is a glycosyl hydrolase family 31 (GH31)
                     alpha-xylosidase found in prokaryotes, eukaryotes, and
                     archaea, that catalyzes the release of alpha-xylose from
                     the non-reducing terminal side of the alpha-xyloside
                     substrate. XylS has been characterized in...; Region:
                     GH31_xylosidase_XylS; cd06591"
                     /db_xref="CDD:133122"
     misc_feature    complement(order(67608..67610,67698..67700,67797..67799,
                     67806..67808,67848..67850,68007..68009,68331..68333))
                     /locus_tag="Rahaq2_4628"
                     /note="putative active site [active]"
                     /db_xref="CDD:133122"
     misc_feature    complement(order(67797..67799,68007..68009))
                     /locus_tag="Rahaq2_4628"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:133122"
     gene            complement(69173..70552)
                     /locus_tag="Rahaq2_4629"
                     /note="IMG reference gene:2506711653"
                     /db_xref="GeneID:11818138"
     CDS             complement(69173..70552)
                     /locus_tag="Rahaq2_4629"
                     /note="TIGRFAM: sugar (Glycoside-Pentoside-Hexuronide)
                     transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside/pentoside/hexuronide transporter"
                     /protein_id="YP_005220364.1"
                     /db_xref="GI:379703990"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="GeneID:11818138"
                     /translation="MTAKLSVKEKISYGLGDMASHIGLDNVIIFLTFYYTDVVGLPAV
                     FVGTMFLVARVADAIVDPAMGLIADRTQTRFGKFRPYILWLALPFGASCLLVYAVPES
                     LTLGGKMVYASVTYCVMMLMYTAINIPYCSMGAIITPDNSQRISLQSYRFFLATLGGA
                     MSTFLMMPLAEMMGGGNKLDGYFGAMAIMASIAVVMFLLCFLNTKERISAPPTHENFL
                     SDLRDLVRNDQWRVVAALIFFNISFGVVRLGAMMYYVTYYLGNASYFMWLLAAHIVGK
                     SLGSLLVKPLTRNRSKLAAFTLCAILTGALSAAIFFVPAWISLLVGMTLLVSTFYQVT
                     TTLMWVMMSDVVDYGEYKQGKRMDGTVFSTLLAILKMGMAVSGAVVGWTLGMSGYVPH
                     AAQQNTVAMLSIIALFSLVPGILSMFSALSMRWYKLNDATMKQINQSKISREHEPEPQ
                     ATLHTQESA"
     misc_feature    complement(69245..70540)
                     /locus_tag="Rahaq2_4629"
                     /note="putative symporter YagG; Provisional; Region:
                     PRK09669; cl15392"
                     /db_xref="CDD:265685"
     misc_feature    complement(69263..70525)
                     /locus_tag="Rahaq2_4629"
                     /note="MFS/sugar transport protein; Region: MFS_2;
                     pfam13347"
                     /db_xref="CDD:257676"
     gene            70919..71401
                     /locus_tag="Rahaq2_4630"
                     /note="IMG reference gene:2506711654"
                     /db_xref="GeneID:11818139"
     CDS             70919..71401
                     /locus_tag="Rahaq2_4630"
                     /note="PFAM: Protein of unknown function (DUF796);
                     TIGRFAM: type VI secretion system effector, Hcp1 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="YP_005220365.1"
                     /db_xref="GI:379703991"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="GeneID:11818139"
                     /translation="MAIPAYLWLKDDGGADIKGSVDVNGREGSIEVLGFGHGLFLPTD
                     NNTGKITGTRVHSALTFEKEFDSSSPYLYKAVAKGQTLKSAEIRWYRINDAGQEAEYF
                     NMLMENVKVVSVCPLMHDCKNPATEKHNHLESISLRYERITWKHCDGNIIFSDAWNDR
                     "
     misc_feature    70922..71398
                     /locus_tag="Rahaq2_4630"
                     /note="type VI secretion system effector, Hcp1 family;
                     Region: VI_effect_Hcp1; TIGR03344"
                     /db_xref="CDD:213799"
     gene            71398..71873
                     /locus_tag="Rahaq2_4631"
                     /note="IMG reference gene:2506711655"
                     /db_xref="GeneID:11818140"
     CDS             join(71398..71577,71577..71873)
                     /locus_tag="Rahaq2_4631"
                     /artificial_location="low-quality sequence region"
                     /note="PFAM: Protein of unknown function (DUF2778);
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220366.1"
                     /db_xref="GI:379703992"
                     /db_xref="InterPro:IPR021225"
                     /db_xref="GeneID:11818140"
                     /translation="MIKCTFRLNGAGISTLSCPGIGFFPAYSGNPAQRNDPEQTAVKN
                     IGPLPPGRYYIVSRPGGGLMYKQRDWLKSIVSGSDHAAWFALFRDDSLIDDTTFIEDV
                     ERGNFRLHPAGYQGTSNGCITFTSKSHFDILREALLKTPTTMVSPTMKAFGTVQVY"
     misc_feature    join(71467..71577,71577..71843)
                     /locus_tag="Rahaq2_4631"
                     /note="Protein of unknown function (DUF2778); Region:
                     DUF2778; pfam10908"
                     /db_xref="CDD:256198"
     gene            71873..72115
                     /locus_tag="Rahaq2_4632"
                     /note="IMG reference gene:2506711656"
                     /db_xref="GeneID:11818141"
     CDS             71873..72115
                     /locus_tag="Rahaq2_4632"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220367.1"
                     /db_xref="GI:379703993"
                     /db_xref="GeneID:11818141"
                     /translation="MKPYQYVLIWMAGSASFVVILVTIFALIPENIAYSLLTEKTGFI
                     TEESWANIFMTFIHLTSFLLNISLIWLVAFLLKKKK"
     gene            72164..72490
                     /locus_tag="Rahaq2_4633"
                     /note="IMG reference gene:2506711657"
                     /db_xref="GeneID:11818142"
     CDS             72164..72490
                     /locus_tag="Rahaq2_4633"
                     /note="PFAM: Protein of unknown function (DUF1493)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220368.1"
                     /db_xref="GI:379703994"
                     /db_xref="InterPro:IPR010862"
                     /db_xref="GeneID:11818142"
                     /translation="MVNNQDVIDWYNLGWNKTGKWPVTIDTSLTTGRYVWVWETGEEI
                     MTSYFKTFGVDTEGFNFLKYWPDEKGMIPNFLLPKSCRVKYIEPAPLTLRMLAESARA
                     GKWLYD"
     misc_feature    <72287..72487
                     /locus_tag="Rahaq2_4633"
                     /note="Protein of unknown function (DUF1493); Region:
                     DUF1493; pfam07377"
                     /db_xref="CDD:254176"
     gene            72759..73292
                     /locus_tag="Rahaq2_4634"
                     /note="IMG reference gene:2506711658"
                     /db_xref="GeneID:11818143"
     CDS             72759..73292
                     /locus_tag="Rahaq2_4634"
                     /note="PFAM: NUDIX domain;
                     TIGRFAM: isopentenyl-diphosphate delta-isomerase, type 1"
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl-diphosphate delta-isomerase"
                     /protein_id="YP_005220369.1"
                     /db_xref="GI:379703995"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR011876"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="GeneID:11818143"
                     /translation="MIEEVVLLDVKNQPAGTMDKALVHTDQTPLHLAFSCYIHNDRGE
                     ILLTRRALSKVAWPGVWTNSVCGHPLPGESLQAAVYRRCQYELGLSVEHITSLVDEFQ
                     YRATDASGIVENEFCPIFAAFTRQPPAPRDSEVMDYQWVKPEDLQNSVRATPWAFSPW
                     MVLQLGQITQENLSLLG"
     misc_feature    72759..73262
                     /locus_tag="Rahaq2_4634"
                     /note="Isopentenyldiphosphate isomerase [Lipid
                     metabolism]; Region: Idi; COG1443"
                     /db_xref="CDD:224360"
     misc_feature    72765..73253
                     /locus_tag="Rahaq2_4634"
                     /note="Isopentenyl diphosphate (IPP) isomerase, a member
                     of the Nudix hydrolase superfamily, is a key enzyme in the
                     isoprenoid biosynthetic pathway. Isoprenoids comprise a
                     large family of natural products including sterols,
                     carotenoids, dolichols and prenylated...; Region:
                     IPP_Isomerase; cd02885"
                     /db_xref="CDD:239218"
     misc_feature    order(72816..72818,72828..72830,72849..72851,72861..72863,
                     72906..72908,72918..72920,72954..72956,72960..72962,
                     73002..73004,73014..73016,73065..73067,73095..73097,
                     73101..73103,73236..73238)
                     /locus_tag="Rahaq2_4634"
                     /note="active site"
                     /db_xref="CDD:239218"
     misc_feature    order(72828..72830,72849..72851,72960..72962,73095..73097,
                     73101..73103)
                     /locus_tag="Rahaq2_4634"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239218"
     misc_feature    72957..73025
                     /locus_tag="Rahaq2_4634"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239218"
     gene            complement(73245..73781)
                     /locus_tag="Rahaq2_4635"
                     /note="IMG reference gene:2506711659"
                     /db_xref="GeneID:11818144"
     CDS             complement(73245..73781)
                     /locus_tag="Rahaq2_4635"
                     /note="PFAM: Shikimate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase-like kinase"
                     /protein_id="YP_005220370.1"
                     /db_xref="GI:379703996"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="GeneID:11818144"
                     /translation="MKINVIGTSGSGKSTLARNISQKLNIPYIELDALFWKPDWQGTP
                     DDEFFARLAGKLAASDGWVIDGNYKRTQPVKWREIDMIVWVDYSFGRTLYQAVKRVFI
                     RAWGQKEIWAGTGNRESFRKSFFSRDSIILWTLKTYAKNRRYYQALFNDPDWQHVRFV
                     RLKSPQQTQVFLRNLTEL"
     misc_feature    complement(73257..73778)
                     /locus_tag="Rahaq2_4635"
                     /note="AAA domain; Region: AAA_17; cl19128"
                     /db_xref="CDD:267481"
     gene            74287..74544
                     /locus_tag="Rahaq2_4636"
                     /note="IMG reference gene:2506711660"
                     /db_xref="GeneID:11818145"
     CDS             74287..74544
                     /locus_tag="Rahaq2_4636"
                     /note="PFAM: Biofilm development protein YmgB/AriR"
                     /codon_start=1
                     /transl_table=11
                     /product="Biofilm development protein YmgB/AriR"
                     /protein_id="YP_005220371.1"
                     /db_xref="GI:379703997"
                     /db_xref="GeneID:11818145"
                     /translation="MQIEAEQTVTEISDYLNARETPTLSEVEILGTLVSGLLASHYPV
                     SNKAIIQGLVRQLEQETNISNQQACRNLLELVLLSTQDDVI"
     misc_feature    74356..74535
                     /locus_tag="Rahaq2_4636"
                     /note="Biofilm development protein YmgB/AriR; Region:
                     YmgB; pfam10798"
                     /db_xref="CDD:151248"
     gene            complement(74604..75461)
                     /locus_tag="Rahaq2_4637"
                     /note="IMG reference gene:2506711661"
                     /db_xref="GeneID:11818146"
     CDS             complement(74604..75461)
                     /locus_tag="Rahaq2_4637"
                     /note="PFAM: NmrA-like family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nucleoside-diphosphate sugar epimerase"
                     /protein_id="YP_005220372.1"
                     /db_xref="GI:379703998"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11818146"
                     /translation="MIAITGATGQLGRLVIAALLKKVPANQIIAAVRNPQKAQDLADL
                     GIEVRQADYSQPATLDSAFKGVEKLLLISSSEVGQREAQHNAVIDAAKRAGVKLLAYT
                     SLLHADKSPLGLGVEHRATEKALSESGVPFVLLRNGWYTENYAASIAPALAHNAFIGS
                     VGEGKISSAARQDYAEAAAAVLTQENQAGKIYELAGDDAYTLTEFTAEIARQSGKKVD
                     YINLPEAEFAKALLGAGLPEGLANMLADSDAGAGKGGLFDDSHTLSKLIGRPTTPVKD
                     VIAATLKTL"
     misc_feature    complement(74655..75461)
                     /locus_tag="Rahaq2_4637"
                     /note="Predicted nucleoside-diphosphate-sugar epimerases
                     [Cell envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: COG0702"
                     /db_xref="CDD:223774"
     misc_feature    complement(74643..75458)
                     /locus_tag="Rahaq2_4637"
                     /note="triphenylmethane reductase (TMR)-like proteins,
                     NMRa-like, atypical (a) SDRs; Region: TMR_SDR_a; cd05269"
                     /db_xref="CDD:187578"
     misc_feature    complement(order(74949..74951,75042..75050,75237..75248,
                     75300..75311,75351..75353,75360..75365,75429..75440,
                     75444..75446))
                     /locus_tag="Rahaq2_4637"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187578"
     gene            75576..75992
                     /locus_tag="Rahaq2_4638"
                     /note="IMG reference gene:2506711662"
                     /db_xref="GeneID:11818147"
     CDS             75576..75992
                     /locus_tag="Rahaq2_4638"
                     /note="PFAM: HxlR-like helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005220373.1"
                     /db_xref="GI:379703999"
                     /db_xref="InterPro:IPR002577"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818147"
                     /translation="MKIISSEQPAERLPLSEQIRRGEVLNPNCPSREILRHITSRWGL
                     LILIALSDNTLRFSELRRKVGGVSEKMLAQTLQSLEEDGFIDRRSYPVVPPHVEYSLT
                     PLGIEVKDQVAGLADWLESNLHRVMKQRSLRIAGTQ"
     misc_feature    75651..75977
                     /locus_tag="Rahaq2_4638"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1733"
                     /db_xref="CDD:224647"
     misc_feature    order(75678..75683,75687..75689,75696..75698,75705..75710,
                     75717..75722,75729..75731,75822..75824)
                     /locus_tag="Rahaq2_4638"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(75681..75686,75696..75704,75741..75749,75777..75788,
                     75792..75797,75804..75809,75813..75818,75834..75839,
                     75849..75851,75864..75872)
                     /locus_tag="Rahaq2_4638"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(75741..75743,75750..75752)
                     /locus_tag="Rahaq2_4638"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            76111..76677
                     /locus_tag="Rahaq2_4639"
                     /note="IMG reference gene:2506711663"
                     /db_xref="GeneID:11818148"
     CDS             76111..76677
                     /locus_tag="Rahaq2_4639"
                     /note="PFAM: Antibiotic biosynthesis monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220374.1"
                     /db_xref="GI:379704000"
                     /db_xref="InterPro:IPR007138"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="GeneID:11818148"
                     /translation="MSPSQTHKQHVTLVITHKIAPASEAQYEAWLNKIMPQASTFPGH
                     LGVNVIRPSRSGDAYTILVRFDTLENLNAWHNSDLRKQLVAEVSPLLLQNDNTEVRPG
                     AEFWFTPPNANVRPPARWKQYLLTLGVIYPSTHLVPWFWGQFLPQLKGTEGGHLLNDA
                     TVVGLVVFLWMPIVTRVFHSWLTRSSAQ"
     misc_feature    76111..76668
                     /locus_tag="Rahaq2_4639"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3224"
                     /db_xref="CDD:225765"
     gene            76692..78572
                     /locus_tag="Rahaq2_4640"
                     /note="IMG reference gene:2506711664"
                     /db_xref="GeneID:11818149"
     CDS             76692..78572
                     /locus_tag="Rahaq2_4640"
                     /note="PFAM: Amidohydrolase family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative TIM-barrel fold metal-dependent
                     hydrolase"
                     /protein_id="YP_005220375.1"
                     /db_xref="GI:379704001"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR013108"
                     /db_xref="GeneID:11818149"
                     /translation="MNSINNVASLILLNGKFHTVDREKPLANAVAIKDGKFLAVGTEN
                     EVMQFADAQTQVVDLHGHTAIPGLNDSHLHLIRGGLNYNLELRWEGVPSLADALRMLK
                     EQALRTPSPQWVRVVGGWTEFQFAERRMPTLDEINQAAPDTPVFILHLYDRALLNRAA
                     LNVVGYTKDTPNPPGGEIQRDSNGNPTGMLIAKPNAMILYSTLAKGPKLPLEQQVNST
                     RQFMRELNRLGLTSAIDAGGGFQNYPEDYQIIDELHQKNQLTVRIAYNLFTQRPQHEL
                     EDFELWTDMLKPGQGTDFYRHNGAGEMLVFSAADFEDFLQPRPDLPPGTEVELERVVR
                     HLVEHRWPFRLHATYDESISRMLDVFEKVNSDIPFNGLHWFFDHAETITERNIERVKA
                     LGGGIAVQHRMAFQGEYFADRYGIEATKHTPPVAKMLSAGVPVGLGTDATRVASYNPW
                     TALYWLVSGRTVGGMAMYDDDARIDRETALMLWTQGSSWFSSEQGKKGQIKIGQLADL
                     AVLSEDFFSVPEERIKGIESVMTVVDGKVVYAAGSFSPLAPPAIPVLPDWSPVTTVPG
                     HYRSAPPQGAARVGLVRQGHQCVGPCGVHKHSHDIARGSDVPVSDDNAFWGALGCSCF
                     SF"
     misc_feature    76710..78317
                     /locus_tag="Rahaq2_4640"
                     /note="Predicted metal-dependent hydrolase with the
                     TIM-barrel fold [General function prediction only];
                     Region: COG1574"
                     /db_xref="CDD:224490"
     misc_feature    76776..78221
                     /locus_tag="Rahaq2_4640"
                     /note="YtcJ_like metal dependent amidohydrolases. YtcJ is
                     a Bacillus subtilis ORF of unknown function. The
                     Arabidopsis homolog LAF3 has been identified as a factor
                     required for photochrome A signalling; Region: YtcJ_like;
                     cd01300"
                     /db_xref="CDD:238625"
     misc_feature    order(76905..76907,76911..76913,77727..77729,77823..77825,
                     78009..78011)
                     /locus_tag="Rahaq2_4640"
                     /note="active site"
                     /db_xref="CDD:238625"
     gene            78699..79607
                     /locus_tag="Rahaq2_4641"
                     /note="IMG reference gene:2506711665"
                     /db_xref="GeneID:11818150"
     CDS             78699..79607
                     /locus_tag="Rahaq2_4641"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220376.1"
                     /db_xref="GI:379704002"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818150"
                     /translation="MMRDLPPTTTLRTFEVVTRHTTFTSAAEELFITQSAVSHQLKKL
                     EEIWGLQLFQRGKTLSLTPAGAALAPLVREFFSKLETTLADLREQKGRVRLRVSTTYS
                     FALKWLLPRLPELARLHPEILVTLESTDKAIHFASADSDVAIRFGHGNYAALHTEFMF
                     REQLFPVASPAFLASFGTPSEPAELLRFPLLTRDGADLVPKWDAWFKQVGVNTDVLHE
                     SVRFADTNMTIEAALLGQGIALARSGHVEKEIRDGSLVRLFDVNFPSPAAYYFVCPEG
                     IESQPHIMEFRNWLLAESQQAQLSYR"
     misc_feature    78699..79592
                     /locus_tag="Rahaq2_4641"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    78729..78893
                     /locus_tag="Rahaq2_4641"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    78978..79568
                     /locus_tag="Rahaq2_4641"
                     /note="The C-terminal substrate domain of LysR-type GcdR,
                     TrPI, HvR and beta-lactamase regulators, and that of other
                     closely related homologs; contains the type 2 periplasmic
                     binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
                     cd08432"
                     /db_xref="CDD:176123"
     misc_feature    order(78978..79001,79005..79058,79062..79082)
                     /locus_tag="Rahaq2_4641"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176123"
     misc_feature    order(78996..79001,79005..79007,79365..79373,79431..79433)
                     /locus_tag="Rahaq2_4641"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176123"
     gene            79683..80510
                     /locus_tag="Rahaq2_4642"
                     /note="IMG reference gene:2506711666"
                     /db_xref="GeneID:11818151"
     CDS             79683..80510
                     /locus_tag="Rahaq2_4642"
                     /note="PFAM: EamA-like transporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220377.1"
                     /db_xref="GI:379704003"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:11818151"
                     /translation="MPAHIILLTLLAALLHASWNALLRGGTDRLWSMTIMCVAIALSC
                     VAIAPFLPLPERESVKYAMLSALLHVGYNLCLIRSYQSGDLGQTYPIARGSSPLMVTC
                     GAALFAGEKIAFNTFVGIALISGGILMLALGRRRPAMPGLKYTLATGAFIAAYSVVDG
                     IGVRVSGNSFSYTVWMSMLWGALMPALYIILRDTKSLLRWRPGLLSAAAGGVVSLLAY
                     GMIIYAMTAAPMGAVSALRETSVLFAAVLGYLFLGETLTLRKMLACAVIATGTLLIG"
     misc_feature    79734..80504
                     /locus_tag="Rahaq2_4642"
                     /note="phosphonate utilization associated putative
                     membrane protein; Region: phn_DUF6; TIGR03340"
                     /db_xref="CDD:234171"
     misc_feature    <79848..80081
                     /locus_tag="Rahaq2_4642"
                     /note="EamA-like transporter family; Region: EamA;
                     cl17759"
                     /db_xref="CDD:266818"
     misc_feature    80139..80504
                     /locus_tag="Rahaq2_4642"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            80531..81421
                     /locus_tag="Rahaq2_4643"
                     /note="IMG reference gene:2506711667"
                     /db_xref="GeneID:11818152"
     CDS             80531..81421
                     /locus_tag="Rahaq2_4643"
                     /note="PFAM: Ketopantoate reductase PanE/ApbA;
                     Ketopantoate reductase PanE/ApbA C terminal;
                     TIGRFAM: 2-dehydropantoate 2-reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="YP_005220378.1"
                     /db_xref="GI:379704004"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11818152"
                     /translation="MSDRPATALLGPGAIGTTIAAVLHEVNRTPLLCGRTAHPQLILH
                     HDDGEIVVPGPVLNNPSAADRPFGLVFVAVKTTQVADSADWLAALCDENTIVCALQNG
                     VEQKTLLEPYVNGATVVPSVVWFPAQREPDASVRLRAKPRLTLPDVPQAKRIADALSG
                     TRCAVELSSDFLSIAWRKLLQNAVAGLMVLANRRAGMFSRGDITQLALAYLHECLTVA
                     RAEGAVLSDSVAQEIVDGFHRAPADLGTSILADRQANRPLEWDIRNGVVQRSGHAKGI
                     PTPVSDILVPLLAAGSEGPG"
     misc_feature    80552..81418
                     /locus_tag="Rahaq2_4643"
                     /note="2-dehydropantoate 2-reductase; Provisional; Region:
                     PRK12921"
                     /db_xref="CDD:183829"
     misc_feature    80552..80980
                     /locus_tag="Rahaq2_4643"
                     /note="Ketopantoate reductase PanE/ApbA; Region: ApbA;
                     pfam02558"
                     /db_xref="CDD:251374"
     misc_feature    81038..81400
                     /locus_tag="Rahaq2_4643"
                     /note="Ketopantoate reductase PanE/ApbA C terminal;
                     Region: ApbA_C; pfam08546"
                     /db_xref="CDD:254871"
     gene            complement(81486..82244)
                     /locus_tag="Rahaq2_4644"
                     /note="IMG reference gene:2506711668"
                     /db_xref="GeneID:11818153"
     CDS             complement(81486..82244)
                     /locus_tag="Rahaq2_4644"
                     /note="PFAM: YdjC-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220379.1"
                     /db_xref="GI:379704005"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR006879"
                     /db_xref="InterPro:IPR022948"
                     /db_xref="GeneID:11818153"
                     /translation="MDKLLIVNADDFGLCKAQNYGIIEAFNNGVVTSTTAMVNMATTE
                     HAAVLSAAHPELAVGMHFVLTLGRPLSPMPGLVRDGELGKWIWEMAEQGTLPLDEIAQ
                     ELQCQFDRFVAVFGRLPTHLDSHHHVHMFPQIFPIVEAFAKDQGIPVRIDRNEIRRRD
                     IALRGAKSTDGFDSSFYGEAISDALFLQTLDNATQRGDRTLEIMTHPSFIDNTILASK
                     YCTPRLAELDVLTSASLKAAIAERGFRLGSFKDL"
     misc_feature    complement(81537..82235)
                     /locus_tag="Rahaq2_4644"
                     /note="Enterococcus faecalis EF3048 and similar proteins;
                     Region: YdjC_EF3048_like; cd10803"
                     /db_xref="CDD:212114"
     misc_feature    complement(order(81576..81578,81627..81629,81870..81887,
                     82062..82070,82206..82217))
                     /locus_tag="Rahaq2_4644"
                     /note="YdjC motif; other site"
                     /db_xref="CDD:212114"
     misc_feature    complement(order(81576..81578,81627..81629,81870..81872,
                     81876..81878,81882..81884,82062..82064,82068..82070,
                     82206..82208,82212..82217))
                     /locus_tag="Rahaq2_4644"
                     /note="putative active site [active]"
                     /db_xref="CDD:212114"
     misc_feature    complement(order(81870..81872,82062..82064,82212..82217))
                     /locus_tag="Rahaq2_4644"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212114"
     misc_feature    complement(order(81906..81908,81915..81917,81939..81941,
                     82002..82004,82008..82013,82110..82124,82131..82133,
                     82197..82199))
                     /locus_tag="Rahaq2_4644"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212114"
     gene            complement(82290..83633)
                     /locus_tag="Rahaq2_4645"
                     /note="IMG reference gene:2506711669"
                     /db_xref="GeneID:11818154"
     CDS             complement(82290..83633)
                     /locus_tag="Rahaq2_4645"
                     /note="PFAM: Family 4 glycosyl hydrolase; Family 4
                     glycosyl hydrolase C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="family 4 glycosyl hydrolase,
                     alpha-galactosidase/6-phospho-beta-glucosidase"
                     /protein_id="YP_005220380.1"
                     /db_xref="GI:379704006"
                     /db_xref="InterPro:IPR001088"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019802"
                     /db_xref="InterPro:IPR022616"
                     /db_xref="GeneID:11818154"
                     /translation="MRNKLKVVTIGGGSSYTPELLEGFIKRYDELPITELWLVDVEAG
                     KEKQDIIFNLCQRMVERAGVPIVMHKTLDRREALADADFVTTQLRVGQLKARELDERI
                     PLSHGYLGQETNGAGGLFKGLRTIPVIFDIIRDVEEICPDAWVINFTNPAGMVTEAVF
                     RHTKFKKFIGVCNIPVGMKMFIQDVLKLTPQEELSIDLFGLNHMVFIKDVLVNGESRF
                     AELLDGVASGTLTAGSVKNIFDLPFSEGLIRSLNLLPCSYLLYYFKQKEMLAIEMGEF
                     YKGGARATVVQKVEKQLFDLYKNPDLNVKPKELELRGGAYYSDAACEVISAIYNDKQT
                     EQYVNFPHNGHIDNIPADWAVEMTCTIGRDGAKPHPRITHFDEKVLGLIYTIKGFEIA
                     ASEAALSGEFNDVLLAMNLSPLIHSDKDAEILAREMLLAHEKLLPNFAETIATLK"
     misc_feature    complement(82314..83624)
                     /locus_tag="Rahaq2_4645"
                     /note="Alpha-galactosidases/6-phospho-beta-glucosidases,
                     family 4 of glycosyl hydrolases [Carbohydrate transport
                     and metabolism]; Region: CelF; COG1486"
                     /db_xref="CDD:224403"
     misc_feature    complement(82326..83621)
                     /locus_tag="Rahaq2_4645"
                     /note="Glycoside Hydrolases Family 4;
                     Phospho-beta-glucosidase; Region: GH4_P_beta_glucosidase;
                     cd05296"
                     /db_xref="CDD:133432"
     misc_feature    complement(order(82683..82685,82698..82700,82764..82766,
                     83184..83186,83190..83192,83238..83240,83298..83300,
                     83367..83375,83493..83495,83511..83516,83586..83588,
                     83592..83597))
                     /locus_tag="Rahaq2_4645"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:133432"
     misc_feature    complement(order(82683..82685,82695..82700,82788..82790,
                     82860..82862,83025..83027,83115..83117,83184..83186,
                     83298..83300,83346..83348))
                     /locus_tag="Rahaq2_4645"
                     /note="sugar binding site [chemical binding]; other site"
                     /db_xref="CDD:133432"
     misc_feature    complement(order(83025..83027,83118..83120))
                     /locus_tag="Rahaq2_4645"
                     /note="divalent metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133432"
     misc_feature    complement(order(82524..82535,82539..82541,82545..82550,
                     82605..82607,82641..82643,82992..82994,83001..83003,
                     83049..83051,83058..83060))
                     /locus_tag="Rahaq2_4645"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133432"
     misc_feature    complement(order(82368..82370,82374..82376,82380..82385,
                     82413..82418,82425..82427,82449..82451,82470..82472,
                     82482..82484,82503..82508,82836..82841,82845..82847,
                     82881..82889,82896..82898,82902..82904))
                     /locus_tag="Rahaq2_4645"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133432"
     gene            complement(83694..84530)
                     /locus_tag="Rahaq2_4646"
                     /note="IMG reference gene:2506711670"
                     /db_xref="GeneID:11818155"
     CDS             complement(83694..84530)
                     /locus_tag="Rahaq2_4646"
                     /note="PFAM: Cupin domain; Bacterial regulatory
                     helix-turn-helix proteins, AraC family"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding domain-containing protein"
                     /protein_id="YP_005220381.1"
                     /db_xref="GI:379704007"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="GeneID:11818155"
                     /translation="MQPPVLSMEIKTARENQLFDGQNFHMFIYNKVESISGLHEHDYY
                     EFTVVLTGRYYQNVNGKRVLLERGDFVFIPLGSNHQSFYEFGATRILNVGISKAFFEQ
                     HYLSLLPPRFVASQVYQIKTEFLAYIESVIASLNFRNGEFNEFLEMVTFYIVNRLHHH
                     RESEITTDAPGWLKNAIEKMHDKAQFGDKALTNMVALSGKSQEYLSRATQRHYGKTPM
                     QIINEIRIDFAKKQLEITNYSVTDIAFESGYSSPSMFIKNFKKLTSFTPNHYRKKLCS
                     IN"
     misc_feature    complement(83697..84530)
                     /locus_tag="Rahaq2_4646"
                     /note="DNA-binding transcriptional regulator ChbR;
                     Provisional; Region: PRK10296"
                     /db_xref="CDD:182362"
     misc_feature    complement(<84291..84425)
                     /locus_tag="Rahaq2_4646"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     misc_feature    complement(83715..83825)
                     /locus_tag="Rahaq2_4646"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(84545..84892)
                     /locus_tag="Rahaq2_4647"
                     /note="IMG reference gene:2506711671"
                     /db_xref="GeneID:11818156"
     CDS             complement(84545..84892)
                     /locus_tag="Rahaq2_4647"
                     /note="PFAM: PTS system, Lactose/Cellobiose specific IIA
                     subunit;
                     TIGRFAM: phosphotransferase system enzyme II,
                     lactose-specific, factor III"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIA"
                     /protein_id="YP_005220382.1"
                     /db_xref="GI:379704008"
                     /db_xref="InterPro:IPR003188"
                     /db_xref="GeneID:11818156"
                     /translation="MMDLDSIVETESEMQDLEEVVMGLIINSGQARSLAYAALRKAKE
                     GDFEQAYAVMAQSKMALNEAHLVQTKLIEDDQGEGKTKVSLVLVHAQDHLMTSMLARE
                     LIAELIELHEKIK"
     misc_feature    complement(84554..84844)
                     /locus_tag="Rahaq2_4647"
                     /note="PTS_IIA, PTS system, lactose/cellobiose specific
                     IIA subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_lac;
                     cd00215"
                     /db_xref="CDD:238133"
     misc_feature    complement(order(84608..84610,84629..84634,84680..84682,
                     84842..84844))
                     /locus_tag="Rahaq2_4647"
                     /note="methionine cluster; other site"
                     /db_xref="CDD:238133"
     misc_feature    complement(order(84614..84622,84626..84628,84797..84799))
                     /locus_tag="Rahaq2_4647"
                     /note="active site"
                     /db_xref="CDD:238133"
     misc_feature    complement(84626..84628)
                     /locus_tag="Rahaq2_4647"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238133"
     misc_feature    complement(84617..84619)
                     /locus_tag="Rahaq2_4647"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238133"
     gene            complement(84956..86314)
                     /locus_tag="Rahaq2_4648"
                     /note="IMG reference gene:2506711672"
                     /db_xref="GeneID:11818157"
     CDS             complement(84956..86314)
                     /locus_tag="Rahaq2_4648"
                     /note="PFAM: Phosphotransferase system, EIIC;
                     TIGRFAM: phosphotransferase system, cellobiose specific,
                     IIC component; PTS system, lactose/cellobiose family IIC
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIC"
                     /protein_id="YP_005220383.1"
                     /db_xref="GI:379704009"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR004501"
                     /db_xref="GeneID:11818157"
                     /translation="MSKAIDSLEKILLPFAVKIGKQAHINAIKNGFIKLMPLTLAGAM
                     FVLINNVFLNFGAGSFFYSLGVRLDPSTIDTLTGLKTIGINVYNGTLGIMSLMAPFFI
                     GMALAEERKVDPLSAGLLAVAAFMTVTPYSVGEAYAVGANWLGGANIISGMVIGLVVA
                     EMFTFVIRRNWVITLPASVPSSVSRSFSALIPGFIILFIFGVISWLLGLYGHNFHQII
                     MDSISKPLAAMGSVVGWAYVIFNSLLWFFGVHGSLALTALDNGIMTPWALENIALYTE
                     YGSVSAAVEAGKTFHFWAKPMLDSYIMLGGSGATLGLIIAIFIASRRADHRQVAKLAL
                     PSGIFQINEPILFGLPIIMNPVMFIPFVLVQPILAAITLAAYSMGIIPPVTNLAPWTM
                     PTGLGAFFNSNGSIAALLVALFNLGIATLVYMPFVILSNKAQTIIEEEESEEDIAAAL
                     KF"
     misc_feature    complement(85010..86314)
                     /locus_tag="Rahaq2_4648"
                     /note="PTS system N,N'-diacetylchitobiose-specific
                     transporter subunit IIC; Provisional; Region: PRK10297"
                     /db_xref="CDD:182363"
     gene            complement(86437..86757)
                     /locus_tag="Rahaq2_4649"
                     /note="IMG reference gene:2506711673"
                     /db_xref="GeneID:11818158"
     CDS             complement(86437..86757)
                     /locus_tag="Rahaq2_4649"
                     /note="PFAM: PTS system, Lactose/Cellobiose specific IIB
                     subunit;
                     TIGRFAM: PTS system, lactose/cellobiose family IIB
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system cellobiose-specific transporter
                     subunit IIB"
                     /protein_id="YP_005220384.1"
                     /db_xref="GI:379704010"
                     /db_xref="InterPro:IPR003501"
                     /db_xref="InterPro:IPR013012"
                     /db_xref="GeneID:11818158"
                     /translation="MEKKVIYLFCSAGMSTSLLVSKMKVQAEKYEVPVIIEAFPETLA
                     AEKGAGADVILLGPQIAYMLDEIKKVLPGKPVEVIDSGLYGKIDGLGVLKAAVAAIKK
                     AAAQ"
     misc_feature    complement(86479..86742)
                     /locus_tag="Rahaq2_4649"
                     /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
                     II (EII) of the N,N-diacetylchitobiose-specific and
                     lichenan-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In these systems, EII is
                     either a lichenan- or an N; Region:
                     PTS_IIB_chitobiose_lichenan; cd05564"
                     /db_xref="CDD:99906"
     misc_feature    complement(order(86506..86508,86581..86583,86710..86715,
                     86719..86724,86728..86730))
                     /locus_tag="Rahaq2_4649"
                     /note="active site"
                     /db_xref="CDD:99906"
     misc_feature    complement(86710..86730)
                     /locus_tag="Rahaq2_4649"
                     /note="P-loop; other site"
                     /db_xref="CDD:99906"
     misc_feature    complement(86728..86730)
                     /locus_tag="Rahaq2_4649"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99906"
     gene            87104..88138
                     /locus_tag="Rahaq2_4650"
                     /note="IMG reference gene:2506711674"
                     /db_xref="GeneID:11818159"
     CDS             87104..88138
                     /locus_tag="Rahaq2_4650"
                     /note="PFAM: Bacterial regulatory proteins, lacI family;
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220385.1"
                     /db_xref="GI:379704011"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11818159"
                     /translation="MVNTLNNKINTQKGRSRTATLEDVAQAAGLSPMTVSRALNNPKV
                     VRPATIARVMEAVNSTGYIPNMLAGGLATRRTKLIAVVVPQINNNMFVDTVQAISDQL
                     AARGYHMLLCIVGYEPEDETDIVATLLSRRPDGIVLTGIHHTSELKRIILNANVPVVE
                     IWDLTPTPIDMLIGFSHEKVGNAIGDYFLGKGFTRFGFICASDRRAMVRKNGAISVLR
                     TLAGHDIKEVIVSRPANMEVGRHALRQLLATGERFDAIICSSDTLAQGAIMEAEAQGL
                     SVPDDFSVIGFADLNFAAHNRPAITTVSVEKWDLGIRAADMLADKIEGIAVEEPIVDM
                     GYRLVIRESA"
     misc_feature    87158..88132
                     /locus_tag="Rahaq2_4650"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    87170..87322
                     /locus_tag="Rahaq2_4650"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(87191..87205,87209..87214,87221..87223,87236..87241,
                     87248..87250,87287..87289,87296..87298,87305..87310,
                     87314..87319)
                     /locus_tag="Rahaq2_4650"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    87287..87316
                     /locus_tag="Rahaq2_4650"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    87335..88132
                     /locus_tag="Rahaq2_4650"
                     /note="Ligand-binding domain of DNA transcription
                     repressor GntR specific for gluconate, a member of the
                     LacI-GalR family of bacterial transcription regulators;
                     Region: PBP1_GntR; cd01575"
                     /db_xref="CDD:107260"
     misc_feature    order(87335..87337,87374..87382,87389..87394,87398..87403,
                     87422..87436,87440..87442,87473..87475,87482..87484,
                     87491..87499,87812..87814,87896..87898,87908..87910,
                     87917..87922)
                     /locus_tag="Rahaq2_4650"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107260"
     misc_feature    order(87371..87376,87383..87385,87518..87520,87587..87589,
                     87626..87628,87728..87730,87803..87805,87965..87967,
                     88016..88018)
                     /locus_tag="Rahaq2_4650"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107260"
     gene            88666..89391
                     /locus_tag="Rahaq2_4651"
                     /note="IMG reference gene:2506711675"
                     /db_xref="GeneID:11818160"
     CDS             88666..89391
                     /locus_tag="Rahaq2_4651"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220386.1"
                     /db_xref="GI:379704012"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:11818160"
                     /translation="MLLQKKTTRRKFLLGSLMALPVGTIMMKGMSAAQAAEMAAPDLL
                     DYKPIFFSADEWQFIMAAADRLIPAGGKGKAPGALETNVPIFIDQQMHGDFGEEIYMQ
                     GPFNVHAPATMGYQIPFRPQQIYKTGIRLANSWCQQNHQKAFHELADQDKDNVLTQLQ
                     KNGIHFADLGEENLVASQFFSELLSDTKHGYLADPIYGGNKGMKAWIAIGFPGARASF
                     TEWVKQHNVPYPLGPVSLQGARA"
     misc_feature    88819..89304
                     /locus_tag="Rahaq2_4651"
                     /note="Gluconate 2-dehydrogenase subunit 3; Region:
                     Gluconate_2-dh3; pfam13618"
                     /db_xref="CDD:257931"
     gene            89437..91206
                     /locus_tag="Rahaq2_4652"
                     /note="IMG reference gene:2506711676"
                     /db_xref="GeneID:11818161"
     CDS             89437..91206
                     /locus_tag="Rahaq2_4652"
                     /note="PFAM: GMC oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase-like flavoprotein"
                     /protein_id="YP_005220387.1"
                     /db_xref="GI:379704013"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="GeneID:11818161"
                     /translation="MAKVTKPEVDVVVVGLGWAGSLMSIELAMAGLTVRALERGGDRG
                     YEEFAYPKPADEYAYAVRNKVMATPAEAAVTVRYNMSETALPTRKWGAFAPGTGVGGS
                     GLHWTAVLIRPTPTDLKLKTYADEAYKPGILQEDMRIMDFPFSWDEIEPYYTKFEHIC
                     GQSGKTGNLRGQIMEGGDPFEGPRSEPYPLPALEDTLNSSMFAEVTKKMGYHPFPNPS
                     ACVSRAWTNPYGNQIAPCNYCGYCSKYPCLNYSKASPQTAVMDALKRMDNFSYEVHAN
                     VLKVELHDDKKTAKGVIYMDADGNECFQPAKIVVLSSFQFCNVRLMLLSGIGKPYNPI
                     TEEGAIGRNYAFLSNGGSTLFFKDKNFNPFATAGATGQMFNDISPGNFDGPSLGFIGG
                     AKIHSSQATGTPISTSLPKGTPAWGTGWKEGMEEWYGHSMKISITTTCQSYRDIYLDL
                     DPNYKDEYGYPLLRMTFDWKQNELKLQQYLKGIVGNITKELNPDSYSESFLPMDAHFD
                     LTKYVSTHNVGGAVMGDNPKTSALNKFLQSWDVHNVFVPGGNAFPQNFQANPTDTIGA
                     ITLMAAQAIKDQYLKNPGPLVQA"
     misc_feature    89452..91200
                     /locus_tag="Rahaq2_4652"
                     /note="Choline dehydrogenase and related flavoproteins
                     [Amino acid transport and metabolism]; Region: BetA;
                     COG2303"
                     /db_xref="CDD:225186"
     misc_feature    89458..>89553
                     /locus_tag="Rahaq2_4652"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    89722..90465
                     /locus_tag="Rahaq2_4652"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    90799..91143
                     /locus_tag="Rahaq2_4652"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            91222..92493
                     /locus_tag="Rahaq2_4653"
                     /note="IMG reference gene:2506711677"
                     /db_xref="GeneID:11818162"
     CDS             91222..92493
                     /locus_tag="Rahaq2_4653"
                     /note="PFAM: Cytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c, mono- and diheme variants family"
                     /protein_id="YP_005220388.1"
                     /db_xref="GI:379704014"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR014353"
                     /db_xref="GeneID:11818162"
                     /translation="MKLKSLFIANALLLGAGFMANAQAVTNAQPDNAALIKQGEYVAR
                     LGDCGACHTVAGKPAFSGGLAINSNLGTIYSTNITPDKDHGISGYSEAQFSDAVRKGV
                     LPDGTRLYPAMPYPDYAKINDEDMHALYVYFMQGVKPSAEQPPETDLSFPFSQRWGMR
                     FWNWAFASDKPFQPIGGASAQVNRGAYLVESLGHCGSCHTPRGFGMNEKALDSSDADF
                     LAGGSLNNWDVPSLRGVAHWNEQEIVDYLGKGRNDKAAVGGEMTSVVENSTAHMTDDD
                     LKAIAAYIKFLGGNPPVPAEDTQKVSATEARLTAAKNLSEGERLYLDNCGACHFVTGK
                     GAPGVFPQLDQATIVNAKDPTGLIHTILAGAQQPSTARAPSTLVMPGFASRLTDEEAA
                     QLSTFIRQGWSNNAPAVTAKDVSEVRKTLTK"
     misc_feature    91609..92076
                     /locus_tag="Rahaq2_4653"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    91741..92184
                     /locus_tag="Rahaq2_4653"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     misc_feature    <92146..92484
                     /locus_tag="Rahaq2_4653"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    92161..92427
                     /locus_tag="Rahaq2_4653"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            complement(92550..92939)
                     /locus_tag="Rahaq2_4654"
                     /note="IMG reference gene:2506711678"
                     /db_xref="GeneID:11818163"
     CDS             complement(92550..92939)
                     /locus_tag="Rahaq2_4654"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220389.1"
                     /db_xref="GI:379704015"
                     /db_xref="InterPro:IPR016918"
                     /db_xref="GeneID:11818163"
                     /translation="MNRFVKEVFDAHVLIQRWFSDSAAPGQVCDELLARFSPAYSMVT
                     ITGHRLDHPALCAFFRAQRGAKSGLKIEVEKPVVIAESEKGAVVAYQERQQLPGQPVT
                     LRYSTVVFVVNAEGKILWRHLHETPAA"
     misc_feature    complement(92562..92939)
                     /locus_tag="Rahaq2_4654"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4460"
                     /db_xref="CDD:226867"
     gene            complement(92936..94324)
                     /locus_tag="Rahaq2_4655"
                     /note="IMG reference gene:2506711679"
                     /db_xref="GeneID:11818164"
     CDS             complement(92936..94324)
                     /locus_tag="Rahaq2_4655"
                     /note="PFAM: Major Facilitator Superfamily;
                     TIGRFAM: drug resistance transporter, EmrB/QacA subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005220390.1"
                     /db_xref="GI:379704016"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818164"
                     /translation="MSHRARVAAVYLLGFFVDLINMFIANVAYPGIAREFQAPVSALA
                     WVSTGYILGLTLVIPLSRWLAERFGARRVFILSLTIFMLASLGAGIAGSLTALTGWRI
                     VQGLGGGLLIPLGQTMTYALYRSHERARLSAVIMLVGLLAPALSPAIGGIIVDSFSWR
                     WVFIASLPLALLAWMLALCWLPETPREPTGKLDLKGFVLLNSGLTLVLCGLTRLGDNR
                     EWLSGSALLLAGAGLMMMFVRASQKNPNPLLDLSLIKDPLLRVSMLIYQCIPGVFTGV
                     SLIAMLYLQNVHHFSATQSGGLMVPWSLASFAAISFTGKMFNRIGPRALFIPGCLIQG
                     AGIGLLALLSVFPAQPWLAVTAFTLMGAGSSLCSSTAQSAAFLHIGTQRLADASALWN
                     INRQLSFCLGVTLVSVLLNMLQIYLPQSAFRLAFIFASASVIVPVMLCLGLPGRDIVQ
                     ERHQQELQKERR"
     misc_feature    complement(92993..94300)
                     /locus_tag="Rahaq2_4655"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(93119..94297)
                     /locus_tag="Rahaq2_4655"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(93128..93130,93137..93142,93149..93154,
                     93161..93166,93197..93199,93206..93211,93221..93223,
                     93230..93235,93242..93244,93395..93397,93407..93409,
                     93416..93418,93428..93430,93440..93442,93482..93484,
                     93491..93496,93503..93508,93515..93517,93896..93898,
                     93914..93919,93926..93931,93965..93967,93974..93979,
                     93986..93991,93998..94003,94139..94144,94148..94153,
                     94163..94165,94172..94177,94184..94186,94235..94240,
                     94244..94252,94259..94261))
                     /locus_tag="Rahaq2_4655"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            94441..95355
                     /locus_tag="Rahaq2_4656"
                     /note="IMG reference gene:2506711680"
                     /db_xref="GeneID:11818165"
     CDS             94441..95355
                     /locus_tag="Rahaq2_4656"
                     /note="PFAM: Bacterial regulatory helix-turn-helix
                     protein, lysR family; LysR substrate binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220391.1"
                     /db_xref="GI:379704017"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818165"
                     /translation="MLNLQRLEIFVAVVNAGSFTGGAASLGLTKAVVSFNVKQLESET
                     GVALLTRSTRRLALTGSGERFYQRCQNLLQEAESVLDDVRRDHGGLSGQLRITSTPEY
                     GARVVVPALAAFCVLHPQLRIQHVASSHHDDLIAGRFDLAIRLGQLTDSSHHAAALGR
                     FGIMPVASPAFLREQANISTLDQLAASRWIAHSRLPLPMNWPVTDAQGKQNPFRVTTP
                     PAIVADSASALLAFALAGAGVALLPDWLVQPEIDGQRLCHLLPDHRFAPQGIFALYPH
                     TRHVPEKVRRFIDFMQSRLAELPARAKI"
     misc_feature    94444..95343
                     /locus_tag="Rahaq2_4656"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    94450..94629
                     /locus_tag="Rahaq2_4656"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    94714..95313
                     /locus_tag="Rahaq2_4656"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    order(94744..94746,94756..94758,94873..94875,94915..94917,
                     94921..94923,95116..95118,95167..95169,95248..95250)
                     /locus_tag="Rahaq2_4656"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    order(94747..94752,94762..94767,94771..94776,94783..94785,
                     94795..94797,94801..94821,95002..95004,95098..95112,
                     95131..95136,95143..95145)
                     /locus_tag="Rahaq2_4656"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            95384..95926
                     /locus_tag="Rahaq2_4657"
                     /note="IMG reference gene:2506711681"
                     /db_xref="GeneID:11818166"
     CDS             95384..95926
                     /locus_tag="Rahaq2_4657"
                     /note="PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, ribosomal protein
                     N-acetylase"
                     /protein_id="YP_005220392.1"
                     /db_xref="GI:379704018"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11818166"
                     /translation="MIIETSRLLLRPVTAEDIHAFFAIYGDPQTNLFNPRGPLPDIAA
                     AQEKLNGWLGEWQENGYGHWAIAHNHQPDHIIGFGGLGIREGYENHRVFLGYRFATTA
                     WGKGLATEFASAVLNIGFKKLGIPRISATVRENHLASQRVLEKIGMQKVGFEGDPVHG
                     TGSYLYRQTGQRAVSDSSLS"
     misc_feature    95402..95830
                     /locus_tag="Rahaq2_4657"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    95411..95845
                     /locus_tag="Rahaq2_4657"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            96095..96334
                     /locus_tag="Rahaq2_4658"
                     /note="IMG reference gene:2506711682"
                     /db_xref="GeneID:11818167"
     CDS             96095..96334
                     /locus_tag="Rahaq2_4658"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220393.1"
                     /db_xref="GI:379704019"
                     /db_xref="GeneID:11818167"
                     /translation="MRQNRHNGMSPDTSHSLYSQVFSEEETLGRVVVEILEAGKNLNR
                     KALCSKLLNRVEAAGSEEEEKHYMKLIRLVLERDS"
     gene            96518..96811
                     /locus_tag="Rahaq2_4659"
                     /note="IMG reference gene:2506711683"
                     /db_xref="GeneID:11818168"
     CDS             96518..96811
                     /locus_tag="Rahaq2_4659"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220394.1"
                     /db_xref="GI:379704020"
                     /db_xref="GeneID:11818168"
                     /translation="MYRSNEERLTDKLIGEAVISLLKSKSPISTDRLIAQLQFMAASA
                     DSINRKTACEQIINEIRHDLADKRARITYEVRDVDNVRHFFNAEGPSDDKKSH"
     gene            96756..97127
                     /locus_tag="Rahaq2_4660"
                     /note="IMG reference gene:2506711684"
                     /db_xref="GeneID:11818169"
     CDS             96756..97127
                     /locus_tag="Rahaq2_4660"
                     /note="PFAM: Biofilm development protein YmgB/AriR"
                     /codon_start=1
                     /transl_table=11
                     /product="Biofilm development protein YmgB/AriR"
                     /protein_id="YP_005220395.1"
                     /db_xref="GI:379704021"
                     /db_xref="GeneID:11818169"
                     /translation="MCDTFSMLKGRPMIRKVIDSSESHMLNSSDSMKSNSSQPMTDSV
                     GNSEDYSYFNHTGELFLSETEVLGAAIRAILAEKGKVTNKAIILHLITQLECTSDVVQ
                     LDILRSALEMVVGMTPPDSGV"
     misc_feature    96936..97115
                     /locus_tag="Rahaq2_4660"
                     /note="Biofilm development protein YmgB/AriR; Region:
                     YmgB; pfam10798"
                     /db_xref="CDD:151248"
     gene            97227..97484
                     /locus_tag="Rahaq2_4661"
                     /note="IMG reference gene:2506711685"
                     /db_xref="GeneID:11818170"
     CDS             97227..97484
                     /locus_tag="Rahaq2_4661"
                     /note="PFAM: Biofilm development protein YmgB/AriR"
                     /codon_start=1
                     /transl_table=11
                     /product="Biofilm development protein YmgB/AriR"
                     /protein_id="YP_005220396.1"
                     /db_xref="GI:379704022"
                     /db_xref="GeneID:11818170"
                     /translation="MQDVSYTHVKLADYILTEDPELLIGNETVIRIYNNLKNQKEYVT
                     HKDIILCLIQKIEQESDSGKQDVYLEALEYVVYRTPDDDIA"
     misc_feature    97320..97472
                     /locus_tag="Rahaq2_4661"
                     /note="Biofilm development protein YmgB/AriR; Region:
                     YmgB; pfam10798"
                     /db_xref="CDD:151248"
     gene            complement(97596..98837)
                     /locus_tag="Rahaq2_4662"
                     /note="IMG reference gene:2506711686"
                     /db_xref="GeneID:11818171"
     CDS             complement(97596..98837)
                     /locus_tag="Rahaq2_4662"
                     /note="PFAM: EAL domain; Sensors of blue-light using FAD"
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="YP_005220397.1"
                     /db_xref="GI:379704023"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR001792"
                     /db_xref="InterPro:IPR007024"
                     /db_xref="GeneID:11818171"
                     /translation="MLLTLVYRSHISDAVSPASLEEMVSRANIKNERNSITGILLFDG
                     MHFFQLLEGPEEAVDAIYSEICSDPRHNNVVVLMRDYAPSRRFGNVGMELFDLRHHHE
                     DVVLQAVLDKGTSRYRLTYEDRALQFLCTFVQAREKENYLEILPADSWSFIADESLKP
                     EAGFIFPEMKDYSFTFQPIVDPLSREIISYEARLCGPGGGSAMEYFSALSGKNIYDAD
                     LKSKKLAFALAQKTGISDKTLTIKLLPMTLVRVPDAIGFLVHEITAHGLVPEQIVVAI
                     TENGVVTREDNFVTALQQLKASGMRLAIDDFGAGSAGLLLLTQCQPEKIMIDRNMICD
                     IHTSGPKQAIVQAIIRFCSSLEISVIATGVEKPEEWMWLDAAGVCNFQGSLFASPRLN
                     GAPVVAWPEVKQEYPLSHQNL"
     misc_feature    complement(98559..98834)
                     /locus_tag="Rahaq2_4662"
                     /note="Sensors of blue-light using FAD; Region: BLUF;
                     smart01034"
                     /db_xref="CDD:198102"
     misc_feature    complement(97671..98312)
                     /locus_tag="Rahaq2_4662"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            99041..99640
                     /locus_tag="Rahaq2_4663"
                     /note="IMG reference gene:2506711687"
                     /db_xref="GeneID:11818172"
     CDS             99041..99640
                     /locus_tag="Rahaq2_4663"
                     /note="PFAM: Tellurite resistance protein TehB;
                     TIGRFAM: tellurite resistance protein TehB"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein TehB"
                     /protein_id="YP_005220398.1"
                     /db_xref="GI:379704024"
                     /db_xref="InterPro:IPR015985"
                     /db_xref="GeneID:11818172"
                     /translation="MTQQPAPEDFYTEKYGLTRTHSEIINAVQYVQPGKALDLGCGSG
                     RNSLYLNLKGFDVTGWDNNAMSVAKVNDIIAAQSLTHIHISEADLNTHRFSGEYDFIF
                     STVVMMFLQRDSIPHIIEDMHAATKTGGYNLIVAAMDSPDYPCPLPFPFTFKPAELRD
                     YYRDWEIVKYNEEVGELHKRDENGDRYKLRFATLLARKV"
     misc_feature    99062..99634
                     /locus_tag="Rahaq2_4663"
                     /note="tellurite resistance protein TehB; Provisional;
                     Region: PRK11207"
                     /db_xref="CDD:183040"
     misc_feature    99143..99433
                     /locus_tag="Rahaq2_4663"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(99155..99175,99221..99226,99299..99307,99350..99352)
                     /locus_tag="Rahaq2_4663"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            99723..99995
                     /locus_tag="Rahaq2_4664"
                     /note="IMG reference gene:2506711688"
                     /db_xref="GeneID:11818173"
     CDS             99723..99995
                     /locus_tag="Rahaq2_4664"
                     /note="PFAM: Bacterial protein of unknown function
                     (DUF883)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220399.1"
                     /db_xref="GI:379704025"
                     /db_xref="InterPro:IPR008462"
                     /db_xref="InterPro:IPR010279"
                     /db_xref="GeneID:11818173"
                     /translation="MSSQDFDKDPNRVEGKVENTVNEFAGEAQKQFGDFVDSPKHQLK
                     GAARKYSAQANEVVSDVADKIKENPLSGLIAAGAIGVVLGLLLGRK"
     misc_feature    <99795..99992
                     /locus_tag="Rahaq2_4664"
                     /note="Bacterial protein of unknown function (DUF883);
                     Region: DUF883; cl01888"
                     /db_xref="CDD:242764"
     gene            complement(100157..100354)
                     /locus_tag="Rahaq2_4665"
                     /note="IMG reference gene:2506711689"
                     /db_xref="GeneID:11818174"
     CDS             complement(100157..100354)
                     /locus_tag="Rahaq2_4665"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220400.1"
                     /db_xref="GI:379704026"
                     /db_xref="GeneID:11818174"
                     /translation="MKDESEKTGLIGLAIGAAVMGLISSGTSINRESIIEELRRLGRK
                     KGDGLEDEIFVKAAQLVGKGQ"
     gene            100535..102934
                     /locus_tag="Rahaq2_4666"
                     /note="IMG reference gene:2506711690"
                     /db_xref="GeneID:11818175"
     CDS             100535..102934
                     /locus_tag="Rahaq2_4666"
                     /note="PFAM: XFP N-terminal domain; D-xylulose
                     5-phosphate/D-fructose 6-phosphate phosphoketolase; XFP
                     C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoketolase"
                     /protein_id="YP_005220401.1"
                     /db_xref="GI:379704027"
                     /db_xref="InterPro:IPR005593"
                     /db_xref="InterPro:IPR018969"
                     /db_xref="InterPro:IPR018970"
                     /db_xref="InterPro:IPR019789"
                     /db_xref="InterPro:IPR019790"
                     /db_xref="GeneID:11818175"
                     /translation="MTLSSSQRCAEEELRQVDRYWRAANYLSVGQIYLMDNPLLREPL
                     KPEHIKPRLLGHWGTTPGLNFIYAHLNRAICQRDLDIIYICGPGHGGPGMVANTWLEG
                     SYSEIYPQISEDASGIQKLFRQFSFPGGIPSHAAPETPGSINEGGELGYSLSHAFGAV
                     FDNPGLIAACVIGDGEAETGPLASSWHGNKFLNPVRDGAVLPVLHLNGYKIANPTILG
                     RMNDEDLRQLFSGYGYEPLFVSGHEPEQMHIQMARTLNIALDIIKDHQLRARAGRPTK
                     GVPRWPMIILRSPKGWTGPQSVDGKKVEGFWRAHQVPVSSCRENDEHRQILENWMRSY
                     QPDDLFDEQGRLKPELRALAPQGDKRMGASPFANGGRLRRELVPAERAKFAVELTSRG
                     EPQVQSTEMLGRYLADIFTLNPDNFRLFGPDETASNRLSDVFDVTNRTWLEDIEPYDE
                     QLAADGRVMEILSEHQCQGWLEGYLLTGRHGLFNCYEAFIHIVDSMFNQHAKWLKVTR
                     KLPWRKPISSLNYLLSSHVWRQDHNGYSHQDPGFMDHVANKKADIVRIYLPPDANTLL
                     WVADHCLQTWDRINVIVAGKQPAPQWLSAEEAAEHCAAGMGIWPWAGTEQDGTEPDVV
                     LACAGDVPTMETLAAADLLREYLPDLSVRVVNVVDIMALQTREQHPHGLSAEAFDGIF
                     TQNKPVIFAFHGYPSLIHRLTYQRNNHRNFHVSGFMEEGTTTTPFDMTVLNKLDRFHL
                     AQAAIVHTEKLQGKADDILDDLQEKIAAHHRYVREYGEDLPEVRNWKWPSQQGSGGAP
                     E"
     misc_feature    100562..102901
                     /locus_tag="Rahaq2_4666"
                     /note="putative phosphoketolase; Provisional; Region:
                     PRK05261"
                     /db_xref="CDD:235379"
     misc_feature    100790..101473
                     /locus_tag="Rahaq2_4666"
                     /note="Thiamine pyrophosphate (TPP) family,
                     Phosphoketolase (PK) subfamily, TPP-binding module; PK
                     catalyzes the conversion of D-xylulose 5-phosphate and
                     phosphate to acetyl phosphate,
                     D-glyceraldehyde-3-phosphate and H2O. This enzyme requires
                     divalent...; Region: TPP_PK; cd02011"
                     /db_xref="CDD:238969"
     misc_feature    order(100979..100981,101051..101062,101153..101155,
                     101159..101161)
                     /locus_tag="Rahaq2_4666"
                     /note="TPP-binding site; other site"
                     /db_xref="CDD:238969"
     misc_feature    101729..102259
                     /locus_tag="Rahaq2_4666"
                     /note="D-xylulose 5-phosphate/D-fructose 6-phosphate
                     phosphoketolase; Region: XFP; pfam03894"
                     /db_xref="CDD:252232"
     misc_feature    102290..102901
                     /locus_tag="Rahaq2_4666"
                     /note="XFP C-terminal domain; Region: XFP_C; pfam09363"
                     /db_xref="CDD:255316"
     gene            complement(103139..103570)
                     /locus_tag="Rahaq2_4667"
                     /note="IMG reference gene:2506711691"
                     /db_xref="GeneID:11818176"
     CDS             complement(103139..103570)
                     /locus_tag="Rahaq2_4667"
                     /note="PFAM: OsmC-like protein;
                     TIGRFAM: peroxiredoxin, OsmC subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC subfamily peroxiredoxin"
                     /protein_id="YP_005220402.1"
                     /db_xref="GI:379704028"
                     /db_xref="InterPro:IPR003718"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="GeneID:11818176"
                     /translation="MTIHKKGQAHWEGDIKHGKGYISSESGALKEQPYGFNTRFEGKP
                     GTNPEELIGAAHSACFSMALSLMLGEAGHTPESIDTVADVSLDKVDGGFAITKIALDS
                     KVKLPGIDKDKFDEIIQKAKAGCPVSQVLKAEITLTYQLEN"
     misc_feature    complement(103157..103558)
                     /locus_tag="Rahaq2_4667"
                     /note="peroxiredoxin, OsmC subfamily; Region:
                     osmo_induc_OsmC; TIGR03562"
                     /db_xref="CDD:234260"
     gene            103705..103884
                     /locus_tag="Rahaq2_4668"
                     /note="IMG reference gene:2506711692"
                     /db_xref="GeneID:11818177"
     CDS             103705..103884
                     /locus_tag="Rahaq2_4668"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220403.1"
                     /db_xref="GI:379704029"
                     /db_xref="GeneID:11818177"
                     /translation="MFKPQDLVQSKTGGPKMIVRRVEGDTLWCSRTDDFSATEIEVKA
                     DTVDLYHEDGDFGVC"
     misc_feature    103708..103863
                     /locus_tag="Rahaq2_4668"
                     /note="Uncharacterized small protein (DUF2158); Region:
                     DUF2158; cl02293"
                     /db_xref="CDD:261236"
     gene            104012..104347
                     /locus_tag="Rahaq2_4669"
                     /note="IMG reference gene:2506711693"
                     /db_xref="GeneID:11818178"
     CDS             104012..104347
                     /locus_tag="Rahaq2_4669"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220404.1"
                     /db_xref="GI:379704030"
                     /db_xref="InterPro:IPR008317"
                     /db_xref="GeneID:11818178"
                     /translation="MDAVIPVEKQFQAYNNHDLDAFVSCYSTDFMAYRMPNMSPSLQG
                     KEALRTFYQNHRFNNKALRAELISRTLLGNKVFDHEMIYGIYDTPVNSIAVFEVENGL
                     IKTAWFYFE"
     misc_feature    104027..104344
                     /locus_tag="Rahaq2_4669"
                     /note="Nuclear transport factor 2 (NTF2-like) superfamily.
                     This family includes members of the NTF2 family,
                     Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
                     and the beta subunit of Ring hydroxylating dioxygenases.
                     This family is a classic example of...; Region: NTF2_like;
                     cl09109"
                     /db_xref="CDD:263720"
     gene            complement(104487..104945)
                     /locus_tag="Rahaq2_4670"
                     /note="IMG reference gene:2506711694"
                     /db_xref="GeneID:11818179"
     CDS             complement(104487..104945)
                     /locus_tag="Rahaq2_4670"
                     /note="PFAM: Transposase IS200 like"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005220405.1"
                     /db_xref="GI:379704031"
                     /db_xref="InterPro:IPR002686"
                     /db_xref="GeneID:11818179"
                     /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQVFYGEKRRAVGSILRKL
                     CEWKNVHILEAECCADHIHMLVEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRN
                     REFWCRGYYVDTVGKNTSKIQEYIKHQLEQDKLGEQLSIPYPGSPFTGGK"
     misc_feature    complement(104559..104912)
                     /locus_tag="Rahaq2_4670"
                     /note="Transposase IS200 like; Region: Y1_Tnp; pfam01797"
                     /db_xref="CDD:250874"
     gene            complement(104955..105078)
                     /locus_tag="Rahaq2_4671"
                     /note="IMG reference gene:2506711695"
                     /db_xref="GeneID:11818180"
     ncRNA           complement(104955..105078)
                     /locus_tag="Rahaq2_4671"
                     /ncRNA_class="other"
                     /product="STnc490k Hfq binding RNA"
                     /db_xref="GeneID:11818180"
     gene            complement(105148..105960)
                     /locus_tag="Rahaq2_4672"
                     /note="IMG reference gene:2506711696"
                     /db_xref="GeneID:11818181"
     CDS             complement(105148..105960)
                     /locus_tag="Rahaq2_4672"
                     /note="PFAM: NLPA lipoprotein;
                     TIGRFAM: lipoprotein, YaeC family"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_005220406.1"
                     /db_xref="GI:379704032"
                     /db_xref="InterPro:IPR004872"
                     /db_xref="GeneID:11818181"
                     /translation="MRITLKFSVLALSLVGALALSACDQKSQENHIKVGISAGIDQQM
                     WETIKKTAKDKYNLDVEVVTFNDFVLPNSALSSGDIDVNSFQHRPYLDKQIKERGYKL
                     VEVGKTFVYPIAGYSRKIKSLDQLSDNAQVAVPNDPTNLGRSLLLLQKEGLIKLKEGV
                     GLLPTSLDIIENPKHLKIVEIEAPQLTRAIDDDKIELAIINTTYSGQVGLTPGKNGLF
                     VEDKDSPYVNIIVAREDNKDSQAVKELVEAYQTDATVKAADAIYHGDAVKGW"
     misc_feature    complement(105151..105960)
                     /locus_tag="Rahaq2_4672"
                     /note="NLPA lipoprotein; Region: Lipoprotein_9; cl19159"
                     /db_xref="CDD:267512"
     gene            complement(106204..107415)
                     /locus_tag="Rahaq2_4673"
                     /note="IMG reference gene:2506711697"
                     /db_xref="GeneID:11818182"
     CDS             complement(106204..107415)
                     /locus_tag="Rahaq2_4673"
                     /note="PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005220407.1"
                     /db_xref="GI:379704033"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818182"
                     /translation="MTECSSLDTRPETSAFRRWLAVYSLACGTFALVNTEFLPIGLLS
                     PIAQSLGVTEGHAGLAVMLPGLVAAISAPLIMLFARKMDRRTLLLLLSATVIVANGIA
                     VMAQSFNILLIGRIILGVGVGGFWSFAIPSGRRLVSEEQGARAISLITAGVAVGTVAG
                     VPAGAFIGDLFGWRMAFMLNAVLALAFFVLQWLALPSLPAQHSIGLRAMLGVTKVAGI
                     RYALIIGVFMAGGHFAAYTYLEPWLRFSLHLTASHISLLLMGYGVAGLLGTLTTEITV
                     RELGVRKAFMLNMLLLSASVLVLSLFPVPLALACALVILWGLAFGALPVCLNIWTYQA
                     SPALFETGSALLVCVFQTSLALGALFGGILADSAGVSSAFLLGGVLTLLAGITIFLSR
                     PQPAVLHAAGK"
     misc_feature    complement(106228..107391)
                     /locus_tag="Rahaq2_4673"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    complement(106246..107352)
                     /locus_tag="Rahaq2_4673"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(106354..106356,106363..106368,
                     106375..106380,106387..106392,106423..106425,
                     106432..106437,106453..106458,106465..106467,
                     106609..106611,106621..106623,106630..106632,
                     106642..106644,106654..106656,106696..106698,
                     106705..106710,106717..106722,106729..106731,
                     106945..106947,106963..106968,106975..106980,
                     107014..107016,107023..107028,107035..107040,
                     107047..107052,107188..107193,107197..107202,
                     107212..107214,107221..107226,107233..107235,
                     107284..107289,107293..107301,107308..107310))
                     /locus_tag="Rahaq2_4673"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(107727..108062)
                     /locus_tag="Rahaq2_4674"
                     /note="IMG reference gene:2506711698"
                     /db_xref="GeneID:11818183"
     CDS             complement(107727..108062)
                     /locus_tag="Rahaq2_4674"
                     /note="PFAM: Small Multidrug Resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cation/cationic drug transporter"
                     /protein_id="YP_005220408.1"
                     /db_xref="GI:379704034"
                     /db_xref="InterPro:IPR000390"
                     /db_xref="GeneID:11818183"
                     /translation="MFKIYLILAVSICAETLATTMMKASNGFTRLIPSVIVVVGYAIS
                     FYGLSQVVKVMHIGIAYAIWAGMGIFLVSAMSFFIYKQRLDTPALIGMGCIALGIMII
                     QLYSKSVSH"
     misc_feature    complement(107730..108050)
                     /locus_tag="Rahaq2_4674"
                     /note="Small Multidrug Resistance protein; Region:
                     Multi_Drug_Res; cl00910"
                     /db_xref="CDD:260691"
     gene            complement(108256..110055)
                     /locus_tag="Rahaq2_4675"
                     /note="IMG reference gene:2506711699"
                     /db_xref="GeneID:11818184"
     CDS             complement(108256..110055)
                     /locus_tag="Rahaq2_4675"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase component of various ABC-type transport
                     systems with duplicated ATPase domain"
                     /protein_id="YP_005220409.1"
                     /db_xref="GI:379704035"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818184"
                     /translation="MQTPVLQVDKLNTAFSVDGEWLNVVRDLSFSIGPKETLALVGES
                     GSGKSVTAMSVMRLLDEKQTRYSGRIHFDGRELLSLTPPEMQSIRGNRIGMIFQEPMT
                     SLNPVLKIGVQITEVLKRHRGMDDASARAEAVRLLEKVRIPAATSRLNEYPLSFSGGM
                     RQRVVIAIALACNPRLLIADEPTTALDVTIQAQILALIKSLQEEEGMSVLFITHDMGV
                     VAEVADRTLVLHRGEAVEQATTREIFHHPKHPYTRALLSAVPRLGTMQGVALPKRFPL
                     TDMHTGEPLPVAESVDTLRTGQPVLEIKNLVTRFDVKSGLLRRVSARIHAVEDVSFSL
                     QPGETLSLVGESGCGKSTTGRTILRLTEATSGDILIRGQDIRRADSARLADIRTQAQM
                     IFQDPYESLNPRMRIGQAIAEPMISLGLHDATSAKIRVAQLLEQVGLQSNMAMRFPHQ
                     FSGGQRQRICIARALALEPKMIIADEAVSALDVSVKAQVINLMLDLQQELGLAYLFIS
                     HDMAVVERISHRVAVMYQGEIVEIGSRADIFENPQHIYTRKLLAAVPVPDPDVHHTRT
                     VVPEELASPLRAATYQPPVRHYREVSAGHFVQI"
     misc_feature    complement(108376..110055)
                     /locus_tag="Rahaq2_4675"
                     /note="ATPase components of various ABC-type transport
                     systems, contain duplicated ATPase [General function
                     prediction only]; Region: COG1123"
                     /db_xref="CDD:224048"
     misc_feature    complement(109342..110043)
                     /locus_tag="Rahaq2_4675"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(109909..109932)
                     /locus_tag="Rahaq2_4675"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(109414..109416,109513..109518,
                     109762..109764,109906..109914,109918..109923))
                     /locus_tag="Rahaq2_4675"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(109762..109773)
                     /locus_tag="Rahaq2_4675"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(109561..109590)
                     /locus_tag="Rahaq2_4675"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(109513..109530)
                     /locus_tag="Rahaq2_4675"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(109495..109506)
                     /locus_tag="Rahaq2_4675"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(109408..109428)
                     /locus_tag="Rahaq2_4675"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<109210..109353)
                     /locus_tag="Rahaq2_4675"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     misc_feature    complement(108457..109158)
                     /locus_tag="Rahaq2_4675"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(109003..109026)
                     /locus_tag="Rahaq2_4675"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(108529..108531,108628..108633,
                     108871..108873,109000..109008,109012..109017))
                     /locus_tag="Rahaq2_4675"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(108871..108882)
                     /locus_tag="Rahaq2_4675"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(108676..108705)
                     /locus_tag="Rahaq2_4675"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(108628..108645)
                     /locus_tag="Rahaq2_4675"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(108610..108621)
                     /locus_tag="Rahaq2_4675"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(108523..108543)
                     /locus_tag="Rahaq2_4675"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<108376..108468)
                     /locus_tag="Rahaq2_4675"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     gene            complement(110058..110975)
                     /locus_tag="Rahaq2_4676"
                     /note="IMG reference gene:2506711700"
                     /db_xref="GeneID:11818185"
     CDS             complement(110058..110975)
                     /locus_tag="Rahaq2_4676"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220410.1"
                     /db_xref="GI:379704036"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818185"
                     /translation="MASDSVHSRTAVQGKSQPAFYTTVRALLRNKFSLCGLIILGIAI
                     LLAVLAPWISPQNPYDLSQLDIMDGRLKPGTSSLSGMIYWLGTDDQGRDLLSAILYGT
                     RTSLLVGVSSAAIALTLGAALGLISAYAGGKTDALIMRIVDIQLSFPPILIALILLAV
                     LGQGVDKIILALVVTQWAYYARTLRGSALLERRRSYVDAARSMALSSPRILFRHILPN
                     CLPPLIVVATMRIAYAIMLEATLSFLGIGLPVTEPSLGLLIANGFDYLMSGDYWISFF
                     PGITLLVLIVAINLVGDALRDILNPRNKD"
     misc_feature    complement(110064..110903)
                     /locus_tag="Rahaq2_4676"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(110118..110669)
                     /locus_tag="Rahaq2_4676"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110118..110123,110130..110135,
                     110142..110147,110151..110156,110163..110168,
                     110196..110201,110247..110252,110259..110270,
                     110289..110291,110298..110303,110343..110345,
                     110394..110396,110403..110408,110418..110420,
                     110424..110429,110436..110438,110442..110444,
                     110448..110453,110526..110549,110553..110564,
                     110592..110594,110607..110612,110619..110624))
                     /locus_tag="Rahaq2_4676"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110253..110270,110526..110546))
                     /locus_tag="Rahaq2_4676"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110166..110168,110196..110198,
                     110205..110207,110250..110252,110466..110468))
                     /locus_tag="Rahaq2_4676"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110322..110324,110334..110339,
                     110355..110393))
                     /locus_tag="Rahaq2_4676"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(110975..111949)
                     /locus_tag="Rahaq2_4677"
                     /note="IMG reference gene:2506711701"
                     /db_xref="GeneID:11818186"
     CDS             complement(110975..111949)
                     /locus_tag="Rahaq2_4677"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220411.1"
                     /db_xref="GI:379704037"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818186"
                     /translation="MSRYLLGRFGQTLLTLFVMSLLVFAGVYLVGNPVDLLLSTTATP
                     AERLSVIQSFGLDKPVWEQYGLFVVNALHGDMGNSFIYNQPALHLIFQRMPATLELAL
                     VAFALALVIGIPLGVYAGLRPDGWLSKSIMAVSILGFSLPTFWIGLMMIMLFSVKLGV
                     LPASGRGATVEVFGVPVSLFTADGLAHLILPALNLALFKISLIIRLTRAGVLECLQQD
                     FIRFARAKGLSESRIVLVHVLKNTLIPLITVIGLELGSLIAFAVVTETIYAWPGMGKL
                     IIDSIAMLDRPVILAYLMITVVMFSLINLLVDVLYVLVDPRVRLGGEN"
     misc_feature    complement(110984..111949)
                     /locus_tag="Rahaq2_4677"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(111044..111670)
                     /locus_tag="Rahaq2_4677"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111044..111049,111056..111061,
                     111068..111073,111077..111082,111089..111094,
                     111122..111127,111152..111157,111164..111175,
                     111194..111196,111203..111208,111248..111250,
                     111299..111301,111308..111313,111323..111325,
                     111329..111334,111341..111343,111347..111349,
                     111353..111358,111497..111499,111503..111508,
                     111515..111544,111548..111559,111590..111592,
                     111605..111610,111617..111622))
                     /locus_tag="Rahaq2_4677"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111158..111175,111497..111541))
                     /locus_tag="Rahaq2_4677"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111092..111094,111122..111124,
                     111131..111133,111155..111157,111371..111373,
                     111497..111499))
                     /locus_tag="Rahaq2_4677"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111227..111229,111239..111244,
                     111260..111298))
                     /locus_tag="Rahaq2_4677"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(111946..112920)
                     /locus_tag="Rahaq2_4678"
                     /note="IMG reference gene:2506711702"
                     /db_xref="GeneID:11818187"
     CDS             complement(111946..112920)
                     /locus_tag="Rahaq2_4678"
                     /note="PFAM: Inosine-uridine preferring nucleoside
                     hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Inosine-uridine nucleoside N-ribohydrolase"
                     /protein_id="YP_005220412.1"
                     /db_xref="GI:379704038"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR015910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="GeneID:11818187"
                     /translation="MSQRIIIDTDPGVDDAIALWLALASPELDVLGVTVVAGNVALKD
                     SVRNACKIVALSGKIATPVFAGAPGPLARDQVYGKYAHIGAFNDELVPDTGLQPQAEH
                     AVDFLVRTLRQAAEDNDPISLCVIGPMTNIALALGMHPDVARGIKQIVTMSCAFTALG
                     HRVPWAEFNVYADPHAAEKVFNSGVPLIIMPLDMTFQALIGADDIEALKQDGGQPGES
                     VAALLNAFDRSDLSRFGREGGPVHDATTVAWLLQPGLFEGQPARVGVAVSGNTAGYTY
                     ADFWNKLATPANAVVMQSVDEYGFFSLMRRVFSRYGTRYSNTSGEMRA"
     misc_feature    complement(112009..112911)
                     /locus_tag="Rahaq2_4678"
                     /note="nuc_hydro_IU_UC_XIUA: inosine-uridine preferring,
                     xanthosine-inosine-uridine-adenosine-preferring and,
                     uridine-cytidine preferring nucleoside hydrolases.
                     Nucleoside hydrolases cleave the N-glycosidic bond in
                     nucleosides generating ribose and the...; Region:
                     nuc_hydro_IU_UC_XIUA; cd02651"
                     /db_xref="CDD:239117"
     misc_feature    complement(order(112192..112194,112414..112416,
                     112420..112422,112438..112440,112543..112545,
                     112678..112680,112804..112806,112876..112881,
                     112891..112893))
                     /locus_tag="Rahaq2_4678"
                     /note="active site"
                     /db_xref="CDD:239117"
     misc_feature    complement(order(112108..112110,112114..112119,
                     112123..112125,112384..112386,112510..112512,
                     112708..112710))
                     /locus_tag="Rahaq2_4678"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239117"
     gene            complement(112925..113875)
                     /locus_tag="Rahaq2_4679"
                     /note="IMG reference gene:2506711703"
                     /db_xref="GeneID:11818188"
     CDS             complement(112925..113875)
                     /locus_tag="Rahaq2_4679"
                     /note="PFAM: Inosine-uridine preferring nucleoside
                     hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Inosine-uridine nucleoside N-ribohydrolase"
                     /protein_id="YP_005220413.1"
                     /db_xref="GI:379704039"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR015910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="GeneID:11818188"
                     /translation="MKTIPVVIDCDPGIDDAIALLSAFVAPQLNILGISTVCGNQPLV
                     NTTRNALQITELGYRLDIPVFAGCHQPLLRAPIHGQFHGENGLGNTAFPAPQKQAESL
                     HAVNFLISCCEQAIENNQPLTLCMLGPLTNLATALRIKPEITAGMGRVVLMGGAYREA
                     GNRTMTSEFNMLADPHAAHIVFSSDLNITVLPLDATHQVILTPEHVAKFIKVSGRISA
                     TLGELMAFWDRNDVRRYGSRGGPLHDPLVIAYVLAPELFGTEKARVFVEHDSELCMGQ
                     TVADWHDKSGQTPNVDIVTRVEAGKVFALFYELLSRYAGK"
     misc_feature    complement(112946..113863)
                     /locus_tag="Rahaq2_4679"
                     /note="nuc_hydro_IU_UC_XIUA: inosine-uridine preferring,
                     xanthosine-inosine-uridine-adenosine-preferring and,
                     uridine-cytidine preferring nucleoside hydrolases.
                     Nucleoside hydrolases cleave the N-glycosidic bond in
                     nucleosides generating ribose and the...; Region:
                     nuc_hydro_IU_UC_XIUA; cd02651"
                     /db_xref="CDD:239117"
     misc_feature    complement(order(113144..113146,113366..113368,
                     113372..113374,113390..113392,113495..113497,
                     113633..113635,113756..113758,113828..113833,
                     113843..113845))
                     /locus_tag="Rahaq2_4679"
                     /note="active site"
                     /db_xref="CDD:239117"
     misc_feature    complement(order(113057..113059,113066..113071,
                     113075..113077,113336..113338,113462..113464,
                     113660..113662))
                     /locus_tag="Rahaq2_4679"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239117"
     gene            complement(113872..114756)
                     /locus_tag="Rahaq2_4680"
                     /note="IMG reference gene:2506711704"
                     /db_xref="GeneID:11818189"
     CDS             complement(113872..114756)
                     /locus_tag="Rahaq2_4680"
                     /note="PFAM: Dihydrodipicolinate synthetase family"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase/N-acetylneuraminate
                     lyase"
                     /protein_id="YP_005220414.1"
                     /db_xref="GI:379704040"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:11818189"
                     /translation="MTSFSGVYPYLVSPVTDGGQIDKPVLTALVEHLIASGVHGLTPL
                     GSTGEFAYLSAEQRTEIVKTVVEAARGRVPVIAGVAATTIQDAVAQTARYVALGVDGI
                     LAILEAYFPVPEQGVEDYFRAIATAAGKLPVVLYTNPQFQRSDLSLPVIERLSYVENI
                     NYIKDASTNTGRLLSIIERTQGRMQVFAASAHIPACVMLIGGVGWMAGPACIVPKQSL
                     ALYEAARQGDWTKAMALQRPLWRINEIFARYSIAGCIKAALQLQGFEVGDPLPPQVPL
                     NQAARQEIAEVLRSVGAL"
     misc_feature    complement(113893..114738)
                     /locus_tag="Rahaq2_4680"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(114265..114267,114349..114351,
                     114616..114624,114631..114633,114727..114729))
                     /locus_tag="Rahaq2_4680"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(114139..114141,114265..114267,
                     114349..114351,114616..114624,114631..114633))
                     /locus_tag="Rahaq2_4680"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(113941..113946,114397..114399,
                     114409..114411,114430..114435,114505..114510,
                     114601..114606,114619..114621))
                     /locus_tag="Rahaq2_4680"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    complement(114265..114267)
                     /locus_tag="Rahaq2_4680"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            complement(114838..116397)
                     /locus_tag="Rahaq2_4681"
                     /note="IMG reference gene:2506711705"
                     /db_xref="GeneID:11818190"
     CDS             complement(114838..116397)
                     /locus_tag="Rahaq2_4681"
                     /note="PFAM: Bacterial extracellular solute-binding
                     proteins, family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005220415.1"
                     /db_xref="GI:379704041"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="GeneID:11818190"
                     /translation="MRKSVLAGVLFSALATPFILQTVQAADLNIGLAASTTSMDPQFY
                     VGGANSAMARNIFDGLVNQDEKQHITPALAVSWKVINDTTWEFALRPGVKFHDGSNFT
                     AKDVIASVKRVALASKNSPSAYTPYVNDIADVTEVNPLTVRITTKTPSPLLLNNLSRV
                     AILPARLETVGSQTLNEGKDVTGTGPFKFVSWTPDDNVVLARNDQYWGGKAQWDKVTL
                     RVFKNPSARVAALRSGDVDMIESVPTADGRDLGKQTSLHLESVAGNRILYLHPDQDRD
                     VSPFAKGPDGSNPLKKREVREAMSLAINRQAIVDRIMDGQGVPASQLVPKGYFGYTPS
                     IAAPVYDPAKAKQLLTQAGYPDGFTLTFHASNDRYPNDSKIAQALGQMFSRVGIKTDV
                     VTMPGSVYFSRASKRDFSLIMGGAAIETGEASGVLGPLLETFGPNGGQGNRGRYSNPE
                     FDKTLLQARETLDDGQREKLLQHATEIAMKDEGTIPLLFLSYTWAMKTPYTYVGRSDG
                     YTLPYFVHEKQ"
     misc_feature    complement(114853..116397)
                     /locus_tag="Rahaq2_4681"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(114877..116319)
                     /locus_tag="Rahaq2_4681"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_2; cd08498"
                     /db_xref="CDD:173863"
     gene            116539..117426
                     /locus_tag="Rahaq2_4682"
                     /note="IMG reference gene:2506711706"
                     /db_xref="GeneID:11818191"
     CDS             116539..117426
                     /locus_tag="Rahaq2_4682"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220416.1"
                     /db_xref="GI:379704042"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818191"
                     /translation="MKINPRQVEAFHKVILTGGMTAAANMMNITQPAVSRLIRDFEYA
                     VDLKLFDRDGRGLIPRDDAIKLYREVERLYLGLEHISRIADEIRHSKGSVLRIGTVAA
                     LSALCVEHILPPLIERISDISLFLDIESTTHITDVVTGNQYDVGFIFGKPDVKGLEAE
                     MLARANAVAVMSPRHPLAKQDVVTAMDLTRYRPIIPGRKTPLREQLDQVMSRLDLYMN
                     NPIETSLNNCCVMAGNNLGIGVVDFITARSHKSDIVLKPFTPDISIAYLAVFPPQIPK
                     SRLVEHITQEMKTLIEGYL"
     misc_feature    116539..117405
                     /locus_tag="Rahaq2_4682"
                     /note="DNA-binding transcriptional regulator LysR;
                     Provisional; Region: PRK11013"
                     /db_xref="CDD:236819"
     misc_feature    116554..116715
                     /locus_tag="Rahaq2_4682"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    116821..117381
                     /locus_tag="Rahaq2_4682"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(116875..116880,116884..116889,116896..116898,
                     116902..116922,117196..117213,117226..117231,
                     117235..117240)
                     /locus_tag="Rahaq2_4682"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            117823..120312
                     /locus_tag="Rahaq2_4683"
                     /note="IMG reference gene:2506711707"
                     /db_xref="GeneID:11818192"
     CDS             117823..120312
                     /locus_tag="Rahaq2_4683"
                     /note="PFAM: Pyrrolo-quinoline quinone coenzyme
                     N-terminus; Pyrrolo-quinoline quinone coenzyme C-terminus;
                     PQQ enzyme repeat;
                     TIGRFAM: membrane-bound PQQ-dependent dehydrogenase,
                     glucose/quinate/shikimate family"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound PQQ-dependent dehydrogenase"
                     /protein_id="YP_005220417.1"
                     /db_xref="GI:379704043"
                     /db_xref="InterPro:IPR002372"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR019551"
                     /db_xref="InterPro:IPR019556"
                     /db_xref="GeneID:11818192"
                     /translation="MPTTNNKWTWLLWLLSALMVVIGLTLGIGGAYLATLGGSLYFLL
                     MGLALIVSAVLIFKGKPSGAWLYAVAFVLSIIWAVWDAGFTFWPLFSRLFTFGVLAFL
                     MALAYPLLQARAGLVVRKGPGFSLAAVLAVALIVAFGNTFVPTPIISADNDQVPVKPV
                     EKGAEQKNWESWGNTPAGDRFAALDQINKTNVDKLQVAWIAHTGDIPQSNGSGAEDQN
                     TPLQIGDKLFVCTAYSKVIALSVDDGKKLWSYDSNSTAPNWQRCRGLGYYQNNSENST
                     ASQAPAAQPAATPAAEPATPNAASEAAAPATDAPQAPAATGGTVSATCERRLFLPTID
                     ARLIAINADTGKPCADFGDNGVVDLKVGMGEVKPGYYQQTSTPLVAGNVVVVGGRVAD
                     NFSTGEPPGVVRAFDVHTGALVWAWDPGNPNITKLPPEGQTYTRGTPNVWSAMSYDPK
                     LGLIYMPTGNATPDFFGGTRTELDDKYSSSVVAVDVATGKVRWTFQTTHHDLWDFDLP
                     SQPLLYDLPDGKGGSTPVLVQTSKQGMIFMLNRETGQPVAKVENREVPQGNVPGERYA
                     KTQPFSVGMPNIGNQTLKESDMWGATPMDQLLCRIEFKGMRHEGVYTPPGLDRSLQFP
                     GSLGGMNWGSVSVDPNNAIMFVNDMRLGLANYMVPRAQVPTGASGIEMGMVPMEGTPY
                     GAVRERFLSPLGIPCQKPPFGTMSAVNLKTGKIVWQVPVGTVKDTGPLGIKMRMPMEV
                     GMPTLGASLSTQSGLLFFAGTQDFYLRAFDTANGKEIWKSRLPVGSQSGPMTYVSPKT
                     GKQYIIISAGGARQSAERGDYVIAYALPDEK"
     misc_feature    <117832..118143
                     /locus_tag="Rahaq2_4683"
                     /note="7TM diverse intracellular signalling; Region:
                     7TMR-DISM_7TM; pfam07695"
                     /db_xref="CDD:254365"
     misc_feature    117916..120300
                     /locus_tag="Rahaq2_4683"
                     /note="membrane-bound PQQ-dependent dehydrogenase,
                     glucose/quinate/shikimate family; Region: PQQ_membr_DH;
                     TIGR03074"
                     /db_xref="CDD:234101"
     misc_feature    118327..120297
                     /locus_tag="Rahaq2_4683"
                     /note="Membrane-bound PQQ-dependent glucose dehydrogenase;
                     Region: PQQ_mGDH; cd10280"
                     /db_xref="CDD:199838"
     misc_feature    order(118402..118410,118417..118419,118534..118536,
                     118540..118542,118549..118557,118564..118566,
                     118837..118839,118843..118845,118852..118860,
                     118867..118869,119035..119037,119041..119043,
                     119050..119058,119065..119067,119269..119271,
                     119275..119277,119284..119292,119299..119301,
                     119434..119436,119440..119442,119449..119457,
                     119464..119466,119941..119943,119947..119949,
                     119956..119964,119971..119973,120124..120126,
                     120130..120132,120139..120147,120154..120156,
                     120286..120288,120292..120294)
                     /locus_tag="Rahaq2_4683"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199838"
     misc_feature    order(118471..118473,118591..118596,118609..118611,
                     118942..118944,118987..118992,119146..119148,
                     119416..119418,120055..120057)
                     /locus_tag="Rahaq2_4683"
                     /note="putative active site [active]"
                     /db_xref="CDD:199838"
     gene            complement(120372..121667)
                     /locus_tag="Rahaq2_4684"
                     /note="IMG reference gene:2506711708"
                     /db_xref="GeneID:11818193"
     CDS             complement(120372..121667)
                     /locus_tag="Rahaq2_4684"
                     /note="PFAM: HipA-like C-terminal domain; HipA-like
                     N-terminal domain;
                     TIGRFAM: HipA N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="HipA domain-containing protein"
                     /protein_id="YP_005220418.1"
                     /db_xref="GI:379704044"
                     /db_xref="InterPro:IPR012893"
                     /db_xref="InterPro:IPR012894"
                     /db_xref="GeneID:11818193"
                     /translation="MDKLTLALNGIAVGTLEKGGSGEMSFVYHQSWLDRPGARAISLS
                     LPLQADKFRGAVVYNFFDNLLPDNEQIRSRIQARFHIPTKQPFDLLSRIGGDCVGAIQ
                     LYPEGDQVAPVTEIHAQPLGEKDIEQLLQGYKDAPLGMEADIEDFRISLAGAQEKTAL
                     LWYRDQWHRPQGSTPTSHILKLPIGYIANNGIDLSESVENEWLCLKIAEKFGFPVARS
                     EIANFGSQKVLVVERFDRRWSQDGSWLMRLPQEDFCQALGVAPALKYEADGGPGIARS
                     MKLLLGSQRAGGDRDMFFKSQILFWMLAAIDGHAKNFSVYIEPGSAYRMTPLYDVMSA
                     FPLMHPTGIPAKKAKMAMAVLGSNRHFHWDRILPRHFVSTAQRVSYSQENVSAMMTEM
                     KEKTEQVIADVKATLPVDFPAKISHAIFEGLRRQAARLP"
     misc_feature    complement(121356..121661)
                     /locus_tag="Rahaq2_4684"
                     /note="HipA N-terminal domain; Region: Couple_hipA;
                     cl11853"
                     /db_xref="CDD:264479"
     misc_feature    complement(120429..121571)
                     /locus_tag="Rahaq2_4684"
                     /note="Toxin module HipA, protein kinase of
                     phosphatidylinositol 3/4-kinase superfamily [General
                     function prediction only]; Region: HipA; COG3550"
                     /db_xref="CDD:226080"
     misc_feature    complement(120960..121220)
                     /locus_tag="Rahaq2_4684"
                     /note="HipA-like N-terminal domain; Region: HipA_N;
                     pfam07805"
                     /db_xref="CDD:254443"
     misc_feature    complement(120678..120929)
                     /locus_tag="Rahaq2_4684"
                     /note="HipA-like C-terminal domain; Region: HipA_C;
                     pfam07804"
                     /db_xref="CDD:254442"
     gene            complement(121671..121922)
                     /locus_tag="Rahaq2_4685"
                     /note="IMG reference gene:2506711709"
                     /db_xref="GeneID:11818194"
     CDS             complement(121671..121922)
                     /locus_tag="Rahaq2_4685"
                     /note="PFAM: Helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="Helix-turn-helix protein"
                     /protein_id="YP_005220419.1"
                     /db_xref="GI:379704045"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11818194"
                     /translation="MNITSAKMLASALRNERKKRKLSQSKTAEAIGLKQSTVSEFENY
                     PDGTRLETLFKLLAALDLELQITPRDSNPQEKSSWDQEW"
     misc_feature    complement(121731..121895)
                     /locus_tag="Rahaq2_4685"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(121794..121796,121869..121871,
                     121881..121883))
                     /locus_tag="Rahaq2_4685"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(121797..121799,121872..121874))
                     /locus_tag="Rahaq2_4685"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(121791..121796,121806..121808,
                     121815..121817,121848..121853))
                     /locus_tag="Rahaq2_4685"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            122175..122885
                     /locus_tag="Rahaq2_4686"
                     /note="IMG reference gene:2506711710"
                     /db_xref="GeneID:11818195"
     CDS             122175..122885
                     /locus_tag="Rahaq2_4686"
                     /note="PFAM: Bacterial regulatory proteins, gntR family;
                     UTRA domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220420.1"
                     /db_xref="GI:379704046"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011663"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818195"
                     /translation="MKKSEFIAQDLLSKIYQHSGSLPEKLPPERQLAEEYGVSRFTVR
                     KALEKLVSIGAVRIVQGSGIYINPGVGSNPLVYNSITEKKFAEISFKMLELHKRRPDK
                     EEQQVFDLSADDFIWAFTRLRRISQRNVQIEYSRMPAREFSDLNQKTIEHSIQQYVLS
                     KGYAISHSLTRYQAVTVSKEQAHILGCKKGIAAMHITNRGILQGGKVYAFSDIIDIDY
                     SCTYVIPFNQDNLAFRQT"
     misc_feature    122175..122807
                     /locus_tag="Rahaq2_4686"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PhnF; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    122178..122375
                     /locus_tag="Rahaq2_4686"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(122178..122180,122184..122186,122253..122255,
                     122259..122264,122286..122300,122304..122309,
                     122316..122318,122346..122351,122355..122366)
                     /locus_tag="Rahaq2_4686"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    122439..122816
                     /locus_tag="Rahaq2_4686"
                     /note="The UbiC transcription regulator-associated (UTRA)
                     domain is a conserved ligand-binding domain; Region: UTRA;
                     smart00866"
                     /db_xref="CDD:214869"
     gene            complement(122891..124090)
                     /locus_tag="Rahaq2_4687"
                     /note="IMG reference gene:2506711711"
                     /db_xref="GeneID:11818196"
     CDS             complement(122891..124090)
                     /locus_tag="Rahaq2_4687"
                     /note="PFAM: Mandelate racemase / muconate lactonizing
                     enzyme, C-terminal domain; Mandelate racemase / muconate
                     lactonizing enzyme, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="L-alanine-DL-glutamate epimerase-like protein"
                     /protein_id="YP_005220421.1"
                     /db_xref="GI:379704047"
                     /db_xref="InterPro:IPR001354"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="InterPro:IPR018110"
                     /db_xref="GeneID:11818196"
                     /translation="MQPVLITNIECQITHPDRHNLVVVRIETDCGVFGLGCATFQQRP
                     LAVKLMVDEYLKPLLIGRDANHIEDLWQMMMVNAYWRNGPVINNAIAGIDMALWDIKG
                     KLANMPLYHLFGGKSKDAVTAYSHAAGETLEELYGEVDRLLGEGYRHIRCQLGFYGGN
                     ARDFHSTREPTAGAYYDQDQYIDNTLAMFKALREKYGNQFHILHDVHERLFPQQAVQF
                     AKAVEQYRPYFIEDILPPDQNEWLAQIRSQTAVPLATGELFNNPAEWKDLIIHRRIDF
                     IRCHVSQIGGITPALKLAHFCQSFGVRLAWHCPPDMTPVGAAVNTHLNIHLHNAAIQE
                     FVAYPANTQRVFPGAQAPEKGYFYPGEEAGIGVGFDPQAAAEFPVVYRPHEWTQSRLP
                     DGVIHTP"
     misc_feature    complement(122894..124075)
                     /locus_tag="Rahaq2_4687"
                     /note="Enolase-superfamily, characterized by the presence
                     of an enolate anion intermediate which is generated by
                     abstraction of the alpha-proton of the carboxylate
                     substrate by an active site residue and is stabilized by
                     coordination to the essential Mg2+ ion; Region:
                     enolase_like; cl17188"
                     /db_xref="CDD:266540"
     misc_feature    complement(122900..124075)
                     /locus_tag="Rahaq2_4687"
                     /note="bifunctional D-altronate/D-mannonate dehydratase;
                     Provisional; Region: PRK15072"
                     /db_xref="CDD:237901"
     misc_feature    complement(order(123320..123322,123398..123400,
                     123476..123478))
                     /locus_tag="Rahaq2_4687"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238188"
     misc_feature    complement(order(123089..123091,123251..123253))
                     /locus_tag="Rahaq2_4687"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238188"
     gene            124400..125815
                     /locus_tag="Rahaq2_4688"
                     /note="IMG reference gene:2506711712"
                     /db_xref="GeneID:11818197"
     CDS             124400..125815
                     /locus_tag="Rahaq2_4688"
                     /note="PFAM: Phosphotransferase system, EIIC;
                     phosphotransferase system, EIIB;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose/maltose/N-acetylglucosamine-specific
                     phosphotransferase system IIC component"
                     /protein_id="YP_005220422.1"
                     /db_xref="GI:379704048"
                     /db_xref="InterPro:IPR001996"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR013013"
                     /db_xref="InterPro:IPR018113"
                     /db_xref="GeneID:11818197"
                     /translation="MNTEIMHSVIKLVGGAGNINKVWHCMTRLRFDLRDENKVAWDEI
                     KNLPGVLGAQSQSEQVQIIIGPRVNIWYDAIVSQLDPVTGNAETTTGNVSTKGRKSLV
                     SMFMDTVSGVFGPIVPAIAGAGMIKGLLAGLIALKVISAKSETVMIIDLIASGVFYFL
                     PFFLAVSAAKIFKTNEYLAAAVAACLMYPTLMDAAKALASHTTGAPTALYFMDVLPVS
                     VFNYSASVIPVIFSVLALSYIHRWVDKIMPDVLKTVFTPTLTLFIAALVSLTLIGPAG
                     IYLGKLLAFGIQGLFDVSAVFAGFIVGAIRPVAILTGMHHAMTPIALQNFTDQGWDML
                     MPMMFMANMAIAGSTFAIYFHVKTREQKSVVLSAAISGLLGITEPALFGVLTRYKKAF
                     IATTLSSSVASAFIAFFGVRLYGYILSSIFSLPAYIGPYFIYIVMGVVLSLGLSFTLT
                     YLMVVKNKGTEHTVPLVNQTR"
     misc_feature    124400..125755
                     /locus_tag="Rahaq2_4688"
                     /note="PTS system, sucrose-specific IIBC component;
                     Region: PTS-II-BC-sucr; TIGR01996"
                     /db_xref="CDD:131051"
     misc_feature    124406..124636
                     /locus_tag="Rahaq2_4688"
                     /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIB_glc; cd00212"
                     /db_xref="CDD:238130"
     misc_feature    124469..124489
                     /locus_tag="Rahaq2_4688"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    124472..124474
                     /locus_tag="Rahaq2_4688"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     misc_feature    124712..125782
                     /locus_tag="Rahaq2_4688"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG; COG1263"
                     /db_xref="CDD:224183"
     gene            complement(125822..126694)
                     /locus_tag="Rahaq2_4689"
                     /note="IMG reference gene:2506711713"
                     /db_xref="GeneID:11818198"
     CDS             complement(125822..126694)
                     /locus_tag="Rahaq2_4689"
                     /note="PFAM: Fumarylacetoacetate (FAA) hydrolase family"
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-4-pentenoate hydratase"
                     /protein_id="YP_005220423.1"
                     /db_xref="GI:379704049"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="GeneID:11818198"
                     /translation="MKIVNFIISKDHTKSFGIYQKDGIVDVGAHSGCRDINEFMAHHQ
                     MEELQRYVQLPADLQLNDISFLPVIDRPGKIFGVGMNYAEKRKEFNETSDAPTLFVRF
                     ADSQVGHNGTIIKPASSEQFDYEGELAIVIGRTGRNISADDALDYIAGYSCYMDGSVR
                     DWQHKWYTAGKNWPSTGAFGPWMVTPDEVGDPQNLSIKTWLNDRLVQDDTTANMVHSI
                     AQMIAYISTFTQLSPGDVIMTGSPGGVGKTRVPPLFLHENDKIEVEIENIGRLTNLIQ
                     NAPLSEMTHSKTAA"
     misc_feature    complement(125870..126646)
                     /locus_tag="Rahaq2_4689"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    complement(125876..126475)
                     /locus_tag="Rahaq2_4689"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            126853..127776
                     /locus_tag="Rahaq2_4690"
                     /note="IMG reference gene:2506711714"
                     /db_xref="GeneID:11818199"
     CDS             126853..127776
                     /locus_tag="Rahaq2_4690"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220424.1"
                     /db_xref="GI:379704050"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818199"
                     /translation="MLNNRDLDYFVTAAEMMNLRLASQNLNITQPALSKSITRLEREL
                     KIKLFKRAGRGLELTEAGRILYQRGVALQSAYLEIGEIMNELSSGAGGIVRVGVSGSA
                     TQFLLPEICKMLQSQVPNMKLEIQIGMNDVLFALLERHAIDVIIGPLVNYDSPVVQLP
                     VTADRVIVAASRDHPLAGKPASLRELSRYGWILPAKTVSMRQWLDKMFYENHCPAPDV
                     KVEISSLASVPGLIAKSGLLSFLSENILVEEEFLSRLIRIDNDQLVMERRVGITWLEG
                     AFLSPATQKVIDVTQSVGQKMQMEARRIMEE"
     misc_feature    126865..127716
                     /locus_tag="Rahaq2_4690"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    126865..127041
                     /locus_tag="Rahaq2_4690"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    127132..127716
                     /locus_tag="Rahaq2_4690"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(127174..127179,127183..127188,127195..127197,
                     127207..127209,127213..127233,127507..127524,
                     127540..127545,127549..127554)
                     /locus_tag="Rahaq2_4690"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(127795..128760)
                     /locus_tag="Rahaq2_4691"
                     /note="IMG reference gene:2506711715"
                     /db_xref="GeneID:11818200"
     CDS             complement(127795..128760)
                     /locus_tag="Rahaq2_4691"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter,
                     ATP-binding protein, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_005220425.1"
                     /db_xref="GI:379704051"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818200"
                     /translation="MNAEYLIEVDGLKKYFPIRDGVFGQETGQLRAVDGVSFNIRKGT
                     IFGLVGESGSGKTTVGRTLLGLYDKTAGNVKFRGEDLHSLKPKQLKALRPKIQLVFQD
                     PYSSLNPRIRIGDAIGEAMLEHKRCTRAQLPEKVRDVMKICGLSPLHYNRFPHEFSGG
                     QRQRIGIARALILQPDFIIADEPISALDVSIQAQIINLFADLRDDHGVTFLFISHDLG
                     VVEHLCDDVAVMYLGQLVETASRDALFRKPLHPYTQALLAAVPTLDPDSEPVAMVSGE
                     IPDPSKPPAGCRFHTRCPRATDHCRQDIPVLREIESGHHVACHQV"
     misc_feature    complement(127798..128754)
                     /locus_tag="Rahaq2_4691"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppF; PRK11308"
                     /db_xref="CDD:236898"
     misc_feature    complement(128044..128745)
                     /locus_tag="Rahaq2_4691"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(128590..128613)
                     /locus_tag="Rahaq2_4691"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(128116..128118,128215..128220,
                     128458..128460,128587..128595,128599..128604))
                     /locus_tag="Rahaq2_4691"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(128458..128469)
                     /locus_tag="Rahaq2_4691"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(128263..128292)
                     /locus_tag="Rahaq2_4691"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(128215..128232)
                     /locus_tag="Rahaq2_4691"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(128197..128208)
                     /locus_tag="Rahaq2_4691"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(128110..128130)
                     /locus_tag="Rahaq2_4691"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(127804..128061)
                     /locus_tag="Rahaq2_4691"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(128757..129761)
                     /locus_tag="Rahaq2_4692"
                     /note="IMG reference gene:2506711716"
                     /db_xref="GeneID:11818201"
     CDS             complement(128757..129761)
                     /locus_tag="Rahaq2_4692"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter,
                     ATP-binding protein, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_005220426.1"
                     /db_xref="GI:379704052"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818201"
                     /translation="MTQPLIRFNQLSLSFSSDQGRVRAVQDVTFDVQAGQTVGIVGES
                     GCGKSVTAMSLMGLLPPQAARIDGGEILFQGQNLLKLRPSQMADLRGNQLAMIFQEPM
                     TALNPVLTLGEQLVEPRIRHLGESPKLAWTHATKMITEVGLARAESLMTSYPHQLSGG
                     MLQRIMIAMALSCKPQLLIADEPTTALDVTVQAQILRLLREQAQQNHMALMLITHDLG
                     VIAQMADHVVVMYAGKIVEQGATAQVLRNPLHPYTQGLIASRPTPGERRRRLYSIPGQ
                     VPDLAALPPYCAFTERCARATDRCRQGIPPLEGQYRQAACFYSGLSAVSDNENRGLQP
                     "
     misc_feature    complement(128808..129749)
                     /locus_tag="Rahaq2_4692"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppD; COG0444"
                     /db_xref="CDD:223521"
     misc_feature    complement(129045..129749)
                     /locus_tag="Rahaq2_4692"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(129615..129638)
                     /locus_tag="Rahaq2_4692"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(129117..129119,129216..129221,
                     129465..129467,129612..129620,129624..129629))
                     /locus_tag="Rahaq2_4692"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(129465..129476)
                     /locus_tag="Rahaq2_4692"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(129264..129293)
                     /locus_tag="Rahaq2_4692"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(129216..129233)
                     /locus_tag="Rahaq2_4692"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(129198..129209)
                     /locus_tag="Rahaq2_4692"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(129111..129131)
                     /locus_tag="Rahaq2_4692"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(128808..129062)
                     /locus_tag="Rahaq2_4692"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(129758..130705)
                     /locus_tag="Rahaq2_4693"
                     /note="IMG reference gene:2506711717"
                     /db_xref="GeneID:11818202"
     CDS             complement(129758..130705)
                     /locus_tag="Rahaq2_4693"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220427.1"
                     /db_xref="GI:379704053"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818202"
                     /translation="MFGSLFSTNRRLREAQIPMLAQATPSPWRQAWRALRQNRLAMFC
                     LILLLVMAVWCIAGPDYSPWRDDATDALMINKAPNAEHWLGTDFLGRDVYTRLLLAGR
                     ISLIIGMLTMLLSVTLGYLMGAVSGYLGGVADKIIMRFADLVMTIPSLPLLIVMGAML
                     SELDFSPDSRVYMVIVMLSLLEWPKLARLVRGQILSLRERDFMLATQVLGLSSRRRLF
                     GHLLPNTVPILVVMATMAVANAILSESALSYLGLGVVPPTPSWGNMMDAANSLIDFQR
                     RPWLWMPPGVAIFITVIAINVLGDGLRDALDPKLKRSKT"
     misc_feature    complement(129770..130654)
                     /locus_tag="Rahaq2_4693"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(130469..130630)
                     /locus_tag="Rahaq2_4693"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    complement(129800..130402)
                     /locus_tag="Rahaq2_4693"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(129800..129805,129812..129817,
                     129824..129829,129833..129838,129845..129850,
                     129914..129919,129959..129964,129971..129982,
                     130001..130003,130010..130015,130055..130057,
                     130106..130108,130115..130120,130130..130132,
                     130136..130141,130148..130150,130154..130156,
                     130160..130165,130235..130237,130241..130246,
                     130253..130282,130286..130297,130325..130327,
                     130340..130345,130352..130357))
                     /locus_tag="Rahaq2_4693"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(129965..129982,130235..130279))
                     /locus_tag="Rahaq2_4693"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(129848..129850,129914..129916,
                     129923..129925,129962..129964,130178..130180,
                     130235..130237))
                     /locus_tag="Rahaq2_4693"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(130034..130036,130046..130051,
                     130067..130105))
                     /locus_tag="Rahaq2_4693"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(130705..131664)
                     /locus_tag="Rahaq2_4694"
                     /note="IMG reference gene:2506711718"
                     /db_xref="GeneID:11818203"
     CDS             complement(130705..131664)
                     /locus_tag="Rahaq2_4694"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220428.1"
                     /db_xref="GI:379704054"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818203"
                     /translation="MRNFILRRLLQTIPMLFLASLLIFMLFAKTPGDFIDGNITLTAQ
                     RAAELKALYGLDQPLLSRYLHWLGNLLRGDLGFSLQYQIPVSQLLDQYIWNSFLLATI
                     AMVLYWGIALAVGIVSAMKPYSLFDHVVSVVIFAAMSFPTFFLCLLLIKWFAVDLHWL
                     PVGGMTNTGSDVTGWAWVMQVAAHLVLPVVALVMLQAGSLTRYFRASMLDVVRMDFIR
                     TARAKGLRERTVILKHALRNALLPIITLLGFELPGLFSGALITEKVFNWPGAGHIHID
                     SLAARDYPVLMGFTLFLAVLTILGNLIADVLYAWADPRIRVRS"
     misc_feature    complement(130711..131664)
                     /locus_tag="Rahaq2_4694"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(130768..131388)
                     /locus_tag="Rahaq2_4694"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(130768..130773,130780..130785,
                     130792..130797,130801..130806,130813..130818,
                     130846..130851,130876..130881,130888..130899,
                     130918..130920,130927..130932,130972..130974,
                     131023..131025,131032..131037,131047..131049,
                     131053..131058,131065..131067,131071..131073,
                     131077..131082,131215..131217,131221..131226,
                     131233..131262,131266..131277,131308..131310,
                     131323..131328,131335..131340))
                     /locus_tag="Rahaq2_4694"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(130882..130899,131215..131259))
                     /locus_tag="Rahaq2_4694"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(130816..130818,130846..130848,
                     130855..130857,130879..130881,131095..131097,
                     131215..131217))
                     /locus_tag="Rahaq2_4694"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(130951..130953,130963..130968,
                     130984..131022))
                     /locus_tag="Rahaq2_4694"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(131716..133428)
                     /locus_tag="Rahaq2_4695"
                     /note="IMG reference gene:2506711719"
                     /db_xref="GeneID:11818204"
     CDS             complement(131716..133428)
                     /locus_tag="Rahaq2_4695"
                     /note="PFAM: Bacterial extracellular solute-binding
                     proteins, family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005220429.1"
                     /db_xref="GI:379704055"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="GeneID:11818204"
                     /translation="MTTLLRSAFAPAAQRARRTASFKIALLASAVMLSSFAFADDVLK
                     EGITPATDASQVPAAAKLRTDTVIAGISEPQGIFNPYFFVNGWDENVTNVIFARLIDW
                     DSQGKLVPGLAQSWTVSPDGKTYTIKLRPDLKFSDGSSLTAEDVAFTLTVLYDPKYDG
                     DTDITLAHIAGGEEYKQGKAESISGLKVIDPLTLQVTTTQPGATTLQKIGGPVLSKAY
                     YGKGYQRGNLDYLRTLHGKPLGNGPYVYDKYIPGQEIRFHANANYYRGVPPTPRFIYR
                     VTNPSTNFQLFQTGDTDYDAFTSRPDDIEQLKMLGFANINLYGSSDYSKIEFNVHRPA
                     LQDVKVRQALIYGLDRQKLIDVVYQGYGTVAIEPIAPISWAYNTDGVNPYKFDPAQAS
                     KLLDEAGWKVGGDGIRVKDGKRLELTLLVSKKVLNDALIPIAKEDYQKIGVLLKPQVV
                     DFNALMSQRKAGNYDLASFSTSTLNDPHDGVWDYYSTEATESGYNNPEVDKLINEGNA
                     TLDIEKRKPIYHELYKVLANDPPAILLGNRKILSASSARVTGFKPDIYNGLTGSLPDV
                     KIVK"
     misc_feature    complement(131767..133383)
                     /locus_tag="Rahaq2_4695"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(131776..133233)
                     /locus_tag="Rahaq2_4695"
                     /note="The substrate-binding domain of an ABC-type
                     nickel/oligopeptide-like import system contains the type 2
                     periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like; cd00995"
                     /db_xref="CDD:173853"
     gene            complement(133759..133980)
                     /locus_tag="Rahaq2_4696"
                     /note="IMG reference gene:2506711720"
                     /db_xref="GeneID:11818205"
     CDS             complement(133759..133980)
                     /locus_tag="Rahaq2_4696"
                     /note="PFAM: Ogr/Delta-like zinc finger;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="Ogr/Delta-like zinc finger"
                     /protein_id="YP_005220430.1"
                     /db_xref="GI:379704056"
                     /db_xref="InterPro:IPR007684"
                     /db_xref="GeneID:11818205"
                     /translation="MMHCPKCQHAAHARSSRYLSLNTKERYHQCQNINCSCTFKTHES
                     IADIIVEPGTVHAVQLHPDKHQQQSLQMH"
     misc_feature    complement(133765..133980)
                     /locus_tag="Rahaq2_4696"
                     /note="Ogr/Delta-like zinc finger; Region: Ogr_Delta;
                     cl19592"
                     /db_xref="CDD:267945"
     gene            134122..134526
                     /locus_tag="Rahaq2_4697"
                     /note="IMG reference gene:2506711721"
                     /pseudo
                     /db_xref="GeneID:11818206"
     gene            complement(134604..136040)
                     /locus_tag="Rahaq2_4698"
                     /note="IMG reference gene:2506711722"
                     /db_xref="GeneID:11818207"
     CDS             complement(134604..136040)
                     /locus_tag="Rahaq2_4698"
                     /note="PFAM: SEFIR domain"
                     /codon_start=1
                     /transl_table=11
                     /product="SEFIR domain-containing protein"
                     /protein_id="YP_005220431.1"
                     /db_xref="GI:379704057"
                     /db_xref="InterPro:IPR013568"
                     /db_xref="GeneID:11818207"
                     /translation="MESPKLFISYSWSNPTHEQWVIELANELTESGVHVILDKWDLKE
                     GHDSVAFMEKMVTDSDISKVAIICDEVYALKADGRAGGVGTETQIISREVYENQEQGK
                     FVAIISERDSQGKAFLPTYYKSRIYIDLSQPDSYADNFEKLLRWVYDKPLYTRPTIGK
                     QPSFLGESEGISLGTTSTYKRAVSAIKENKTFSAGALDEYFSTFITNLESFRIGKKEG
                     EFDDQIIDNIDKFLPYRNEIIMLFITIAQYAPKEENILKIHRFLEGLVPYMHRPQNVN
                     SWQEWDFDNFKFIIHEVFLYSIAIFMKFERFAEVNILLTQKYYVPGNTDYGKNTMVGY
                     QVFREHLHSMQHRNSRLNLRRLSLHADLLEQRSKSSGLEFRYLMQADFILFIRSEIQG
                     DDYYSRWFPTTLLYVGHFHSAFEVFARSSSKSYFDKVKCILAIDKPSDMNELMAAYET
                     GEKILPRWDFESFTPSQLLGFEKLAKDA"
     misc_feature    complement(<135720..136031)
                     /locus_tag="Rahaq2_4698"
                     /note="SEFIR domain; Region: SEFIR; pfam08357"
                     /db_xref="CDD:254756"
     gene            complement(136193..136327)
                     /locus_tag="Rahaq2_4699"
                     /note="IMG reference gene:2506711723"
                     /db_xref="GeneID:11818208"
     CDS             complement(136193..136327)
                     /locus_tag="Rahaq2_4699"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220432.1"
                     /db_xref="GI:379704058"
                     /db_xref="GeneID:11818208"
                     /translation="MTKNVETSGMLWCFDLCFERSVILRRLCKVGRGLMRSGLADTHI
                     "
     gene            complement(136517..136705)
                     /locus_tag="Rahaq2_4700"
                     /note="IMG reference gene:2506711724"
                     /db_xref="GeneID:11818209"
     CDS             complement(136517..136705)
                     /locus_tag="Rahaq2_4700"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220433.1"
                     /db_xref="GI:379704059"
                     /db_xref="GeneID:11818209"
                     /translation="MEGLQTAALLERIALIVKLATSTDCDHDKREMVAIWIAEMAVAE
                     KEELLAVIFDVNGAGKIH"
     gene            136918..137409
                     /locus_tag="Rahaq2_4701"
                     /note="IMG reference gene:2506711725"
                     /db_xref="GeneID:11818210"
     CDS             136918..137409
                     /locus_tag="Rahaq2_4701"
                     /note="PFAM: Protein of unknown function (DUF796);
                     TIGRFAM: type VI secretion system effector, Hcp1 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="YP_005220434.1"
                     /db_xref="GI:379704060"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="GeneID:11818210"
                     /translation="MAIPAYLWLKDDGGADIKGSVDVRGREGSIEIVGFTHDVSIPND
                     NNTGKPTGTRIHAPFTFDKEIDSSTPYIYKALCTGQTLKSAEIKYYRINDAGQEVEYF
                     NTLLENVKIIGIIPMMHDIKSAYGEKRNHIEYVELRYEKITWKYLDGNIQHSDSWNER
                     ATA"
     misc_feature    136921..137397
                     /locus_tag="Rahaq2_4701"
                     /note="type VI secretion system effector, Hcp1 family;
                     Region: VI_effect_Hcp1; TIGR03344"
                     /db_xref="CDD:213799"
     gene            137422..137778
                     /locus_tag="Rahaq2_4702"
                     /note="IMG reference gene:2506711726"
                     /db_xref="GeneID:11818211"
     CDS             137422..137778
                     /locus_tag="Rahaq2_4702"
                     /note="manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220435.1"
                     /db_xref="GI:379704061"
                     /db_xref="GeneID:11818211"
                     /translation="MVWTYKQSTGEMFHDGVLVGKGYSGVLTNKNNPDRQHVRGMGPL
                     PRGTYRIGSTTASKGPMTIELHQTSGDSFGRSLFRIHGERTHGPSGFASEGCIILPPS
                     VRHQIRGSSESLEVVR"
     misc_feature    137488..>137712
                     /locus_tag="Rahaq2_4702"
                     /note="Protein of unknown function (DUF2778); Region:
                     DUF2778; pfam10908"
                     /db_xref="CDD:256198"
     gene            137775..138281
                     /locus_tag="Rahaq2_4703"
                     /note="IMG reference gene:2506711727"
                     /db_xref="GeneID:11818212"
     CDS             137775..138281
                     /locus_tag="Rahaq2_4703"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220436.1"
                     /db_xref="GI:379704062"
                     /db_xref="GeneID:11818212"
                     /translation="MRFFAALLLFPVMAFAAATPQKLRNEIQKYGESEFSEKISSDDW
                     KTALDNIASGQKDWISLAPDLAPVINQQQAEQLSEALYYAIAPNSKETLNTLAILDKH
                     KYKHQQGSVLSCVSPLNKPKEEMMRIYNETRLALLDVPGVESATCLWSLEGWMEQVKQ
                     EDASKINK"
     gene            complement(138654..139565)
                     /locus_tag="Rahaq2_4704"
                     /note="IMG reference gene:2506711728"
                     /pseudo
                     /db_xref="GeneID:11818213"
     gene            complement(139994..140980)
                     /locus_tag="Rahaq2_4705"
                     /note="IMG reference gene:2506711729"
                     /db_xref="GeneID:11818214"
     CDS             complement(139994..140980)
                     /locus_tag="Rahaq2_4705"
                     /note="PFAM: Initiator Replication protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein involved in initiation of plasmid
                     replication"
                     /protein_id="YP_005220437.1"
                     /db_xref="GI:379704063"
                     /db_xref="InterPro:IPR000525"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818214"
                     /translation="MELNKLTVVQGNDLLEGAYSVTLDEMRLLNLALAQIDSRKPQPD
                     TLYRLFPQDYQRIYGVNPTSSHRQLREAAESLMKKPVTIYKPDVKTGKVRTVQLSWFS
                     RLEYVSSDDHSAVVLRFGQDVAPYLYELKESFTKLNFANIAKLDTPFSVRLYGWLIKA
                     KNLYGRRSGKAIEVTLDLNWMREKAGLAGKYEDYRDFRQKLLEPTINRINANTDISVV
                     WEPVKQGRTVVSIKFAYVDESAPEASKPLRPRLPRRPRAVAGSALEGEWARRCISIFE
                     EYREKLSAYDVDEKATLPDLRKLSGWYKLIGEKNKQKEILAEVSARSKKAAA"
     misc_feature    complement(140282..140971)
                     /locus_tag="Rahaq2_4705"
                     /note="Initiator Replication protein; Region: Rep_3;
                     pfam01051"
                     /db_xref="CDD:250324"
     gene            complement(142357..142566)
                     /locus_tag="Rahaq2_4706"
                     /note="IMG reference gene:2506711730"
                     /db_xref="GeneID:11818215"
     CDS             complement(142357..142566)
                     /locus_tag="Rahaq2_4706"
                     /note="PFAM: ParG"
                     /codon_start=1
                     /transl_table=11
                     /product="ParG"
                     /protein_id="YP_005220438.1"
                     /db_xref="GI:379704064"
                     /db_xref="InterPro:IPR010985"
                     /db_xref="InterPro:IPR015354"
                     /db_xref="GeneID:11818215"
                     /translation="MKMKLGQHRQLTTALEAVSKPPASVKKLQTNIDEELHRRFKTSC
                     FLQDREMKDVLTELIEAWLITNERT"
     misc_feature    complement(142366..142563)
                     /locus_tag="Rahaq2_4706"
                     /note="ParG; Region: ParG; pfam09274"
                     /db_xref="CDD:117819"
     gene            complement(142563..143189)
                     /locus_tag="Rahaq2_4707"
                     /note="IMG reference gene:2506711731"
                     /db_xref="GeneID:11818216"
     CDS             complement(142563..143189)
                     /locus_tag="Rahaq2_4707"
                     /note="PFAM: CobQ/CobB/MinD/ParA nucleotide binding
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning ATPase"
                     /protein_id="YP_005220439.1"
                     /db_xref="GI:379704065"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="GeneID:11818216"
                     /translation="MAAKIISFLNGKGGVGKTTTSINIATCLARQGHKVVMVDTDPQG
                     SISNWYDESKCQFDLAEAASEKEVYTVRKQLKEYDYVVIDGAAAISAISSAAVMVSDL
                     VLIPVTPSPLDFAACGAILAVVEARENLQPVIARFLITKKVASAKMLEVLKESIADTG
                     VPALRTGTTQRQVYIRTMMDGGTVFDTTDGNAKGEIEIMTKEITELLK"
     misc_feature    complement(142575..143180)
                     /locus_tag="Rahaq2_4707"
                     /note="ParA-like protein; Provisional; Region: PHA02518"
                     /db_xref="CDD:222854"
     misc_feature    complement(142770..143177)
                     /locus_tag="Rahaq2_4707"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(143136..143156)
                     /locus_tag="Rahaq2_4707"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(142938..142940,143136..143138))
                     /locus_tag="Rahaq2_4707"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            complement(144564..145649)
                     /locus_tag="Rahaq2_4708"
                     /note="IMG reference gene:2506711732"
                     /db_xref="GeneID:11818217"
     CDS             complement(144564..145649)
                     /locus_tag="Rahaq2_4708"
                     /note="PFAM: ABC transporter; TOBE domain;
                     TIGRFAM: spermidine/putrescine ABC transporter ATP-binding
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding subunit"
                     /protein_id="YP_005220440.1"
                     /db_xref="GI:379704066"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR008995"
                     /db_xref="InterPro:IPR013611"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818217"
                     /translation="MRTYVSFKNIKKSYDGEKLVVKNLNLDVREGEFLTLLGPSGSGK
                     TTSLMMLAGFETPTQGEILLRDKPLHNLPPHQRDIGMVFQNYALFPHMTVAENLAFPL
                     TIRRLNKSDIKEKVDRILDMVKLKSLADRYPAQMSGGQQQRVALARALVFEPKLVLMD
                     EPLGALDKQLREHMQMEIKQLHKMLDLTIVYVTHDQSEAMTMSDRVAVFNDGVIQQMD
                     SPSVIYEKPDNAFVAQFIGENNSLLATNNAAEGDYYRASLDDGTQLRAVKIRPSSPGK
                     KILLSIRPERISVNSPQPGMEQVKARIQQFIYLGDHVRMMTEVAGQDNFMVKLSAAAM
                     DPDWKPGSEVLLSWQPEHLRALDVITH"
     misc_feature    complement(144576..145649)
                     /locus_tag="Rahaq2_4708"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    complement(144939..145637)
                     /locus_tag="Rahaq2_4708"
                     /note="ATP-binding cassette domain of the polyamine
                     transporter; Region: ABC_PotA_N; cd03300"
                     /db_xref="CDD:213267"
     misc_feature    complement(145515..145538)
                     /locus_tag="Rahaq2_4708"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213267"
     misc_feature    complement(order(145068..145070,145167..145172,
                     145398..145400,145512..145520,145524..145529))
                     /locus_tag="Rahaq2_4708"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213267"
     misc_feature    complement(145398..145409)
                     /locus_tag="Rahaq2_4708"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213267"
     misc_feature    complement(145215..145244)
                     /locus_tag="Rahaq2_4708"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213267"
     misc_feature    complement(145167..145184)
                     /locus_tag="Rahaq2_4708"
                     /note="Walker B; other site"
                     /db_xref="CDD:213267"
     misc_feature    complement(145149..145160)
                     /locus_tag="Rahaq2_4708"
                     /note="D-loop; other site"
                     /db_xref="CDD:213267"
     misc_feature    complement(145062..145082)
                     /locus_tag="Rahaq2_4708"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213267"
     misc_feature    complement(144582..144812)
                     /locus_tag="Rahaq2_4708"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            complement(145911..147455)
                     /locus_tag="Rahaq2_4709"
                     /note="IMG reference gene:2506711733"
                     /db_xref="GeneID:11818218"
     CDS             complement(145911..147455)
                     /locus_tag="Rahaq2_4709"
                     /note="PFAM: Aminotransferase class I and II; Bacterial
                     regulatory proteins, gntR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator with HTH domain and
                     aminotransferase domain"
                     /protein_id="YP_005220441.1"
                     /db_xref="GI:379704067"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11818218"
                     /translation="MRSLLSDLILQRLTELSDALPGTLNKRLYQALQQAIFDGSISPG
                     SRLPASRDLAKELNISRNTVLAAYEQLQAEGYIQTRSGSGTFVPADLPKDGVFADKTP
                     TRCTPVRSHVSLSKRGSQLLTRTGVASHQWGAFMPGVPDVTKFPHDIWRKLQNRLSRR
                     LSPEFLTYSGHGGCPQLQHALADYLRIARSVDCTADQILITAGTHQALDLLAKMLCDP
                     GDTAWIEEPSYWGIRNVLTINGVDIQPVPVDENGLNPPDSPPQDRAPKLICVTPSHHY
                     PLGSVMSLARRQKILAIASQQGSWVVEDDYDSEFRYSGSPIPALQGLSSDAPVIYIGT
                     FSKTMYPAMRISYVVLPRPLASRLKIAHSELYRAGNGLTQLTLAQFIREGHYAAHIRR
                     MRLLYGRRRNALIRLIEQELGPEFLCENSNAGLHLILSLPDSIDDVALSAELEQKKIL
                     TRPLSAYYLRPAPRRGLLLGYGCVPEEEIETTFGHIVDCLRRRLQSGGAIPLTDNEAL
                     PKRGIA"
     misc_feature    complement(145968..147395)
                     /locus_tag="Rahaq2_4709"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(147195..147380)
                     /locus_tag="Rahaq2_4709"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(147201..147212,147216..147221,
                     147249..147251,147258..147263,147267..147281,
                     147303..147308,147312..147314))
                     /locus_tag="Rahaq2_4709"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(146016..147044)
                     /locus_tag="Rahaq2_4709"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(146424..146426,146445..146450,
                     146454..146456,146535..146537,146628..146630,
                     146769..146771,146841..146849))
                     /locus_tag="Rahaq2_4709"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(146328..146330,146337..146339,
                     146424..146432,146556..146558,146739..146741,
                     146838..146840))
                     /locus_tag="Rahaq2_4709"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(146445..146447)
                     /locus_tag="Rahaq2_4709"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            147601..148869
                     /locus_tag="Rahaq2_4710"
                     /note="IMG reference gene:2506711734"
                     /db_xref="GeneID:11818219"
     CDS             147601..148869
                     /locus_tag="Rahaq2_4710"
                     /note="PFAM: Aminotransferase class-III;
                     TIGRFAM: 4-aminobutyrate aminotransferase, prokaryotic
                     type"
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="YP_005220442.1"
                     /db_xref="GI:379704068"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11818219"
                     /translation="MSHSELEKRRKEATPRGVGVMCDFYAAKAENATLWDEQGREYID
                     FTAGIAVLNTGHRHPKIVEAIRNQLDLFTHTSYQIVPYASFVDLAERINMISPVSGKA
                     KTTFFSTGAEAVENAVKIARSATGRPGIITFSGAFHGRTLLTMALTGKVVPYKVGFGP
                     FPASVFHAQYPNAVHGVTTEMALDSIERIFRSDIAPQQIAAILYEPVQGEGGFNIAPE
                     DFVKGLREICDRHGIVMIADEVQSGFARTGKMFASEYYPDAKPDIVTMAKSLGGGLPI
                     SGVTGRAELMDAPEPGGLGGTYAGNPLAVASALAVLDIIEEEKLCERANRLGAELAEV
                     LEKAKANCAALVDVRARGSMVAAEFNDPSTGKPSSELTRQYLRKALDAGLLMLSCGVH
                     GNVIRFLYPLTIPDVQFKAALTILSRVLAD"
     misc_feature    147616..148860
                     /locus_tag="Rahaq2_4710"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    147679..148860
                     /locus_tag="Rahaq2_4710"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(147925..147933,148009..148014,148018..148020,
                     148213..148215,148312..148314,148318..148323,
                     148402..148404)
                     /locus_tag="Rahaq2_4710"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(147928..147933,148009..148014,148213..148215,
                     148312..148314,148321..148323,148402..148404)
                     /locus_tag="Rahaq2_4710"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    148402..148404
                     /locus_tag="Rahaq2_4710"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            149143..150171
                     /locus_tag="Rahaq2_4711"
                     /note="IMG reference gene:2506711735"
                     /db_xref="GeneID:11818220"
     CDS             149143..150171
                     /locus_tag="Rahaq2_4711"
                     /note="PFAM: Bacterial extracellular solute-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine-binding periplasmic
                     protein"
                     /protein_id="YP_005220443.1"
                     /db_xref="GI:379704069"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="GeneID:11818220"
                     /translation="MFKKIVLTTLIAGMVFQAQAGSLTVISFGGLNKDAQDKAFYKPF
                     AAAGKGTIEPGEYNGEMARIRAMVETKQVGWDVVEVESPELIRGCDEGLFEPLDWSKL
                     GDKAQYVPGAVTECGAGIFLWSTVLTYDASKLKKAPTSWADFWDVKDFPGKRALRKSA
                     KFTLEIALLADGVKREDIYKVLATPAGVERAFKKLDQIKPNIQWWESGAQPLQWLVSG
                     DVVMTSAYNGRVSAAQGEGHDFKMVWDNSLYDLDSWAIVKGSQHKDLAEQFIAFANKP
                     ENQKVFAETIPYGPTEKSVTGMIDPKYAQNLPTAEKNLAGALQVDTHFWIEHGEDLEQ
                     RFNAWSSK"
     misc_feature    149155..150159
                     /locus_tag="Rahaq2_4711"
                     /note="Spermidine/putrescine-binding periplasmic protein
                     [Amino acid transport and metabolism]; Region: PotD;
                     COG0687"
                     /db_xref="CDD:223759"
     gene            150342..151607
                     /locus_tag="Rahaq2_4712"
                     /note="IMG reference gene:2506711736"
                     /db_xref="GeneID:11818221"
     CDS             150342..151607
                     /locus_tag="Rahaq2_4712"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter permease
                     I"
                     /protein_id="YP_005220444.1"
                     /db_xref="GI:379704070"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818221"
                     /translation="MSQTEMLTTPVPEESAEGPTLRQRLRKVDAAYTRRSLLLIAPLL
                     LFVIVSFLFPIASILGKSVTNPELGATMPETVALLSHWDGKSVPDEATFSALVADLRN
                     ARNSGQMATIAKRLSYEDNRYRSLITGTLRHVPEGGGAVREPLIRSMPLWGELSTWQT
                     VKRASAPVTSLYLLSVFDRKVDADSGKIVALPPDQALYVNVLLRTLWMALVVTVCCVA
                     LGYPLAYWLAKQPAGRANLLMILVLLPFWTSLIVRTASWIVLLQSGGLINRALLSTGI
                     IDHPLVMVFNRLGVYISMTHIMLPFIVLPLYAVMKGISPNYVRAAISLGAHPFTAFWR
                     VYVPQTYAGVTAGALLVFMMAMGYYITPALLGGPGDQMISYFVAFFTNTTMNWGMAAA
                     LGSQLLVIVVLLYIVYIRVTRTKAEIAAH"
     misc_feature    150945..151553
                     /locus_tag="Rahaq2_4712"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(150993..150998,151005..151010,151023..151025,
                     151053..151064,151068..151097,151104..151109,
                     151113..151115,151191..151196,151236..151238,
                     151242..151244,151251..151256,151260..151262,
                     151272..151277,151284..151286,151335..151337,
                     151377..151382,151389..151391,151410..151421,
                     151428..151433,151470..151475,151503..151508,
                     151515..151520,151524..151529,151536..151541,
                     151548..151553)
                     /locus_tag="Rahaq2_4712"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(151071..151115,151410..151427)
                     /locus_tag="Rahaq2_4712"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(151113..151115,151167..151169,151428..151430,
                     151464..151466,151473..151475,151503..151505)
                     /locus_tag="Rahaq2_4712"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(151287..151325,151341..151346,151356..151358)
                     /locus_tag="Rahaq2_4712"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            151619..152458
                     /locus_tag="Rahaq2_4713"
                     /note="IMG reference gene:2506711737"
                     /db_xref="GeneID:11818222"
     CDS             151619..152458
                     /locus_tag="Rahaq2_4713"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter permease
                     II"
                     /protein_id="YP_005220445.1"
                     /db_xref="GI:379704071"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818222"
                     /translation="MKHTMRQKGALILRLWRWCFNFYSAAILLFLIVPVLIIVPLSFN
                     AGSFLSYPLTGFSLRWYQTFFHSDEWLSSLGNSLLIAPLATLLATVLGVLASVGLVRG
                     EFRGKSLVMAILISPMIAPVVIIAVGMFFFFARVSLLNSYLGLVLAHALLGVPFVVIT
                     VVAILKNYDRNLSRAAASLGASPWTVFRKVTLPLIAPGVFSGALFAFAASFDEVVVTL
                     FLASPRQRTLPIQMFAGIRENLDPTIAAAASLMVGASLILLLVMELLRRRGERLRHSP
                     ATH"
     misc_feature    151631..152383
                     /locus_tag="Rahaq2_4713"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    151838..152380
                     /locus_tag="Rahaq2_4713"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(151886..151891,151898..151903,151916..151918,
                     151946..151957,151961..151990,151997..152002,
                     152006..152008,152084..152086,152093..152098,
                     152102..152104,152114..152119,152126..152128,
                     152177..152179,152219..152224,152231..152233,
                     152252..152263,152270..152275,152312..152317,
                     152345..152350,152357..152362,152366..152371,
                     152378..152380)
                     /locus_tag="Rahaq2_4713"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(151964..152008,152252..152269)
                     /locus_tag="Rahaq2_4713"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(152006..152008,152066..152068,152270..152272,
                     152306..152308,152315..152317,152345..152347)
                     /locus_tag="Rahaq2_4713"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(152129..152167,152183..152188,152198..152200)
                     /locus_tag="Rahaq2_4713"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            152546..153289
                     /locus_tag="Rahaq2_4714"
                     /note="IMG reference gene:2506711738"
                     /db_xref="GeneID:11818223"
     CDS             152546..153289
                     /locus_tag="Rahaq2_4714"
                     /note="PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005220446.1"
                     /db_xref="GI:379704072"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11818223"
                     /translation="MTDTTQKKTLLLTGASRGIGHATVKHFYAAGWRIFTASRQNWVD
                     ECPWAEGFLNHIHLDLEDIDSVQKALPMIKERLGGRLDALVDNAGISPKTPTGGRLGV
                     LDSDYATWLQVFNVNLFSTAILATGLFDELKAAKGSIINVTSIAGSKVHPFAGVAYAC
                     SKAALSTLTREMAHEFGPHGVRVNAIAPGEIDTAILSPGTQDIVERSVPLQRLGKAEE
                     VASLIHFLCTSGASYVNGAEIHVNGGQHV"
     misc_feature    152561..153286
                     /locus_tag="Rahaq2_4714"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    152576..153271
                     /locus_tag="Rahaq2_4714"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(152585..152587,152591..152602,152657..152665,
                     152717..152725,152804..152812,152891..152893,
                     152969..152977,153017..153019,153029..153031,
                     153107..153118,153122..153127)
                     /locus_tag="Rahaq2_4714"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(152894..152896,152975..152977,153017..153019,
                     153029..153031)
                     /locus_tag="Rahaq2_4714"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            153282..154346
                     /locus_tag="Rahaq2_4715"
                     /note="IMG reference gene:2506711739"
                     /db_xref="GeneID:11818224"
     CDS             153282..154346
                     /locus_tag="Rahaq2_4715"
                     /note="PFAM: Phosphotransferase enzyme family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative homoserine kinase type II (protein
                     kinase fold)"
                     /protein_id="YP_005220447.1"
                     /db_xref="GI:379704073"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="GeneID:11818224"
                     /translation="MSDTPSLLLTGLLTTEVPRVSTLQAENIAAQVYGLEGKAEVLGG
                     ERDSNFCLTTDPGHAYMLRFVNPAEVPAEVDFQTAILSHLALHDSQLPVPRLLQSRHG
                     ELTPQVKVAGQFLTLRAVSYLPGTAQYQVPRTPRLMHELGDALARLDIALRDFEHPGA
                     KRDLLWDISDMSRLEGGITQFTDPEQRRTITRVLETHRQKVVPASQQLRRQVIHNDLN
                     AHNVLVNSADPQRLAGIIDFGDALHAPLINELATALAYQLNSEGDDLFLYCRPMIAAY
                     TGRLPLTGAELDILPELVASRLALSLLIARHRAALYPQNRDYILRNQAHAWGSLSRLM
                     SLPFTQTDLIFRQSCAFEQK"
     misc_feature    153339..154322
                     /locus_tag="Rahaq2_4715"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     misc_feature    order(153426..153428,153462..153464,153468..153470,
                     153561..153563,153639..153650,153927..153929,
                     153939..153944,153948..153950,153987..153992,
                     154044..154046)
                     /locus_tag="Rahaq2_4715"
                     /note="active site"
                     /db_xref="CDD:240159"
     misc_feature    order(153426..153428,153462..153464,153468..153470,
                     153561..153563,153639..153650,153927..153929,
                     153939..153944,153948..153950,153987..153992)
                     /locus_tag="Rahaq2_4715"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240159"
     misc_feature    order(153927..153929,154044..154046)
                     /locus_tag="Rahaq2_4715"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240159"
     gene            154358..155614
                     /locus_tag="Rahaq2_4716"
                     /note="IMG reference gene:2506711740"
                     /db_xref="GeneID:11818225"
     CDS             154358..155614
                     /locus_tag="Rahaq2_4716"
                     /note="PFAM: Aminotransferase class-III"
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="YP_005220448.1"
                     /db_xref="GI:379704074"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11818225"
                     /translation="MLTSKQVSEGRQQFLGGGYRLFYQEPLHVVRGEGVWLYDSEGRR
                     YLDAYNNVASVGHCHPAVVEAIATQAAQLNTHTRYLNDAIVEFAEDFLTEFPPELRNL
                     TMTCTGSEANDLALRIARQVTGGQGVIVTRWAYHGVTSALAELSPSLGDGFEQGKNVW
                     LTDAPDTFRHPGKFAAGVERALDAMKQAGVKPAALLADTIFSSDGVFSPEPAEMQRAV
                     ARVRAAGGLFIADEVQPGFGRTGSQRWGFARYGVTPDLISLGKPMGNGHPVAGLVGRP
                     ELFTEFGRRQRYFNTFGGNPVSCRAAHAVLQILRREALQQNARMTGAILREGLQKLAK
                     RYPVIGDVRGDGLFIGVELVSDQYNTPAPERAAFVVNAMRRKRVLISATGPAANVLKI
                     RPPLVFQPEHATLLLETLAGVLAEMG"
     misc_feature    154388..155599
                     /locus_tag="Rahaq2_4716"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    154412..155605
                     /locus_tag="Rahaq2_4716"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(154676..154684,154760..154765,154769..154771,
                     154949..154951,155048..155050,155054..155059,
                     155138..155140)
                     /locus_tag="Rahaq2_4716"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(154679..154684,154760..154765,154949..154951,
                     155048..155050,155057..155059,155138..155140)
                     /locus_tag="Rahaq2_4716"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    155138..155140
                     /locus_tag="Rahaq2_4716"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(155744..156490)
                     /locus_tag="Rahaq2_4717"
                     /note="IMG reference gene:2506711741"
                     /db_xref="GeneID:11818226"
     CDS             complement(155744..156490)
                     /locus_tag="Rahaq2_4717"
                     /note="PFAM: Bacterial regulatory proteins, gntR family;
                     FCD domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220449.1"
                     /db_xref="GI:379704075"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818226"
                     /translation="MLYNRFPRPYPNSGCAHIICYGELLNYPISSINHAYLGSSVYAT
                     LREALITGRLKPNDRLRIRELAEQVGTSVTPVRDAILQLAKEQALEMRTPKDIRVPQL
                     DEQQYQEIRTLRLELEGLGAEKAAQSVTEYELQRIAQNIENNRQAISNEDLPEALRLN
                     SEFHLMLAQSARMPLLSNFIDSLWMRTGPLIAQAYAHFSERMAIEHHEEILIALRKGD
                     GATARRAIQEDILDGSQKMVEFLAVGREKA"
     misc_feature    complement(155747..156382)
                     /locus_tag="Rahaq2_4717"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    complement(156215..156370)
                     /locus_tag="Rahaq2_4717"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    complement(order(156215..156220,156248..156250,
                     156257..156262,156266..156280,156302..156307,
                     156308..156310))
                     /locus_tag="Rahaq2_4717"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(155801..156166)
                     /locus_tag="Rahaq2_4717"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(156593..158050)
                     /locus_tag="Rahaq2_4718"
                     /note="IMG reference gene:2506711742"
                     /db_xref="GeneID:11818227"
     CDS             complement(156593..158050)
                     /locus_tag="Rahaq2_4718"
                     /note="PFAM: Sugar (and other) transporter;
                     TIGRFAM: MFS transporter, sugar porter (SP) family"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter, sugar porter family"
                     /protein_id="YP_005220450.1"
                     /db_xref="GI:379704076"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818227"
                     /translation="MSKKINSGGQDEAAKASQPTEPLVKVIAFIATLGGLLFGYDTGV
                     IAGALLFMKHDLHLTSLTTGMVTSFLILGSAVGAVCAGRVADRFGRKKVILVMALIFM
                     AGSLGCATAPNVVIMIICRFILGLAVGGAAAIVPIYIAEIVPSHRRWQFVTLQELMIV
                     SGQLIAYTSNAAINEVWGGETTWRWMLGVACVPAVVLWVGMLFLPDTPRWYAMHGRYR
                     EARDVLERTRKASKVEKELSEIRSSMSSRSEKHSRRQKTISVWMKRLVFLGIGIAMLQ
                     QLSGVNTIMFYAPTMLQATGLSTNASLLATIANGVISVLMTFVGIMLLSRFGRRPLLL
                     TGQIGCTLTLLAIGLVTWLMPETVNGHPDTVRSYLVLGGMLVFLCFQQGALSPVTWLL
                     LSEIFPMRIRGMANGVSVFAMQMTNFSIAFMFPIMLESIGLTMSFFCFAAIGVAGGLF
                     AVIFAPETQGKTLEQIEKHFKKQLQDDPVPQEAGS"
     misc_feature    complement(156650..157969)
                     /locus_tag="Rahaq2_4718"
                     /note="Sugar (and other) transporter; Region: Sugar_tr;
                     pfam00083"
                     /db_xref="CDD:249572"
     misc_feature    complement(156686..157966)
                     /locus_tag="Rahaq2_4718"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(156800..156802,156809..156814,
                     156821..156826,156833..156838,156869..156871,
                     156878..156883,156893..156895,156902..156907,
                     156914..156916,157100..157102,157112..157114,
                     157121..157123,157133..157135,157145..157147,
                     157184..157186,157193..157198,157205..157210,
                     157217..157219,157562..157564,157580..157585,
                     157592..157597,157631..157633,157640..157645,
                     157652..157657,157664..157669,157805..157810,
                     157814..157819,157829..157831,157838..157843,
                     157850..157852,157901..157906,157910..157918,
                     157925..157927))
                     /locus_tag="Rahaq2_4718"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            158387..160762
                     /locus_tag="Rahaq2_4719"
                     /note="IMG reference gene:2506711743"
                     /db_xref="GeneID:11818228"
     CDS             158387..160762
                     /locus_tag="Rahaq2_4719"
                     /note="PFAM: Molybdopterin oxidoreductase; Molydopterin
                     dinucleotide binding domain; Molybdopterin oxidoreductase
                     Fe4S4 domain;
                     TIGRFAM: anaerobic dimethyl sulfoxide reductase, A
                     subunit, DmsA/YnfE family; molybdopterin guanine
                     dinucleotide-containing S/N-oxide reductases"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic dimethyl sulfoxide reductase subunit
                     A"
                     /protein_id="YP_005220451.1"
                     /db_xref="GI:379704077"
                     /db_xref="InterPro:IPR006655"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="GeneID:11818228"
                     /translation="MKNKCDIISNVTRRDFVKVSSMVAALPLVGFKFSHAADKSSVTS
                     SGLVPSPVNVVATCSTFDCGGKCDIRAHVQDGAVIQITTRPDAELDPDMPVMRACVRG
                     RSYRKFVYHPDRLKYPMKRVGKRGEGKFVRISWDEATTLIADNLQRITKKYGPSSRYV
                     HVGTAVSGGAFSGDTMARRLLNLTGGHLSSYHSVSMGNTAAATPYTYGTAASGNTLDT
                     LADTPLVILWGHNPTETIFGHTNHYFQQMKQNGTRFIVVDPRYSDTASSLADEWIPLR
                     PSTDNALMDAMMYVIVSENLHDNAFIERYTLGFDESSMPEDVPPDESLMSYLTGVKDG
                     VVKTPEWAEVITHVPAQTIRRLAREYATTKPAALIQGWGPQRHNCGERTARGSTLLAT
                     LTGNVGIKGGWAGGYGGIGNRKFTTGPEMPDNPVKQKISVMNWVQAADDASLVTPQDG
                     LTGGDKLDSNIRILFSLAGNYLANQNPDIHQAVKVLEDESKIEFIVASDLYLTPSAKY
                     VDLLLPETSFMERWNIGETWGTGNYLMLSEKLIEPPFESRSDYDWLREVAAKLGVEQE
                     FSQGRTEKEWITHIWEKTRQAMPDEKLPTFKELLVTRRHLFKSEPYVAFEDNIRDPKN
                     HPFQTPSGKIEIFSRRLYDMHHPEIPALSHYVPAHEGPEDPLAEKFPLQMITWKGKNR
                     ANSTQYANPWLQEVQEQKLWINPLDAHRRGIAQGDLVRIHNDRGVTQIPAEVTQRIMP
                     GVVAMQAGAWWQPDARGVDHGGCANVLSSARITALAKGNSHQTMLVEVIKA"
     misc_feature    158417..160759
                     /locus_tag="Rahaq2_4719"
                     /note="anaerobic dimethyl sulfoxide reductase, A subunit,
                     DmsA/YnfE family; Region: dmsA_ynfE; TIGR02166"
                     /db_xref="CDD:233756"
     misc_feature    158555..160372
                     /locus_tag="Rahaq2_4719"
                     /note="This CD (MopB_DmsA-EC) includes the DmsA enzyme of
                     the dmsABC operon encoding the anaerobic dimethylsulfoxide
                     reductase (DMSOR) of Escherichia coli and other related
                     DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this
                     group has a  predicted...; Region: MopB_DmsA-EC; cd02770"
                     /db_xref="CDD:239171"
     misc_feature    order(158561..158563,158573..158575,158585..158587,
                     158681..158683)
                     /locus_tag="Rahaq2_4719"
                     /note="putative [Fe4-S4] binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239171"
     misc_feature    order(158969..158971,159071..159073,159086..159091,
                     159155..159163,159215..159220,159224..159226,
                     159500..159505,159512..159514,159788..159790,
                     159794..159796,159806..159808,159812..159814,
                     159878..159883,159893..159895,159947..159949,
                     160034..160036)
                     /locus_tag="Rahaq2_4719"
                     /note="putative molybdopterin cofactor binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:239171"
     misc_feature    160394..160756
                     /locus_tag="Rahaq2_4719"
                     /note="The MopB_CT_DmsA-EC CD includes the DmsA enzyme of
                     the dmsABC operon encoding the anaerobic dimethylsulfoxide
                     reductase (DMSOR) of Escherichia coli and other related
                     DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this
                     group has a  predicted...; Region: MopB_CT_DmsA-EC;
                     cd02794"
                     /db_xref="CDD:239195"
     misc_feature    order(160412..160414,160418..160423,160430..160432,
                     160436..160444,160625..160627,160679..160681,
                     160727..160732)
                     /locus_tag="Rahaq2_4719"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239195"
     gene            160759..161379
                     /locus_tag="Rahaq2_4720"
                     /note="IMG reference gene:2506711744"
                     /db_xref="GeneID:11818229"
     CDS             160759..161379
                     /locus_tag="Rahaq2_4720"
                     /note="PFAM: 4Fe-4S binding domain;
                     TIGRFAM: DMSO reductase, iron-sulfur subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase, iron-sulfur subunit"
                     /protein_id="YP_005220452.1"
                     /db_xref="GI:379704078"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="GeneID:11818229"
                     /translation="MSQFTDYPPVSDRQLGFYIDSSRCSGCKACQVACKDKNNLEVGR
                     RFRRIYEIKGGGFIPTGMGGMVNNVYAYTLSISCNHCNDPVCTKNCPTTAMHKRPGDG
                     IVRVNTDKCVGCGYCAWSCPYGAPQLNTQTGQMSKCDFCIDLQVTGQQPVCVSTCPLG
                     AIKFGPIDELRAKYGSLCDVQGLPDSALTQPNLVIKPHQGAEKRSQ"
     misc_feature    160798..161283
                     /locus_tag="Rahaq2_4720"
                     /note="DMSO reductase, iron-sulfur subunit; Region:
                     DMSO_dmsB; TIGR02951"
                     /db_xref="CDD:131996"
     misc_feature    160990..161253
                     /locus_tag="Rahaq2_4720"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     gene            161379..162227
                     /locus_tag="Rahaq2_4721"
                     /note="IMG reference gene:2506711745"
                     /db_xref="GeneID:11818230"
     CDS             161379..162227
                     /locus_tag="Rahaq2_4721"
                     /note="PFAM: DMSO reductase anchor subunit (DmsC)"
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase anchor subunit"
                     /protein_id="YP_005220453.1"
                     /db_xref="GI:379704079"
                     /db_xref="InterPro:IPR007059"
                     /db_xref="GeneID:11818230"
                     /translation="MLQEWPLIIFTLLLQLSVGSIVFITFTLIYGADNLNAQDKWRVA
                     TPAMLLAFITGALGLMVSTAHLGYPLNAFHALSHISSSWLSREIVFASLYLGMLGLTT
                     LIALMLKRVMTSLLLLASLLGLTDLFCMSAVYVHASVVTWMHVNTYVMFYGAALSLGA
                     IAGLWRISRCPWLPWQLARRLAGFGIGLLIAVTLMRLLEQLLYLGYLGGVNSDVITFP
                     HQPLVAFDQSQTLRLVAWVILIAGTGATAYSGQNHRIRGGLLSAGGILMLLAEIMLRF
                     NFFSIH"
     misc_feature    161379..162224
                     /locus_tag="Rahaq2_4721"
                     /note="DMSO reductase anchor subunit (DmsC); Region: DmsC;
                     cl17519"
                     /db_xref="CDD:248073"
     gene            162227..163102
                     /locus_tag="Rahaq2_4722"
                     /note="IMG reference gene:2506711746"
                     /db_xref="GeneID:11818231"
     CDS             162227..163102
                     /locus_tag="Rahaq2_4722"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220454.1"
                     /db_xref="GI:379704080"
                     /db_xref="InterPro:IPR012285"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="GeneID:11818231"
                     /translation="MEVFSLNDRPRFTGAGKACVRNTVKNSRCVACAEVCPTGAVTFN
                     KEKMMVINPQACIGCGYCLFNCPTGAPEGISPAQRHYRGDRLVTPLSTIAPCPEELLM
                     WHSEYGIRFVEMTADSAAGWFLAVATLNVRLKQMQEPLWNIVPPSRQTFNGSRRRWLH
                     LKNEGASAGNVPVGRRSRRTRFTQISEYHLDLDKGRCALCGACSRICPEQAICLDNLA
                     LTLDPVKCTGCGNCEAVCFDGALFVRESNEGTLTVYSLEQAQCRVCRHLFPAWSARDN
                     ECPVCRRHAFGMREA"
     misc_feature    162308..162436
                     /locus_tag="Rahaq2_4722"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:257339"
     misc_feature    162812..162934
                     /locus_tag="Rahaq2_4722"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:257339"
     misc_feature    <162812..>162934
                     /locus_tag="Rahaq2_4722"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     gene            163300..164496
                     /locus_tag="Rahaq2_4723"
                     /note="IMG reference gene:2506711747"
                     /db_xref="GeneID:11818232"
     CDS             163300..164496
                     /locus_tag="Rahaq2_4723"
                     /note="PFAM: Trans-2-enoyl-CoA reductase catalytic region;
                     NAD(P)H binding domain of trans-2-enoyl-CoA reductase;
                     Enoyl reductase FAD binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative paraquat-inducible protein B"
                     /protein_id="YP_005220455.1"
                     /db_xref="GI:379704081"
                     /db_xref="InterPro:IPR010758"
                     /db_xref="GeneID:11818232"
                     /translation="MIIKPRIRGFICVTAHPEGCKANVKEQIDYVTAQGKIAGGPKKV
                     LVIGASTGYGLAARISAAFGSDAATLGIFFERPGDESKTATAGWYNSAAFEEFADAKG
                     LYAKSINGDAFSDEVKQKTIELIKQDLGQVDLVVYSLAAPRRTHPKTGEVFNSTLKPI
                     GKQVTIRGINTDKETINETTLEPATPEEIAGTVAVMGGEDWQMWIDDLKAAGVLAEGA
                     KTTAFTYLGEEVTQDIYWNGSIGEAKKDLDKRVLDIRSTLAEQGGDARVSVLKAVVTQ
                     ASSAIPVMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSLYGAEPLVDNEGRLRADLK
                     EIAPEVQEEVGKLWNEVTNDNIAELTDFAGYKSEFMRLFGFGLNGVDYAADTNPDVKI
                     KHLIQM"
     misc_feature    163300..164487
                     /locus_tag="Rahaq2_4723"
                     /note="trans-2-enoyl-CoA reductase; Provisional; Region:
                     PRK13656"
                     /db_xref="CDD:237460"
     misc_feature    163303..163539
                     /locus_tag="Rahaq2_4723"
                     /note="NAD(P)H binding domain of trans-2-enoyl-CoA
                     reductase; Region: Eno-Rase_NADH_b; pfam12242"
                     /db_xref="CDD:256925"
     misc_feature    163543..164250
                     /locus_tag="Rahaq2_4723"
                     /note="Trans-2-enoyl-CoA reductase catalytic region;
                     Region: Enoyl_reductase; pfam12241"
                     /db_xref="CDD:256924"
     misc_feature    164266..164454
                     /locus_tag="Rahaq2_4723"
                     /note="Enoyl reductase FAD binding domain; Region:
                     Eno-Rase_FAD_bd; pfam07055"
                     /db_xref="CDD:254038"
     gene            complement(164641..164943)
                     /locus_tag="Rahaq2_4724"
                     /note="IMG reference gene:2506711748"
                     /db_xref="GeneID:11818233"
     CDS             complement(164641..164943)
                     /locus_tag="Rahaq2_4724"
                     /note="PFAM: TM2 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220456.1"
                     /db_xref="GI:379704082"
                     /db_xref="InterPro:IPR007829"
                     /db_xref="GeneID:11818233"
                     /translation="MGSMVFCRGCGKEIHESAKSCPHCGATQSINPQGTKSRVAAALL
                     AFFLGGFGVHKFYLGKIGQGFLYLIFCWTFIPSIIAFIEFIIYLCDSDENFAKKYG"
     misc_feature    complement(164866..164928)
                     /locus_tag="Rahaq2_4724"
                     /note="zinc-ribbon domain; Region: zinc_ribbon_2;
                     pfam13240"
                     /db_xref="CDD:257597"
     misc_feature    complement(<164647..164853)
                     /locus_tag="Rahaq2_4724"
                     /note="Predicted membrane protein [Function unknown];
                     Region: XynA; COG2314"
                     /db_xref="CDD:225196"
     gene            complement(165285..165545)
                     /locus_tag="Rahaq2_4725"
                     /note="IMG reference gene:2506711749"
                     /db_xref="GeneID:11818234"
     CDS             complement(165285..165545)
                     /locus_tag="Rahaq2_4725"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005220457.1"
                     /db_xref="GI:379704083"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11818234"
                     /translation="MNNHDWHQADIIAALRKKGTTLAAVSRAAGLSSSTLSNALSRPW
                     PKGELLIAQALEIHPSTIWPSRYFDPRTRERIQRTVRSSNRI"
     misc_feature    complement(165303..165533)
                     /locus_tag="Rahaq2_4725"
                     /note="Winged helix-turn-helix DNA-binding; Region:
                     HTH_35; pfam13693"
                     /db_xref="CDD:205869"
     gene            complement(165814..165888)
                     /locus_tag="Rahaq2_4726"
                     /note="IMG reference gene:2506711750"
                     /db_xref="GeneID:11818235"
     ncRNA           complement(165814..165888)
                     /locus_tag="Rahaq2_4726"
                     /ncRNA_class="other"
                     /product="isrK Hfq binding RNA"
                     /db_xref="GeneID:11818235"
     gene            complement(166122..166427)
                     /locus_tag="Rahaq2_4727"
                     /note="IMG reference gene:2506711751"
                     /db_xref="GeneID:11818236"
     CDS             complement(166122..166427)
                     /locus_tag="Rahaq2_4727"
                     /note="PFAM: Protein of unknown function (DUF1471)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220458.1"
                     /db_xref="GI:379704084"
                     /db_xref="InterPro:IPR010854"
                     /db_xref="GeneID:11818236"
                     /translation="MKGLVNDVLSIFSPKAVKPVLVRQGLSHREIASLQAVGVTTVSW
                     ATSMEELNNAFVKKALDAGAVGYHITHVESHKPGKEQQHVMAATATFYHINHKVAYG"
     misc_feature    complement(166149..166328)
                     /locus_tag="Rahaq2_4727"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; pfam07338"
                     /db_xref="CDD:254164"
     gene            167067..168344
                     /locus_tag="Rahaq2_4728"
                     /note="IMG reference gene:2506711752"
                     /db_xref="GeneID:11818237"
     CDS             167067..168344
                     /locus_tag="Rahaq2_4728"
                     /note="PFAM: PTS system sugar-specific permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220459.1"
                     /db_xref="GI:379704085"
                     /db_xref="InterPro:IPR004703"
                     /db_xref="GeneID:11818237"
                     /translation="MEIFLSLVKTPAVIIAIIAFLGLVFQKASVSRIITGTALSFIGF
                     TMIKVGGSILMKVLTAFSTLFSNAFNIVGVVPSNEAIMAATIDQIGSTAAIILLFSMV
                     INILLARFTRLKFIYLSLHLVLFMSFALTAVLMQLGYSYYPIIIISSIFIGFYMAASP
                     FFLNRFSREIIGSDEYAISHAAISSYIIGSYMGKWFGNKKTDTEHLKISNKFDFLREP
                     NIATLLTMLVLLLISCVFATQPQIKTAMTLVYGAGAADKNTLIFILEQSAVFACGLYL
                     AKAGVNLFTAEIVPAFKGFSRVFAPGAVPAVDVMVLFTKAPNATLIGFLVSFSVELAC
                     ILIFPFVGLPIIVPGIMASFITGGAAAIFGNATGGFRGAMIASGINGLLLCVLPALTL
                     PLFSHLGAQGVTFADPDFTLSSLILNHLMGLFK"
     misc_feature    167067..168341
                     /locus_tag="Rahaq2_4728"
                     /note="PTS system sugar-specific permease component;
                     Region: EIIC-GAT; cl04451"
                     /db_xref="CDD:262165"
     gene            complement(168474..169859)
                     /locus_tag="Rahaq2_4729"
                     /note="IMG reference gene:2506711753"
                     /db_xref="GeneID:11818238"
     CDS             complement(168474..169859)
                     /locus_tag="Rahaq2_4729"
                     /note="PFAM: Aldehyde dehydrogenase family"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent aldehyde dehydrogenase"
                     /protein_id="YP_005220460.1"
                     /db_xref="GI:379704086"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="GeneID:11818238"
                     /translation="MTTPDTHAISLNPFNGQRIAEYPFDTAPALEESVAQGSAAFKQW
                     RKTDIAQRASLLNNLATELRAAGEDIARMISREMGKPVKQARAEVEKSAGLCEWYARQ
                     GPAMLAPEPTMVDNGEAHIHYRPSGMILAIMPWNFPVWQILRGAVPALLAGNTFLLKP
                     APNVMGTTYLVKQAALKAGFPAGAFGVINVGNADVAALIADPRVVAVTVTGSVRAGGA
                     IAELAGKSLKKCVLELGGSDPFIVLNDASLDEAVKAAVAGRYQNTGQVCAAAKRMIVE
                     EGVLEAFTEKFVAATQALVIGNPLDDDTYIGPMARYDLRDELHKQVQDTLAEGATLLL
                     GGEKIAGDGNFYAPTILSNVTPQMTAFRQELFGPVAAITAARDAEHAVELANDSDFGL
                     SATIYTADLARAEQMTGELQTGGVFINGYSASDPRVAFGGVKKSGYGRELSHFGLREF
                     CNVQTVWSNRK"
     misc_feature    complement(168489..169772)
                     /locus_tag="Rahaq2_4729"
                     /note="Mycobacterium tuberculosis succinate-semialdehyde
                     dehydrogenase 1-like; Region: ALDH_SSADH1_GabD1; cd07100"
                     /db_xref="CDD:143418"
     misc_feature    complement(order(168570..168572,168684..168686,
                     168762..168764,168768..168770,169059..169061,
                     169155..169163,169203..169208,169215..169217,
                     169224..169235,169374..169379,169383..169385,
                     169428..169430,169452..169466))
                     /locus_tag="Rahaq2_4729"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143418"
     misc_feature    complement(order(169059..169061,169068..169070,
                     169161..169163,169452..169454))
                     /locus_tag="Rahaq2_4729"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143418"
     gene            169960..170844
                     /locus_tag="Rahaq2_4730"
                     /note="IMG reference gene:2506711754"
                     /db_xref="GeneID:11818239"
     CDS             169960..170844
                     /locus_tag="Rahaq2_4730"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220461.1"
                     /db_xref="GI:379704087"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818239"
                     /translation="MNLSQLEMFRAVAQTGSISAAAQLVHRVPSNLTTRIKQLEAELG
                     VALFIRENQRLRLSPAGRNFLTYNNRILDLVDEARISVAGTEPQGIFALGALESTAAV
                     RIPALLARYHQQFSKVELALSTGPSGELLDKLLEGELEATFVDGPVLHPVLDGVPVYK
                     EEMVIVAPLHHAPVTRGQDVNGEILYAFRSNCSYRRHFESWFADDGAAPGKIYEMESY
                     HGMLACVIAGGGLALMPRSMLESMPGSTTVSIWPLADNYRFLTTWLIWRRGVLTRNLT
                     EFAALASQLTVNLPPPAI"
     misc_feature    169960..170766
                     /locus_tag="Rahaq2_4730"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    169966..170145
                     /locus_tag="Rahaq2_4730"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    170230..170805
                     /locus_tag="Rahaq2_4730"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators, YofA and SoxR,
                     contains the type 2 periplasmic binding fold; Region:
                     PBP2_YofA_SoxR_like; cd08442"
                     /db_xref="CDD:176133"
     misc_feature    order(170272..170277,170281..170286,170293..170295,
                     170305..170307,170311..170331,170593..170610,
                     170626..170631,170635..170640)
                     /locus_tag="Rahaq2_4730"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176133"
     gene            171390..171797
                     /locus_tag="Rahaq2_4731"
                     /note="IMG reference gene:2506711755"
                     /db_xref="GeneID:11818240"
     CDS             171390..171797
                     /locus_tag="Rahaq2_4731"
                     /note="PFAM: H-NS histone family"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein H-NS"
                     /protein_id="YP_005220462.1"
                     /db_xref="GI:379704088"
                     /db_xref="InterPro:IPR001801"
                     /db_xref="GeneID:11818240"
                     /translation="MDNALNVLNNIRTLRAQAREMPLSTLEEILEKLTAIVEETRENA
                     KARSAQQQERDEKLLKYREMLANDGIAIDDLLGHQSAKVTTKAKRKPRPAIYEYTDTD
                     GSKKTWTGQGRTPSAIKAALDGGATLESFLIKR"
     misc_feature    171390..171788
                     /locus_tag="Rahaq2_4731"
                     /note="Domain in histone-like proteins of HNS family;
                     Region: HNS; cl19571"
                     /db_xref="CDD:267924"
     misc_feature    171390..171788
                     /locus_tag="Rahaq2_4731"
                     /note="DNA binding protein, nucleoid-associated;
                     Provisional; Region: PRK10328"
                     /db_xref="CDD:182380"
     gene            172003..172536
                     /locus_tag="Rahaq2_4732"
                     /note="IMG reference gene:2506711756"
                     /db_xref="GeneID:11818241"
     CDS             172003..172536
                     /locus_tag="Rahaq2_4732"
                     /note="PFAM: Cytochrome b(N-terminal)/b6/petB"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="YP_005220463.1"
                     /db_xref="GI:379704089"
                     /db_xref="InterPro:IPR005797"
                     /db_xref="InterPro:IPR016174"
                     /db_xref="GeneID:11818241"
                     /translation="MRTRYSSVQIVIHWLVLVLVVLTYTTMDIKGAFIKGSQARELLT
                     LAHYSLGFCVLFLMCVRVFVRAMYTTPSVKPAPPHWQHNLSVLVHAVIYLMFIGLPVL
                     GILSKYYSGHDWTMFNLMMPKSVLPDLSLQKELKTLHTWLANAGYYLIGLHAFAALWH
                     HYRLRDNTLVRMLPGRK"
     misc_feature    172003..172533
                     /locus_tag="Rahaq2_4732"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:260663"
     gene            172697..173161
                     /locus_tag="Rahaq2_4733"
                     /note="IMG reference gene:2506711757"
                     /db_xref="GeneID:11818242"
     CDS             172697..173161
                     /locus_tag="Rahaq2_4733"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220464.1"
                     /db_xref="GI:379704090"
                     /db_xref="GeneID:11818242"
                     /translation="MDTTEELSGTYFYHGHANLSNQELFGLIFIESLSNHLGLDTTAT
                     VLIITGQPYIPVQGKVVTAIPGTSVASKLSRALLKQAKLPFGLRAWTPVGKSFNTLTM
                     RKTTKWAALIDRYVPFVGYAMAVILIQQVAAETRSKYNLIARPEDRIAWTYF"
     misc_feature    <172706..172777
                     /locus_tag="Rahaq2_4733"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     gene            173161..173490
                     /locus_tag="Rahaq2_4734"
                     /note="IMG reference gene:2506711758"
                     /db_xref="GeneID:11818243"
     CDS             173161..173490
                     /locus_tag="Rahaq2_4734"
                     /note="PFAM: Protein of unknown function (DUF1493)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220465.1"
                     /db_xref="GI:379704091"
                     /db_xref="InterPro:IPR010862"
                     /db_xref="GeneID:11818243"
                     /translation="MEEKVLLMFREEIPGYYDFDLKREVPLEFDTELQDFAPGDDFVC
                     ALEVYEKTFKVDLSVVNWSFYFPWENLPFFTRWFKVKRKDVEKTRKPLTVRMFAESAK
                     AGKWLYD"
     misc_feature    173164..173487
                     /locus_tag="Rahaq2_4734"
                     /note="Protein of unknown function (DUF1493); Region:
                     DUF1493; pfam07377"
                     /db_xref="CDD:254176"
     gene            complement(173512..173994)
                     /locus_tag="Rahaq2_4735"
                     /note="IMG reference gene:2506711759"
                     /db_xref="GeneID:11818244"
     CDS             complement(173512..173994)
                     /locus_tag="Rahaq2_4735"
                     /note="PFAM: Protein of unknown function (DUF796);
                     TIGRFAM: type VI secretion system effector, Hcp1 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="YP_005220466.1"
                     /db_xref="GI:379704092"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="GeneID:11818244"
                     /translation="MAIPAYLWLKDDGGALIKGGVDVKDREYSIEVKGFHHNLMTPTD
                     DRTGKITGTRVHSPMMLVKDFDCSSPYIYKAVATGQCLASAEIKWYRINDAGQEVEYF
                     NMLLEKVRIVSITPAMAAASNPNENHMETIELRYEKIAWMHNDGNIIFADSWNDRQTA
                     "
     misc_feature    complement(173524..173991)
                     /locus_tag="Rahaq2_4735"
                     /note="type VI secretion system effector, Hcp1 family;
                     Region: VI_effect_Hcp1; TIGR03344"
                     /db_xref="CDD:213799"
     gene            complement(174174..175097)
                     /locus_tag="Rahaq2_4736"
                     /note="IMG reference gene:2506711760"
                     /db_xref="GeneID:11818245"
     CDS             complement(174174..175097)
                     /locus_tag="Rahaq2_4736"
                     /note="PFAM: Ketopantoate reductase PanE/ApbA;
                     Ketopantoate reductase PanE/ApbA C terminal;
                     TIGRFAM: 2-dehydropantoate 2-reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="YP_005220467.1"
                     /db_xref="GI:379704093"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11818245"
                     /translation="MRILVVGAGATGGYFGARLAQAGQDVTFLLREKRAQAVQQDGLT
                     IHSPHGDFHFQPNVLQASQLTGSYDLILLTVKSFGLEAAIKDIAPVVGENTMVMPVLN
                     GMKHMETLSLRFGEHALIGGLCKINATLDADGHVHQMTPLHQIIYGELSGEKTERILK
                     VDQAFQSAGVEAILSETIITDLWEKWLLLSSFGAITCTMRGNIGQVASAPGGTEFAQA
                     IVTEALTTMKAFGYAERAAAVAKIRESVTDKSSPQTSSMYRDMMQGYPIEADQIIGDL
                     VGRATRVGINIPLLQAAYTHLCVYQKNFVKQ"
     misc_feature    complement(174189..175097)
                     /locus_tag="Rahaq2_4736"
                     /note="2-dehydropantoate 2-reductase; Provisional; Region:
                     PRK12921"
                     /db_xref="CDD:183829"
     misc_feature    complement(174642..175091)
                     /locus_tag="Rahaq2_4736"
                     /note="Ketopantoate reductase PanE/ApbA; Region: ApbA;
                     pfam02558"
                     /db_xref="CDD:251374"
     misc_feature    complement(174195..174566)
                     /locus_tag="Rahaq2_4736"
                     /note="Ketopantoate reductase PanE/ApbA C terminal;
                     Region: ApbA_C; pfam08546"
                     /db_xref="CDD:254871"
     gene            175254..176027
                     /locus_tag="Rahaq2_4737"
                     /note="IMG reference gene:2506711761"
                     /db_xref="GeneID:11818246"
     CDS             175254..176027
                     /locus_tag="Rahaq2_4737"
                     /note="PFAM: Fic/DOC family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220468.1"
                     /db_xref="GI:379704094"
                     /db_xref="InterPro:IPR003812"
                     /db_xref="GeneID:11818246"
                     /translation="MAGYQPPYSITPQILNRVVDVGELLGRWAAHAEQSSVLLRKENR
                     IRTIQASLAIEHNSLSTPQVTAIMEGKRVLAPQKDIQEVRNAILTYEQLPVLKSHRLE
                     DVLKAHQTLMLGLVDAPGHLRSGNVGVYRDNQLIHMAPPAGQLPRLMSDLLNWLKETD
                     IHPLIASSIFHYEFEFIHPFADGNGRMGRLWQTLILSQWRSELAWLPVETLIHNQQQD
                     YYRILGECDRASDCTAFISFMLDNLAEALREGIETQSSP"
     misc_feature    175263..>176012
                     /locus_tag="Rahaq2_4737"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    175554..175841
                     /locus_tag="Rahaq2_4737"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     gene            complement(176080..177102)
                     /locus_tag="Rahaq2_4738"
                     /note="IMG reference gene:2506711762"
                     /db_xref="GeneID:11818247"
     CDS             complement(176080..177102)
                     /locus_tag="Rahaq2_4738"
                     /note="PFAM: Branched-chain amino acid transport system /
                     permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose/xylose/arabinose/galactoside ABC
                     transporter permease"
                     /protein_id="YP_005220469.1"
                     /db_xref="GI:379704095"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:11818247"
                     /translation="MNKTLTSRNTPHSATGEKTTMAVTPFFRRMMCWEGFLLLVTLLV
                     FVVNAFASPYFLNIWNLSDATFNFTEKAIIVLPMAMLIIAREIDLSVASTMALSSTMM
                     GFCAQAGLPTPALVGVGLSVGLLCGLINGLLVTRLNLSSIVITIGTMSLFRGMTYVLL
                     GDQSLNQYPASFAWFGQGYVWGPLSFEFTLFLVLGAVFYFLLHKTNFGRRTYAIGNNP
                     VAAWYSGINVKRHNLTLFVLVGVMSGLAAVLLTSRLGSTRPTLALGWELSVITMAVLG
                     GVSVLGGSGSMTGVIIAAFLMGLLTFGLSLLNVPGIVMSVIVGAMLIVVISLPVLYRK
                     VLARGK"
     misc_feature    complement(176119..176901)
                     /locus_tag="Rahaq2_4738"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(176392..176448)
                     /locus_tag="Rahaq2_4738"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(177099..178112)
                     /locus_tag="Rahaq2_4739"
                     /note="IMG reference gene:2506711763"
                     /db_xref="GeneID:11818248"
     CDS             complement(177099..178112)
                     /locus_tag="Rahaq2_4739"
                     /note="PFAM: Branched-chain amino acid transport system /
                     permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose/xylose/arabinose/galactoside ABC
                     transporter permease"
                     /protein_id="YP_005220470.1"
                     /db_xref="GI:379704096"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:11818248"
                     /translation="MIKNLLKYRELLLAVVIVLMVLGVGARSPEFVGAGNLLEMFNDT
                     SILIILALGQMMVLLTKGIDLSMAANLALTGMIVALINFHHPDIPVWSLVLLATFLGL
                     VMGAINGLLVWKVGIPPIVVTLGTMSIYRGIIFLLSNGGWINAHQMSPDFLSLPRATF
                     IGLPLLGWCAIAALILVAYFLRYSRTGRALYTAGGNATAAYYTGINAGKMQFVSFCLS
                     GALAGFCGYLWISRFAVAYVDVANGFELQIVAACVIGGISTMGGIGSVVGCLLGALFL
                     GVINNALPVIEVSPFWQMAISGGVIVIAVILNERANKRKGRLILRHSPAVQPVRTETG
                     VSS"
     misc_feature    complement(177189..177983)
                     /locus_tag="Rahaq2_4739"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(177465..177521)
                     /locus_tag="Rahaq2_4739"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(178109..179623)
                     /locus_tag="Rahaq2_4740"
                     /note="IMG reference gene:2506711764"
                     /db_xref="GeneID:11818249"
     CDS             complement(178109..179623)
                     /locus_tag="Rahaq2_4740"
                     /note="PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATPase"
                     /protein_id="YP_005220471.1"
                     /db_xref="GI:379704097"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818249"
                     /translation="MSDSATPLLSLQGISKVFPGVRALNNVHVDLYPGKVTALIGENG
                     AGKSTLVKVMTGIYQPEEGELRYKAIPIKLPNPESAHKVGITAIHQETVLFDELSVTE
                     NIFVGHYLYRGIFKRLDWPAMHQQARDILTRLEVNIDPHAILKELSIAQRHMVAIARA
                     LSFDAQVVILDEPTAALSQHEIVEFYQIVERLKQEGKAILFISHKFDEIFSISDYYTV
                     LRDGSYVGSGKLSDISEQQMVTMMVGREVSQAYPKVNCEPGETVLEVQNLSHPTEFAG
                     INFSLRKGEILGFYGLVGAGRTELMQALFGVTQPNGGKILINGKEHHFSRPSQAIRAG
                     IVYVPEERQKQGAIIDLPISQNISLPQLSQLNPHGVLNDKKEWALADDYARRLQVKAS
                     SWKQAVGTLSGGNQQKVVIAKWLATRPDIIILDEPTKGIDIGSKAAVHQFMSELVGRG
                     LAVIMVSSELPEVMGMADRIIVMHEGLMVAEFNAGEATAEMIVSAASGAGEEAA"
     misc_feature    complement(178145..179623)
                     /locus_tag="Rahaq2_4740"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    complement(178943..179599)
                     /locus_tag="Rahaq2_4740"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(179480..179503)
                     /locus_tag="Rahaq2_4740"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(179012..179014,179108..179113,
                     179354..179356,179477..179485,179489..179494))
                     /locus_tag="Rahaq2_4740"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(179354..179365)
                     /locus_tag="Rahaq2_4740"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(179156..179185)
                     /locus_tag="Rahaq2_4740"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(179108..179125)
                     /locus_tag="Rahaq2_4740"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(179090..179101)
                     /locus_tag="Rahaq2_4740"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(179006..179026)
                     /locus_tag="Rahaq2_4740"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(178196..178849)
                     /locus_tag="Rahaq2_4740"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            complement(179691..180683)
                     /locus_tag="Rahaq2_4741"
                     /note="IMG reference gene:2506711765"
                     /db_xref="GeneID:11818250"
     CDS             complement(179691..180683)
                     /locus_tag="Rahaq2_4741"
                     /note="PFAM: family;
                     TIGRFAM: rhamnose ABC transporter, rhamnose-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnose ABC transporter, rhamnose-binding
                     protein"
                     /protein_id="YP_005220472.1"
                     /db_xref="GI:379704098"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:11818250"
                     /translation="MKLKHVLSLTLIAGSILLAGAASAEVKIALVAKSLGNGFFEAAN
                     VGAQQAAKELGDVKVIYTGPTTTTAEAQIEVLNGLIAQGVDAIAVSANDPDALVPVLK
                     KAMQRGIKVVSWDSGVAKDGRQIHLNPSNNALIGETNVKLAADALKALNVEKGDVAIL
                     SATPTSTNQNLWIAEMKKVLPKYPSVNLVTVAYGDDLSDKSYRETIGLLKSYPDLKVI
                     ISPSSVGIVAAAQAVKDQGKIGKVYVTGLGLPSEMAGAVKSGATKSFAIWNPIDLGYA
                     ATYLAYDLVKGTATKTEASMGRLGKVKLDADGSGAMAEPFVYDASNIDKFSKIF"
     misc_feature    complement(179712..180605)
                     /locus_tag="Rahaq2_4741"
                     /note="Periplasmic binding domain of autoinducer-2 (AI-2)
                     receptor LsrB from Salmonella typhimurium and its close
                     homologs; Region: PBP1_LsrB_Quorum_Sensing; cd06302"
                     /db_xref="CDD:107297"
     misc_feature    complement(179823..180602)
                     /locus_tag="Rahaq2_4741"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     misc_feature    complement(order(179880..179882,180015..180023,
                     180168..180170,180177..180182,180297..180299,
                     180339..180341,180585..180587))
                     /locus_tag="Rahaq2_4741"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107297"
     gene            181085..181900
                     /locus_tag="Rahaq2_4742"
                     /note="IMG reference gene:2506711766"
                     /db_xref="GeneID:11818251"
     CDS             181085..181900
                     /locus_tag="Rahaq2_4742"
                     /note="PFAM: Bacterial regulatory helix-turn-helix
                     proteins, AraC family; AraC-like ligand binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding domain-containing protein"
                     /protein_id="YP_005220473.1"
                     /db_xref="GI:379704099"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR003313"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="GeneID:11818251"
                     /translation="MTVLRSSEYFPSGDFPVAIEPRYPQETFPEHHHQDFNEIVLVEQ
                     GTGTHVFNDQPLILSAGSVCFVRHCDHHLYEDTENLHLTNVLYRSPDAFRFLNGVGDL
                     LPQEVDGMYPAHWRISPTQIVQAKTLIDLLARHPVMQSPESQAQQELYFMQLLLLLRK
                     GSRDVGYRGQGGDLNNLLDWMNEHYNEEIDWPELAAQFSMSLRTLHRQMKQQTGCTPL
                     NYLNRLRLLNARNMLRFSDSPITEIAHHCGFCDSNYFSTLFKREFGYAPRSIR"
     misc_feature    181085..181897
                     /locus_tag="Rahaq2_4742"
                     /note="transcriptional activator RhaS; Provisional;
                     Region: PRK13503"
                     /db_xref="CDD:184094"
     misc_feature    181133..>181399
                     /locus_tag="Rahaq2_4742"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:145456"
     misc_feature    181625..181735
                     /locus_tag="Rahaq2_4742"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    181790..181897
                     /locus_tag="Rahaq2_4742"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            182134..183573
                     /locus_tag="Rahaq2_4743"
                     /note="IMG reference gene:2506711767"
                     /db_xref="GeneID:11818252"
     CDS             182134..183573
                     /locus_tag="Rahaq2_4743"
                     /note="PFAM: Aldehyde dehydrogenase family"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent aldehyde dehydrogenase"
                     /protein_id="YP_005220474.1"
                     /db_xref="GI:379704100"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="GeneID:11818252"
                     /translation="MSTVQKRMYINGGFVENTGGKWIDVVNPATEQVISQIPEGSAED
                     AKKAIDAAEAAQPGWEALPAVERGVWLHKIADGIREREAELTETIIAEGGKTYGLAQT
                     EVLFTADYLDYMAEWARRYEGEIIQSDRPNENIFVFRKAIGVTTGILPWNFPFFLIAR
                     KAAPALITGNTIVIKPSEITPNNAIIFAEIIHKVGLPKGVLNIVTGYGPTVGQELAAN
                     PKVGMVSLTGSVAAGIATMTAAAQNVTKVSLELGGKAPAIVMNDADLDLAVKAIVSSR
                     VINTGQVCNCAERVYVQEGVYDEFISRISEAMKKVTFGNTAEQKELDMGPLISAAALQ
                     RVEEKVAKAVSQGAKVLLGGKRHGDKGFFYQPTVLVDVRQEMPIMHEEVFGPVLPVAT
                     FKTLDEAIAMANDSEYGLTSSIYTSNINTAMKALKQLKFGETYINRENFEAMQGFHAG
                     WRKSGVGGADGKHGLQEYLQTHVAYLQFH"
     misc_feature    182158..183561
                     /locus_tag="Rahaq2_4743"
                     /note="Escherichia coli lactaldehyde dehydrogenase
                     AldA-like; Region: ALDH_LactADH-AldA; cd07088"
                     /db_xref="CDD:143407"
     misc_feature    order(182575..182586,182656..182658,182665..182667,
                     182755..182757,182767..182772,182809..182811,
                     182818..182820,182827..182829,182836..182838,
                     183124..183126,183136..183138)
                     /locus_tag="Rahaq2_4743"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143407"
     misc_feature    order(182587..182589,182881..182883,182974..182976,
                     182983..182985)
                     /locus_tag="Rahaq2_4743"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143407"
     misc_feature    order(182590..182592,182611..182613,182881..182883,
                     182983..182988,183457..183459,183475..183477)
                     /locus_tag="Rahaq2_4743"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143407"
     gene            183645..184226
                     /locus_tag="Rahaq2_4744"
                     /note="IMG reference gene:2506711768"
                     /db_xref="GeneID:11818253"
     CDS             183645..184226
                     /locus_tag="Rahaq2_4744"
                     /note="PFAM: Uncharacterised ACR, YkgG family COG1556"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220475.1"
                     /db_xref="GI:379704101"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="InterPro:IPR003741"
                     /db_xref="GeneID:11818253"
                     /translation="MNRNDFLTGIRQHKFMQTLFPPQTQKPNPPEDFGRALTLMGGIW
                     DDRFLRVPKNGYTTLNAYLRGLYPADSVFCSATPEIIADVDFDARTDAASLKDVDVGV
                     VRACFGVAETGAVFLSDHHLCVNTLSAMAKNLVVLLDVNLIIEHLHLAHRQPQPFNAR
                     YAIMVTGPAAMADSESALMLGAKGVKSLRVIAI"
     misc_feature    <183873..184223
                     /locus_tag="Rahaq2_4744"
                     /note="Uncharacterized ACR, YkgG family COG1556; Region:
                     DUF162; pfam02589"
                     /db_xref="CDD:251397"
     gene            184367..185437
                     /locus_tag="Rahaq2_4745"
                     /note="IMG reference gene:2506711769"
                     /db_xref="GeneID:11818254"
     CDS             184367..185437
                     /locus_tag="Rahaq2_4745"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220476.1"
                     /db_xref="GI:379704102"
                     /db_xref="GeneID:11818254"
                     /translation="MSVIQSLIKQAFGTGNSNEAATFLASACNRMKAMDKTTIAREVE
                     SALRGVSFSRTESDKAKVKTVYKDTAVTLEKLASLEKQVRSLTNELAVARNQTRDTED
                     AERMKGELLRLNTRISELLRESDIQRKQHVDELALLRSRQRAAGNSTSAELDAANSLI
                     AYTGSQMAAMAAARDTLQQRLTRLETETEHRLREEEDKRHAANRRADGNYALLGQQKE
                     LTAEANRKITQLRASLKLEEYEGQNAKNEKAKLKKQIAGLEDENSRLAERLRDNEEDC
                     ERLSNALERTNQELVAYKTQKERLTRWIHVPGAMMGVSVVALVLYSDAQPGHLFDSLA
                     PAVFLGCVVYALSLMIAFTRRA"
     misc_feature    185030..>185266
                     /locus_tag="Rahaq2_4745"
                     /note="Rice tungro bacilliform virus P46 protein; Region:
                     RTBV_P46; pfam06216"
                     /db_xref="CDD:114908"
     gene            complement(185456..186214)
                     /locus_tag="Rahaq2_4746"
                     /note="IMG reference gene:2506711770"
                     /db_xref="GeneID:11818255"
     CDS             complement(185456..186214)
                     /locus_tag="Rahaq2_4746"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220477.1"
                     /db_xref="GI:379704103"
                     /db_xref="GeneID:11818255"
                     /translation="MRLRLVSTLLFAATAAFGSQAATAAPVKNIVLVHGAFVGGSGWR
                     PVYDILTHDGYKVTLVQEPLTSFTDDVAATKRILAMQDGPAILVGHSYGGAIITEAGN
                     DPHVAGLVYIAAHALDNGETEAINGKKFPNSAHPFVKTPDGFLYINPANFPSDFAADL
                     PRKQAEFEAQAQMLTSASVFTANIPDPAWKVKPSWYMVAKSDKIINPDLERMYAKRAH
                     SHTVEIAGASHSVYESHPKEVAALIEQAATGAVK"
     misc_feature    complement(185471..186139)
                     /locus_tag="Rahaq2_4746"
                     /note="Probable pheophorbidase; Region: PLN02965; cl17657"
                     /db_xref="CDD:248211"
     misc_feature    complement(185489..186127)
                     /locus_tag="Rahaq2_4746"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            187004..189157
                     /locus_tag="Rahaq2_4747"
                     /note="IMG reference gene:2506711771"
                     /db_xref="GeneID:11818256"
     CDS             187004..189157
                     /locus_tag="Rahaq2_4747"
                     /note="PFAM: TonB dependent receptor; TonB-dependent
                     Receptor Plug Domain"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane receptor for Fe3+-dicitrate"
                     /protein_id="YP_005220478.1"
                     /db_xref="GI:379704104"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:11818256"
                     /translation="MNAKTSAFIITFLSFLNPVSVSYAQSATATPKGETDDASDASTM
                     MVIKQAGTGELSELDTPAAVSVIDGEDFRNSKAQVNLSESLGSVPGLQVQNRQNYAQD
                     LQLSVRGFGSRSMYGVRGVRIYVDGIPATMPDGQGQTSNIDLNSVERVEVLRGPFSAL
                     YGNASGGVVNVDTQTGSQPASLEAGTYFGSYGSFRNSVKASGATGDGTHAGDVNYLIS
                     GSRFTTDGYRDHSGTQKNLGNGKLGVRIDDASTLTLMFNSVSVDANDPGGLTESEWHD
                     DPKQARRADQYNARKSLDQTQVGLRYQRQMGENDEFSLMTYHGERHTTQYQTIPATSQ
                     KNPLNAGGVIVLERKYSGVDTRWKHDDQIGSVPFSVTGGLDYETMTERRFGYENFNSE
                     GDLGVKGDERRNEKNVMWNLDPYLQTTWNLTSRWTLDAGARYSTVSFDSQDYYITGSN
                     PDDSGSRRYHKLLPMASLNYAVTPALNTYISAGRGFETPTINELSYRTDGKSGLNLGL
                     EPSTSTTVELGSKWRVGNGLVTAAVFQTDTDDELIVAQSTGGRSSYTNAGKTRRRGLE
                     LSLDQQIEENWRVKMAWTLLDATFRNETCGAGDCTPAGNRLPGIARNMGYASLEWAPV
                     EGWHAGADIRYMSDIEVNDENSEQAPAYTVASVNAGYRFNWNNVTLDLFTRVDNLFDR
                     NYVGSVIVNEGNGRYFEPAPGRNYGGGATLSYSFE"
     misc_feature    187004..189151
                     /locus_tag="Rahaq2_4747"
                     /note="Outer membrane receptor proteins, mostly Fe
                     transport [Inorganic ion transport and metabolism];
                     Region: CirA; COG1629"
                     /db_xref="CDD:224544"
     misc_feature    187193..189151
                     /locus_tag="Rahaq2_4747"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(187193..187219,187250..187279,187316..187333,
                     187370..187393,187433..187465,187496..187522)
                     /locus_tag="Rahaq2_4747"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    187979..187981
                     /locus_tag="Rahaq2_4747"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            189324..191723
                     /locus_tag="Rahaq2_4748"
                     /note="IMG reference gene:2506711772"
                     /db_xref="GeneID:11818257"
     CDS             189324..191723
                     /locus_tag="Rahaq2_4748"
                     /note="PFAM: Pyrrolo-quinoline quinone coenzyme
                     N-terminus; Pyrrolo-quinoline quinone coenzyme C-terminus;
                     PQQ enzyme repeat;
                     TIGRFAM: membrane-bound PQQ-dependent dehydrogenase,
                     glucose/quinate/shikimate family"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound PQQ-dependent dehydrogenase"
                     /protein_id="YP_005220479.1"
                     /db_xref="GI:379704105"
                     /db_xref="InterPro:IPR001479"
                     /db_xref="InterPro:IPR002372"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR019551"
                     /db_xref="InterPro:IPR019556"
                     /db_xref="GeneID:11818257"
                     /translation="METKASLSRIVVIITALFAALSGIYLLAGGIWLAKLGGSLYYII
                     AGVISLVTAWLLYRRRSSALLLYAIFLFGTTVWAVWEVGTDFWALTPRLDVTFFLGLW
                     ILLPVVYNQMLAKNAFARGALAVSLLFTVIVLGYAIFNDPQVINGTIKAADSAPAKSE
                     SGIPDGDWPAYGRTQGGTRYSPLNQINDKNVSKLDVAWTFRTGDLKTPNDPGEITDEV
                     TPIKIGDMLYLCTPHQKLFALDAATGKEKWKFDPELKPNPTFQHVTCRGVSYHETTPA
                     AEGNATNGAAPAVCSRRIILPVNDGRLFALDAETGARCPAFGNNGELNLQGNMPYATP
                     GHYEPTSPPIITKSVIIVAGAVTDNYSNREPSGVIRGFDVETGKLLWAFDPGAAEPNK
                     IPEDGQHFTPNSPNSWAPAAYDDKLDLVYLPIGVATPDIWGGNRTPEMERFASGLLAL
                     NATTGKLAWFYQTVHHDLWDMDVPAQPTLADITDKSGNKVPAIYVPTKTGNIFVLDRR
                     DGKLIVDAPEKPVPQGAAKGDHVSPTQPFSKLTFRPEAKLTGKDMWGATIYDQLMCRV
                     IFHKLRYEGTFTPPSEQGTLVFPGNLGMFEWGGISVDTDRQVAIANPIALPFVSKLIP
                     RGPGNPIEPDANDKGGSGTETGIQPQYGVPFGVTLNPFLSPLGFPCKQPAWGYISGVD
                     LKTNDIVWKKRIGTVRDSSPLPLPFKMGMPMLGAPVSTAGNVFFIAATADNYLRAFNM
                     SNGDKLWEARLPAGGQATPMTYSVNGKQYVVIAAGGHGSFGTKLGDYIIAYALPDADA
                     K"
     misc_feature    <189327..>189503
                     /locus_tag="Rahaq2_4748"
                     /note="Predicted integral membrane protein (DUF2269);
                     Region: DUF2269; cl02335"
                     /db_xref="CDD:261249"
     misc_feature    189417..191705
                     /locus_tag="Rahaq2_4748"
                     /note="membrane-bound PQQ-dependent dehydrogenase,
                     glucose/quinate/shikimate family; Region: PQQ_membr_DH;
                     TIGR03074"
                     /db_xref="CDD:234101"
     misc_feature    189825..191702
                     /locus_tag="Rahaq2_4748"
                     /note="Membrane-bound PQQ-dependent glucose dehydrogenase;
                     Region: PQQ_mGDH; cd10280"
                     /db_xref="CDD:199838"
     misc_feature    order(189900..189908,189915..189917,190035..190037,
                     190041..190043,190050..190058,190065..190067,
                     190236..190238,190242..190244,190251..190259,
                     190266..190268,190434..190436,190440..190442,
                     190449..190457,190464..190466,190668..190670,
                     190674..190676,190683..190691,190698..190700,
                     190833..190835,190839..190841,190848..190856,
                     190863..190865,191361..191363,191367..191369,
                     191376..191384,191391..191393,191532..191534,
                     191538..191540,191547..191555,191562..191564,
                     191691..191693,191697..191699)
                     /locus_tag="Rahaq2_4748"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199838"
     misc_feature    order(189972..189974,190101..190106,190119..190121,
                     190341..190343,190386..190391,190545..190547,
                     190815..190817,191463..191465)
                     /locus_tag="Rahaq2_4748"
                     /note="putative active site [active]"
                     /db_xref="CDD:199838"
     gene            complement(191805..192155)
                     /locus_tag="Rahaq2_4749"
                     /note="IMG reference gene:2506711773"
                     /db_xref="GeneID:11818258"
     CDS             complement(191805..192155)
                     /locus_tag="Rahaq2_4749"
                     /note="PFAM: Variant SH3 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="SH3 domain-containing protein"
                     /protein_id="YP_005220480.1"
                     /db_xref="GI:379704106"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="InterPro:IPR014593"
                     /db_xref="GeneID:11818258"
                     /translation="MNSLAKVIKEHRSSYPNPITLRENEIVMISHCDLEWRGWIWIRQ
                     SSGNAGWAPQQIFTLSAPDRGICTENYTAYELSVAPGEVLTLEKKLNGWFWACNKSGE
                     SGWVPEENLMNISK"
     misc_feature    complement(191988..192146)
                     /locus_tag="Rahaq2_4749"
                     /note="Variant SH3 domain; Region: SH3_2; pfam07653"
                     /db_xref="CDD:254334"
     misc_feature    complement(order(191997..191999,192039..192044,
                     192102..192104,192114..192116,192123..192125,
                     192129..192131))
                     /locus_tag="Rahaq2_4749"
                     /note="peptide ligand binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:212690"
     misc_feature    complement(order(191826..191831,191835..191837,
                     191877..191882,191931..191933,191943..191945,
                     191949..191951))
                     /locus_tag="Rahaq2_4749"
                     /note="peptide ligand binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:212690"
     misc_feature    complement(191835..191948)
                     /locus_tag="Rahaq2_4749"
                     /note="Src homology 3 domains; Region: SH3; smart00326"
                     /db_xref="CDD:214620"
     gene            complement(192197..192655)
                     /locus_tag="Rahaq2_4750"
                     /note="IMG reference gene:2506711774"
                     /db_xref="GeneID:11818259"
     CDS             complement(192197..192655)
                     /locus_tag="Rahaq2_4750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220481.1"
                     /db_xref="GI:379704107"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="GeneID:11818259"
                     /translation="MHHASRNVQIRNVKAGQNVVIYEPANVYDCTLHDDVFVGPFVEI
                     QANTSIGRGTKIQSHTFICEYVTVGENCFIGHGVMFANDMFKTGRPDAERNSWARIHV
                     GNDVSIGSGATILGVTICDGTVIGAGSVVTKDITIKGIYAGNPARWLRTL"
     misc_feature    complement(192206..192556)
                     /locus_tag="Rahaq2_4750"
                     /note="WcxM-like, Left-handed parallel beta-Helix (LbH)
                     N-terminal domain: This group is composed of Xanthomonas
                     campestris WcxM and proteins with similarity to the WcxM
                     N-terminal domain. WcxM is thought to be bifunctional,
                     catalyzing both the isomerization...; Region:
                     LbH_WxcM_N_like; cd03358"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(192224..192226,192272..192274,
                     192326..192328,192335..192337,192341..192343,
                     192392..192397,192401..192403,192419..192421,
                     192437..192439,192443..192445,192467..192469,
                     192491..192493,192497..192499))
                     /locus_tag="Rahaq2_4750"
                     /note="putative trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(192221..192223,192227..192232,
                     192257..192262,192275..192280,192311..192313,
                     192326..192331,192335..192337,192392..192394,
                     192401..192403,192485..192487,192491..192493))
                     /locus_tag="Rahaq2_4750"
                     /note="putative active site [active]"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(192401..192403,192485..192487,
                     192491..192493))
                     /locus_tag="Rahaq2_4750"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(192209..192211,192221..192223,
                     192227..192232,192236..192238,192257..192262,
                     192275..192280,192284..192286,192311..192313,
                     192326..192331,192335..192337,192392..192394,
                     192401..192403))
                     /locus_tag="Rahaq2_4750"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100048"
     gene            192870..193232
                     /locus_tag="Rahaq2_4751"
                     /note="IMG reference gene:2506711775"
                     /db_xref="GeneID:11818260"
     CDS             192870..193232
                     /locus_tag="Rahaq2_4751"
                     /note="PFAM: Protein of unknown function, DUF596"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220482.1"
                     /db_xref="GI:379704108"
                     /db_xref="InterPro:IPR007670"
                     /db_xref="InterPro:IPR023138"
                     /db_xref="GeneID:11818260"
                     /translation="MEIKTVCDAVSESACGLSIGAVWQHISVECAHIPDNDAFRVEVF
                     FTLLERLMNEGKIRLASGGEYLGGTHGQQLQQLKDAWPRGNSEDEFDDLDDTGYWFLA
                     RSPAGIVWIMPDGREIWT"
     misc_feature    193023..193229
                     /locus_tag="Rahaq2_4751"
                     /note="Protein of unknown function, DUF596; Region:
                     DUF596; cl10492"
                     /db_xref="CDD:263982"
     gene            complement(193239..193883)
                     /locus_tag="Rahaq2_4752"
                     /note="IMG reference gene:2506711776"
                     /db_xref="GeneID:11818261"
     CDS             complement(193239..193883)
                     /locus_tag="Rahaq2_4752"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220483.1"
                     /db_xref="GI:379704109"
                     /db_xref="GeneID:11818261"
                     /translation="MPRTTSLVSLSALIASVFLLTGCPPPPDLTQWQRPDSTIDDARV
                     AMGQCGVPLPGPEPDFTANETVLYYQCMEGKGFTYKHDFHICDVHKNTPACIEKQQGH
                     PLSQRQLEALPFVADEGFHPIKPDSGRDESQLISWRKTGASLHFSHAVENDKLALQVM
                     YDCGYPKPLGSVPFVPTILKAAKVQQCMLDKGFEPKHKLSLVCRNYPQVTGCKK"
     gene            194021..194401
                     /locus_tag="Rahaq2_4753"
                     /note="IMG reference gene:2506711777"
                     /db_xref="GeneID:11818262"
     CDS             194021..194401
                     /locus_tag="Rahaq2_4753"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220484.1"
                     /db_xref="GI:379704110"
                     /db_xref="GeneID:11818262"
                     /translation="MTVVLDEIKALECSLHGVRRKDKLWLEKVLHADFREITRSGVMV
                     DRQQTVAALTAETQDLRLEAEGFQLQTLNESCVILTYKTFLNRGNENRRYTLRASCWT
                     NAGGTGWQMIFHQGTPAAETLTCG"
     misc_feature    194021..194371
                     /locus_tag="Rahaq2_4753"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4994"
                     /db_xref="CDD:227327"
     gene            complement(194408..194647)
                     /locus_tag="Rahaq2_4754"
                     /note="IMG reference gene:2506711778"
                     /db_xref="GeneID:11818263"
     CDS             complement(194408..194647)
                     /locus_tag="Rahaq2_4754"
                     /note="PFAM: Protein of unknown function (DUF1272)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220485.1"
                     /db_xref="GI:379704111"
                     /db_xref="InterPro:IPR010696"
                     /db_xref="GeneID:11818263"
                     /translation="MLELRPNCECCNTDLPPAADARICSFECTFCVPCAENTLKGICP
                     NCGGELVARPRRPANKLANNPASTARVFKPEGCAS"
     misc_feature    complement(194414..194647)
                     /locus_tag="Rahaq2_4754"
                     /note="Protein of unknown function (DUF1272); Region:
                     DUF1272; cl19740"
                     /db_xref="CDD:268093"
     gene            complement(194679..196097)
                     /locus_tag="Rahaq2_4755"
                     /note="IMG reference gene:2506711779"
                     /db_xref="GeneID:11818264"
     CDS             complement(194679..196097)
                     /locus_tag="Rahaq2_4755"
                     /note="PFAM: Major Facilitator Superfamily;
                     TIGRFAM: drug resistance transporter, EmrB/QacA subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005220486.1"
                     /db_xref="GI:379704112"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818264"
                     /translation="MELFSDKPGDEGLPGRERGFAMAAVMIMATMAVFDGSMVNIALP
                     QIAQALDISAGAAVWVSNGYLLSASMTLAIFAALASHIGFRRLFAAGLTVFTLASLGC
                     ALSSSLDMLIIMRVLQGIGAAATLSIGPAILRSVFPNRLLGRILGLNALMIATSTAVA
                     PVLGGTILSAMSWQWLFAINIPLGIIAVVLTLRVVPSNPASTRQPFDTAGAILSAVAL
                     GALIMAAESFARPGNDELATAITYGLTAIIAGVAFVWRQRRAPKPLLPLGMFASARFT
                     LAAFTSLASFVSQGITFVALPFLFQSVYGYSAFVSALLFTPWPLGIILAAPHAGRLAD
                     RYPAAIISTVGLAVFAVGLLLLAQLPAHPQVWDIGLRSFICGLGFGCFQSPNNREMLS
                     NASRENSGYASGVLAIMRTFGQCLGAACVGVILTIYSARSVLQEAQAVQVSLWVAVIA
                     TVVAMLISLSRLRNPATHLQNG"
     misc_feature    complement(194796..196034)
                     /locus_tag="Rahaq2_4755"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(194844..196025)
                     /locus_tag="Rahaq2_4755"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(194856..194858,194865..194870,
                     194877..194882,194889..194894,194925..194927,
                     194934..194939,194949..194951,194958..194963,
                     194970..194972,195120..195122,195132..195134,
                     195141..195143,195153..195155,195165..195167,
                     195207..195209,195216..195221,195228..195233,
                     195240..195242,195627..195629,195645..195650,
                     195657..195662,195696..195698,195705..195710,
                     195717..195722,195729..195734,195870..195875,
                     195879..195884,195894..195896,195903..195908,
                     195915..195917,195966..195971,195975..195983,
                     195990..195992))
                     /locus_tag="Rahaq2_4755"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            196232..197137
                     /locus_tag="Rahaq2_4756"
                     /note="IMG reference gene:2506711780"
                     /db_xref="GeneID:11818265"
     CDS             196232..197137
                     /locus_tag="Rahaq2_4756"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220487.1"
                     /db_xref="GI:379704113"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818265"
                     /translation="MTEPDLNLLIALDVLLAEGSVAGAARRLGLSASAMSRTLSRLRA
                     TTGDPLLVRAGRNMVLTPYAEEIRQRTRNVAFEARALLRPSSADFNLARLERTFLIRS
                     NDGFVVAFGAAMIAAAAQVAPCVCLRFMPKPEKTSNALREGRVDLEIGVLGEMGPEIR
                     LQTLFRDRFMGVVRKGHPLALKKAITAEDYVSFGHVVVSRRNNTYGPVDDALAEVGLK
                     RKIAAVVPGFSAALAIAQNSDLVALIPGSFLIAEPDRLYAFELPLKTREITISQMWHP
                     RSEVDPAHRWLRQLVLKVCRDEVPL"
     misc_feature    196241..197131
                     /locus_tag="Rahaq2_4756"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    196247..196426
                     /locus_tag="Rahaq2_4756"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    196520..197116
                     /locus_tag="Rahaq2_4756"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     similar to DntR, which is involved in the catabolism of
                     dinitrotoluene; contains the type 2 periplasmic binding
                     fold; Region: PBP2_DntR_like_1; cd08460"
                     /db_xref="CDD:176149"
     misc_feature    order(196538..196540,196544..196549,196559..196561,
                     196730..196732,196844..196846,197039..197041)
                     /locus_tag="Rahaq2_4756"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176149"
     misc_feature    order(196541..196543,196550..196555,196562..196567,
                     196574..196579,196583..196588,196595..196600,
                     196604..196618,196622..196624,196811..196813,
                     196895..196909,196916..196921,196928..196933,
                     196940..196942,196982..196984)
                     /locus_tag="Rahaq2_4756"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176149"
     gene            complement(197141..197803)
                     /locus_tag="Rahaq2_4757"
                     /note="IMG reference gene:2506711781"
                     /db_xref="GeneID:11818266"
     CDS             complement(197141..197803)
                     /locus_tag="Rahaq2_4757"
                     /note="PFAM: Exonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III epsilon subunit-like 3'-5'
                     exonuclease"
                     /protein_id="YP_005220488.1"
                     /db_xref="GI:379704114"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="GeneID:11818266"
                     /translation="MLRVIDTETCGLQGGVVEVASVDIEDGKIVNPMSDLVRPDRPIS
                     HQAMAIHKITEAMVADKPWIEEIIARYHGSQYYVAHNASFDQRMLPEMQGEWICTVKL
                     SRRLWPGIKYSNMALYKSLKLEVATPADLHHHRALFDCYITAALLIRIMDESGWTPEE
                     MVTITGRPALVSTMMFGKYRGRKIAEIAEDDPMYLRWMLNNIKELTPDLRMTLKHYLE
                     VP"
     misc_feature    complement(197150..197803)
                     /locus_tag="Rahaq2_4757"
                     /note="exodeoxyribonuclease X; Provisional; Region:
                     PRK07983"
                     /db_xref="CDD:181186"
     misc_feature    complement(197360..197794)
                     /locus_tag="Rahaq2_4757"
                     /note="DEDDh 3'-5' exonuclease domain family; Region:
                     DEDDh; cd06127"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(197387..197389,197402..197404,
                     197549..197557,197561..197566,197771..197773,
                     197777..197788))
                     /locus_tag="Rahaq2_4757"
                     /note="active site"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(197387..197389,197402..197404,
                     197552..197557,197561..197566,197771..197773,
                     197777..197788))
                     /locus_tag="Rahaq2_4757"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(197387..197389,197402..197404,
                     197549..197551,197780..197782,197786..197788))
                     /locus_tag="Rahaq2_4757"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176648"
     misc_feature    complement(<197210..197287)
                     /locus_tag="Rahaq2_4757"
                     /note="Protein of unknown function (DUF3820); Region:
                     DUF3820; cl01411"
                     /db_xref="CDD:242489"
     gene            198191..199345
                     /locus_tag="Rahaq2_4758"
                     /note="IMG reference gene:2506711782"
                     /db_xref="GeneID:11818267"
     CDS             198191..199345
                     /locus_tag="Rahaq2_4758"
                     /note="PFAM: Mandelate racemase / muconate lactonizing
                     enzyme, C-terminal domain; Mandelate racemase / muconate
                     lactonizing enzyme, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="L-alanine-DL-glutamate epimerase-like protein"
                     /protein_id="YP_005220489.1"
                     /db_xref="GI:379704115"
                     /db_xref="InterPro:IPR001354"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="GeneID:11818267"
                     /translation="MKISSVEVSVFTYPTRRVSDSAGHSHPGEESQAKMAMLTLTTDE
                     GDCGYSFAPPEVVRPHVVNAFFRKVLIGQNPFDRERLWQDLVHWQRGSAHQLTERALS
                     FVEQALWDLIGRKLNMPVHKLLGGFREKVPAYGSTMCGDELKGGLSTPDEFGQFAEKL
                     VARGYQAIKLHTWMPPVAFAPDPKMDIKACAAVREAVGPDIELMLDGYHWYSRSQALT
                     IGKALEKLNFAWFEEPMEEESMASYAWLAENLSIDVIGPESLGGKHHSRADWVKAGAC
                     DILRAGANGVGGISPCMKVASLAEAFGMDCEVHGNGAASLAVVGAIRNCRWYERGLLH
                     PFLEYDEPAAYLNSIVDPMDEQGFVHLSDRPGLGEDINFDYIETHTVSRD"
     misc_feature    198191..199342
                     /locus_tag="Rahaq2_4758"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    198194..199327
                     /locus_tag="Rahaq2_4758"
                     /note="Mandelate racemase (MR)-like subfamily of the
                     enolase superfamily, subgroup 4. Enzymes of this subgroup
                     share three conserved carboxylate ligands for the
                     essential divalent metal ion (usually Mg2+), two
                     aspartates and a glutamate, and conserved catalytic...;
                     Region: MR_like_4; cd03329"
                     /db_xref="CDD:239445"
     misc_feature    order(198590..198592,198695..198697,198701..198703,
                     198806..198808,198878..198880,198884..198886,
                     198962..198964,199034..199036,199115..199117,
                     199175..199177)
                     /locus_tag="Rahaq2_4758"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:239445"
     misc_feature    order(198806..198808,198884..198886,198962..198964)
                     /locus_tag="Rahaq2_4758"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239445"
     gene            199397..201040
                     /locus_tag="Rahaq2_4759"
                     /note="IMG reference gene:2506711783"
                     /db_xref="GeneID:11818268"
     CDS             199397..201040
                     /locus_tag="Rahaq2_4759"
                     /note="PFAM: Bacterial extracellular solute-binding
                     proteins, family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005220490.1"
                     /db_xref="GI:379704116"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="GeneID:11818268"
                     /translation="MNSGKPWGAWLFALLLMTAGWTAQAKTPPDQLIIGMNMNNLLTL
                     DPAAMTGNDIVGIVVNLYDPLIELDPQQLTNVRPALATSWEVNDARNLITFHLREGVK
                     FHSGNPVTAEDVVWSMRRILHLNLAQASVWKSYGFSKKNVDEMVRAPDPYTVEIQLPK
                     PNDPKLVIYSLAALGSVVALDSKIVQAHEVNGDWGNRWLTTNEAGSGPFRLDNWQAKD
                     VLNMSRNPQYWRGEPKLSRVVFRHFQESQTLRLMIEKGDLDIANNMAVSDVKALSHDP
                     AMQVDQVKKGTIYYVAMSMKEPHFANPKVREAVRYLIDYQGIGKALMNGYGIAHQRPI
                     QVGMPATLPDPGYKLDIPRAKTLLAEAGYPDGFDTTLRVLADQPFLNIAIAVQSTLMQ
                     AGIRAKIVTGTGNQIYGAMRERKFDMLVGRGGSGVEPHPHSSLRALVYNPDNNDAARL
                     TNFQGWRTGFYDKQLNADIDQALLERDPEKQKQDYFAIQERYDALIPALVPLSQMVDS
                     IVVRRDVKNYLPHPSATTFLRDVWKDEPADVQPTGGKGL"
     misc_feature    199418..201001
                     /locus_tag="Rahaq2_4759"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    199478..200950
                     /locus_tag="Rahaq2_4759"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_7; cd08512"
                     /db_xref="CDD:173877"
     gene            201037..202098
                     /locus_tag="Rahaq2_4760"
                     /note="IMG reference gene:2506711784"
                     /db_xref="GeneID:11818269"
     CDS             201037..202098
                     /locus_tag="Rahaq2_4760"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220491.1"
                     /db_xref="GI:379704117"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818269"
                     /translation="MTMQIPAPASKQTARMSFPAGRIGKRLVQVAVTLFGLLLLTFFI
                     GRVMPVDPVLAIVGPDADHSTYEQVYHQLGFDKPLWTQFGIYLSGLAHGDLGNALLTG
                     KPVTQDILRVFPATMELATLAIILGAGVGIPLGVLAAAKRNSLADYGVRIISLAGYST
                     PIFWVGMMGLLVFYAWLGWVGGAGRVDFSLDGQVTRHSGFMLIDALIAGNGEVFRNAL
                     NHLILPASLLGFHSLAYISRMTRSFMLAQLSQEFIITARVKGLSEWQVLWNHAFRNIL
                     VQLLTVVALAYGSLLEGAVLIETVFSWPGFGSYLTSSLMLGDMNAVMGCVLVVGMIFV
                     VLNLLSDLLYQVFDPRTKV"
     misc_feature    201103..202095
                     /locus_tag="Rahaq2_4760"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    201373..202062
                     /locus_tag="Rahaq2_4760"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(201421..201426,201433..201438,201451..201453,
                     201484..201495,201499..201528,201535..201540,
                     201544..201546,201727..201732,201736..201738,
                     201742..201744,201751..201756,201760..201762,
                     201772..201777,201784..201786,201835..201837,
                     201877..201882,201889..201891,201910..201921,
                     201928..201933,201979..201984,202012..202017,
                     202024..202029,202033..202038,202045..202050,
                     202057..202062)
                     /locus_tag="Rahaq2_4760"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(201502..201546,201910..201927)
                     /locus_tag="Rahaq2_4760"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(201544..201546,201712..201714,201928..201930,
                     201973..201975,201982..201984,202012..202014)
                     /locus_tag="Rahaq2_4760"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(201787..201825,201841..201846,201856..201858)
                     /locus_tag="Rahaq2_4760"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            202095..203000
                     /locus_tag="Rahaq2_4761"
                     /note="IMG reference gene:2506711785"
                     /db_xref="GeneID:11818270"
     CDS             202095..203000
                     /locus_tag="Rahaq2_4761"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220492.1"
                     /db_xref="GI:379704118"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818270"
                     /translation="MTISLDSVPLSAGDEKRQRVKRAVGRVGHFLWQMACNPLTAIGG
                     AIVLVLMIVAVFAPWIAPFHPLVQDLNNALSPPSAAHWFGTDEFGRDIFSRLVYGSRI
                     TLYIVLLVSVTVGPLGLLLGVTAGYFGGKTDMVLMRVTDIFISFPSLVLALAFVAALG
                     PGLEHVVIAITLTAWPPIARLARAETLSLRQADFISAVRLQGASPVRVLWRHIVPLCL
                     PSVIIRITMNMAGIILTAAGLGFLGLGAQPPDPEWGAMISSGRTYMMECWWVATIPGL
                     AILINSLAFNFLGDGLRDILDPRND"
     misc_feature    202170..202991
                     /locus_tag="Rahaq2_4761"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    202185..202328
                     /locus_tag="Rahaq2_4761"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    202395..202934
                     /locus_tag="Rahaq2_4761"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(202440..202445,202452..202457,202470..202472,
                     202500..202511,202515..202544,202551..202556,
                     202560..202562,202611..202616,202620..202622,
                     202626..202628,202635..202640,202644..202646,
                     202656..202661,202668..202670,202719..202721,
                     202761..202766,202773..202775,202794..202805,
                     202812..202817,202857..202862,202896..202901,
                     202908..202913,202917..202922,202929..202934)
                     /locus_tag="Rahaq2_4761"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(202518..202562,202794..202811)
                     /locus_tag="Rahaq2_4761"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(202560..202562,202596..202598,202812..202814,
                     202851..202853,202860..202862,202896..202898)
                     /locus_tag="Rahaq2_4761"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(202671..202709,202725..202730,202740..202742)
                     /locus_tag="Rahaq2_4761"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            202972..203838
                     /locus_tag="Rahaq2_4762"
                     /note="IMG reference gene:2506711786"
                     /db_xref="GeneID:11818271"
     CDS             202972..203838
                     /locus_tag="Rahaq2_4762"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     ATPase"
                     /protein_id="YP_005220493.1"
                     /db_xref="GI:379704119"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="GeneID:11818271"
                     /translation="MTFSIPEMTDAPALLDVQDLHVSFVNGRQVTQAVRGVSFQLGRE
                     KLAIVGESGSGKSTVGRALLHLHPSKARITASKMQFADVDLLHASPAQMRQVRGKRIS
                     MIMQDPKYSLNPVLCVGDQIAEAWRSHHKCSYNDAKSKVLNMLDVVRIRDPERVYGLY
                     PHEISGGQGQRIMIAMMLITDPEMVIADEPTSALDVSVRLQVLALLDDLVKTRGLGLI
                     FISHDINLVRSFCDRVLVMYAGRIVESIAATDLDNAQHPYTRGLLNALPDMDNRRYPL
                     PVMQRQASWLTD"
     misc_feature    203011..203772
                     /locus_tag="Rahaq2_4762"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    203011..203703
                     /locus_tag="Rahaq2_4762"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    203119..203142
                     /locus_tag="Rahaq2_4762"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(203128..203133,203137..203145,203287..203289,
                     203533..203538,203635..203637)
                     /locus_tag="Rahaq2_4762"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    203278..203289
                     /locus_tag="Rahaq2_4762"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    203461..203490
                     /locus_tag="Rahaq2_4762"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    203521..203538
                     /locus_tag="Rahaq2_4762"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    203545..203556
                     /locus_tag="Rahaq2_4762"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    203623..203643
                     /locus_tag="Rahaq2_4762"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    203722..>203790
                     /locus_tag="Rahaq2_4762"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            203848..204633
                     /locus_tag="Rahaq2_4763"
                     /note="IMG reference gene:2506711787"
                     /db_xref="GeneID:11818272"
     CDS             203848..204633
                     /locus_tag="Rahaq2_4763"
                     /note="PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     ATPase"
                     /protein_id="YP_005220494.1"
                     /db_xref="GI:379704120"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818272"
                     /translation="MTAKTMIDVRNLNLTFGEGAKNTQVLTDVNIAVREGEIFGLVGE
                     SGSGKTTVLKCLAGLFTHWQGELEIDGQQLEHRIGRERCRLVQMVFQDPYGSLHPRHT
                     IGDILEEPLQIHRIDQREQRINTILEKVGLNRAFRSRYPHQLSGGQRQRVAIARALIL
                     KPRVLLLDEPTSALDVSVQAEILNLLFDLQKEEGLTYLMVTHDLGVIAHLCQRVAVMK
                     YGKILETLDTDALLRGDIHDDYTRTLVDASRDYSREMAAKVML"
     misc_feature    203857..204609
                     /locus_tag="Rahaq2_4763"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    203863..204522
                     /locus_tag="Rahaq2_4763"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    203974..203997
                     /locus_tag="Rahaq2_4763"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(203983..203988,203992..204000,204118..204120,
                     204349..204354,204451..204453)
                     /locus_tag="Rahaq2_4763"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    204109..204120
                     /locus_tag="Rahaq2_4763"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    204277..204306
                     /locus_tag="Rahaq2_4763"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    204337..204354
                     /locus_tag="Rahaq2_4763"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    204361..204372
                     /locus_tag="Rahaq2_4763"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    204439..204459
                     /locus_tag="Rahaq2_4763"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     gene            205077..205328
                     /locus_tag="Rahaq2_4764"
                     /note="IMG reference gene:2506711788"
                     /db_xref="GeneID:11818273"
     CDS             205077..205328
                     /locus_tag="Rahaq2_4764"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220495.1"
                     /db_xref="GI:379704121"
                     /db_xref="GeneID:11818273"
                     /translation="MKLLNNIYEYRDWMIKDYLHLDDTFPSVFEPDEIEIDILRQAPK
                     EFPCLVQLVEDESGNYPQFFQFIYRSQVEEWARLFGIVR"
     gene            complement(205343..205450)
                     /locus_tag="Rahaq2_4765"
                     /note="IMG reference gene:2506711789"
                     /db_xref="GeneID:11818274"
     CDS             complement(205343..205450)
                     /locus_tag="Rahaq2_4765"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220496.1"
                     /db_xref="GI:379704122"
                     /db_xref="GeneID:11818274"
                     /translation="MKEDVNGLIALRKVNGSLFNWPVTLSIKTPPQVAR"
     gene            complement(205434..206525)
                     /locus_tag="Rahaq2_4766"
                     /note="IMG reference gene:2506711790"
                     /db_xref="GeneID:11818275"
     CDS             complement(205434..206525)
                     /locus_tag="Rahaq2_4766"
                     /note="PFAM: Protein of unknown function (DUF1305);
                     TIGRFAM: type VI secretion protein, VC_A0111 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="YP_005220497.1"
                     /db_xref="GI:379704123"
                     /db_xref="InterPro:IPR010732"
                     /db_xref="GeneID:11818275"
                     /translation="MAGTPPDAGVVLMMPDDFDDDAKKKENVLKEFWRDKDGNDRAYA
                     FNFYRFCQLLEKQLSDNKPIGSTFSPKNDAVRFRPHPGMGFPVSELKAVETREECPDT
                     PPTVRATFMGLYGVDSPLPTGYIDDIAQRREGHEALEAFLDIFNHRMMTQFYRIWRKY
                     NYPATFEDGGTDKTSRSLMALTGITGSGDVPASRLLALLQPLVRTTRTAEGIVSVIRS
                     QAPNTQVTVKPHKVTRMAAGKRARFSFSEQQRLSDHLVLGSHTEDANYCIGVEMFTED
                     AAEAKGWLPGGQLREDVFTLLRVYLGCDYDASLTLTIPMKLAPLPRLGDPRLMAGYNV
                     VMGLREDNLDKMPKEVTMKLGRIRNERRC"
     misc_feature    complement(205515..206408)
                     /locus_tag="Rahaq2_4766"
                     /note="Protein of unknown function (DUF1305); Region:
                     DUF1305; pfam06996"
                     /db_xref="CDD:254012"
     gene            complement(206489..208264)
                     /locus_tag="Rahaq2_4767"
                     /note="IMG reference gene:2506711791"
                     /db_xref="GeneID:11818276"
     CDS             complement(206489..208264)
                     /locus_tag="Rahaq2_4767"
                     /note="PFAM: Bacterial protein of unknown function
                     (DUF879);
                     TIGRFAM: type VI secretion protein, VC_A0110 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="YP_005220498.1"
                     /db_xref="GI:379704124"
                     /db_xref="InterPro:IPR010272"
                     /db_xref="GeneID:11818276"
                     /translation="MEDDFLKYFDGEMRYLKEAGLEFAKEFPELGRALGLDGSPVPRD
                     DSVERLFQGFSLMMAKLRQKIDDDIPELTEPLLSHLLPVINRTLPSTAIVELTPAAPA
                     LHIREEILPAESELLTRPPGNDNQRCAYRTTRDLKVHPFALDNVSLFTLQEGQQALKL
                     RFTLPALTEIRRADWQNISLYLNGDRVLQSALYLALSRQIKRVNVRFWQESTVLTPVD
                     VQFVPRWQAENDASIWPESDSPALCGEVRPWLEYFTSPERYFFMQLRGLETLTFPADT
                     TAFDIEVTLSERWPYDLAVPPDAIRMHCVPVINLFRLLAQPLSVTAAVSDYRLRPHRL
                     SDGRTEIYAVNDVAEVTEDNTEFSYVPYSQFREKGGMLQYAKNWPDRYYHTRMYRGTS
                     GLNETILMLGGRTHEAQNGLKMRLNMTCTNGAWPRMALQESVFDGETALGNLELKCAT
                     RKRPSMPYYPPAAELYQWQVLSLLHPQAIAGLMEIGTLRHALSLLDWTHDPENARRIA
                     GITHVEYAPSHYPAEGWHGVAIRVTLDEHQFCGLGDALLFCEVLEQFYTQYADIRRFI
                     QLTVTLSQSGTQWAWPERRLTRVLF"
     misc_feature    complement(206492..208252)
                     /locus_tag="Rahaq2_4767"
                     /note="Bacterial protein of unknown function (DUF879);
                     Region: DUF879; pfam05947"
                     /db_xref="CDD:253471"
     gene            complement(208264..208797)
                     /locus_tag="Rahaq2_4768"
                     /note="IMG reference gene:2506711792"
                     /db_xref="GeneID:11818277"
     CDS             complement(208264..208797)
                     /locus_tag="Rahaq2_4768"
                     /note="TIGRFAM: type VI secretion lipoprotein, VC_A0113
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion lipoprotein"
                     /protein_id="YP_005220499.1"
                     /db_xref="GI:379704125"
                     /db_xref="GeneID:11818277"
                     /translation="MTPDNFQRVRRGTVLFLLPLLISSCGLTQRVGNGASAVADAVLY
                     RKIDTLHLKLTSRAALNSNEGGEALPTVVRVYQLKDRKTFDTASYAALLRQDNTVLAA
                     DLLDRQVVQVMPDAEATVAVPLHADAQFVAVVALFMAPDVTNNTWRLVLERSDLDDSK
                     DQIVELNDNRLQLRKSQ"
     misc_feature    complement(208285..208689)
                     /locus_tag="Rahaq2_4768"
                     /note="Type VI secretion lipoprotein; Region: T6SS-SciN;
                     pfam12790"
                     /db_xref="CDD:257298"
     gene            complement(208784..212152)
                     /locus_tag="Rahaq2_4769"
                     /note="IMG reference gene:2506711793"
                     /db_xref="GeneID:11818278"
     CDS             complement(208784..212152)
                     /locus_tag="Rahaq2_4769"
                     /note="PFAM: Protein of unknown function (DUF1215);
                     Intracellular multiplication and human macrophage-killing"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220500.1"
                     /db_xref="GI:379704126"
                     /db_xref="InterPro:IPR009612"
                     /db_xref="InterPro:IPR010623"
                     /db_xref="GeneID:11818278"
                     /translation="MTKSLHLMLVVMLALALSVLWLSVDGETLTHGVAWWATGVILLS
                     YFLLARYAFALELLDFNRPPETQDDARITAFDTLRFTLRHRYDWHWKHKQPWLLVTGE
                     AAVVEKIAPGLTQARWQESQNAVLIWCGEADALDLAAVTQLRDMRGRRAFNAVLWVTD
                     VTAEPQYLWTTQPVPNQTLPAGNSDTVYRQFIALGHTLSWRPPVFGVCLSEPQWEQDD
                     RPVQSIGCHWPAGTPVSLDDQLSQLAATLIPQGIAQLNENKHWAWLLQLSGDLKHHTG
                     ALLRQRFQPWLGENQRVLAGGIFFMPAAPESASVQQRSHACYLSPAWNGVIAQSRMQQ
                     GRRDHLSTGDRLAIGTLTLAGLWVLGMGISACANRALIADSQALLQAARTPAPMSDTL
                     TRSVALQDNIDRLLWWQQNGSPWLHRFGLDQRDAVIEALWPAYTRQSQALLITPMVNA
                     LKDRLQAFVSLPPGSAERRLAGKLAYQQLKAYLMLMHPEHADPAFMQPVLSPLWTVPD
                     GVAPGEWLARSDKLLAFYLQQLPRHPQWKLPADDTLVANVRTILRSQKGISNSENALY
                     QQVLLSVSPHYADVTLDSLLGEFAGGQLFSTDDTLPGMFTREAWEGEVSDAIDKAAAA
                     RHVTSDWVLDDKGEQQLLTKDPLQYRLTERYFADYTSAWLNFLNSIRWNTSDSLSTSL
                     DQLTRLADARQSPLLALSRTLRYQGAAGQHREAMGDSLLKSAQKLVSKTTPDAGFAGG
                     RNDPTRVLSETFAPLLAVLPPETPAAGETQTVQNTAVVSVSNYLLQVSQTRLQLMQVA
                     NASDPQAMAQNLVRSAFSNGDTTLSQGRHYAQLLAASLGGEWSSFADAAFVQPLEQAW
                     NGVMTPAQQGINSAWQVQVQNPWQAEFTGRYPFDNTKNDADFTQLAHYLTPDTGLIDQ
                     FITRQLAGVLEKQGDSWVPDPLNTQGMSINPDFLSAVNQLSQLGRRVFPQGKPGVTFE
                     LQIRPTRNVVETDLQIDDATLKYFNQLPGWQTFRWPDAASDHPQVSLTYSPVAASGKS
                     ADAFQSYFQADGGWAWLRLLDKAQVEQLDSSRYRLSWQTATRETLNVVLRTQSGGGPL
                     ELLTLRRFTLPAQIFTSPGLATDNAEDTTHHDAR"
     misc_feature    complement(208844..212134)
                     /locus_tag="Rahaq2_4769"
                     /note="Type VI protein secretion system component VasK
                     [Intracellular trafficking, secretion, and    vesicular
                     transport]; Region: IcmF; COG3523"
                     /db_xref="CDD:226054"
     misc_feature    complement(210026..210919)
                     /locus_tag="Rahaq2_4769"
                     /note="Intracellular multiplication and human
                     macrophage-killing; Region: IcmF-related; pfam06761"
                     /db_xref="CDD:253899"
     misc_feature    complement(209282..209653)
                     /locus_tag="Rahaq2_4769"
                     /note="Protein of unknown function (DUF1215); Region:
                     DUF1215; pfam06744"
                     /db_xref="CDD:253889"
     gene            complement(212145..213557)
                     /locus_tag="Rahaq2_4770"
                     /note="IMG reference gene:2506711794"
                     /db_xref="GeneID:11818279"
     CDS             complement(212145..213557)
                     /locus_tag="Rahaq2_4770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220501.1"
                     /db_xref="GI:379704127"
                     /db_xref="GeneID:11818279"
                     /translation="MNWHLPQMARNALPKLPGWWWWLAVPAACIALAAIALFFTWPVQ
                     RGFTNLRFWFWLLLLPVLVSSAVMAFVLSAALQVRRETDWRHLFIDRKYAHWQHWGRR
                     SLRLVAFHCLTPETDIASRELGLEGQPPQAPAKPAEIIPVQPLQLGESPLKDILSQTL
                     EPLSETLRAQSSIEIWLYANTPEEQATNAVEQYWSAKLKKRLPTENIHWQSIAQDAAL
                     LDSWCDEDISVPRLVIALHLLDGKSQASASSSALLFQRSSGPVIKAPPFRPVYLFRPL
                     VTQSHDLDADFPRFLAASQTGAKRLSHLWDAGLHSRERGALLAMLDEHDVMLPAQGRH
                     DLSLLLGPASPASFWLALCLAAQGCDLGQRGQLVAAQSEESISLVQLSTQPAAPVDMP
                     VDTISRYPLAYLAGIVAVMLALILLPADRDTQSGMLPWLGGGLVVVAALLSFSVPLAL
                     RLWRKRLDVEWHLLEQQRHD"
     gene            complement(213557..213811)
                     /locus_tag="Rahaq2_4771"
                     /note="IMG reference gene:2506711795"
                     /db_xref="GeneID:11818280"
     CDS             complement(213557..213811)
                     /locus_tag="Rahaq2_4771"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220502.1"
                     /db_xref="GI:379704128"
                     /db_xref="GeneID:11818280"
                     /translation="MKGVIRLGDPHTHGGNVSSASGALFEGKPVMLAGDTVSCSQHGT
                     VPVNQGHPTWKMNGKAVIVDGCVAQCGCTLKTTLPNAGAQ"
     misc_feature    complement(213590..213799)
                     /locus_tag="Rahaq2_4771"
                     /note="PAAR motif; Region: PAAR_motif; pfam05488"
                     /db_xref="CDD:253216"
     gene            complement(213880..214626)
                     /locus_tag="Rahaq2_4772"
                     /note="IMG reference gene:2506711796"
                     /db_xref="GeneID:11818281"
     CDS             complement(213880..214626)
                     /locus_tag="Rahaq2_4772"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220503.1"
                     /db_xref="GI:379704129"
                     /db_xref="GeneID:11818281"
                     /translation="MILIQRIGIGLMAGLISACQAAPQSPPTQVVYRFDDHRYLELTG
                     FNCQGGLRYIDTQRGIQHQIYDVSTGYRIFTKKFVHPSERYIAITSYEGGGFAISKDY
                     GRTWDGASFSPGGGAVRYKDDHPQREEIESLTVVHDQGFMLTKAGDIYMSSKPFDDPR
                     LEPGGSGIDYTITTKRGLVQDHHIAPGYGGGKWGENYLSWNSVQGPKPWSILAYKTNF
                     QGIPNKVPAVKNYSGWDHMRCDPNLGITSK"
     gene            complement(214623..215369)
                     /locus_tag="Rahaq2_4773"
                     /note="IMG reference gene:2506711797"
                     /db_xref="GeneID:11818282"
     CDS             complement(214623..215369)
                     /locus_tag="Rahaq2_4773"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220504.1"
                     /db_xref="GI:379704130"
                     /db_xref="GeneID:11818282"
                     /translation="MQTLKMAGVLILVINIGACQATPQSPPTQVVYRFDDHRYLELTG
                     FNCQGGLRYIDTQRGIQHQIYDVSDGYRIFTKKFVHPSERYIAITSYEGGGFAISKDY
                     GQTWDGARFSPGGGAIRYKGSNPTREEIESFTVVNDQGFMLTKAGDIYMSSKPFDDPR
                     LEPGGSGIDYSFTTKRGVLQTNHMRPGYGGGKWGTEYSSWNSFAGPNHWTTDTYRRNF
                     QGIPNKVPEVKNYTGWDHMRCDPNLGLASK"
     gene            complement(215382..217499)
                     /locus_tag="Rahaq2_4774"
                     /note="IMG reference gene:2506711798"
                     /db_xref="GeneID:11818283"
     CDS             complement(215382..217499)
                     /locus_tag="Rahaq2_4774"
                     /note="PFAM: Protein of unknown function (DUF3274)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220505.1"
                     /db_xref="GI:379704131"
                     /db_xref="InterPro:IPR021692"
                     /db_xref="GeneID:11818283"
                     /translation="MADSCSNIRNPKLLSEGDICRPVTSGKALIQECGVQPPLPCIVI
                     LVHGVNDVGEAYENQDVGICAGLNTRLGRTDMHHHEWKQHDFMISDADGNITTETCAV
                     QDQTCVGVVNRSPVIPFYWGYKPVDHDAFVQDQKRYKSELLKKGNDADLPYDTYREND
                     TKKLKAHNNAKIDNLNNWLDPLSAKGGGTFANATTNIPDMFGPGAAGPILAMIGKLMS
                     RTETFNLNNKDWSHPIYQNPHRIYQAYAARRLADLILDIRRNQDTQSDTINIVAHSQG
                     TIITMLANMWVEAEGYPTADCVILNHSPYALENRWLENFMPGNQQTSDARQKTFAHFC
                     KLMAKNPNAPQGTLSHDSAYIQKIMDTGCLAKKAKETIWESALYNRNNFGRVYNYFCP
                     NDQVVSMSPIQGFGWRGIPDKIKAQLGDNLYQRVFCKDVWVGDKTGFHYTMPPRQADD
                     SKDTGYSFTDVTINAPVLPEPFQFALMAQGKDNYKAKMAGNDPEIAKAAMKAEKFIPE
                     TVDVPNSPLFYGMRSNGSVLSPEQLEELNATYAPKKFVSGIVSGHRDSFQQLILQREM
                     TNDELTAAVQMDVSYSQHSSIVASDKTPSHAMVYDLAIGQCEAFENQEFWERLLLQAD
                     WRRPENPEPKIKQYYIEGILPYEDIKQFMNKPELDKGMPIGEEFGVKNDYGSRQMVKP
                     GNHRNMENTTVQLLQWDMPKPQV"
     misc_feature    complement(215559..216233)
                     /locus_tag="Rahaq2_4774"
                     /note="Protein of unknown function (DUF3274); Region:
                     DUF3274; pfam11678"
                     /db_xref="CDD:256546"
     gene            complement(217499..220009)
                     /locus_tag="Rahaq2_4775"
                     /note="IMG reference gene:2506711799"
                     /db_xref="GeneID:11818284"
     CDS             complement(217499..220009)
                     /locus_tag="Rahaq2_4775"
                     /note="PFAM: Phage-related baseplate assembly protein;
                     Uncharacterized protein conserved in bacteria (DUF2345);
                     TIGRFAM: Rhs element Vgr protein; type VI secretion system
                     Vgr family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhs element Vgr protein"
                     /protein_id="YP_005220506.1"
                     /db_xref="GI:379704132"
                     /db_xref="InterPro:IPR006531"
                     /db_xref="InterPro:IPR018769"
                     /db_xref="GeneID:11818284"
                     /translation="MGIQEYILAGSKLPVHNHYQLRLTRLESQQPGVDISVLRFSGSE
                     AISDILRYEIEFTSAVKDIPAQHIINYSALFLMYPDGKPWKSVKPRIIPGVITRFRQC
                     GTSADETRYVATLEHRVTRLNQGSNNAIYQNDSVISMTENTFLRYNMDRLDFRFALHD
                     RYPLKKFMMQFGESEYAHIARRLADSGISYFFEYDEENNCDVMVLADHSYAWPEPVAI
                     PFRNPAGMFDGGLESVWEMSVSRKAIPKSVTVNDDYYPAAQSDMTATATTNPDYPALV
                     AEDYRWGEYYPEPGKEYSSDPGQGMWYAKRRQERYLSEQITFEGKSNCMTLRPGMVIT
                     TPGKDWPEAPDGLLIVSTNSKNVARDTAYFVTFTAVPRNTQHPYRPALLPWPTVTGTL
                     PARISSAHPDEPYAHINADGLYRAQFGFDRTEWQKGFESCWLRLAKPYSGDTCGFHMP
                     LLDSTGVAIAFENGDVDRPYIAYALHDSRHPDHVALPNYKRNIIRTPSGNKIRLEDQR
                     GKEHIKISTVHSGKSQLSLGHLVDSARKQRGEGAELRTDAYVAVRGGKGVLLSTEPKN
                     SAQGQQLDMDAAIAQLEKALALAKTLKSTADIAQASPAETTDQELLKTDLTKLAQPGV
                     VVYGDAGIAHTTPKTIQQTAGKNLVATAGQDASFSVFRRFSVAAGELFSVFANKLGIK
                     LIAAAGKVQLQAQKDQMELTSFEDMQITSTNGRIVLNAKKELLLMCGGAGIRIKDGTI
                     EELAPTRITQKSPVLEYQGGDSVKQAMPTFNQGDFGMKYKLHINGDPSHVLKNQKFRV
                     HRQDGSVSEGITDANGESSLLQMSELENVAIELIKGVK"
     misc_feature    complement(218453..219901)
                     /locus_tag="Rahaq2_4775"
                     /note="Rhs element Vgr protein; Region: vgr_GE; TIGR01646"
                     /db_xref="CDD:233505"
     misc_feature    complement(218954..219883)
                     /locus_tag="Rahaq2_4775"
                     /note="Phage late control gene D protein (GPD); Region:
                     Phage_GPD; pfam05954"
                     /db_xref="CDD:253474"
     misc_feature    complement(218552..218794)
                     /locus_tag="Rahaq2_4775"
                     /note="Phage-related baseplate assembly protein; Region:
                     Phage_base_V; pfam04717"
                     /db_xref="CDD:252757"
     misc_feature    complement(218222..218539)
                     /locus_tag="Rahaq2_4775"
                     /note="Putative type VI secretion system Rhs element Vgr;
                     Region: T6SS_Vgr; pfam13296"
                     /db_xref="CDD:205476"
     misc_feature    complement(217508..218296)
                     /locus_tag="Rahaq2_4775"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4253"
                     /db_xref="CDD:226704"
     gene            220347..220488
                     /locus_tag="Rahaq2_4776"
                     /note="IMG reference gene:2506711800"
                     /pseudo
                     /db_xref="GeneID:11818285"
     gene            complement(220500..222299)
                     /locus_tag="Rahaq2_4777"
                     /note="IMG reference gene:2506711801"
                     /db_xref="GeneID:11818286"
     CDS             complement(220500..222299)
                     /locus_tag="Rahaq2_4777"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220507.1"
                     /db_xref="GI:379704133"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818286"
                     /translation="MSESLYCRTCAGVSRLRMSQTGGAGVPLISRLLTLAAIVVLTGL
                     LPWLSGSDPALSLLRARSGEQEATAETLNAIRLTLGLDQGPWHALTHWLGGLPGGDAG
                     VSWVSGLPVLPGMLRATGVSLTLMTASAGVAFLIAVLLCAGTLIRGLQGGTPRPAGFL
                     AALLTALPEFLLASVLLITGAVWLKFFPPYGWAGWHYAVLPALALGIPAGGYLGRLYS
                     DALSGAFNESWLTTWSVLGISRRHIALAIIRRTLPGVMPLTGLVLVSLTGGAIAVEKV
                     FAIPGLGRATLGAAAAGDLPALQTGVLILLLLASALGMLTGGIRRILLGRALSLGAMP
                     VPQPVALPEKQRAWLPLLCLSILVVMVFAGLPRDPLTSAYLRLQPPSFALPFGADAMG
                     RDLLARVAHGTLNTCLQALAVSLICLLAGMTAGAFPRAMTGPIEVTNALPPVIAGLVI
                     AAINGPTATGAVIAVTVVSWAPLAAHTAALVAEIRARPYIQMLAVMGVGTLRRHVFYV
                     FPALAGPLLRHALLRLPGIALALASLGFLGLGAPPPAPEWGRVLAEGMPYIERAPWSV
                     LAPAGALALLSVLAVTMSSLRWKNRVRQPGTLH"
     misc_feature    complement(221394..222218)
                     /locus_tag="Rahaq2_4777"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(221394..222200)
                     /locus_tag="Rahaq2_4777"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cl00427"
                     /db_xref="CDD:260417"
     misc_feature    complement(220608..221261)
                     /locus_tag="Rahaq2_4777"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(220626..220997)
                     /locus_tag="Rahaq2_4777"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cl00427"
                     /db_xref="CDD:260417"
     gene            complement(222299..223807)
                     /locus_tag="Rahaq2_4778"
                     /note="IMG reference gene:2506711802"
                     /db_xref="GeneID:11818287"
     CDS             complement(222299..223807)
                     /locus_tag="Rahaq2_4778"
                     /note="PFAM: Bacterial extracellular solute-binding
                     proteins, family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005220508.1"
                     /db_xref="GI:379704134"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="GeneID:11818287"
                     /translation="MSVKHVSPLAGLLSAALLLTGCFGEADKNPGKTADQRLRLAMLQ
                     PPRSGLTPLSDDAFKLSRWSTTETLVTLDKLGEAQPALATKWQQTGDNSWRFELRHGV
                     RFHDGSLLDAATVVNALTVAAHAAPKPRILDGVQLTAVADGEQAVMVTTAQPDPLLPQ
                     RLSSPQLAILSQKAYSTSGVVDPRHAGSGPFELVQVNGTSSARLERFGGYWGEKAKAS
                     GIDVSFVPDGTARGAALRTGAADIVEAIPVSQAPLLDQTLIHEVPMPRTNTLYLNTRL
                     GVMQDPALRAAVRDAINRQQLVDNVYEKRADVAQGLLGPALPWAAPLRQPVSQPVTAR
                     KPAGETITLATFSDRAELPEVAVYVAQQLTAAGFTVKQVVREYSQIESDALAGKFDAF
                     ILSRATVLDSGDPVAYLYSDFACKGSFNIAQLCRPDIDQALQKASVIPAGAERRQAIM
                     LAENLILATDAAIPMLHERVIQGELADIRDAVRDPRERTLINAATQRVVQAD"
     misc_feature    complement(222404..223732)
                     /locus_tag="Rahaq2_4778"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(222341..223702)
                     /locus_tag="Rahaq2_4778"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_3; cd08490"
                     /db_xref="CDD:173855"
     gene            complement(223821..225059)
                     /locus_tag="Rahaq2_4779"
                     /note="IMG reference gene:2506711803"
                     /db_xref="GeneID:11818288"
     CDS             complement(223821..225059)
                     /locus_tag="Rahaq2_4779"
                     /note="PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily transporter"
                     /protein_id="YP_005220509.1"
                     /db_xref="GI:379704135"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818288"
                     /translation="MLTRSIAHTSAPKPPLLLASSLVFNIGFYAVVPFLAIFLRDDLL
                     LSGWAIGLVLGLRTFSQQGMFLLGGALSDRYGARVIILLGCVVRIAGFLLLGLSDTLA
                     PVILGACLTGIGGALFSPSIEALLAQAGTHSEKAGKRSRAEWFALSAVCAELGAVLGP
                     LLGSLLSGYGFQPVALAGSGLFLIALLVLFFTLPATPKRAAELKIVPWWQTFRQPRFV
                     AFIIAYSAYLFSYNQLYLALPVELRRSGGSEQDLGPLFVLASVLVIVLQMPLARFSRR
                     LGAARILPAGFGLLSSAFIAVALFAWTVPPEGWLRLLPSVLLITLLTVGQMLIVPVGM
                     DLIPRFAGQHNLGAHYGALSSMGGIAVLTGNFLLGGLLDNALTPSPGAVIPWLALAAV
                     PFLSALAMRRICRQLPPPAI"
     misc_feature    complement(223863..225014)
                     /locus_tag="Rahaq2_4779"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(223968..225011)
                     /locus_tag="Rahaq2_4779"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(223977..223979,223986..223991,
                     223998..224003,224010..224015,224046..224048,
                     224055..224060,224070..224072,224079..224084,
                     224091..224093,224259..224261,224271..224273,
                     224280..224282,224292..224294,224304..224306,
                     224343..224345,224352..224357,224364..224369,
                     224376..224378,224592..224594,224610..224615,
                     224622..224627,224679..224681,224688..224693,
                     224700..224705,224712..224717,224853..224858,
                     224862..224867,224877..224879,224886..224891,
                     224898..224900,224952..224957,224961..224969,
                     224976..224978))
                     /locus_tag="Rahaq2_4779"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(225064..225879)
                     /locus_tag="Rahaq2_4780"
                     /note="IMG reference gene:2506711804"
                     /db_xref="GeneID:11818289"
     CDS             complement(225064..225879)
                     /locus_tag="Rahaq2_4780"
                     /note="PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase component of various ABC-type transport
                     systems with duplicated ATPase domain"
                     /protein_id="YP_005220510.1"
                     /db_xref="GI:379704136"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818289"
                     /translation="MEPSLPRVSGPFLHLQNISRHLALPGSFWRTQRTALFEHLSLRI
                     GRHETLGLVGASGCGKSSLLRILLALEAPDSGDVYCAGVRIRPGSARSLREYRQRVQY
                     IPQDPAGSLPPVHTVYQIIAEPLKRLGFTGDIRLRVSDVMAQVCLSETLLWRVAGELS
                     GGQAQRLAIARALAIGPQFLVADEPVSGLDLPLRGQIKHLLQQVTQQNGMGLLMVTHD
                     MSMVAGLCGRLLVMHGGEIVEDRATQDVLRAPDHTHTRQLLQAIPHLPLTVDG"
     misc_feature    complement(225160..225843)
                     /locus_tag="Rahaq2_4780"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(225091..225792)
                     /locus_tag="Rahaq2_4780"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    complement(225697..225720)
                     /locus_tag="Rahaq2_4780"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(225229..225231,225328..225333,
                     225565..225567,225694..225702,225706..225711))
                     /locus_tag="Rahaq2_4780"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(225565..225576)
                     /locus_tag="Rahaq2_4780"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(225376..225405)
                     /locus_tag="Rahaq2_4780"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(225328..225345)
                     /locus_tag="Rahaq2_4780"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(225310..225321)
                     /locus_tag="Rahaq2_4780"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(225223..225243)
                     /locus_tag="Rahaq2_4780"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     gene            complement(225879..226697)
                     /locus_tag="Rahaq2_4781"
                     /note="IMG reference gene:2506711805"
                     /db_xref="GeneID:11818290"
     CDS             complement(225879..226697)
                     /locus_tag="Rahaq2_4781"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase component of various ABC-type transport
                     systems with duplicated ATPase domain"
                     /protein_id="YP_005220511.1"
                     /db_xref="GI:379704137"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818290"
                     /translation="MTHNRTQNTEPVLAVQGLTVRLAGETRLSGLSFSVGAGERVCLL
                     GASGSGKSLTAKAITGTLPAGATLSGSIRVNGVGVCGRHPVSRCAASRVATVFQDSST
                     ALNPLMTLGKQLRLALPAAREDELRTMLDAVGLGDITQFYARYPAELSGGQRQRLCLA
                     LAMQSASSLLVADEPTTALDVLTQQQVLQVMRNACASPQSPRALLFITHDIAVAAQLC
                     ERALVMENGVLVESAGMAQLLSHPQHPYSQKLVHAARQAAALHQNAASLYGVAI"
     misc_feature    complement(225939..226667)
                     /locus_tag="Rahaq2_4781"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    complement(225999..226664)
                     /locus_tag="Rahaq2_4781"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(226542..226565)
                     /locus_tag="Rahaq2_4781"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(226071..226073,226176..226181,
                     226404..226406,226539..226547,226551..226556))
                     /locus_tag="Rahaq2_4781"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(226404..226415)
                     /locus_tag="Rahaq2_4781"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(226224..226253)
                     /locus_tag="Rahaq2_4781"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(226176..226193)
                     /locus_tag="Rahaq2_4781"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(226158..226169)
                     /locus_tag="Rahaq2_4781"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(226065..226085)
                     /locus_tag="Rahaq2_4781"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<225936..226010)
                     /locus_tag="Rahaq2_4781"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(226955..228010)
                     /locus_tag="Rahaq2_4782"
                     /note="IMG reference gene:2506711806"
                     /db_xref="GeneID:11818291"
     CDS             complement(226955..228010)
                     /locus_tag="Rahaq2_4782"
                     /note="PFAM: Bacterial regulatory proteins, lacI family;
                     TIGRFAM: D-fructose-responsive transcription factor"
                     /codon_start=1
                     /transl_table=11
                     /product="D-fructose-responsive transcription factor"
                     /protein_id="YP_005220512.1"
                     /db_xref="GI:379704138"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11818291"
                     /translation="MSFRITEYGAVKKTKRITISGIAELAGVSKSTASQVLNGHSKKF
                     RISDLTRDRVLAVAAEHHYQPSIHARSLNVTRSFTLGLVVPEMTNYGFAACSNELETL
                     CRENGMQLLIACTDENTSQETMVVNNLIQRQVDGLIVASSMLSDAEYVKISQQVPVVL
                     FDRHIQDTQLPIVVCEAIESSAELVSRIAKTQRDEFYFLGGQPRISPTRDRLAGYQLG
                     LQRAGVSLDPDWILYGNYHPSSGYEMFAQLCARLGRPPKALFVASCGLMEGVLRYMSQ
                     HQLLESDIHLCSFDDHYLYDSLSVKIDTVAQDCRELAMHCFSMISDLMNEQPIEQTQC
                     FLSPKLHWRSPPFSQIK"
     misc_feature    complement(226982..227959)
                     /locus_tag="Rahaq2_4782"
                     /note="D-fructose-responsive transcription factor; Region:
                     fruct_sucro_rep; TIGR02417"
                     /db_xref="CDD:131470"
     misc_feature    complement(227795..227947)
                     /locus_tag="Rahaq2_4782"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(227795..227797,227801..227806,
                     227813..227815,227822..227824,227861..227863,
                     227870..227875,227897..227899,227906..227911,
                     227915..227929))
                     /locus_tag="Rahaq2_4782"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(227795..227824)
                     /locus_tag="Rahaq2_4782"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(226988..227776)
                     /locus_tag="Rahaq2_4782"
                     /note="Ligand binding domain of DNA transcription
                     repressor specific for fructose (FruR) and its close
                     homologs; Region: PBP1_FruR; cd06274"
                     /db_xref="CDD:107269"
     misc_feature    complement(order(227114..227116,227120..227122,
                     227207..227209,227615..227617,227669..227671,
                     227675..227677,227684..227686,227699..227701,
                     227708..227713,227717..227722,227750..227752))
                     /locus_tag="Rahaq2_4782"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107269"
     misc_feature    complement(order(227141..227143,227222..227224,
                     227378..227380,227486..227497,227528..227533,
                     227726..227728,227738..227740))
                     /locus_tag="Rahaq2_4782"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107269"
     gene            complement(228011..229420)
                     /locus_tag="Rahaq2_4783"
                     /note="IMG reference gene:2506711807"
                     /db_xref="GeneID:11818292"
     CDS             complement(228011..229420)
                     /locus_tag="Rahaq2_4783"
                     /note="PFAM: Glycosyl hydrolases family 32 N-terminal
                     domain;
                     TIGRFAM: sucrose-6-phosphate hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose-6-phosphate hydrolase"
                     /protein_id="YP_005220513.1"
                     /db_xref="GI:379704139"
                     /db_xref="InterPro:IPR008985"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR018053"
                     /db_xref="GeneID:11818292"
                     /translation="MTETRLLKKALRSVVAGQVRAAADPYRPGWHLAPPVGLLNDPNG
                     FIQHNGRFHLFYQWNPLACAHGAKFWGHWSSADLLHWQHEPVALVPSEEFETHGCYSG
                     SAVTDNGQLTLIYTGNVKYPDGSRTAFQCLARENAEGQFDKAGPVFNLPQGYTGHVRD
                     PKVWWHDKHWYMVLGAQDLSLKGKVLLLRSDNLLAWDLLGEIAGSGLYGLGEFGYMWE
                     CPDLFPLAGHDVLICCPQGLAAGSDRYLNTFQAGYFVGQLDYDKATFAHGDFAELDLG
                     FEFYAPQTTLTDDGRRLLIGWMGIPDGDEFYQPTIQNGWLHTLTCPRELTLVAGKIIQ
                     QPARELQQLRRNVQEWQGVADNAPSPDITKAETEIVTEHAFCADFGGDMTLSRDGECL
                     RLTRKNRRTGLPEHRVWRGRLRKLTVLSDASSLEIFINDGEAVMSSRYFPVLPAQLNL
                     RGSHQITLRHWSLAECVIE"
     misc_feature    complement(228095..229372)
                     /locus_tag="Rahaq2_4783"
                     /note="sucrose-6-phosphate hydrolase; Region: scrB_fam;
                     TIGR01322"
                     /db_xref="CDD:233357"
     misc_feature    complement(228404..229312)
                     /locus_tag="Rahaq2_4783"
                     /note="Glycosyl hydrolase family 32, beta-fructosidases;
                     Region: GH32_B_Fructosidase; cd08996"
                     /db_xref="CDD:185737"
     misc_feature    complement(order(228767..228769,228941..228946,
                     229118..229123,229250..229252,229298..229303))
                     /locus_tag="Rahaq2_4783"
                     /note="substrate binding [chemical binding]; other site"
                     /db_xref="CDD:185737"
     misc_feature    complement(order(228767..228769,228941..228943,
                     229298..229300))
                     /locus_tag="Rahaq2_4783"
                     /note="active site"
                     /db_xref="CDD:185737"
     misc_feature    complement(228125..>228178)
                     /locus_tag="Rahaq2_4783"
                     /note="Glycosyl hydrolases family 32 C terminal; Region:
                     Glyco_hydro_32C; pfam08244"
                     /db_xref="CDD:254688"
     gene            complement(229417..230790)
                     /locus_tag="Rahaq2_4784"
                     /note="IMG reference gene:2506711808"
                     /db_xref="GeneID:11818293"
     CDS             complement(229417..230790)
                     /locus_tag="Rahaq2_4784"
                     /note="PFAM: Phosphotransferase system, EIIC;
                     phosphotransferase system, EIIB;
                     TIGRFAM: PTS system, sucrose-specific IIBC component; PTS
                     system, glucose-like IIB component; PTS system, maltose
                     and glucose-specific subfamily, IIC component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, maltose and glucose-specific
                     subfamily, IIC component"
                     /protein_id="YP_005220514.1"
                     /db_xref="GI:379704140"
                     /db_xref="InterPro:IPR001996"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR013013"
                     /db_xref="InterPro:IPR018113"
                     /db_xref="GeneID:11818293"
                     /translation="MNINAIATELLPLLGGKDNIASAAHCATRLRLVLADDSLINKSA
                     IEKVEGVKGCFSNAGQIQIIFGTGLVNKVYAEFIKVAGISESSKSEAADIAARKLNPF
                     QRLARVLSNIFVPIIPAIVASGLLMGLLGMVKTYGWANPESAIFIMLDMFSSAAFIIL
                     PILIGFTAAREFGGNPFLGATLGGILTHPALTNAWGVASGFHTMNFFGIEIAMIGYQG
                     TVFPVLLAVWFMSFIEKRLRKVIPDALDLILTPFLTVIISGFIAFLLIGPAGRVLGDG
                     ISFILSTLITHAGWVAGLVFGGLYSVIVITGIHHSFHAIEAGLLGNPNIGVNFLLPIW
                     SMANVAQGGACLAVYFKTRDAKIKAIAVPSAFSAMLGITEAAIFGINLRFMKPFLAAL
                     AGGALGGAWVVAMHVNMTAVGLTGIPGLAIVQSSSILSYLIGLVIAFGSAFLLSLLLK
                     YNTESEK"
     misc_feature    complement(229444..230787)
                     /locus_tag="Rahaq2_4784"
                     /note="PTS system, sucrose-specific IIBC component;
                     Region: PTS-II-BC-sucr; TIGR01996"
                     /db_xref="CDD:131051"
     misc_feature    complement(230545..230781)
                     /locus_tag="Rahaq2_4784"
                     /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIB_glc; cd00212"
                     /db_xref="CDD:238130"
     misc_feature    complement(230698..230718)
                     /locus_tag="Rahaq2_4784"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    complement(230713..230715)
                     /locus_tag="Rahaq2_4784"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     misc_feature    complement(229438..230508)
                     /locus_tag="Rahaq2_4784"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG; COG1263"
                     /db_xref="CDD:224183"
     gene            complement(230866..232446)
                     /locus_tag="Rahaq2_4785"
                     /note="IMG reference gene:2506711809"
                     /db_xref="GeneID:11818294"
     CDS             complement(230866..232446)
                     /locus_tag="Rahaq2_4785"
                     /note="PFAM: LamB porin"
                     /codon_start=1
                     /transl_table=11
                     /product="maltoporin (phage lambda and maltose receptor)"
                     /protein_id="YP_005220515.1"
                     /db_xref="GI:379704141"
                     /db_xref="InterPro:IPR003192"
                     /db_xref="GeneID:11818294"
                     /translation="MMIKPRYLAVAIGLILSGTAQGTDISASAIEARFAALEKRLQVA
                     ENRAAKAERRASEAEQQVKTLEARTASNEQQTRLVAKDVEMTGQKTAEVAKRTETLAA
                     DTTKNSSDNSGFKFTGYARSGVIMNDSATSTESGPYVTPAGQTGGAVGRLGNEKDTYV
                     ELNLEHNQTMASGATSRYKVMLADGQRSYNDWTAATSDLNIRQAFVELGSLPTFSGPW
                     KDSTLWAGKRFDRDNFDIHWLDSDIIFLAGTGGGIYDVKWGENLKSNFSLYGRNFDDL
                     EDNNNDDTRIENYIVTANNYAGPFQWMLSGLRAKNNQDRENTGTSGITNAADTGFHTL
                     LAYHGDSFYGLREGTSKTALLYGHGLGAEVKALGSDGHLTDDASTLRLATYGITPISK
                     NWSIAPAVLAQQSKDRYVSGDDYKWLTFNTRLIQQITENFELAYEGSYQYMDLDPQGY
                     SDYNKVKGGFYKLTFAPTFKVGDISNMLSRPEIRFFATYMDWSKELDSYSSSDSFGTD
                     GFAAGGQWNFGIQMETWF"
     misc_feature    complement(232267..232446)
                     /locus_tag="Rahaq2_4785"
                     /note="Maltoporin periplasmic N-terminal extension;
                     Region: Sugarporin_N; pfam11471"
                     /db_xref="CDD:256472"
     misc_feature    complement(230869..232107)
                     /locus_tag="Rahaq2_4785"
                     /note="The Maltoporin-like channels (LamB porin) form a
                     trimeric structure which facilitate the diffusion of
                     maltodextrins and other sugars across the outer membrane
                     of Gram-negative bacteria. The membrane channel is formed
                     by an 18-strand antiparallel...; Region: Maltoporin-like;
                     cd01346"
                     /db_xref="CDD:238656"
     misc_feature    complement(order(230869..230871,230875..230877,
                     230881..230883,230887..230889,230998..231000,
                     231004..231006,231037..231042,231154..231156,
                     231592..231594,231631..231645,231694..231708,
                     231760..231762,231766..231774,231778..231780,
                     231823..231825,231829..231837,231841..231846,
                     231889..231891,231895..231903,231913..231915,
                     231919..231921,231967..231975,232069..232077,
                     232081..232083,232099..232101))
                     /locus_tag="Rahaq2_4785"
                     /note="trimer interface; other site"
                     /db_xref="CDD:238656"
     misc_feature    complement(230872..232101)
                     /locus_tag="Rahaq2_4785"
                     /note="maltoporin; Provisional; Region: lamB; PRK09360"
                     /db_xref="CDD:236481"
     misc_feature    complement(order(231712..231714,231721..231723,
                     231727..231729,231748..231750,231760..231762,
                     231841..231843,231964..231966,231970..231972,
                     232084..232086))
                     /locus_tag="Rahaq2_4785"
                     /note="sugar binding site [chemical binding]; other site"
                     /db_xref="CDD:238656"
     gene            232697..233629
                     /locus_tag="Rahaq2_4786"
                     /note="IMG reference gene:2506711810"
                     /db_xref="GeneID:11818295"
     CDS             232697..233629
                     /locus_tag="Rahaq2_4786"
                     /note="PFAM: pfkB family carbohydrate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="YP_005220516.1"
                     /db_xref="GI:379704142"
                     /db_xref="InterPro:IPR002139"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="GeneID:11818295"
                     /translation="MNNRVWVLGDAVVDLIAEEDGRLLKCPGGAPANVAVGIRRLGGD
                     SAFIGRVGDDPFGKFLMKTLGDEGVNIDWMYPDPDHRTSTVVVENDADGERTFTFMVR
                     PGADLFLRDTDIPAFDAGDFLHLCSIALSAEPSRSAAFLAMAKMKAAGGYICFDPNIR
                     HDLWPDEGQLRENLARALSLADVIKVSEDELEFLTGEALLSEGVLRLCDVYKPELLLV
                     TQGKQGVSVYRKYNAGLKHYPAPEVKAVDTTGAGDAFVAGLLAGLAQHWPLRSDNVWQ
                     SIIRQALACGSLATTARGAMTALPDSDTLKAFSS"
     misc_feature    232706..233584
                     /locus_tag="Rahaq2_4786"
                     /note="Fructokinases (FRKs) mainly from bacteria and
                     plants are enzymes with high specificity for fructose, as
                     are all FRKs, but they catalyzes the conversion of
                     fructose to fructose-6-phosphate, which is an entry point
                     into glycolysis via conversion into...; Region: bac_FRK;
                     cd01167"
                     /db_xref="CDD:238572"
     misc_feature    order(232793..232795,233444..233446,233453..233455)
                     /locus_tag="Rahaq2_4786"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238572"
     misc_feature    order(233255..233257,233351..233353,233438..233440,
                     233447..233452,233459..233461)
                     /locus_tag="Rahaq2_4786"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238572"
     gene            233851..236274
                     /locus_tag="Rahaq2_4787"
                     /note="IMG reference gene:2506711811"
                     /db_xref="GeneID:11818296"
     CDS             233851..236274
                     /locus_tag="Rahaq2_4787"
                     /note="PFAM: Surface antigen variable number repeat;
                     Surface antigen;
                     TIGRFAM: outer membrane protein assembly complex, YaeT
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly complex, YaeT
                     protein"
                     /protein_id="YP_005220517.1"
                     /db_xref="GI:379704143"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="InterPro:IPR010827"
                     /db_xref="InterPro:IPR016474"
                     /db_xref="GeneID:11818296"
                     /translation="MTMKKLLLASLLFSSVPVFAAGGFVVKDIHVEGLQRVTVGAALL
                     SIPVRVGDTVSDDDISQTIRALFATGNFDDVKVLEDGNTLIVQVKERPTIASITFSGN
                     KAIKDEMLQQNLEASGIRVGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPR
                     NRVDVKLVFTEGVSAKIQQINIVGNKAFTSDDLIAHFQLRDEVPWWNVIGDKKYEKQK
                     LSGDLETLRSFYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGAKYTVSGVVVTGD
                     MAGHSSEIETLATIPAGEWYNGAKVTTVESDIKNLLGRYGYAYPHVTTQSDINETDKT
                     VKLRISVDTGNRYSVRRIRFEGNDTSKDEVLRREMRQMEGAWLGNDLVQKGKDRLNRT
                     GYFESVDVDTQPVPGSQDQVDVVYKVKERNTGTFNVGVGYGTDSGISYQLGVTQDNWL
                     GSGNTVSFSGTRNSYQTYVEVSATNPYYTVDGISLGGKVFYNHYDAEDNDLAAYNLQS
                     YGTGVNLGLPVSENNTLNLGLDYVHSTLSDMEPQVAVWRYLNASGVQPGLVTTSTSSD
                     AQLSTNDFFASAGWAYNDLNRGFFPSSGTRASLVAKVTTPGSDDSYYKITFDANHYIP
                     LSDKSDWVLMGRAKAGYAAGIGSNEVPFYDNFYAGGSSSVRGFSSNTIGPKAAYYKCS
                     SADNSYSTCPVTKSTDAVGGNAMAIASAELYVPTPFISEKYASSVRTSLFVDSGTVWD
                     TKWKNTSATEAAGIPDYSDPTHIRVSSGIALQWQSPLGPLVFSYAQPLVKYEGDSAEQ
                     FQFNIGKTW"
     misc_feature    233851..236271
                     /locus_tag="Rahaq2_4787"
                     /note="outer membrane protein assembly factor YaeT;
                     Provisional; Region: PRK11067"
                     /db_xref="CDD:236834"
     misc_feature    233920..234123
                     /locus_tag="Rahaq2_4787"
                     /note="Surface antigen variable number repeat; Region:
                     Surf_Ag_VNR; pfam07244"
                     /db_xref="CDD:254121"
     misc_feature    234124..234366
                     /locus_tag="Rahaq2_4787"
                     /note="Surface antigen variable number repeat; Region:
                     Surf_Ag_VNR; pfam07244"
                     /db_xref="CDD:254121"
     misc_feature    234373..234639
                     /locus_tag="Rahaq2_4787"
                     /note="Surface antigen variable number repeat; Region:
                     Surf_Ag_VNR; pfam07244"
                     /db_xref="CDD:254121"
     misc_feature    234646..234882
                     /locus_tag="Rahaq2_4787"
                     /note="Surface antigen variable number repeat; Region:
                     Surf_Ag_VNR; pfam07244"
                     /db_xref="CDD:254121"
     misc_feature    234889..235113
                     /locus_tag="Rahaq2_4787"
                     /note="Surface antigen variable number repeat; Region:
                     Surf_Ag_VNR; pfam07244"
                     /db_xref="CDD:254121"
     misc_feature    235192..236271
                     /locus_tag="Rahaq2_4787"
                     /note="Surface antigen; Region: Bac_surface_Ag; pfam01103"
                     /db_xref="CDD:250364"
     gene            complement(236486..236872)
                     /locus_tag="Rahaq2_4788"
                     /note="IMG reference gene:2506711812"
                     /db_xref="GeneID:11818297"
     CDS             complement(236486..236872)
                     /locus_tag="Rahaq2_4788"
                     /note="PFAM: SelR domain;
                     TIGRFAM: methionine-R-sulfoxide reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220518.1"
                     /db_xref="GI:379704144"
                     /db_xref="InterPro:IPR002579"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="GeneID:11818297"
                     /translation="MNRELNDFERFVIENKGTERPNTGEYNDHFSPGRYVCKRCSAPL
                     YSSEHKFESHCGWPAFDDEIPGAVERVPDADGRRTEIVCANCKAHLGHVFEGEYLTEK
                     NLRHCVNSVSMIFESADAQGNYHKAE"
     misc_feature    complement(236522..236866)
                     /locus_tag="Rahaq2_4788"
                     /note="SelR domain; Region: SelR; cl15841"
                     /db_xref="CDD:265802"
     gene            complement(236971..237095)
                     /locus_tag="Rahaq2_4789"
                     /note="IMG reference gene:2506711813"
                     /pseudo
                     /db_xref="GeneID:11818298"
     gene            complement(237187..238221)
                     /locus_tag="Rahaq2_4790"
                     /note="IMG reference gene:2506711814"
                     /db_xref="GeneID:11818299"
     CDS             complement(237187..238221)
                     /locus_tag="Rahaq2_4790"
                     /note="PFAM: Bacterial extracellular solute-binding
                     protein, family 7"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component"
                     /protein_id="YP_005220519.1"
                     /db_xref="GI:379704145"
                     /db_xref="InterPro:IPR018389"
                     /db_xref="GeneID:11818299"
                     /translation="MDLIRKPLALALALLLLPAVVSATTLRYTDHEPLGAMRTRFIKD
                     VLFPAIEKESHGRLKIEEHWGGELSTGYDALRTVREGNNADIGIVVPEYTAKELPLHQ
                     LFKSFPTGPSGDKQIAFFRRVYAEIPAFPAELAKNGVVDIFLSTGYPVAFFSTHPLEK
                     LQNIKGTAWRSASFWHQNFLRNAGATPVTTPWGEQTVNAFKTGKLDGILVNIDSGYDL
                     KIQKMAPEVIVSKELWLGHLYLLVMNHKVWNGLAQEDKDAITRAANTAYKVAGSMMDH
                     SVEPQLDALRKDGANVRVLQHSEVTYWQEVTGYQDIQANWVKNQEAAGVKDVASTLQK
                     VSKVMEEEMK"
     misc_feature    complement(237211..238155)
                     /locus_tag="Rahaq2_4790"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            complement(238370..240790)
                     /locus_tag="Rahaq2_4791"
                     /note="IMG reference gene:2506711815"
                     /db_xref="GeneID:11818300"
     CDS             complement(238370..240790)
                     /locus_tag="Rahaq2_4791"
                     /note="PFAM: TonB-dependent Receptor Plug Domain; TonB
                     dependent receptor;
                     TIGRFAM: TonB-dependent hemoglobin/transferrin/lactoferrin
                     receptor family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane receptor for ferrienterochelin
                     and colicins"
                     /protein_id="YP_005220520.1"
                     /db_xref="GI:379704146"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:11818300"
                     /translation="MFKSFTQQGLVKNVIFMGTILTTTFNVNAAEAVKDNTDLTANNT
                     QSSEAIKKKPAVRTAQDLAQNNEEVMTVTETMPDKKPGSKTTLTAADMQRKGGNDFGT
                     IMRYEPLITATGANGGSGNGKSGFDRSGYTGYNIRGLESNRVGIDVDGIPQPSATGRS
                     YVSRAGLNTFGIGRDYIDPYIYGQVDIESGATSADRANTSIGGAVSFLPKSADDYLHP
                     GKETYFGYQSDYDSSDRSWHNGITAAAGDDTLRGLIAISRRDGQETRNNSGTLDAYPA
                     NWHSDAVMTSVIWQPNDAHKITGTLDYYEKVNHTHYDTWNNAGSAILGTAQQQSNTRR
                     WGASLKDEWTPFNDYVDAIVTKVYYQYTQAHDNTYLPNESQQMMNVYSNYDVNTYGAE
                     TSWLKTLGRHELSAGINGRVSNTERPFRESPDQSAFTTIMQPEANSRTYILGGFLQDT
                     IRFDLDGHNFSVVPAVRVAYQNTKARNLSDLSNSIVSEDQVSTLYGKANSDTQALPSL
                     AFTYDITPKLMTYLQYQRGAQFPDASQLYGSWNLGSNYAGRGQYALIGNTDLKTETSN
                     NFEWGMKGEATEGVTFKTSVFYNTYKNFIANTRYTRAGSPGMFTNVPSNIYTIYQAEN
                     RDEAFIYGGDLSTKINYGTWFSNVDGLSTTFALGYAKGQSKSSYDGDKYVDLDSVPPM
                     KFVAGVAWDDPSGIYGTALTATFVKGKKAEATSRQSYTNAGTPITGSTTEYMNVPGYG
                     MVDATAYWKVAKNVKLSGGVYNITDRKYWDYLSSRTLTETTNQDEYNKALAVMPGRSF
                     QLGVNVDF"
     misc_feature    complement(238373..240574)
                     /locus_tag="Rahaq2_4791"
                     /note="TonB-dependent hemoglobin/transferrin/lactoferrin
                     receptor family protein; Region: TonB-hemlactrns;
                     TIGR01786"
                     /db_xref="CDD:233577"
     misc_feature    complement(238373..240544)
                     /locus_tag="Rahaq2_4791"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(240164..240190,240224..240256,
                     240332..240355,240374..240391,240458..240487,
                     240515..240544))
                     /locus_tag="Rahaq2_4791"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(239639..239641,239699..239701))
                     /locus_tag="Rahaq2_4791"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            241157..241969
                     /locus_tag="Rahaq2_4792"
                     /note="IMG reference gene:2506711816"
                     /db_xref="GeneID:11818301"
     CDS             241157..241969
                     /locus_tag="Rahaq2_4792"
                     /note="PFAM: Siderophore-interacting protein;
                     Siderophore-interacting FAD-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore-interacting protein"
                     /protein_id="YP_005220521.1"
                     /db_xref="GI:379704147"
                     /db_xref="InterPro:IPR007037"
                     /db_xref="InterPro:IPR013113"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="GeneID:11818301"
                     /translation="MAQHRTESPAANLPVRVKNELVFRHITVKSSETISGCFKRIVLN
                     GDELTGFTSRGFDDHIKLFFPAVPGDVITPPVATEEGIVWGEGPRPLNREYTPLHYDA
                     QTNELTLDFYIHDGGVASEWAAGAKPGDKLIIGGPRGSLIIPTTYKWQLYVCDETGLP
                     AVKRRLRELKQAGSDARVTVLVKVKEVSCVSYLDEEKDFNIEWIVSDEHNGYQEDDAA
                     VKKLKSLPLPESDYYIWATGEGKFAKGLNDYFVETRGLEPNLVRCVAYWHNK"
     misc_feature    241193..241966
                     /locus_tag="Rahaq2_4792"
                     /note="Siderophore-interacting protein [Inorganic ion
                     transport and metabolism]; Region: ViuB; COG2375"
                     /db_xref="CDD:225250"
     misc_feature    241238..241957
                     /locus_tag="Rahaq2_4792"
                     /note="Siderophore interacting proteins share the domain
                     structure of the ferredoxin reductase like family.
                     Siderophores are produced in various bacteria (and some
                     plants) to extract iron from hosts. Binding constants are
                     high, so iron can be pilfered from...; Region:
                     siderophore_interacting; cd06193"
                     /db_xref="CDD:99790"
     misc_feature    order(241433..241444,241484..241486,241490..241492,
                     241496..241498,241505..241516,241625..241627,
                     241952..241957)
                     /locus_tag="Rahaq2_4792"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99790"
     misc_feature    order(241433..241435,241439..241444)
                     /locus_tag="Rahaq2_4792"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99790"
     misc_feature    order(241505..241507,241514..241516,241523..241525,
                     241541..241543)
                     /locus_tag="Rahaq2_4792"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99790"
     misc_feature    order(241625..241630,241703..241711,241868..241873)
                     /locus_tag="Rahaq2_4792"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99790"
     gene            241978..242457
                     /locus_tag="Rahaq2_4793"
                     /note="IMG reference gene:2506711817"
                     /db_xref="GeneID:11818302"
     CDS             241978..242457
                     /locus_tag="Rahaq2_4793"
                     /note="PFAM: Transcriptional regulator PadR-like family;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005220522.1"
                     /db_xref="GI:379704148"
                     /db_xref="InterPro:IPR005149"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818302"
                     /translation="MNHKHRRERMFETGDIRLLMLHFLQQRSAHGYELIKAIEQLSKG
                     EYTPSASIIYPNLTFLEEQGLIMASQEEGGKKQYSITPEGSQSLAEQGDLLGSVTEKL
                     HSLAILSNNRSIPEMQRAINNIRMALNLRLAKGPIEQETLYKITDALDRATKEIERS"
     misc_feature    241996..242397
                     /locus_tag="Rahaq2_4793"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1695"
                     /db_xref="CDD:224609"
     gene            242642..245575
                     /locus_tag="Rahaq2_4794"
                     /note="IMG reference gene:2506711818"
                     /db_xref="GeneID:11818303"
     CDS             242642..245575
                     /locus_tag="Rahaq2_4794"
                     /note="TIGRFAM: RHS repeat-associated core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="RHS repeat-associated core domain-containing
                     protein"
                     /protein_id="YP_005220523.1"
                     /db_xref="GI:379704149"
                     /db_xref="GeneID:11818303"
                     /translation="MSTSLFSQTPWVNVTDNRGLTVRSITYYRHPDSPQATDERTTFY
                     QYNACGFLKHSADPRLQGAGLVNIRRQTDLAGRLLHKQSTDAGTTVCLDDAAGRPFIT
                     ISNIRTADDGTQDISQAVSRTFVYEDATLPGRPLSMTEQVNGEAACISDRFVYAGNTD
                     AERALNLAGQCISHYDTAGLIQTDSIALTRVPLSVTRRLLKDANNPDTVADWQGQDAS
                     VWNDLLASEAYNMLTATDATGMTLTTTDAQDNVQRVAYDVAGRQTGSWLRLRGANEQV
                     IVKSLTYSAAGQKLREEHGNGVVTTYQYEPETQRLIGIKTERPAGHASGAKVLQDLRY
                     EYDPVGNVLSIRNDAEETRFWRNQKVVPENTYTYDSLYQLVSGTGREMANAGQQGSSL
                     RSPNVPLPTDSSAYTTYTRTYTYDNAGNLTLIRHSAPATNNNYTQAITVSDRSNRGVS
                     GTLAEIPSQVDASFTAGGQQKYLQPGQRLSWTARNELLQVTLVAREGDADDRECYRYD
                     TSSQRILKVVEQKANNIMQMRQVIYLPGLELRTTNSGGMQTENLQVICLGEAGRAQVR
                     IMHWVEGKPADLANDQIRYSYDNLNGSSVLELDGAGNIISAEEYYPYGGTAVWSARSQ
                     VEANYKTLRYSGKERDASGLYYYGYRYYQPWVGRWLSVDPAGTIDGLNMFRMCRNNPV
                     TLTDYDGLAPHPRTRLGEGPLYEPKLSTGKDRDLPGALPVISATPVSAEVTGTPIKLG
                     DVLNDEVMKSIPLLTDLINPAKMDMDDATKKILTHPDRIGDILAFSAIHISVNENDNI
                     HALRIVDSKTSDYQKRAGATLAYWAPQGGHVDIPAHPQKGQPELVFTPGFSGCTFVAD
                     KLDENTLRVRHVQGGKEDTEYNDLAVNEHGQGMIDAMEYRDYGYHMNGQEGLMENISG
                     SAFMIYEEGQWNIKYQSLANAPGILSVKEDTAGLFKKRQYLKVGMRHIKGGGVVNNGA
                     ISLRH"
     misc_feature    242648..244714
                     /locus_tag="Rahaq2_4794"
                     /note="Rhs family protein [Cell envelope biogenesis, outer
                     membrane]; Region: RhsA; COG3209"
                     /db_xref="CDD:225750"
     misc_feature    244469..244711
                     /locus_tag="Rahaq2_4794"
                     /note="RHS repeat-associated core domain; Region:
                     Rhs_assc_core; TIGR03696"
                     /db_xref="CDD:234316"
     gene            complement(245673..246473)
                     /locus_tag="Rahaq2_4795"
                     /note="IMG reference gene:2506711819"
                     /db_xref="GeneID:11818304"
     CDS             complement(245673..246473)
                     /locus_tag="Rahaq2_4795"
                     /note="PFAM: Metallopeptidase family M24;
                     TIGRFAM: methionine aminopeptidase, type I"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="YP_005220524.1"
                     /db_xref="GI:379704150"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /db_xref="GeneID:11818304"
                     /translation="MNNGSDSRYFINNNRMIKTPEGIDKARIAGKLAARVLHMITPYV
                     VPGVTTNELDRLCHDFIVNELQAIPANIGYHGYQKTTCTSVNHVICHGIPSDKALKKG
                     DIVNIDVALIKDGWYGDTSRMYYAGEPGILARRLVDTTFEAMMAGIAVVRPGATLGDV
                     GYAIAAVARREGFTIVEEYCGHGIGMGYHEDPQVLHYGERGRGLVLQEGMLFTIEPML
                     NAGKKQNKVLPDGWTVVTKDHSLSAQWEHMIAVTKDGYEILTPWPEDN"
     misc_feature    complement(245694..246407)
                     /locus_tag="Rahaq2_4795"
                     /note="Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also
                     known as methionyl aminopeptidase and Peptidase M.
                     Catalyzes release of N-terminal amino acids,
                     preferentially methionine, from peptides and arylamides;
                     Region: MetAP1; cd01086"
                     /db_xref="CDD:238519"
     misc_feature    complement(order(245736..245738,245829..245831,
                     245928..245930,246117..246119,246150..246152,
                     246201..246203))
                     /locus_tag="Rahaq2_4795"
                     /note="active site"
                     /db_xref="CDD:238519"
     gene            complement(246466..246720)
                     /locus_tag="Rahaq2_4796"
                     /note="IMG reference gene:2506711820"
                     /db_xref="GeneID:11818305"
     CDS             complement(246466..246720)
                     /locus_tag="Rahaq2_4796"
                     /note="PFAM: Protein of unknown function (DUF3423)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220525.1"
                     /db_xref="GI:379704151"
                     /db_xref="InterPro:IPR021831"
                     /db_xref="GeneID:11818305"
                     /translation="MGIIKISELMHENLRIASLAYTRSMNAQAEHWMKIGMLMETHPD
                     MTHSEISQLLVRCSVESDENSDSIRTLLNVGGTHRKASNE"
     misc_feature    complement(<246553..246720)
                     /locus_tag="Rahaq2_4796"
                     /note="Protein of unknown function (DUF3423); Region:
                     DUF3423; pfam11903"
                     /db_xref="CDD:152339"
     gene            246880..247269
                     /locus_tag="Rahaq2_4797"
                     /note="IMG reference gene:2506711821"
                     /db_xref="GeneID:11818306"
     CDS             246880..247269
                     /locus_tag="Rahaq2_4797"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220526.1"
                     /db_xref="GI:379704152"
                     /db_xref="GeneID:11818306"
                     /translation="MKSISKLLIGLVCVMALSGCARTEPVSTPHTTLVTHNSDSQIRT
                     AIIDAGQKRGWIMTDGAPGVINGHLNNREHKADIRITYNTSGYTINYVGSTNLLAEKG
                     EIHRSYNHWVNNLDNDIQIRLASSATK"
     gene            complement(247382..247633)
                     /locus_tag="Rahaq2_4798"
                     /note="IMG reference gene:2506711822"
                     /db_xref="GeneID:11818307"
     CDS             complement(247382..247633)
                     /locus_tag="Rahaq2_4798"
                     /note="TIGRFAM: pentapeptide MXKDX repeat protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pentapeptide MXKDX repeat-containing protein"
                     /protein_id="YP_005220527.1"
                     /db_xref="GI:379704153"
                     /db_xref="GeneID:11818307"
                     /translation="MKKLTVMMMSACLMMGAVSTTYAADAMAKKDTMGHMSKDCMKKD
                     SMSKDNMAKDSMGKDCMSKDHMKKDNMSKDAMKKDAMSQ"
     misc_feature    complement(247391..247627)
                     /locus_tag="Rahaq2_4798"
                     /note="pentapeptide MXKDX repeat protein; Region:
                     penta_MxKDx; TIGR02953"
                     /db_xref="CDD:131998"
     gene            complement(247684..248487)
                     /locus_tag="Rahaq2_4799"
                     /note="IMG reference gene:2506711823"
                     /db_xref="GeneID:11818308"
     CDS             complement(247684..248487)
                     /locus_tag="Rahaq2_4799"
                     /note="PFAM: Oxidoreductase molybdopterin binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite oxidase-like oxidoreductase"
                     /protein_id="YP_005220528.1"
                     /db_xref="GI:379704154"
                     /db_xref="InterPro:IPR000572"
                     /db_xref="GeneID:11818308"
                     /translation="MKKLIKKTISQIFSTADSEAIVQEAQKQIIRELDAPSRRLFLQR
                     GLTLGGVAMLTGCDISDNASVENALGKISGFNDRVQGWLFGSTRLAPVYAESMITRPF
                     PFNAFYAEEDAPQVDGNDYRLKIAGLALDKREWSLPALYNMAQVSQVTRHICVEGWSA
                     IGKWGGVPFGDFLRLIGADLTAEYVSFKCADEYYTSIDMATALHPQTLLALTYDGQIL
                     PRKYGFPMKLRMPTKLGYKNPKHIEVIEITNKFTGGYWEDQGYNWFGGS"
     misc_feature    complement(247690..248382)
                     /locus_tag="Rahaq2_4799"
                     /note="Sulfite oxidase and related enzymes [General
                     function prediction only]; Region: COG2041"
                     /db_xref="CDD:224952"
     misc_feature    complement(247693..248223)
                     /locus_tag="Rahaq2_4799"
                     /note="Sulfite oxidase (SO) family, molybdopterin binding
                     domain. This molybdopterin cofactor (Moco) binding domain
                     is found in a variety of oxidoreductases, main members of
                     this family are nitrate reductase (NR) and sulfite oxidase
                     (SO). SO catalyzes the...; Region: SO_family_Moco;
                     cl00199"
                     /db_xref="CDD:260254"
     misc_feature    complement(order(247765..247770,247774..247776,
                     247783..247785,247807..247809,247822..247824,
                     247909..247911,248026..248028,248158..248160,
                     248164..248166,248170..248172))
                     /locus_tag="Rahaq2_4799"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:238198"
     misc_feature    complement(248026..248028)
                     /locus_tag="Rahaq2_4799"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:238198"
     gene            complement(248497..249123)
                     /locus_tag="Rahaq2_4800"
                     /note="IMG reference gene:2506711824"
                     /db_xref="GeneID:11818309"
     CDS             complement(248497..249123)
                     /locus_tag="Rahaq2_4800"
                     /note="PFAM: Cytochrome b(N-terminal)/b6/petB"
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate reductase cytochrome B subunit
                     (membrane anchoring protein)"
                     /protein_id="YP_005220529.1"
                     /db_xref="GI:379704155"
                     /db_xref="InterPro:IPR000516"
                     /db_xref="InterPro:IPR005797"
                     /db_xref="InterPro:IPR016174"
                     /db_xref="GeneID:11818309"
                     /translation="MTIHTDLPHQAKSKPATVHPLWLRLTHWLNALAVLIMVTSGWQI
                     YNASPLFNFDFPSTLTLGGWLGGAIQWHFAGMWLFGFNGLFYLLMNIFTGRMKQKFWP
                     LTPRGIFNDFCAALRGKLKHDDLRHYNMVQRAAYVFVMFDGIVLVISGLVVWKSVQFP
                     LLRALMGGFDTARYVHFLAMASLVGFVVLHIVMVALVPKTLIAMLRGR"
     misc_feature    complement(248503..249072)
                     /locus_tag="Rahaq2_4800"
                     /note="Cytochrome b(N-terminal)/b6/petB; Region:
                     Cytochrom_B_N; pfam00033"
                     /db_xref="CDD:249526"
     gene            249277..249999
                     /locus_tag="Rahaq2_4801"
                     /note="IMG reference gene:2506711825"
                     /db_xref="GeneID:11818310"
     CDS             249277..249999
                     /locus_tag="Rahaq2_4801"
                     /note="PFAM: Response regulator receiver domain;
                     Transcriptional regulatory protein, C terminal"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator with CheY-like receiver
                     domain and winged-helix DNA-binding domain"
                     /protein_id="YP_005220530.1"
                     /db_xref="GI:379704156"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="GeneID:11818310"
                     /translation="MDKTKKILIVEDDGDIAELLSLHLRDEGYEITHAADGNLGVAHL
                     EKGGWDALILDLMLPGVDGLEICRRARNMTRYTPIIIISARSSEVHRVLGLELGADDY
                     LAKPFSMLELVARVKALFRRQEAMSRNMKMDAGTLSFSGLVIDPIARDVMLNHQPVEL
                     TPREFDLLYFFAKNPGKVFSRLSLLNQVWGYEHEGYEHTVNTHINRLRIKIEANPAEP
                     ERILTVWGKGYKFVSSSEESQG"
     misc_feature    249289..249972
                     /locus_tag="Rahaq2_4801"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    249298..249636
                     /locus_tag="Rahaq2_4801"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(249307..249312,249439..249441,249463..249465,
                     249523..249525,249580..249582,249589..249594)
                     /locus_tag="Rahaq2_4801"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    249439..249441
                     /locus_tag="Rahaq2_4801"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(249448..249453,249457..249465)
                     /locus_tag="Rahaq2_4801"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    249589..249597
                     /locus_tag="Rahaq2_4801"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    249685..249969
                     /locus_tag="Rahaq2_4801"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(249757..249759,249814..249819,249871..249873,
                     249880..249882,249904..249909,249943..249945,
                     249958..249960)
                     /locus_tag="Rahaq2_4801"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            250003..251469
                     /locus_tag="Rahaq2_4802"
                     /note="IMG reference gene:2506711826"
                     /db_xref="GeneID:11818311"
     CDS             250003..251469
                     /locus_tag="Rahaq2_4802"
                     /note="PFAM: HAMP domain; Histidine kinase-, DNA gyrase
                     B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_005220531.1"
                     /db_xref="GI:379704157"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="GeneID:11818311"
                     /translation="MKNLTLAQRLTLVFTGLLIACCAFSGYMQVRSSNQYSQSVIQRL
                     SANLATQIAANNPLLSQGNWDPKAVHTLFDQLMAVNPSVEVYLLDKDGNIVGNAAPPG
                     RLQQQKIDLAPVNALLNGAKMPVYGENPRDPQTRQVFSAAPLRVDGIIKGYVYIILLG
                     DQYTALTSDAQYQSAISLALRSMGLVALFGLLAGALAFRWVTRPVRKLTSQIARLDTG
                     GMEAIQALAKTNTPAGAARDEVTQLQQAFVALAKRIDQQWQSLMVQDQQRREFIANIS
                     HDLRTPLTSLHGYLETLSVKADHLSDEDRQRYLNIALTQSKKVGRLAQELFELARLEY
                     GVVKPQKEPFSLSELVQDVFQKFELATETRGQKLLADITPGIPLVNADLGMIERVLTN
                     LLDNAIRFTPEGGVIEIKLWKQAGQVMVQLKDSGPGIAPELKDSLFVRPSILSTNKHR
                     AGGLGLMIVRRILQLHGSDIKLIEQPKHGACFQFSVPL"
     misc_feature    250003..250614
                     /locus_tag="Rahaq2_4802"
                     /note="Bacterial virulence factor haemolysin; Region:
                     SMP_2; cl11479"
                     /db_xref="CDD:264392"
     misc_feature    250012..251463
                     /locus_tag="Rahaq2_4802"
                     /note="heavy metal sensor kinase; Region: cztS_silS_copS;
                     TIGR01386"
                     /db_xref="CDD:233391"
     misc_feature    250549..250770
                     /locus_tag="Rahaq2_4802"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    250795..250995
                     /locus_tag="Rahaq2_4802"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(250813..250815,250825..250827,250837..250839,
                     250846..250848,250858..250860,250867..250869,
                     250924..250926,250936..250938,250945..250947,
                     250957..250959,250966..250968,250978..250980)
                     /locus_tag="Rahaq2_4802"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    250831..250833
                     /locus_tag="Rahaq2_4802"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    251158..251460
                     /locus_tag="Rahaq2_4802"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(251176..251178,251188..251190,251197..251199,
                     251266..251268,251272..251274,251278..251280,
                     251284..251289,251359..251370,251416..251418,
                     251422..251424,251437..251442,251446..251448)
                     /locus_tag="Rahaq2_4802"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    251188..251190
                     /locus_tag="Rahaq2_4802"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(251278..251280,251284..251286,251359..251361,
                     251365..251367)
                     /locus_tag="Rahaq2_4802"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            251598..251918
                     /locus_tag="Rahaq2_4803"
                     /note="IMG reference gene:2506711827"
                     /db_xref="GeneID:11818312"
     CDS             251598..251918
                     /locus_tag="Rahaq2_4803"
                     /note="PFAM: Small Multidrug Resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cation/cationic drug transporter"
                     /protein_id="YP_005220532.1"
                     /db_xref="GI:379704158"
                     /db_xref="InterPro:IPR000390"
                     /db_xref="GeneID:11818312"
                     /translation="MAWVYLFFAGIFEVVWSTAMKESHGFTRLIPSILTVFFMILSVV
                     LLAISMKTLPLGTSYTVWVGIGAIGAFILGVVMFGESLSPLRVIAVLLIFSGVILLKV
                     ATKG"
     misc_feature    251598..251912
                     /locus_tag="Rahaq2_4803"
                     /note="Membrane transporters of cations and cationic drugs
                     [Inorganic ion transport and metabolism]; Region: EmrE;
                     COG2076"
                     /db_xref="CDD:224987"
     gene            complement(251978..252451)
                     /locus_tag="Rahaq2_4804"
                     /note="IMG reference gene:2506711828"
                     /db_xref="GeneID:11818313"
     CDS             complement(251978..252451)
                     /locus_tag="Rahaq2_4804"
                     /note="PFAM: Helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="Helix-turn-helix protein"
                     /protein_id="YP_005220533.1"
                     /db_xref="GI:379704159"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:11818313"
                     /translation="MKEPLIAADSAKSTIAKIRAKKNDANHSRRDAGQMLAQEKTSST
                     VKKQTRRRVSSLTKPVSTNDRNEARLNIMRALLLGEITQGQALKALRITVLGLKQDTF
                     AKLVSVSRKSLSEVENDKGNYTPDIINRLFKPFGLKVGLVPVSQQIFRTLFESSE"
     misc_feature    complement(252035..252202)
                     /locus_tag="Rahaq2_4804"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(252098..252100,252176..252178,
                     252188..252190))
                     /locus_tag="Rahaq2_4804"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(252101..252103,252179..252181))
                     /locus_tag="Rahaq2_4804"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(252095..252100,252110..252112,
                     252119..252121,252152..252157))
                     /locus_tag="Rahaq2_4804"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(252402..252848)
                     /locus_tag="Rahaq2_4805"
                     /note="IMG reference gene:2506711829"
                     /pseudo
                     /db_xref="GeneID:11818314"
     gene            complement(252880..253020)
                     /locus_tag="Rahaq2_4806"
                     /note="IMG reference gene:2506711830"
                     /pseudo
                     /db_xref="GeneID:11818315"
     gene            253354..253572
                     /locus_tag="Rahaq2_4807"
                     /note="IMG reference gene:2506711831"
                     /db_xref="GeneID:11818316"
     CDS             253354..253572
                     /locus_tag="Rahaq2_4807"
                     /note="PFAM: Bacterial protein of unknown function
                     (DUF903)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220534.1"
                     /db_xref="GI:379704160"
                     /db_xref="InterPro:IPR010305"
                     /db_xref="GeneID:11818316"
                     /translation="MKKLLSGVAVMGIMFAVSACSSDYIISTNDGHMITTHGKPVKDK
                     DTGLISYKDTDGSIHQVHQGDVKEIVEK"
     misc_feature    253420..253566
                     /locus_tag="Rahaq2_4807"
                     /note="Bacterial protein of unknown function (DUF903);
                     Region: DUF903; pfam06004"
                     /db_xref="CDD:253505"
     gene            253800..254318
                     /locus_tag="Rahaq2_4808"
                     /note="IMG reference gene:2506711832"
                     /db_xref="GeneID:11818317"
     CDS             253800..254318
                     /locus_tag="Rahaq2_4808"
                     /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
                     TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit sigma24"
                     /protein_id="YP_005220535.1"
                     /db_xref="GI:379704161"
                     /db_xref="InterPro:IPR000838"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR013324"
                     /db_xref="InterPro:IPR013325"
                     /db_xref="GeneID:11818317"
                     /translation="MSTNAAVSPARAFEALYSSHHRWLKNWLQFKLGSANDADDLAQD
                     TFMRVLTGDSAQEIREPKSFLCTIARRVMVDFFRRNALERAYLDMLALMPEEHMPSPE
                     QRQCLLETLQQIDTMLDGLGEKVRQAFLLSQLEGLTYPVIAERLNVSVSSVKKYMAKA
                     TEHCLLFSLEHG"
     misc_feature    253803..254315
                     /locus_tag="Rahaq2_4808"
                     /note="RNA polymerase sigma factor FecI; Provisional;
                     Region: PRK09651"
                     /db_xref="CDD:182018"
     misc_feature    253845..254042
                     /locus_tag="Rahaq2_4808"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    254130..254279
                     /locus_tag="Rahaq2_4808"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(254163..254165,254193..254195,254211..254216,
                     254244..254246,254250..254255,254259..254267,
                     254271..254276)
                     /locus_tag="Rahaq2_4808"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            254324..255295
                     /locus_tag="Rahaq2_4809"
                     /note="IMG reference gene:2506711833"
                     /db_xref="GeneID:11818318"
     CDS             254324..255295
                     /locus_tag="Rahaq2_4809"
                     /note="PFAM: FecR protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+-dicitrate sensor membrane protein"
                     /protein_id="YP_005220536.1"
                     /db_xref="GI:379704162"
                     /db_xref="InterPro:IPR006860"
                     /db_xref="InterPro:IPR012373"
                     /db_xref="GeneID:11818318"
                     /translation="MNSSVSDHQRLALKMAARWFATLCSGEVTPQQNQKWQVWLAQHE
                     DHRWAWQRVESLQGQMHSMPGKFSYQTLSHAHRQSDITRRRVLKGLLVLLGLGGTWKA
                     WQTPAGQGLLADTRTSTGEIKTLRLDDGSQLSLNTASAADIRFTPQQRLIRLHQGEIR
                     ITTARDPQPVARPFLVQTQQGMLRALGTEFIVRQYDDATRLTVLKHAVEITLPGHPVP
                     RLQVSEGHSVRFTGTAFGEVTAIESGAGSWNKGVLSVSDRRLAEVVDELARYRHGHLS
                     CDPAVADLRISGTFPLNDTDSVLNILSRTLPVKIQTMTRYWVNVVPA"
     misc_feature    254324..255292
                     /locus_tag="Rahaq2_4809"
                     /note="fec operon regulator FecR; Reviewed; Region:
                     PRK09774"
                     /db_xref="CDD:236622"
     misc_feature    254669..254950
                     /locus_tag="Rahaq2_4809"
                     /note="FecR protein; Region: FecR; pfam04773"
                     /db_xref="CDD:252792"
     gene            255431..257791
                     /locus_tag="Rahaq2_4810"
                     /note="IMG reference gene:2506711834"
                     /db_xref="GeneID:11818319"
     CDS             255431..257791
                     /locus_tag="Rahaq2_4810"
                     /note="PFAM: TonB dependent receptor; TonB-dependent
                     Receptor Plug Domain; Secretin and TonB N terminus short
                     domain;
                     TIGRFAM: TonB-dependent siderophore receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="YP_005220537.1"
                     /db_xref="GI:379704163"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR010917"
                     /db_xref="InterPro:IPR011662"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:11818319"
                     /translation="MSISRSRVVRSFGKTTPLAIAIHCAIIPAALMSALPAAAAVQSA
                     SYQIAAGDLDTALNQFAAKAGITLSVDSSLTRGKHSNGLQGNYTPDDGLTALLADSGL
                     EAKSLGNSAFTLAAIPVPVQTPESLTVVGDWLADARENDVFEHGGARDVIRREDFVKT
                     GATTVREVMNRIPGVNAPENNGTGSHDMAMNFGIRGLNPRLASRTTVLMDGIPVPFAP
                     YGQPQLSLAPVSPGNMDAVDVVRGGGAVRYGPQSVGGVVNFVTRAIPKDFGIEAGTEG
                     TYSPTSSQNHPKGTGNLMIGGTADNGLGGALLYSGTRGSDWREHSATKIDDVMLKTRY
                     APNEIHTFNSLLQYYEGRAEMPGGLSRADYNASRFQSTRPYDEFWGRRQLASFGYQYQ
                     PDQQHKFNIQSFYTYTLRSGYLDQGKNLTLSPRQYWVRGIEPRYSQSFNLGQTAHEVG
                     VGYRYVSESTHELRYYSPAKSGVLPTGNSPYDRDTQSGTQANAFYIDDRIDVGDWTLT
                     PGMRYEHIQSYQNNYIKGTKQEISYNAPLPALNVVYHLNDAWNIYGNTEGSFGTVQYS
                     QIGKAVDSGNIGPEKARTWELGTRFDNNIVKAEVGLFLINFNNQYDSSQTTDSVTARG
                     KTRHTGLESQIRYDLSDLSPKLENVSAYASYAYVNAVIREEGDTHGNQVPFSPKNKGT
                     LGLDYTPGNWFFNVNSEYQSGQFADNANTVEESADGSTGRIPGFMLWGARAGYQFGAD
                     MANLNLAFGVKNIFDHEYFTRAYDDNNKGIYAGQPRTLYMQGSLKF"
     misc_feature    255611..257788
                     /locus_tag="Rahaq2_4810"
                     /note="Outer membrane receptor for Fe3+-dicitrate
                     [Inorganic ion transport and metabolism]; Region: FecA;
                     COG4772"
                     /db_xref="CDD:227113"
     misc_feature    255626..255778
                     /locus_tag="Rahaq2_4810"
                     /note="Secretin and TonB N terminus short domain; Region:
                     STN; smart00965"
                     /db_xref="CDD:198033"
     misc_feature    255878..257788
                     /locus_tag="Rahaq2_4810"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(255878..255901,255929..255958,256004..256021,
                     256049..256072,256121..256153,256187..256213)
                     /locus_tag="Rahaq2_4810"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    order(256658..256660,256703..256705)
                     /locus_tag="Rahaq2_4810"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            257843..258748
                     /locus_tag="Rahaq2_4811"
                     /note="IMG reference gene:2506711835"
                     /db_xref="GeneID:11818320"
     CDS             257843..258748
                     /locus_tag="Rahaq2_4811"
                     /note="PFAM: Periplasmic binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type Fe3+-citrate transport system,
                     periplasmic component"
                     /protein_id="YP_005220538.1"
                     /db_xref="GI:379704164"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:11818320"
                     /translation="MSFFSRFALFASLCFLLPAAQAVTVTDQQGSFTIDSTPKRVVVL
                     ELSFVDALAVVDVSPVGVADDNDADRILPQVRQRISAWQSVGTRSQPSLEAIAALKPD
                     LIIADSSRHSGIYAALKGIAPTLLLKSRNETYSEDLASAAIIGKVLGKDVLMQQRLKE
                     HHQRMQAFAAQLPKGTQVVFGTSREQQFNLHTRDSYTGSVLTSLGLIVPEPVNQQALA
                     NISFEQLLAINPDWLIVAHYRQESIVRQWQQDPLWQMMKAAQQKQEASVDSNVWARMR
                     GVFAAEQIARDTVQILHHQALKTAP"
     misc_feature    257948..258700
                     /locus_tag="Rahaq2_4811"
                     /note="Fe3+-siderophore binding domain FhuD.  These
                     proteins have been shown to function as initial receptors
                     in ABC transport of Fe3+-siderophores in many eubacterial
                     species. They belong to the TroA-like superfamily of
                     helical backbone metal receptor proteins...; Region: FhuD;
                     cd01146"
                     /db_xref="CDD:238566"
     misc_feature    257963..258631
                     /locus_tag="Rahaq2_4811"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    order(258053..258055,258104..258109,258170..258172,
                     258407..258409)
                     /locus_tag="Rahaq2_4811"
                     /note="siderophore binding site; other site"
                     /db_xref="CDD:238566"
     gene            258745..259749
                     /locus_tag="Rahaq2_4812"
                     /note="IMG reference gene:2506711836"
                     /db_xref="GeneID:11818321"
     CDS             258745..259749
                     /locus_tag="Rahaq2_4812"
                     /note="PFAM: FecCD transport family"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe3+-siderophore ABC transporter permease"
                     /protein_id="YP_005220539.1"
                     /db_xref="GI:379704165"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="GeneID:11818321"
                     /translation="MMAVKYLFAGWRWTLPLFILGVSFWLTLFCRSAVPIGAVESLRA
                     LLPGPPVSLAQALVLNLRLPRSLVAMLLGASLALAGSLLQTLTRNPLASPSLFGINAG
                     ASLAMVLVSALSPQLFSGFSIALVAALGGGVSWGTVMLTGGGWRQAGDRSRLILAGVA
                     VSALCAALAKATLILSEDHAYGILSWLAGGVAHARWPEFWHLFPFTAIIAPWVLLLAG
                     RLNLLQVSDDSAQTLGVNLPRLRLTINLMVLLLVGACVSVAGPLAFIGLLVPHISRYW
                     IGYDLRRMLPLSMIFGATLMLLADLLARFLAWPGELPAGVVLALIGAPFFVWLVRTRT
                     "
     misc_feature    258943..259734
                     /locus_tag="Rahaq2_4812"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(258994..258996,259006..259014,259384..259389,
                     259393..259401,259405..259410,259414..259431,
                     259435..259443,259564..259566,259585..259587)
                     /locus_tag="Rahaq2_4812"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(259009..259011,259015..259017,259030..259032,
                     259201..259203,259207..259212,259219..259224,
                     259231..259236,259243..259245,259252..259257,
                     259261..259263,259294..259299,259306..259308,
                     259534..259536,259690..259692,259699..259704,
                     259711..259713,259720..259725,259732..259734)
                     /locus_tag="Rahaq2_4812"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(259261..259263,259336..259338,259510..259512,
                     259522..259524,259654..259656,259681..259683)
                     /locus_tag="Rahaq2_4812"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            259746..260708
                     /locus_tag="Rahaq2_4813"
                     /note="IMG reference gene:2506711837"
                     /db_xref="GeneID:11818322"
     CDS             259746..260708
                     /locus_tag="Rahaq2_4813"
                     /note="PFAM: FecCD transport family"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe3+-siderophore ABC transporter permease"
                     /protein_id="YP_005220540.1"
                     /db_xref="GI:379704166"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="GeneID:11818322"
                     /translation="MTRQFTLFLTLSALLLLTFVISLRYGTHTLTFEQMRLAVSPADS
                     NHFPLFEYRLPRTLLAMLVGAALALSGVLVQGIIRNPLASPDILGVNHAAGLASAGAL
                     MLLPALPVLWLPPLAFTGGIAAFVLLRLMAGRSAPLRLALTGVALTAFYASLTDYLML
                     SHPMEINNALLWLTGSLWGRGWNFVEIVAPWLLILLPLSLWFCRDLDVLALGDDSAST
                     LGIRVSRVQRLVLLLAVALAAISVAACGPVGFIGLVAPHLTRKLVGGRHRVLIPASLL
                     VGALILLLADVLARTLHPPLELPAGVLTAVIGAPYFFWLLMRTR"
     misc_feature    259914..260693
                     /locus_tag="Rahaq2_4813"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(259968..259970,259980..259988,260343..260348,
                     260352..260360,260364..260369,260373..260390,
                     260394..260402,260523..260525,260544..260546)
                     /locus_tag="Rahaq2_4813"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(259983..259985,259989..259991,260004..260006,
                     260160..260162,260166..260171,260178..260183,
                     260190..260195,260202..260204,260211..260216,
                     260220..260222,260253..260258,260265..260267,
                     260493..260495,260649..260651,260658..260663,
                     260670..260672,260679..260684,260691..260693)
                     /locus_tag="Rahaq2_4813"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(260220..260222,260295..260297,260469..260471,
                     260481..260483,260613..260615,260640..260642)
                     /locus_tag="Rahaq2_4813"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            260711..261478
                     /locus_tag="Rahaq2_4814"
                     /note="IMG reference gene:2506711838"
                     /db_xref="GeneID:11818323"
     CDS             260711..261478
                     /locus_tag="Rahaq2_4814"
                     /note="PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin/Fe3+-siderophore ABC transporter
                     ATPase"
                     /protein_id="YP_005220541.1"
                     /db_xref="GI:379704167"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818323"
                     /translation="MQLSAENLTAGYGNKNILNGLSLTLPAGKITALIGPNGCGKSTL
                     LKCFSRLLTPACGTLRLGDDDLSTLHGRPLARKLALLPQQHIAPEGISVRELVGYGRS
                     PWLNLWGRLGQQDKTIVERAMQETNITELAEKRVSELSGGQRQRVFLAMVLAQDTPLV
                     LLDEPTTYLDISHQVELMSLLRSQNQQGKTLVAVLHDLNQASRYCDYLVMMAAGKIIA
                     QGTPEEVMTPELLAQVFDIDAQIYPEPVTGKPMCIVR"
     misc_feature    260711..261475
                     /locus_tag="Rahaq2_4814"
                     /note="iron-dicitrate transporter ATP-binding subunit;
                     Provisional; Region: fecE; PRK11231"
                     /db_xref="CDD:183044"
     misc_feature    260720..261370
                     /locus_tag="Rahaq2_4814"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    260813..260836
                     /locus_tag="Rahaq2_4814"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(260822..260827,260831..260839,260957..260959,
                     261197..261202,261296..261298)
                     /locus_tag="Rahaq2_4814"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    260948..260959
                     /locus_tag="Rahaq2_4814"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    261125..261154
                     /locus_tag="Rahaq2_4814"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    261185..261202
                     /locus_tag="Rahaq2_4814"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    261209..261220
                     /locus_tag="Rahaq2_4814"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    261284..261304
                     /locus_tag="Rahaq2_4814"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            complement(261503..261988)
                     /locus_tag="Rahaq2_4815"
                     /note="IMG reference gene:2506711839"
                     /db_xref="GeneID:11818324"
     CDS             complement(261503..261988)
                     /locus_tag="Rahaq2_4815"
                     /note="PFAM: Protein of unknown function (DUF796);
                     TIGRFAM: type VI secretion system effector, Hcp1 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="YP_005220542.1"
                     /db_xref="GI:379704168"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="GeneID:11818324"
                     /translation="MPIPAYMWLYDDGGSAIKGSVDVAGREGSIEIIGFSHGLNIPVD
                     SRSGSITGTRSHSPMMFEKEFDSSSPYLYKAVSKGQTLKSAEIRWYRINDAGREEAYF
                     IMTIEGVKITGVNPGMPNVKMSGNSQINHMESVSMMYNKITWHCVDGNIKYTDEWNDR
                     S"
     misc_feature    complement(261509..261985)
                     /locus_tag="Rahaq2_4815"
                     /note="type VI secretion system effector, Hcp1 family;
                     Region: VI_effect_Hcp1; TIGR03344"
                     /db_xref="CDD:213799"
     gene            262179..262706
                     /locus_tag="Rahaq2_4816"
                     /note="IMG reference gene:2506711840"
                     /db_xref="GeneID:11818325"
     CDS             262179..262706
                     /locus_tag="Rahaq2_4816"
                     /note="PFAM: Protein of unknown function (DUF2778)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220543.1"
                     /db_xref="GI:379704169"
                     /db_xref="InterPro:IPR021225"
                     /db_xref="GeneID:11818325"
                     /translation="MALQGKFVINDADYCPLLMYGVGTYMAYSGKDAYRNRASCSGIL
                     NLGPIPHGRYHIIKRATGGVKGIVRADLRDSYSWFTPTPVIKAEWFALYRDDGSIDDK
                     TWIEGVERGNFRLHPPGPLGISLGCITLQHRSDFMAIRQALMSTRQTELPNGLMSYGM
                     IEVILNGQASCGNGM"
     misc_feature    262245..262634
                     /locus_tag="Rahaq2_4816"
                     /note="Protein of unknown function (DUF2778); Region:
                     DUF2778; pfam10908"
                     /db_xref="CDD:256198"
     gene            262675..262941
                     /locus_tag="Rahaq2_4817"
                     /note="IMG reference gene:2506711841"
                     /db_xref="GeneID:11818326"
     CDS             262675..262941
                     /locus_tag="Rahaq2_4817"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220544.1"
                     /db_xref="GI:379704170"
                     /db_xref="GeneID:11818326"
                     /translation="MDRRRVATGCRILIGLGIYILVFLILRPSSPVTKEQYAFWNESA
                     AIFGEPDVEGFIGWALFIICPVITVILYQVIVRLLHWHLNKPGK"
     gene            263144..264307
                     /locus_tag="Rahaq2_4818"
                     /note="IMG reference gene:2506711842"
                     /db_xref="GeneID:11818327"
     CDS             263144..264307
                     /locus_tag="Rahaq2_4818"
                     /note="PFAM: FMN-dependent dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-hydroxyacid dehydrogenase"
                     /protein_id="YP_005220545.1"
                     /db_xref="GI:379704171"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020920"
                     /db_xref="GeneID:11818327"
                     /translation="MIISASTDYRAAAKSKLPPFLFHYIDGGAYNEHTLRRNTADLAD
                     IALRQRILKNMSDLSLETQLFGEKLAMPVVLAPVGLTGMYARRGEVQAARAAAKKGIP
                     FTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAQAAGVRTLVFTVDMPT
                     PGARYRDAHSGMSGPNAAVRRMFQAVMHPQWAWDVGLNGKPHDLGNVSAYRGKPTTLE
                     DYIGWLAANFDPSISWKDLEWIREFWKGPMIIKGILDPEDAKDAVKFGADGIVVSNHG
                     GRQLDGVLSTAHALPAIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVY
                     ALAAAGEAGVINLLNLIEKEMRVAMILTGAKSIADISADSLVYGRDQVHRATL"
     misc_feature    263144..264286
                     /locus_tag="Rahaq2_4818"
                     /note="L-lactate dehydrogenase; Provisional; Region: lldD;
                     PRK11197"
                     /db_xref="CDD:183033"
     misc_feature    263165..264256
                     /locus_tag="Rahaq2_4818"
                     /note="Family of homologous FMN-dependent
                     alpha-hydroxyacid oxidizing enzymes. This family occurs in
                     both prokaryotes and eukaryotes. Members of this family
                     include flavocytochrome b2 (FCB2), glycolate oxidase
                     (GOX), lactate monooxygenase (LMO), mandelate...; Region:
                     alpha_hydroxyacid_oxid_FMN; cd02809"
                     /db_xref="CDD:239203"
     misc_feature    order(263213..263215,263459..263461,263528..263530,
                     263612..263614,263633..263635,263894..263896,
                     263966..263968,263975..263977,264131..264133)
                     /locus_tag="Rahaq2_4818"
                     /note="active site"
                     /db_xref="CDD:239203"
     misc_feature    order(263213..263215,263528..263530,263633..263635,
                     263966..263968,263975..263977)
                     /locus_tag="Rahaq2_4818"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239203"
     misc_feature    order(263459..263461,263528..263530,263612..263614,
                     263894..263896,263966..263968,263975..263977,
                     264131..264133)
                     /locus_tag="Rahaq2_4818"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239203"
     misc_feature    order(263528..263530,263633..263635,263966..263968)
                     /locus_tag="Rahaq2_4818"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239203"
     gene            complement(264350..265480)
                     /locus_tag="Rahaq2_4819"
                     /note="IMG reference gene:2506711843"
                     /db_xref="GeneID:11818328"
     CDS             complement(264350..265480)
                     /locus_tag="Rahaq2_4819"
                     /note="PFAM: GGDEF domain;
                     TIGRFAM: diguanylate cyclase (GGDEF) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase domain-containing protein"
                     /protein_id="YP_005220546.1"
                     /db_xref="GI:379704172"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="GeneID:11818328"
                     /translation="MQKTTHTLQNTAFDTLLDHYKKASLRTSGIWLLLANLSFVLFLF
                     GRHQFRVLLDPNADVAVSGPVLDKLALIFLVFFIILLPVLRFIRSRMPAMILAFLVGL
                     YWAVVFHFMLASDAQQQLVFPLFCMLIFTALIALYPTMPVLYSFTLPLWFSLFFHLVL
                     LKPAIPILEIAAMIVVSALFETARMMLSRWFVLSVRRECDNQLLVSKLDNLAHYDPLT
                     GIANRRQLDNQLEQMIAQTERQGGTFSLIMIDVDFFKKYNDHYGHQAGDTCLVGIAEC
                     FKQVVRQPADLVARYGGEEFVVLLHNADAKDAEVVAERIRQSVTQAAIPHALSQVSDT
                     VTVSQGIMQWSPGMTSLELLKRADGALYDAKHAGRNGYCVGQ"
     misc_feature    complement(<264890..>265261)
                     /locus_tag="Rahaq2_4819"
                     /note="Acyltransferase family; Region: Acyl_transf_3;
                     cl19154"
                     /db_xref="CDD:267507"
     misc_feature    complement(264362..264844)
                     /locus_tag="Rahaq2_4819"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(264599..264601,264731..264733))
                     /locus_tag="Rahaq2_4819"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(264596..264607,264611..264613,
                     264680..264682,264692..264694,264704..264709,
                     264716..264718))
                     /locus_tag="Rahaq2_4819"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(264539..264541,264623..264625))
                     /locus_tag="Rahaq2_4819"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(265489..267699)
                     /locus_tag="Rahaq2_4820"
                     /note="IMG reference gene:2506711844"
                     /db_xref="GeneID:11818329"
     CDS             complement(265489..267699)
                     /locus_tag="Rahaq2_4820"
                     /note="PFAM: Peptidase M16 inactive domain; Insulinase
                     (Peptidase family M16);
                     TIGRFAM: coenzyme PQQ biosynthesis probable peptidase
                     PqqF"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ biosynthesis peptidase PqqF"
                     /protein_id="YP_005220547.1"
                     /db_xref="GI:379704173"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="GeneID:11818329"
                     /translation="MLPAVHTLTLASGLRVNILHDPQASRAAALVHLNAGSHHEPPEF
                     PGLAHLFEHVVFAGSRRFQGGDRLMMWAQAEGAQLNATTHATSTAWFFEIIPAKFEEG
                     LARLMDMLVQPLLSTDAVQQEVAVIDAEYRMLSAHADPLCDVALSLAFAAPAQLHDFH
                     IGHRTAFGEDISALQQALRHYHQRFFTAGLLTLWLQGPQSVAELTALAEHYGNAFAAG
                     KGSPPAHTQPLALSRERYLQLRLESSPRLRFSFPVTPCPALTLLRQLLTDEAPGSLLE
                     QLRTQALADSVRVSLPYASAGDAILSIEFMTCATAPTLRAGVETLFCHWLQQIRDLSA
                     GHLQHYTALARRDFSRLTPLDQLRVRTLDFAPAAQNGWQRLLSELKPENMTRLWIAPD
                     VHGHNAPAQGFTLPVSLTEWQSKSDSVTKSTFMFYLSPAVTAHKTDESIHTTGAPLTL
                     FQACIARASLRALCAQSAHEGNSLVFTHVQGNGLLQLSGPQAWATHTLATALALLRAP
                     SPTALAQGKRLYEQEQHQRNSDIAIRTLLATLPEVVSGSSGNVHELPAAGDDAAVLMF
                     CPLVENTAECLAATQVLASFLEPKFFQRLRVEKNVGYVVSCRFHQTARQSGILFALQS
                     PVYDAETLLGLIGDFIADIPALVAEISAEALEEKYGALRESLSVKPADRLEAARQQWL
                     REFAYAPEINEASVATMTTEQLLACVREPDNPLRASAGGGVKTLLRLHYPRRRS"
     misc_feature    complement(265780..267684)
                     /locus_tag="Rahaq2_4820"
                     /note="coenzyme PQQ biosynthesis probable peptidase PqqF;
                     Region: PQQ_syn_pqqF; TIGR02110"
                     /db_xref="CDD:233732"
     misc_feature    complement(267304..267657)
                     /locus_tag="Rahaq2_4820"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    complement(266707..267174)
                     /locus_tag="Rahaq2_4820"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            complement(267707..268840)
                     /locus_tag="Rahaq2_4821"
                     /note="IMG reference gene:2506711845"
                     /db_xref="GeneID:11818330"
     CDS             complement(267707..268840)
                     /locus_tag="Rahaq2_4821"
                     /note="PFAM: Radical SAM superfamily;
                     TIGRFAM: coenzyme PQQ biosynthesis protein E; radical SAM
                     additional 4Fe4S-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ biosynthesis protein E"
                     /protein_id="YP_005220548.1"
                     /db_xref="GI:379704174"
                     /db_xref="InterPro:IPR000385"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR017200"
                     /db_xref="GeneID:11818330"
                     /translation="MNLLKPAVKPPLWLLAELTYRCPLQCPYCSNPLDFAKQEKELTT
                     AQWIKVFEEAREMGAVQIGFSGGEPLVRKDLPELIRAARDLGFYTNLITSGIGLTEKK
                     IDAFAEAGLDHIQISFQASDETLNAALAGNAKAFRQKLEMAKAVKAHGYPMVLNFVLH
                     RHNIDQIDKIIDLSIELEADDVELATCQFYGWAQLNREGLLPTREQIARAEQVVHQYR
                     EKMAGTGNLANLLFVTPDYYEERPKGCMGGWGAIFLSVTPEGMALPCHSARQLPVEFP
                     SVLENTLQEIWYDSFGFNKYRGFDWMPEPCRSCSEKEKDFGGCRCQAFMLTGNADNAD
                     PVCSKSEHHGKILAAREQANCTNIQINQLQFRNRANSQLIFKG"
     misc_feature    complement(267710..268840)
                     /locus_tag="Rahaq2_4821"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqE;
                     Provisional; Region: PRK05301"
                     /db_xref="CDD:235397"
     misc_feature    complement(268265..268792)
                     /locus_tag="Rahaq2_4821"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(268271..268276,268367..268369,
                     268490..268492,268559..268567,268637..268642,
                     268646..268648,268751..268759,268763..268765,
                     268769..268771,268775..268777))
                     /locus_tag="Rahaq2_4821"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(267830..268108)
                     /locus_tag="Rahaq2_4821"
                     /note="radical SAM additional 4Fe4S-binding SPASM domain;
                     Region: rSAM_more_4Fe4S; TIGR04085"
                     /db_xref="CDD:234461"
     STS             268373..270062
                     /standard_name="Myln"
                     /db_xref="UniSTS:143966"
     gene            complement(268827..269114)
                     /locus_tag="Rahaq2_4822"
                     /note="IMG reference gene:2506711846"
                     /db_xref="GeneID:11818331"
     CDS             complement(268827..269114)
                     /locus_tag="Rahaq2_4822"
                     /note="PFAM: Coenzyme PQQ synthesis protein D (PqqD);
                     TIGRFAM: coenzyme PQQ biosynthesis protein PqqD"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ biosynthesis protein PqqD"
                     /protein_id="YP_005220549.1"
                     /db_xref="GI:379704175"
                     /db_xref="InterPro:IPR008792"
                     /db_xref="GeneID:11818331"
                     /translation="MITITEHYTPMFRRGYRMQFEKTQDCHVILYPEGMAKLNDSATF
                     ILQLVDGGRTIANIIDELNTRFPEAGGVNDDVKDFFAQAHAQKWITFREPA"
     misc_feature    complement(268839..269096)
                     /locus_tag="Rahaq2_4822"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqD;
                     Provisional; Region: PRK02079"
                     /db_xref="CDD:179362"
     gene            complement(269111..269878)
                     /locus_tag="Rahaq2_4823"
                     /note="IMG reference gene:2506711847"
                     /db_xref="GeneID:11818332"
     CDS             complement(269111..269878)
                     /locus_tag="Rahaq2_4823"
                     /note="PFAM: TENA/THI-4/PQQC family;
                     TIGRFAM: coenzyme PQQ biosynthesis protein C"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ biosynthesis protein C"
                     /protein_id="YP_005220550.1"
                     /db_xref="GI:379704176"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="GeneID:11818332"
                     /translation="MSISTTQTSPMTPQEFEQALRAKGAFYHIHHPYHIAMHNGQATR
                     GQIQGWVANRFYYQTSIPLKDAAIMANCPDAQTRRKWVQRILDHDGHGGSEGGIEAWL
                     RLGEAVGLDRDVLLSEERVLPGVRFAVDAYVNFARRAVWQEAACSSLTELFAPQIHQA
                     RLDTWPQHYTWIEEEGYGYFRSRLSQANRDVEHGLQLALEYCDTVEKQQRMLEILQFK
                     LDILWSMLDSMSMAYELNRPPYHSVTQQAVWHKGRLL"
     misc_feature    complement(269138..269857)
                     /locus_tag="Rahaq2_4823"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqC;
                     Provisional; Region: PRK05157"
                     /db_xref="CDD:235353"
     gene            complement(269891..270802)
                     /locus_tag="Rahaq2_4824"
                     /note="IMG reference gene:2506711848"
                     /db_xref="GeneID:11818333"
     CDS             complement(269891..270802)
                     /locus_tag="Rahaq2_4824"
                     /note="TIGRFAM: coenzyme PQQ biosynthesis protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ biosynthesis protein B"
                     /protein_id="YP_005220551.1"
                     /db_xref="GI:379704177"
                     /db_xref="GeneID:11818333"
                     /translation="MQIIVLGSAAGGGFPQWNCNCSNCQGVRNGTMKTSPRTQSSIAV
                     SDNGTDWVLCNASPDICHQIAATPELIKQDVLRGTSIGSIILTDSQIDHCTGLLNLRE
                     GCPHQVWCTPEVHEDLTTGFPIFTMLSHWNGGLQHHAIRPENRFSVAVCPNLTFTAIP
                     LLSNAPPYSKYRGKPLPGHNIALFIEDTKTGTSLLYAPGLGEPDDELLKWLHKADCLL
                     IDGTLWQDNELATTGVGRNTGKDMGHLALAEEQGLIALLSSLPAKRKILIHINNTNPI
                     LNESSAERQALTQQNIEVSRDGMRIEL"
     misc_feature    complement(269894..270802)
                     /locus_tag="Rahaq2_4824"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqB;
                     Provisional; Region: PRK05184"
                     /db_xref="CDD:235361"
     gene            complement(270860..270931)
                     /locus_tag="Rahaq2_4825"
                     /note="IMG reference gene:2506711849"
                     /db_xref="GeneID:11818334"
     CDS             complement(270860..270931)
                     /locus_tag="Rahaq2_4825"
                     /note="PFAM: PqqA family;
                     TIGRFAM: coenzyme PQQ biosynthesis protein A;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ biosynthesis protein A"
                     /protein_id="YP_005220552.1"
                     /db_xref="GI:379704178"
                     /db_xref="GeneID:11818334"
                     /translation="MWTKPSFEDLRLGLEVTLYISNR"
     misc_feature    complement(270863..270931)
                     /locus_tag="Rahaq2_4825"
                     /note="coenzyme PQQ synthesis protein PqqA; Provisional;
                     Region: pqqA; PRK00284"
                     /db_xref="CDD:178960"
     gene            complement(271102..272139)
                     /locus_tag="Rahaq2_4826"
                     /note="IMG reference gene:2506711850"
                     /db_xref="GeneID:11818335"
     CDS             complement(271102..272139)
                     /locus_tag="Rahaq2_4826"
                     /note="PFAM: Membrane dipeptidase (Peptidase family M19)"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent dipeptidase, microsomal
                     dipeptidase"
                     /protein_id="YP_005220553.1"
                     /db_xref="GI:379704179"
                     /db_xref="InterPro:IPR008257"
                     /db_xref="GeneID:11818335"
                     /translation="MNTIPHPPVFDGHNDLLLRLWLHDAADPAALFLDGSLEGHLDFR
                     RCRLGGFAGGLFAIFVPPASYMPQLKPDSPAEPHDAFAITQAQISLLERLETQSAGRA
                     KICRTVGEIEACITQNVLAMVMHIEGAEALGDDFSRLERWYEKGLRSIGPLWNLPNQF
                     GTGVKGDFPGSPDTGDGLTPAGLGLLHECNRKRILFDVSHMNEKAFWQTAKFSDAPLV
                     ATHSNVHALCPQPRNLTDKQLAAIAESNGFVGVNFGTAFLRADGKRNGDTPITEIVKH
                     LDNLVGKLGEENVGFGSDFDGINVPDTLGDVAGLPLLLQAMSDAGYGDALIEKIAYRN
                     WLKVLKQTWGE"
     misc_feature    complement(271126..272118)
                     /locus_tag="Rahaq2_4826"
                     /note="renal dipeptidase (rDP), best studied in mammals
                     and also called membrane or microsomal dipeptidase, is a
                     membrane-bound glycoprotein hydrolyzing dipeptides and is
                     involved in hydrolytic metabolism of penem and carbapenem
                     beta-lactam antibiotics; Region: rDP_like; cd01301"
                     /db_xref="CDD:238626"
     misc_feature    complement(order(271249..271251,271258..271260,
                     271444..271446,271477..271479,271540..271542,
                     271759..271761,271963..271965,272095..272097,
                     272101..272103))
                     /locus_tag="Rahaq2_4826"
                     /note="active site"
                     /db_xref="CDD:238626"
     misc_feature    complement(order(271705..271710,271717..271722,
                     271726..271731,271861..271863,271873..271875,
                     271882..271887,271891..271899,271957..271959))
                     /locus_tag="Rahaq2_4826"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238626"
     gene            complement(272863..275088)
                     /locus_tag="Rahaq2_4827"
                     /note="IMG reference gene:2506711851"
                     /db_xref="GeneID:11818336"
     CDS             complement(272863..275088)
                     /locus_tag="Rahaq2_4827"
                     /note="PFAM: TonB-dependent Receptor Plug Domain; TonB
                     dependent receptor;
                     TIGRFAM: TonB-dependent siderophore receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="YP_005220554.1"
                     /db_xref="GI:379704180"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR010917"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:11818336"
                     /translation="MCVFSGNCAVRNNKQNIDNNSGKKLSLSVIALLMSSSLHSAYAA
                     ETTAKKTAGDTVVVTGGNNSTSATDTAATDYSVPVTTAGTKMTLTARDIPQSVSIISK
                     QRMQDQQLQSLGDVLRNTTGIQESVSDLDRRTYYARGFLIDNYMVDNIPTTFDPRWDL
                     GDSQSDTAIYDRIEVVRGATGLMTGPGNPSASVNQVRKHADSKEFTGNVSATYGSWNK
                     QRYVADLSTPLNASGSVRGRLVTGYQDKNSYVERYGATKKFVYATVDADLTDSTLLSA
                     GYEFQQTNTDSPTWGGMPRWYLDGSKTDYRRGFNSAPDWAYSDKETTKLFTTLKQSFD
                     NGWQATLNGTHTESHIDSKMMYIDGTFDKTTGVGESAYAGYPVVAGTGYNTGKRKVDG
                     VDAFASGPYELFGRQHELMTGVSYSKQQNTYYSSFANISTEELGNFNDFNGQFPETDW
                     APRTLAEENVIRQKSAYVATRLSLADPLHLIVGARYTNWNSHTLTDQIEKNNITPYAG
                     LVFDINDTWSTYASYTSVFQPQTYRDINGGYLSPVIGKNYEAGVKSDWFNSRLTASVS
                     IFRAELDNVAQSTGRVIPGTTDTAYEGKNGTVSRGVEFEVNGALTDNWQMTFGGTRYI
                     AEDENGDAVNPQLPRTQLKLFSSYRLPMLQDLTVGGGVNWQTHVWDTVPGPSGNGTRY
                     AEQGSYALVNLFSRYQVTRQLAVQANVNNLFDKEYDTSVNQYVVYGEPRNVSVTASYS
                     F"
     misc_feature    complement(<274747..275022)
                     /locus_tag="Rahaq2_4827"
                     /note="Protein of unknown function (DUF541); Region:
                     SIMPL; cl01077"
                     /db_xref="CDD:260779"
     misc_feature    complement(272866..275007)
                     /locus_tag="Rahaq2_4827"
                     /note="ferric-rhodotorulic acid outer membrane
                     transporter; Provisional; Region: PRK10003"
                     /db_xref="CDD:236640"
     misc_feature    complement(272866..274803)
                     /locus_tag="Rahaq2_4827"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(274498..274524,274558..274590,
                     274633..274656,274669..274686,274717..274746,
                     274774..274803))
                     /locus_tag="Rahaq2_4827"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(273931..273933,274012..274014))
                     /locus_tag="Rahaq2_4827"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            275983..276885
                     /locus_tag="Rahaq2_4828"
                     /note="IMG reference gene:2506711852"
                     /db_xref="GeneID:11818337"
     CDS             275983..276885
                     /locus_tag="Rahaq2_4828"
                     /note="PFAM: Homocysteine S-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="homocysteine/selenocysteine methylase"
                     /protein_id="YP_005220555.1"
                     /db_xref="GI:379704181"
                     /db_xref="InterPro:IPR003726"
                     /db_xref="GeneID:11818337"
                     /translation="MISNIKILDGGMGRELARMGAPFRQPEWSALALMQAPEFVRAAH
                     DAFIAAGSQVITTNSYAVVPFHVGEEIFAEQGAALIALSGKLAREAAEAAPAAVQVAG
                     SLPPVLGSYRPDLFEPVAAKKLLQVLVDNLTDSVDVWLAETQSSVAEVEAVRDVLGDD
                     PRPLWLSFTLQDNPDDQGNALLRSGESVGDAVSAALRVSAAAVLFNCSRPEVMATAVK
                     TARAALTTQGSQLDIGVYANAFEPSDNKRGANEGLSKMRQDTDPAGYLDFAKDWVAQG
                     ATLVGGCCGIGPEHIAALKQAFAK"
     misc_feature    275992..276882
                     /locus_tag="Rahaq2_4828"
                     /note="Homocysteine/selenocysteine methylase
                     (S-methylmethionine-dependent) [Amino acid transport and
                     metabolism]; Region: MHT1; COG2040"
                     /db_xref="CDD:224951"
     gene            276969..278513
                     /locus_tag="Rahaq2_4829"
                     /note="IMG reference gene:2506711853"
                     /db_xref="GeneID:11818338"
     CDS             276969..278513
                     /locus_tag="Rahaq2_4829"
                     /note="PFAM: Bacterial extracellular solute-binding
                     proteins, family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005220556.1"
                     /db_xref="GI:379704182"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:11818338"
                     /translation="MIDRRSFIKSAGALSVAAATHSLWLGNAFAAEAEKPKKGGHLVV
                     GVDNASSTDRLDPAFWFETYMYFVGSQMFNNLVEIDENARLAPSLAEAWASTDGSKTW
                     VLKIRQGVQFHDGRSLGAKDVVYSLNHHRGEKSTSPVKGYLDTVSSIEATGDHEVTIK
                     LTAPDVEFVWLLSAVHFAITAENENFDKGIGTGAFILEKFQPGVSTLTKHNPNYWNSE
                     RGHVDSVETLAMNDSTARVAALVSGSAQLINRVNPRIVSRIERMPNLKLVRAKDSMIY
                     TFPGLSNLAPFDNVDGRLALKYAIDRQKIIDTVLGGYASVANDNPIFPSNRYFAKDIP
                     QRPYDPEKAQFHWKKSGFSGPLTLNVADAGFPGAVDAGQLYQQSAAKAGINLNVVRVP
                     DDAFWNDIWQKKAFVSSNWANRPTADALLSLVFTSQSSWNESAWHVPAFDAMVKAARG
                     EADEARRKQIYHDIQVMLVDQGSEIIPLYADALDGCSAKIKGFTSVPGMPLSGNRAAE
                     KVWIEG"
     misc_feature    276969..278504
                     /locus_tag="Rahaq2_4829"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    277074..278447
                     /locus_tag="Rahaq2_4829"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_17; cd08503"
                     /db_xref="CDD:173868"
     gene            278473..279546
                     /locus_tag="Rahaq2_4830"
                     /note="IMG reference gene:2506711854"
                     /db_xref="GeneID:11818339"
     CDS             278473..279546
                     /locus_tag="Rahaq2_4830"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220557.1"
                     /db_xref="GI:379704183"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818339"
                     /translation="MVTVRQRKSGLKAEPGKNMSDLSAQQKVTQRPAGRFSPHRSGLL
                     SMVLVRLFYGVLVVLAVSMLIFAGVQLLPGNAATAILGQSATPDAIRELNLQLGLDKP
                     AVSRYLSWLFGVLHGDFGTSFSTREAISGPLFTRLGNTLFLAGCTAAIAVPLALLIGF
                     ISVRYHGSVIDTLLNAITRATVALPEFFSGYLLILIFAITLAWAPSNSSITADMPLTA
                     KLSAISLPCATLVLAILGHMSNMTRVALIAAQSSAYVDTALLKGLSPSRILWRHVLPN
                     AVGPIINVVAINLAYLMVGVVIVENVFVYPGLGQYMVDSISKRDIPVMQDCALLLAGI
                     YILLNLLADVMALVANPRLRHNR"
     misc_feature    278599..279537
                     /locus_tag="Rahaq2_4830"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    278881..279504
                     /locus_tag="Rahaq2_4830"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(278929..278934,278941..278946,278959..278961,
                     278992..279003,279007..279036,279043..279048,
                     279052..279054,279169..279174,279178..279180,
                     279184..279186,279193..279198,279202..279204,
                     279214..279219,279226..279228,279277..279279,
                     279319..279324,279331..279333,279352..279363,
                     279370..279375,279400..279405,279454..279459,
                     279466..279471,279475..279480,279487..279492,
                     279499..279504)
                     /locus_tag="Rahaq2_4830"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(279010..279054,279352..279369)
                     /locus_tag="Rahaq2_4830"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(279052..279054,279154..279156,279370..279372,
                     279394..279396,279403..279405,279454..279456)
                     /locus_tag="Rahaq2_4830"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(279229..279267,279283..279288,279298..279300)
                     /locus_tag="Rahaq2_4830"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            279565..280383
                     /locus_tag="Rahaq2_4831"
                     /note="IMG reference gene:2506711855"
                     /db_xref="GeneID:11818340"
     CDS             279565..280383
                     /locus_tag="Rahaq2_4831"
                     /note="PFAM: Binding-protein-dependent transport system
                     inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease"
                     /protein_id="YP_005220558.1"
                     /db_xref="GI:379704184"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:11818340"
                     /translation="MPALKPASILGLLVLSLFILIAIFAPWLAPHAPDQTLGMSWDLP
                     GPDSVLGTDNLGRDLLSRLIWGTRVSLGVTTLAALVAFIVGCTFGFIAGLRGGWLDQV
                     ISRCNDIVMAIPTLILALIVLAVLPKTILVLTLVLGLLESTRVLRVARSLAVDIGVME
                     FVDVARLRGESLGWILGHVILPNALQTLIAEFGLRFIFILLFLSALSFLGLGIQPPTA
                     DWGGLARDNKDGILFGVWAALVPGGAIAVLALAVNAVADWLMSGERRVWGKKHE"
     misc_feature    <279580..279672
                     /locus_tag="Rahaq2_4831"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    279589..280341
                     /locus_tag="Rahaq2_4831"
                     /note="nickel ABC transporter, permease subunit NikC;
                     Region: nickel_nikC; TIGR02790"
                     /db_xref="CDD:131837"
     misc_feature    279766..280308
                     /locus_tag="Rahaq2_4831"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(279811..279816,279823..279828,279841..279843,
                     279871..279882,279886..279915,279922..279927,
                     279931..279933,279991..279993,279997..279999,
                     280006..280011,280015..280017,280027..280032,
                     280039..280041,280090..280092,280132..280137,
                     280144..280146,280165..280176,280183..280188,
                     280225..280230,280258..280263,280270..280275,
                     280279..280284,280291..280296,280303..280308)
                     /locus_tag="Rahaq2_4831"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(279889..279933,280165..280182)
                     /locus_tag="Rahaq2_4831"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(279931..279933,280183..280185,280219..280221,
                     280228..280230,280258..280260)
                     /locus_tag="Rahaq2_4831"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(280042..280080,280096..280101,280111..280113)
                     /locus_tag="Rahaq2_4831"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            280376..281962
                     /locus_tag="Rahaq2_4832"
                     /note="IMG reference gene:2506711856"
                     /db_xref="GeneID:11818341"
     CDS             280376..281962
                     /locus_tag="Rahaq2_4832"
                     /note="PFAM: ABC transporter; Oligopeptide/dipeptide
                     transporter, C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase component of various ABC-type transport
                     systems with duplicated ATPase domain"
                     /protein_id="YP_005220559.1"
                     /db_xref="GI:379704185"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818341"
                     /translation="MNEHVLNVENLCVVSQGKNPRTLVDCVSFTVKRGEVLGLIGESG
                     AGKSTIGLAILGHCRQGMRIHSGKIAFSGRELTSLSERQLRQVRGRQIAYVAQSAGAA
                     FNPAITLGEQVIEAALKHNVYPRQQAQAKAIALFEQLGLPDPQAFYQRYPHQVSGGQL
                     QRAMIAMALCAGPELLIFDEPTTALDVTTQLGVLKAISDVIRLSGVAAIYISHDLAVV
                     AQISDHIMVLQHGKTVEQAETAQLLSQPQQDYTRRLLHAQGGNKTPQTGPAPVALDIS
                     NISARYHAQPVLQNISLSLPRGRTLAVIGESGSGKSTLGKVICGLLTQESGEISLNQQ
                     VLPASLRQRSRVQLRDVQLIHQIPDTALDPKERIGGQISRVLACFTTLNRSQREARVS
                     ELLAQVGLHAELAARFPAALSGGQKQRVCIARALAAEPKIIVCDEPTSALDPLVARDV
                     LALLRQIQQETGISYLFITHDLQVVREIADEVAVLKQGVIVRQGPVASALAEPLDDYT
                     RELLRSVPEMRVGWLEEMFA"
     misc_feature    280376..281929
                     /locus_tag="Rahaq2_4832"
                     /note="ATPase components of various ABC-type transport
                     systems, contain duplicated ATPase [General function
                     prediction only]; Region: COG1123"
                     /db_xref="CDD:224048"
     misc_feature    280388..281086
                     /locus_tag="Rahaq2_4832"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    280496..280519
                     /locus_tag="Rahaq2_4832"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(280505..280510,280514..280522,280664..280666,
                     280910..280915,281012..281014)
                     /locus_tag="Rahaq2_4832"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    280655..280666
                     /locus_tag="Rahaq2_4832"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    280838..280867
                     /locus_tag="Rahaq2_4832"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    280898..280915
                     /locus_tag="Rahaq2_4832"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    280922..280933
                     /locus_tag="Rahaq2_4832"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    281000..281020
                     /locus_tag="Rahaq2_4832"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    281192..281857
                     /locus_tag="Rahaq2_4832"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    281288..281311
                     /locus_tag="Rahaq2_4832"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(281297..281302,281306..281314,281441..281443,
                     281681..281686,281783..281785)
                     /locus_tag="Rahaq2_4832"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    281432..281443
                     /locus_tag="Rahaq2_4832"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    281609..281638
                     /locus_tag="Rahaq2_4832"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    281669..281686
                     /locus_tag="Rahaq2_4832"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    281693..281704
                     /locus_tag="Rahaq2_4832"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    281771..281791
                     /locus_tag="Rahaq2_4832"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    281846..>281950
                     /locus_tag="Rahaq2_4832"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            282205..283869
                     /locus_tag="Rahaq2_4833"
                     /note="IMG reference gene:2506711857"
                     /db_xref="GeneID:11818342"
     CDS             282205..283869
                     /locus_tag="Rahaq2_4833"
                     /note="PFAM: HAMP domain; Methyl-accepting chemotaxis
                     protein (MCP) signaling domain"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_005220560.1"
                     /db_xref="GI:379704186"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:11818342"
                     /translation="MYKLINNMRVGARLGAAFGLIILLLFIVSGIAITKISSINSSIE
                     QIVNDRYVKVRLAFDVRDGVNDQIKYLRGIVIDTKNPEQNKKRYLQLDDTVKKTNVAM
                     DKIAAIQSTVTGKQKIKALQEAGETFEAAKEQLIALARAGDMDGATEYVLRKLTTSQN
                     AYLDLATAFATSQDQQLQAEGKTAVADGATAIQLTLIFSTLAILMAAALGYFLSRSIT
                     RPLHTAVKVAENVAAGDLTTQILVTSQDETGQLMQGLKNMNENLLKIVTEVRAGTHAI
                     TSASSEIAAGNLDLSSRTEQQASSLEETASAMEQMTATVKQNADNARQANQLAAQASR
                     VAVQGGEVVGEVVNTMEGINTSSRKIVDIIAVIDGIAFQTNILALNAAVEAARAGEQG
                     RGFAVVASEVRNLAQRSASAAKEIKVLIDDSVAKVDNGTQLVAKAGATMAEVVSSVRN
                     VTDIVGEIAIASNEQSTGIEEINKAITQMDEVTQQNAALVQEASSAAYSLNEQAERLS
                     QAISIFKVSAGSATAAVRKAGQTKSPALLSNRQPVPAADQGNWETF"
     misc_feature    282223..282762
                     /locus_tag="Rahaq2_4833"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    282601..283752
                     /locus_tag="Rahaq2_4833"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    282853..282990
                     /locus_tag="Rahaq2_4833"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(282853..282858,282865..282870,282874..282879,
                     282886..282891,282895..282897,282943..282948,
                     282952..282957,282964..282969,282973..282978,
                     282985..282990)
                     /locus_tag="Rahaq2_4833"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    283087..283680
                     /locus_tag="Rahaq2_4833"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(283111..283116,283123..283128,283135..283137,
                     283144..283149,283153..283158,283165..283167,
                     283174..283179,283186..283188,283195..283200,
                     283207..283212,283219..283221,283228..283233,
                     283237..283242,283252..283254,283258..283263,
                     283270..283272,283279..283284,283291..283296,
                     283303..283305,283312..283314,283321..283326,
                     283333..283335,283345..283347,283354..283356,
                     283375..283377,283387..283389,283396..283398,
                     283405..283410,283417..283419,283426..283431,
                     283438..283443,283447..283452,283459..283464,
                     283501..283506,283513..283515,283522..283527,
                     283534..283536,283543..283548,283552..283557,
                     283564..283569,283576..283578,283585..283590,
                     283597..283599,283606..283611,283615..283620,
                     283627..283632,283636..283641,283648..283650,
                     283657..283662,283669..283671,283678..283680)
                     /locus_tag="Rahaq2_4833"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    283321..283422
                     /locus_tag="Rahaq2_4833"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            283994..284881
                     /locus_tag="Rahaq2_4834"
                     /note="IMG reference gene:2506711858"
                     /db_xref="GeneID:11818343"
     CDS             283994..284881
                     /locus_tag="Rahaq2_4834"
                     /note="PFAM: Beta-lactamase"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase class A"
                     /protein_id="YP_005220561.1"
                     /db_xref="GI:379704187"
                     /db_xref="InterPro:IPR000871"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="GeneID:11818343"
                     /translation="MMKNTLRKTVLMAAAVVPMLAFSAASWAQTATKMTSVQQQLAAL
                     EKDSGGRLGVMLINTEDNSQIAYRADERFAMCSTSKFMAASAILKQSETQTELLNRHV
                     SLKKSDLVNYNPITEKHLNTGMTVGELAAAALQYSDNTAMNKLIGQLGGPQKVTEYAR
                     TLGDKTFRLDRTEPTLNTAIPGDDRDTTSPRAMALSLQHVALGSALAEPQRAQLVEWM
                     KGNTTGAMSIRAGLPATWVVGDKTGSGDYGTTNDIAVIWPDNKAPLILITYFTQPEKD
                     AKSRRDVLASAAKIVTQGY"
     misc_feature    284012..284878
                     /locus_tag="Rahaq2_4834"
                     /note="Beta-lactamase class A [Defense mechanisms];
                     Region: PenP; COG2367"
                     /db_xref="CDD:225242"
     misc_feature    284036..284806
                     /locus_tag="Rahaq2_4834"
                     /note="Beta-lactamase enzyme family; Region:
                     Beta-lactamase2; cl19191"
                     /db_xref="CDD:267544"
     gene            285035..285385
                     /locus_tag="Rahaq2_4835"
                     /note="IMG reference gene:2506711859"
                     /db_xref="GeneID:11818344"
     CDS             285035..285385
                     /locus_tag="Rahaq2_4835"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220562.1"
                     /db_xref="GI:379704188"
                     /db_xref="GeneID:11818344"
                     /translation="MSGSLSRWARITCTSALLLSFTAIADQQGRQQLQEHFADQNRQQ
                     EEQMRQIERQQSQYAADYARESQERVDRQIKEQEETTTRIQNEAIATHEKRDAEAREA
                     ARQKREQAGDPERN"
     gene            286156..287538
                     /locus_tag="Rahaq2_4836"
                     /note="IMG reference gene:2506711860"
                     /db_xref="GeneID:11818345"
     CDS             286156..287538
                     /locus_tag="Rahaq2_4836"
                     /note="PFAM: Aminotransferase class-III;
                     TIGRFAM: 2,4-diaminobutyrate 4-transaminases"
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-diaminobutyrate 4-transaminase"
                     /protein_id="YP_005220563.1"
                     /db_xref="GI:379704189"
                     /db_xref="InterPro:IPR004637"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11818345"
                     /translation="MTDKVRIDSLGANSLNGNNETYLARQAEFESNVRSYPRKLPLAI
                     AKANGVWITDVENKQYLDCLAGAGTLALGHNHPEVLQSIQNVITSGLPLHTLDLTTPL
                     KDQFSEYLLSLLPQQGKEYCLQFTGPSGADAVEAAMKLAKKVTGRSGIISFSGGYHGM
                     THATLAVTGNLSPKEAVNGMMPEVQFMPYPHQYRCPLGIGGDAGVKALTYYFENLIND
                     VESGVRKPAAVILEAVQGEGGVNPAPAEWLQRIRKVTQEHGIMLILDEVQAGFCRTGK
                     QFAFEHAGIEPDIIVMSKAVGGGLPLAVLGIRKEFDAWAPGHHTGTFRGNQLAMATGL
                     TTLKILKEEKIAEKVAAQGEWLKGKLADMQKRYPVMGHVRGLGLMIGIEIVKPNEAQD
                     HMGCYPADGELSALLQKKCFEAGLILERGGRNGCVLRLLPSLLITNDELGIFLDKFEQ
                     ALLAAGIKPA"
     misc_feature    286222..287511
                     /locus_tag="Rahaq2_4836"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    286261..287511
                     /locus_tag="Rahaq2_4836"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(286540..286548,286624..286629,286633..286635,
                     286849..286851,286948..286950,286954..286959,
                     287035..287037)
                     /locus_tag="Rahaq2_4836"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(286543..286548,286624..286629,286849..286851,
                     286948..286950,286957..286959,287035..287037)
                     /locus_tag="Rahaq2_4836"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    287035..287037
                     /locus_tag="Rahaq2_4836"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            287557..289029
                     /locus_tag="Rahaq2_4837"
                     /note="IMG reference gene:2506711861"
                     /db_xref="GeneID:11818346"
     CDS             287557..289029
                     /locus_tag="Rahaq2_4837"
                     /note="PFAM: Pyridoxal-dependent decarboxylase conserved
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent enzyme, glutamate decarboxylase"
                     /protein_id="YP_005220564.1"
                     /db_xref="GI:379704190"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:11818346"
                     /translation="MSELNPILAGSAQSTEAYQQAIAQSSEAVVQWLQQPEMYQGKTV
                     AELRERITLDFNPNGLGNQAAIERAIEYFLKDSLSVHHPQCVAHLHCPSLVVSQAAEV
                     LINATNQSMDSWDQSPSATIIEMKLIEWLRTQVGYQAGDAGVFTSGGTQSNLMGLMLA
                     RDAFFARQGHSIQQDGLVGNLRKIKVLCSENAHFSVQKNMALLGLGYQCVTLVKTDEF
                     ARMDLNDLREKVAQAQANGDQILAIVATAGTTDAGAIDPLRAIAELAAEHQIWVHVDA
                     AWGGALLLSEKYRHYLDGIELVDSITLDFHKQFFQTISCGAFLLKEERHYELMRYQAA
                     YLNSEFDEAAGVPNLVSKSLQTTRRFDALKLWMGLEALGQKQYAAIIDHGVTLAQDVA
                     QYVGSEAALELVMKPQLASVLFRYRPAQLAGSSDAAIALLNQKIGDALLESGRANVGV
                     TEHNGITCLKLTLLNPTVTLEDVKVLLALVEKTAQQLLNA"
     misc_feature    287809..289002
                     /locus_tag="Rahaq2_4837"
                     /note="DOPA decarboxylase family. This family belongs to
                     pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). The major groups in
                     this CD correspond to DOPA/tyrosine decarboxylase (DDC),
                     histidine decarboxylase (HDC), and...; Region:
                     DOPA_deC_like; cd06450"
                     /db_xref="CDD:99743"
     misc_feature    order(288001..288006,288013..288015,288292..288294,
                     288379..288381,288388..288390,288466..288468,
                     288475..288477)
                     /locus_tag="Rahaq2_4837"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99743"
     misc_feature    288475..288477
                     /locus_tag="Rahaq2_4837"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99743"
     gene            289379..290491
                     /locus_tag="Rahaq2_4838"
                     /note="IMG reference gene:2506711862"
                     /db_xref="GeneID:11818347"
     CDS             289379..290491
                     /locus_tag="Rahaq2_4838"
                     /note="PFAM: Mechanosensitive ion channel"
                     /codon_start=1
                     /transl_table=11
                     /product="small-conductance mechanosensitive channel"
                     /protein_id="YP_005220565.1"
                     /db_xref="GI:379704191"
                     /db_xref="InterPro:IPR006685"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR011014"
                     /db_xref="InterPro:IPR011066"
                     /db_xref="GeneID:11818347"
                     /translation="MNFLSHFDVIALMMTPVFWMGVATMCVVTLVTYWLLSWLVSFLR
                     KGVKRWGEVNEASHRIRFILGEILDRTSNLLIFIAAFLFSLRFVNLPDNLYNTISHAW
                     FLVLAFQMALWLDQAVVSWLRHIMRQPGMNKNPVTLVITGLIFRAVVWSVMLLSILAN
                     VGVNITALVASLGVGGIAIALAIQTILSDVFASLSIGFDKPFEIGDFVVFNDVAGTVE
                     HIGLKTTRIRSLSGEQIVCGNAILLQQTLHNYKRMQTRRIVFNFGIAINTPPEKLRII
                     GDMVKEIIIDVGETKFDRAHLLGFGTDRLNIEVVHIVNTADYNKYMDIQQEINIRIIE
                     KLIEQGIEMALPNMIIKTQAEREEGAGESTREKGQA"
     misc_feature    289679..290488
                     /locus_tag="Rahaq2_4838"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     misc_feature    289808..290407
                     /locus_tag="Rahaq2_4838"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:250229"
     gene            complement(290602..291048)
                     /locus_tag="Rahaq2_4839"
                     /note="IMG reference gene:2506711863"
                     /db_xref="GeneID:11818348"
     CDS             complement(290602..291048)
                     /locus_tag="Rahaq2_4839"
                     /note="PFAM: Protein of unknown function (DUF421)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220566.1"
                     /db_xref="GI:379704192"
                     /db_xref="InterPro:IPR007353"
                     /db_xref="InterPro:IPR023090"
                     /db_xref="GeneID:11818348"
                     /translation="MENVLRAAIMYVFLFIIFKISGRKTLLEMNIFDFILVLIISEAT
                     QQALLGEDFSLMGAMITIGTLIFIDKSLGFLENKSPTFNLWLNGSPIILIENGKILDQ
                     RLRKCSLTEDEIMVVARQQEAIVSMDEIKFAILEKNGKISIIPYKK"
     misc_feature    complement(<290614..291048)
                     /locus_tag="Rahaq2_4839"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2323"
                     /db_xref="CDD:225205"
     gene            complement(291061..291579)
                     /locus_tag="Rahaq2_4840"
                     /note="IMG reference gene:2506711864"
                     /db_xref="GeneID:11818349"
     CDS             complement(291061..291579)
                     /locus_tag="Rahaq2_4840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220567.1"
                     /db_xref="GI:379704193"
                     /db_xref="GeneID:11818349"
                     /translation="MDKDNQSQFEPRTTPVEENIGWIKTAWRLERIGFFLLGLFILYA
                     LLGGFSQGWLSDSRYQNEEKSTQITYEKYLRSDTESPLIIAYPLKEAQSDHITLSGKF
                     VNEYDIINVSPESAVIHRSPGTMIIYPNNTGVTNAGNVQLTLKPRKFGIYTLSVAANN
                     DSPFIFKQIVFP"
     gene            291745..292938
                     /locus_tag="Rahaq2_4841"
                     /note="IMG reference gene:2506711865"
                     /db_xref="GeneID:11818350"
     CDS             291745..292938
                     /locus_tag="Rahaq2_4841"
                     /note="PFAM: Alcohol dehydrogenase GroES-like domain"
                     /codon_start=1
                     /transl_table=11
                     /product="theronine dehydrogenase-like Zn-dependent
                     dehydrogenase"
                     /protein_id="YP_005220568.1"
                     /db_xref="GI:379704194"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11818350"
                     /translation="MRALTYHGPYRVSVDNMPDPTLQASDDIILKVTATAICGSDLHL
                     YRGKIPGTHHGDIFGHEFMGEVVEAGSDVTAVAKGDRVVIPFVIACGECFFCKLNQYA
                     ACETTNSGKGAALNPKKITPPAALFGYSDLYGGIPGGQAEYVRVPKANTGPFKVPDGL
                     ADEKVLFLSDILPTAWQAVKNAGLMPGSSVAIFGAGPVGLLSAACARLAGAEQIFMID
                     HHPYRLAFAQERYGVIPINFDENDDAAAWIIEHTAGHRGVDAVIDAVGFEAKGSVTET
                     ILSNLKIEGSSGKALRQCIAAVRRGGIVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQT
                     HVHAYLPDLLMLIESGQLKPEEIVTHHMPLEDAAKGYSLFEKRQEDCRKIILLPGTPS
                     RVSAA"
     misc_feature    291745..292908
                     /locus_tag="Rahaq2_4841"
                     /note="Glutathione-dependent formaldehyde dehydrogenase
                     related proteins, child 1; Region: FDH_like_1; cd08283"
                     /db_xref="CDD:176243"
     misc_feature    291745..292908
                     /locus_tag="Rahaq2_4841"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    order(291856..291864,291871..291873,292000..292002,
                     292252..292254,292264..292266,292321..292326,
                     292330..292338,292393..292401,292411..292413,
                     292456..292458,292534..292542,292612..292614,
                     292663..292671,292738..292746,292864..292866)
                     /locus_tag="Rahaq2_4841"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:176243"
     misc_feature    order(291856..291858,291862..291864,291922..291924,
                     292252..292254)
                     /locus_tag="Rahaq2_4841"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176243"
     misc_feature    order(292012..292017,292021..292023,292030..292032,
                     292054..292056)
                     /locus_tag="Rahaq2_4841"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176243"
     gene            complement(292972..295482)
                     /locus_tag="Rahaq2_4842"
                     /note="IMG reference gene:2506711866"
                     /db_xref="GeneID:11818351"
     CDS             complement(292972..295482)
                     /locus_tag="Rahaq2_4842"
                     /note="PFAM: Alpha amylase, catalytic domain;
                     TIGRFAM: malto-oligosyltrehalose synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="malto-oligosyltrehalose synthase"
                     /protein_id="YP_005220569.1"
                     /db_xref="GI:379704195"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013797"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11818351"
                     /translation="MKIPTATYRIQFRNGLDFDTATGLIPYLKQLGISHLYASPVFTA
                     TSGSTHGYDITDANEIDPSIGGREGFDRMAQALKTAGIGLILDIVPNHMAASLENPWW
                     RDVIEHGEKSRYARHFDIDWSRRLTLPFLGDSFEEALEKGDITLKSDPKTGQPTFAYF
                     DTYYPVAPGTLTAVRTGGLSKTELTELHERQPYRLMCWRDAPRELSYRRFFEITGLAG
                     VRVEDDGVFDDTHRLILELVRSGVADGLRVDHVDGLADPKAYLERLREKAGADCYITV
                     EKILGKDERLPPDWPVSGTTGYEFIASLSDVLVNDENMAVLSELYDNVVGKPVDIRNE
                     LRAAKLMMVEKNFAGEFTTLWKLATGIAATEGTGYDENDVRTALCELLIAFPVYRTYG
                     TEQGMPAEDSTLLHKIQRKISTSPLAVQPEILAFLVRILCGETSAVSSSQAGLFRTRF
                     QQLTGPLMAKSVEDTLFFRQNMELALNEVGAEPLIRTFSLSRFHTGMIKRREEQPEAL
                     SATSTHDTKRGEDARARLFTLTEAPQEWAACVKRWHRMNESHVMMLADGPAPRPALTW
                     MLYQALAGAWPATLTPEDAQGLQELDERFQSFVEKALREAKLRTNWDDNNEDYEKAVL
                     DYAHHLLSPENRLFLQDFHASIQPFIHAGLVNSLTQTVIKLMAPGVPDIYQGSEALNF
                     SLVDPDNRRLPDFTGLERLLMQDKKPAGDKPESWLNGQLKQYLVSALAGLRQQKPALF
                     QQGDYVPLSASGDHGENVIAFARVNNDDAVIVVARRLVLGLQAQTFPQTEIVLPPQLA
                     YRHYRELFSNKEMTSAGRLDMAAWPGFSPVILIASSPS"
     misc_feature    complement(292990..295482)
                     /locus_tag="Rahaq2_4842"
                     /note="Maltooligosyl trehalose synthase [Carbohydrate
                     transport and metabolism]; Region: TreY; COG3280"
                     /db_xref="CDD:225819"
     misc_feature    complement(293278..295467)
                     /locus_tag="Rahaq2_4842"
                     /note="Alpha amylase catalytic domain found in
                     maltooligosyl trehalose synthase (MTSase); Region:
                     AmyAc_MTSase; cd11336"
                     /db_xref="CDD:200475"
     misc_feature    complement(order(293413..293415,293425..293427,
                     293938..293940,294046..294048,294094..294096,
                     294319..294321,294646..294648,294652..294654,
                     294736..294738,294853..294855,295207..295209,
                     295327..295329,295333..295335))
                     /locus_tag="Rahaq2_4842"
                     /note="active site"
                     /db_xref="CDD:200475"
     misc_feature    complement(order(293938..293940,294652..294654,
                     294736..294738))
                     /locus_tag="Rahaq2_4842"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200475"
     gene            complement(295479..297266)
                     /locus_tag="Rahaq2_4843"
                     /note="IMG reference gene:2506711867"
                     /db_xref="GeneID:11818352"
     CDS             complement(295479..297266)
                     /locus_tag="Rahaq2_4843"
                     /note="PFAM: Alpha amylase, catalytic domain; Domain of
                     unknown function (DUF3459);
                     TIGRFAM: malto-oligosyltrehalose trehalohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="malto-oligosyltrehalose trehalohydrolase"
                     /protein_id="YP_005220570.1"
                     /db_xref="GI:379704196"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR012768"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR022567"
                     /db_xref="GeneID:11818352"
                     /translation="MQRDAFMTSWGASFISAGTVRFRVRAPGQDKMTLRLSGENREML
                     PTENGWFEFVATGVSPGEEYQFILADGLPVPDPASRAQLADVNGPSLVTSSSGYAWRN
                     HDWKGRPWEETVIYEMHIGTFTPEGTFSAAQAKLAYLAETGITMIEVLPLSQFGGQRG
                     WGYDGVLLYAPHSAYGSPDDFKAFVDAAHGVGISVVLDIVLNHFGPEGNYLPLLAPDF
                     FDSQRMTAWGAGIDYQNDAARCYIVEAPLYWLKEYRLDGLRFDAIDQMQDTSSPHILI
                     EIAERIREEITDRPVHLTTEDSRNVTFLHPRNADGTVPLFTAEWNDDFHNAIHVLSTG
                     ETHAYYQDFAQNPEKLAARALAEGFAYQGEKSPQTGQPRGAVSRRQPPVAFVDFIQNH
                     DQIGNRAHGDRLLTLAGAERTHILLAALLLSPHIPLLFMGEEYGETHPFLFFTDFEGE
                     LAQAVREGRAREFEGHSGYGSQAVPDPNALSTFENSKLDWQKLTYPESQNTLALTRRL
                     LALRRKHIVPLLTPAKGEVGQIVETSAGFLAVKWVFPRGTLSLVLNIGKDTHPLPELP
                     GETLFAWPQDAAISAPCSLIVRLAPGVIP"
     misc_feature    complement(296988..297236)
                     /locus_tag="Rahaq2_4843"
                     /note="N-terminal Early set domain associated with the
                     catalytic domain of Maltooligosyl trehalose
                     trehalohydrolase (also called Glycosyltrehalose
                     trehalohydrolase) and similar proteins; Region:
                     E_set_MTHase_like_N; cd02853"
                     /db_xref="CDD:199883"
     misc_feature    complement(295578..297209)
                     /locus_tag="Rahaq2_4843"
                     /note="malto-oligosyltrehalose trehalohydrolase; Region:
                     trehalose_TreZ; TIGR02402"
                     /db_xref="CDD:233850"
     misc_feature    complement(295797..297041)
                     /locus_tag="Rahaq2_4843"
                     /note="Alpha amylase catalytic domain found in
                     Glycosyltrehalose trehalohydrolase (also called
                     Maltooligosyl trehalose Trehalohydrolase); Region:
                     AmyAc_GTHase; cd11325"
                     /db_xref="CDD:200464"
     misc_feature    complement(order(296088..296090,296379..296381,
                     296484..296486))
                     /locus_tag="Rahaq2_4843"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200464"
     misc_feature    complement(order(296076..296078,296085..296090,
                     296289..296291,296301..296303,296373..296375,
                     296379..296381))
                     /locus_tag="Rahaq2_4843"
                     /note="active site"
                     /db_xref="CDD:200464"
     misc_feature    complement(295503..295727)
                     /locus_tag="Rahaq2_4843"
                     /note="Domain of unknown function (DUF3459); Region:
                     DUF3459; pfam11941"
                     /db_xref="CDD:256746"
     gene            complement(297412..297603)
                     /locus_tag="Rahaq2_4844"
                     /note="IMG reference gene:2506711868"
                     /db_xref="GeneID:11818353"
     CDS             complement(297412..297603)
                     /locus_tag="Rahaq2_4844"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220571.1"
                     /db_xref="GI:379704197"
                     /db_xref="GeneID:11818353"
                     /translation="MAPVASISGGIIFIIVGIVMLWLLVKAHKGNTSKKFFTPHKCML
                     LIGTLVSFVISIVFFTSSS"
     gene            297910..299016
                     /locus_tag="Rahaq2_4845"
                     /note="IMG reference gene:2506711869"
                     /db_xref="GeneID:11818354"
     CDS             297910..299016
                     /locus_tag="Rahaq2_4845"
                     /note="PFAM: Periplasmic binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe3+-hydroxamate ABC transporter periplasmic
                     protein"
                     /protein_id="YP_005220572.1"
                     /db_xref="GI:379704198"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:11818354"
                     /translation="MKLLHGLLFMLSVVITGQSGAATTTLTDVLGNKITLETPVKRAV
                     LGFYFEDYMAVGGEQAFDHIVGISREAWHGKVPANWDMYIKYRPSIASIPDIGEIDLH
                     NVSLEKVISLKPDVVILASWQYAALKYEVTQLQSLNIPVVVLDYNDQTVENHVKSTEI
                     IGILTGQTDRAHELAQLYKNNITLIEDRIRQANLPKPKVYIEFGNKGPAEYSFTYGEN
                     MWGVMLRLAGGENIAAPFVKQWGEINPEQLLVAKPDVIFISGRENNKVDTALEMGIGV
                     NEATARAKLNGFAQRDGWRSLPAIKNDKLFGVYQGASRTLVDFTMVQFIAKSLYPDLF
                     RDIDPVKNYHDYYKKYLPVMPVGTFALSASGEPH"
     misc_feature    297943..298917
                     /locus_tag="Rahaq2_4845"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    297982..298986
                     /locus_tag="Rahaq2_4845"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    order(298303..298308,298315..298317,298396..298398)
                     /locus_tag="Rahaq2_4845"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            299414..301102
                     /locus_tag="Rahaq2_4846"
                     /note="IMG reference gene:2506711870"
                     /db_xref="GeneID:11818355"
     CDS             299414..301102
                     /locus_tag="Rahaq2_4846"
                     /note="PFAM: Histidine kinase; 5TMR of 5TMR-LYT; Histidine
                     kinase-, DNA gyrase B-, and HSP90-like ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative regulator of cell autolysis"
                     /protein_id="YP_005220573.1"
                     /db_xref="GI:379704199"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR010559"
                     /db_xref="InterPro:IPR011620"
                     /db_xref="GeneID:11818355"
                     /translation="MYEFNLILLLLQQMCVFLVIAWLMSKTRLFIPLVQVTVRLPHKL
                     LCYITFSIFCIMGTYFGLHIEDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGIHRYSM
                     GGMTALSCMISTIAEGLLGGLVHSVLIKRGRIDKLFNPLVAAGVTFVAEILQMLIILL
                     IARPFHDALNLVSSIAAPMMVTNTLGAAMFMRILLDKRAMFEKYTSAFSATALKVAAS
                     TEGILRRGFNEENSMKVAQVLLKELDIGAVAITDRDKLLAFTGIGDDHHLVGKPIASQ
                     YTWRAIENDEVVYADGNEMPYRCSLHPSCKLGSTLVIPLRGENQRVIGTIKLYEVRNR
                     LFSSINRTLGEGIAQLLSAQILAGKFEQQKALLAQSEIKLLHAQVNPHFLFNALNTLM
                     AVIRHDSDKAGQLVQYLSTFFRKNLKRSSESVTLADELEHVNAYLQIELARFPTQLKV
                     DLQVPEAFSDQSLPAFTLQPLVENAIKHGTSQLLSNGNIIIRAYSEGEMVIVEVEDNA
                     GLYQPEESGDGLGMSLVDKRLRARFGDDYGITVSCKPDDFTRVTLRLPVEGATC"
     misc_feature    299420..301099
                     /locus_tag="Rahaq2_4846"
                     /note="Putative regulator of cell autolysis [Signal
                     transduction mechanisms]; Region: LytS; COG3275"
                     /db_xref="CDD:225814"
     misc_feature    299492..300001
                     /locus_tag="Rahaq2_4846"
                     /note="5TMR of 5TMR-LYT; Region: 5TM-5TMR_LYT; pfam07694"
                     /db_xref="CDD:254364"
     misc_feature    300116..300478
                     /locus_tag="Rahaq2_4846"
                     /note="GAF domain; Region: GAF; pfam01590"
                     /db_xref="CDD:250726"
     misc_feature    300524..300769
                     /locus_tag="Rahaq2_4846"
                     /note="Histidine kinase; Region: His_kinase; pfam06580"
                     /db_xref="CDD:253806"
     misc_feature    300815..301078
                     /locus_tag="Rahaq2_4846"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(300821..300823,300833..300835,300842..300844,
                     300923..300925,300929..300931,300968..300979,
                     301034..301036,301040..301042,301055..301060,
                     301064..301066)
                     /locus_tag="Rahaq2_4846"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    300833..300835
                     /locus_tag="Rahaq2_4846"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(300968..300970,300974..300976)
                     /locus_tag="Rahaq2_4846"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            301096..301815
                     /locus_tag="Rahaq2_4847"
                     /note="IMG reference gene:2506711871"
                     /db_xref="GeneID:11818356"
     CDS             301096..301815
                     /locus_tag="Rahaq2_4847"
                     /note="PFAM: Response regulator receiver domain; LytTr
                     DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator of the LytR/AlgR family"
                     /protein_id="YP_005220574.1"
                     /db_xref="GI:379704200"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR007492"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="GeneID:11818356"
                     /translation="MLRVLIVDDEPLALENLRLQLQDESDIDIVGECTNAIEAIGVIH
                     KIRPDIVFLDIQMPRISGLEMVGMLDQQHRPHIVFLTAFEEYAVQAFEQCAFDYLLKP
                     IQAARLQKTLARLRLGYQTQDVSQLPQYQQPLKFIPCISSNRIWLLQMEDVAYVSSRV
                     GGVYVTGQDGKETFTELTLRTLEVRTPLLRCHRQYLVNMDYLKEIRLEDKNQAELLLR
                     DGQIVPVSRRYLKSLKETVGL"
     misc_feature    301096..301812
                     /locus_tag="Rahaq2_4847"
                     /note="putative two-component response-regulatory protein
                     YehT; Provisional; Region: PRK11697"
                     /db_xref="CDD:236956"
     misc_feature    301108..301440
                     /locus_tag="Rahaq2_4847"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(301117..301122,301255..301257,301279..301281,
                     301336..301338,301387..301389,301396..301401)
                     /locus_tag="Rahaq2_4847"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    301255..301257
                     /locus_tag="Rahaq2_4847"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(301264..301269,301273..301281)
                     /locus_tag="Rahaq2_4847"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    301396..301404
                     /locus_tag="Rahaq2_4847"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    301522..301800
                     /locus_tag="Rahaq2_4847"
                     /note="LytTr DNA-binding domain; Region: LytTR; pfam04397"
                     /db_xref="CDD:252568"
     gene            complement(301837..302826)
                     /locus_tag="Rahaq2_4848"
                     /note="IMG reference gene:2506711872"
                     /db_xref="GeneID:11818357"
     CDS             complement(301837..302826)
                     /locus_tag="Rahaq2_4848"
                     /note="PFAM: Cobalamin synthesis protein cobW C-terminal
                     domain; CobW/HypB/UreG, nucleotide-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GTPase, G3E family"
                     /protein_id="YP_005220575.1"
                     /db_xref="GI:379704201"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /db_xref="GeneID:11818357"
                     /translation="MKNNETMTPIAVTVLTGFLGAGKTTLLRQILHTQQQIKIAVIEN
                     EFGEMPIDNQLIGDRATRITTLSNGCICCTRSGELEAALLDLLDSVDKGEVRFDRLMI
                     ECTGMADPGPILQAFFAHEIICERYVLDGVITLVDAVHAMSQLDQFPLAQSQIGYADR
                     ILLTKTDVAGECPELAERLQRINARAPVYKMVQGDIDPALLFDTRGFMLEENVVAARP
                     RFHRIAPQQNAVSSIVVELDYPVALKAISAVMEELLASFADNLMRYKGMLWIADQPCR
                     LLFQGVQRLYSADWDREWQADETPHSALVFIGMQLPETEIREAFARLRPACLI"
     misc_feature    complement(301852..302808)
                     /locus_tag="Rahaq2_4848"
                     /note="putative GTP-binding protein YjiA; Provisional;
                     Region: PRK11537"
                     /db_xref="CDD:183183"
     misc_feature    complement(302323..302796)
                     /locus_tag="Rahaq2_4848"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    complement(301843..302139)
                     /locus_tag="Rahaq2_4848"
                     /note="Cobalamin synthesis protein cobW C-terminal domain;
                     Region: CobW_C; pfam07683"
                     /db_xref="CDD:254355"
     gene            complement(302856..303059)
                     /locus_tag="Rahaq2_4849"
                     /note="IMG reference gene:2506711873"
                     /db_xref="GeneID:11818358"
     CDS             complement(302856..303059)
                     /locus_tag="Rahaq2_4849"
                     /note="PFAM: Protein of unknown function (DUF466)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220576.1"
                     /db_xref="GI:379704202"
                     /db_xref="InterPro:IPR007423"
                     /db_xref="GeneID:11818358"
                     /translation="MFDNLGAAKKYLGQAARMLVGIPDYDTYVLHMQTNHPDTTPMTY
                     EEFFRERQQARYGGDGKGGMRCC"
     misc_feature    complement(302859..303059)
                     /locus_tag="Rahaq2_4849"
                     /note="Uncharacterized small protein [Function unknown];
                     Region: COG2879"
                     /db_xref="CDD:225434"
     gene            complement(303119..305302)
                     /locus_tag="Rahaq2_4850"
                     /note="IMG reference gene:2506711874"
                     /db_xref="GeneID:11818359"
     CDS             complement(303119..305302)
                     /locus_tag="Rahaq2_4850"
                     /note="PFAM: Carbon starvation protein CstA"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon starvation membrane protein"
                     /protein_id="YP_005220577.1"
                     /db_xref="GI:379704203"
                     /db_xref="InterPro:IPR003706"
                     /db_xref="GeneID:11818359"
                     /translation="MSPFKITGLFMNKKALFKHIPWMIVALLGACCLGVVALRRGEHI
                     SALWIVVASVSVYLVAYRYYSLYIAQKVMKLDPSRSTPAVINNDGLNYVPTNRNVLFG
                     HHFAAIAGAGPLVGPVLAAQMGYLPGVLWLLAGVVLAGAVQDFMVLFISSRRNGASLG
                     EMIKEEMGPVPGTIALFGCFLIMIIILAVLALIVVKALAESPWGVFTVCSTVPIALFM
                     GIYMRFIRPGRVGEISVIGVVLLVAAIWFGGVIASDPYWGPALTFKDTTITFTLIGYA
                     FVSALLPVWLILAPRDYLATFLKIGVIVGLAIGIVILNPELKMPALTQYIDGTGPLWK
                     GALFPFLFITIACGAVSGFHALIASGTTPKLLACETDARFIGYGAMLMESFVAVMALV
                     AASIIEPGLYFAMNTPPAGLGITMPNLHELGGDNAPMILAQLKDVTAHAAATVSSWGF
                     VISPEQIMQTAKDIGEPSVLNRAGGAPTLAVGIAHVFHKIMPLADMGFWYHFGILFEA
                     LFILTALDAGTRSGRFMLQDLLGNFIPFLKKTDSLVAGIIGTAGCVGLWGYLLYQGVV
                     DPLGGVKSLWPLFGISNQMLAAVALILATVVLVKMKRTKYIWVTMLPAIWLLICTTWA
                     LGMKLFSTNVQMEGFFYMAGQYKARISAGGANLTPEQISNMHHIVINNYTNAGLSILF
                     LIVVYSIIFYGIRACLQARKTDKRTDKETPYVPVPAEGIKISAGH"
     misc_feature    complement(303122..305251)
                     /locus_tag="Rahaq2_4850"
                     /note="carbon starvation protein A; Provisional; Region:
                     PRK15015"
                     /db_xref="CDD:184976"
     misc_feature    complement(304037..305173)
                     /locus_tag="Rahaq2_4850"
                     /note="Carbon starvation protein CstA; Region: CstA;
                     pfam02554"
                     /db_xref="CDD:251371"
     misc_feature    complement(303431..303823)
                     /locus_tag="Rahaq2_4850"
                     /note="C-terminal domain on CstA (DUF4161); Region:
                     DUF4161; pfam13722"
                     /db_xref="CDD:258019"
     gene            305546..305614
                     /locus_tag="Rahaq2_4851"
                     /note="IMG reference gene:2506711875"
                     /pseudo
                     /db_xref="GeneID:11818360"
     gene            complement(305805..306284)
                     /locus_tag="Rahaq2_4852"
                     /note="IMG reference gene:2506711876"
                     /db_xref="GeneID:11818361"
     CDS             complement(305805..306284)
                     /locus_tag="Rahaq2_4852"
                     /note="PFAM: Protein of unknown function (DUF796);
                     TIGRFAM: type VI secretion system effector, Hcp1 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="YP_005220578.1"
                     /db_xref="GI:379704204"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="GeneID:11818361"
                     /translation="MSNPAYIWLVDENGSPIVGDSLVSGRLGAIELKSVNHNVSIPTD
                     QHTGRLTGTRVHSPISLQKEFDKATPILYRALCQGVTLQSATIKMYQITETGTEAEYF
                     NIILDNVKIVAITPNLYPGGQTGTHFENILLHYETITWKYCDGNIIYKDTWNNRAVA"
     misc_feature    complement(305817..306278)
                     /locus_tag="Rahaq2_4852"
                     /note="Protein of unknown function (DUF796); Region:
                     DUF796; cl01226"
                     /db_xref="CDD:260845"
     gene            complement(306522..307172)
                     /locus_tag="Rahaq2_4853"
                     /note="IMG reference gene:2506711877"
                     /db_xref="GeneID:11818362"
     CDS             complement(306522..307172)
                     /locus_tag="Rahaq2_4853"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220579.1"
                     /db_xref="GI:379704205"
                     /db_xref="GeneID:11818362"
                     /translation="MNSYDEISTRIAEIIISPDSAIGFIHGILSVPVDLGYLAYGYLN
                     TESRYSNQTETIRIIQAIDNGILNYDRIIEAIQIVFKRFDKYVSESEKNKIYSRTIFS
                     VLGRTTANSFLSGKIATAICGQASVFITLRGGLIGNILLAGGMTERCIRTSEKLSVDE
                     PDVYELLRAKNYDLLYFMFEPALKPFVDALTVRRNQGIYAFKTILDLVESKVNGYV"
     gene            307586..308017
                     /locus_tag="Rahaq2_4854"
                     /note="IMG reference gene:2506711878"
                     /db_xref="GeneID:11818363"
     CDS             307586..308017
                     /locus_tag="Rahaq2_4854"
                     /note="PFAM: Peptidase S24-like"
                     /codon_start=1
                     /transl_table=11
                     /product="SOS response transcriptional repressor,
                     RecA-mediated autopeptidase"
                     /protein_id="YP_005220580.1"
                     /db_xref="GI:379704206"
                     /db_xref="InterPro:IPR006197"
                     /db_xref="InterPro:IPR011056"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="GeneID:11818363"
                     /translation="MVITMQFLTANEPRQFVTFPLFSDLVPCGFPSPAQDYVERRIDL
                     NELMIQHPSATYFVRVTGDSMIDAGIGEGDLLVVDSSRKAEHGHIVIAAVDGEFTVKR
                     LQLHPVVMLKPENSVYAPIMIGGEENLEVFGVVTYIVKTAS"
     misc_feature    <307625..308005
                     /locus_tag="Rahaq2_4854"
                     /note="SOS-response transcriptional repressors
                     (RecA-mediated autopeptidases) [Transcription / Signal
                     transduction mechanisms]; Region: LexA; COG1974"
                     /db_xref="CDD:224885"
     misc_feature    307751..307993
                     /locus_tag="Rahaq2_4854"
                     /note="Peptidase S24 LexA-like proteins are involved in
                     the SOS response leading to the repair of single-stranded
                     DNA within the bacterial cell. This family includes: the
                     lambda repressor CI/C2 family and related bacterial
                     prophage repressor proteins; LexA (EC...; Region:
                     S24_LexA-like; cd06529"
                     /db_xref="CDD:119397"
     misc_feature    order(307775..307777,307886..307888)
                     /locus_tag="Rahaq2_4854"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            308020..309285
                     /locus_tag="Rahaq2_4855"
                     /note="IMG reference gene:2506711879"
                     /db_xref="GeneID:11818364"
     CDS             308020..309285
                     /locus_tag="Rahaq2_4855"
                     /note="PFAM: impB/mucB/samB family C-terminal;
                     impB/mucB/samB family; IMS family HHH motif"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase/DNA polymerase involved
                     in DNA repair"
                     /protein_id="YP_005220581.1"
                     /db_xref="GI:379704207"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="GeneID:11818364"
                     /translation="MFALCDVNSFYASCETVFRPDLKGRPVVVLSNNDGCVIARSAEA
                     NAFAKMGEPYFKQKELFRRHGVVCFSSNYELYADMSNRVMTTIEEMSPRCEVYSIDEI
                     FCDLTGVRHCRDLTEFGREIRATVLQRTHLTVGVGIAQTKTLAKLANYAAKKWQRETG
                     GVVDLSNVEHQRKLMAALPVGEVWGVGRRIAKKLDSMGIKTVLQLADTDIRFIRKHFN
                     VVLERTVRELRGESCLELEEFAPVKQEIVCSRSFGDRITEYEEMRQAICSYAIRAAEK
                     LRHEHQHCRFISAFIKTSPFGVNESYYGPSSSVNLLTPTQDSRDIIAAATRCLEAIWK
                     EGYRYQKAGVMLGDFYSQGVAQLNLFDENPPRHNSQKLMGVLDYLNAKKGRGTLYFAG
                     QGIRQQWQMKREMLSPRYTTRYQDLLVIK"
     misc_feature    308020..309282
                     /locus_tag="Rahaq2_4855"
                     /note="DNA polymerase V subunit UmuC; Reviewed; Region:
                     umuC; PRK03609"
                     /db_xref="CDD:179607"
     misc_feature    308026..309063
                     /locus_tag="Rahaq2_4855"
                     /note="umuC subunit of DNA Polymerase V; Region:
                     PolY_Pol_V_umuC; cd01700"
                     /db_xref="CDD:176454"
     misc_feature    order(308035..308040,308047..308052,308143..308145,
                     308152..308154,308317..308322,308476..308478)
                     /locus_tag="Rahaq2_4855"
                     /note="active site"
                     /db_xref="CDD:176454"
     misc_feature    order(308311..308313,308320..308322,308569..308589,
                     308674..308676,308749..308766,308845..308847,
                     308902..308916,308920..308922)
                     /locus_tag="Rahaq2_4855"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176454"
     misc_feature    309124..309279
                     /locus_tag="Rahaq2_4855"
                     /note="Domain of unknown function (DUF4113); Region:
                     DUF4113; pfam13438"
                     /db_xref="CDD:257763"
     gene            309609..311267
                     /locus_tag="Rahaq2_4856"
                     /note="IMG reference gene:2506711880"
                     /db_xref="GeneID:11818365"
     CDS             309609..311267
                     /locus_tag="Rahaq2_4856"
                     /note="PFAM: Mechanosensitive ion channel"
                     /codon_start=1
                     /transl_table=11
                     /product="small-conductance mechanosensitive channel"
                     /protein_id="YP_005220582.1"
                     /db_xref="GI:379704208"
                     /db_xref="InterPro:IPR006685"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR011066"
                     /db_xref="GeneID:11818365"
                     /translation="MGDSRLRVMALLAWLRKGRLYGFLVWLSFFTSFLLQAAEPRQMP
                     SDQEKARTVYIFHQPVVMLQAKFGLSTPEERVLRIRNTLRSLSGEDIRHPVQILPVQR
                     YGQQGRLLVINGKPLMLLAESDLDEGDDLTLDQAAQRVLARFNAQRISLTEQYSSTYL
                     TIATLKVVAGTAVLILLYYAAFTSWAKVKAYFTARILLKKGWIPYRWRSLLGAVEVHL
                     YAILMILLSIVAFYLWLSWLFRLYPWTRVWGESLGDWSVNVMQKIALAIVSAFPGLMI
                     VAIIFLITAFILKLLKIMLKRVETRKLNVPGLHPETVGATRKLISVMIWLFALSAAYP
                     FLPGANSLAFKGVSVFFGLMLTLGSAGVMNHAMSGLVLIYSRALRKGDVIRIGDNEGL
                     VSEIGMLATKIITRESYVVTVPNAVVVSGKITNLSAQNPGGGVNLTTSITIGYDTPWR
                     QVHAMLELAASRTRGIDLQHKPLVRQLSLMDWYIAYELQVHLRAGESLAAVRSELHSH
                     IQDVFNEFNVQIMSPNFVNQPETAVRVAQDNWFAAPASPPDKPT"
     misc_feature    310272..311189
                     /locus_tag="Rahaq2_4856"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     misc_feature    310563..311168
                     /locus_tag="Rahaq2_4856"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:250229"
     gene            complement(311310..311753)
                     /locus_tag="Rahaq2_4857"
                     /note="IMG reference gene:2506711881"
                     /db_xref="GeneID:11818366"
     CDS             complement(311310..311753)
                     /locus_tag="Rahaq2_4857"
                     /note="PFAM: SnoaL-like polyketide cyclase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ester cyclase"
                     /protein_id="YP_005220583.1"
                     /db_xref="GI:379704209"
                     /db_xref="InterPro:IPR009959"
                     /db_xref="GeneID:11818366"
                     /translation="MSDNNEIANRLIAERKAVEKIYQAFSLHNPDLLDEAVTQDWNDI
                     PLAPGQASGPEGLKPIIRGFIEAFPDVKITVHDLLQTPGKIAVRAEITGTHNGNFMGI
                     EPTGKFVSIRLHEFHELNGERVTTTWHLEDWFGAFMQLGQFPPQG"
     misc_feature    complement(311334..311705)
                     /locus_tag="Rahaq2_4857"
                     /note="Nuclear transport factor 2 (NTF2-like) superfamily.
                     This family includes members of the NTF2 family,
                     Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
                     and the beta subunit of Ring hydroxylating dioxygenases.
                     This family is a classic example of...; Region: NTF2_like;
                     cl09109"
                     /db_xref="CDD:263720"
     gene            311872..312786
                     /locus_tag="Rahaq2_4858"
                     /note="IMG reference gene:2506711882"
                     /db_xref="GeneID:11818367"
     CDS             311872..312786
                     /locus_tag="Rahaq2_4858"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220584.1"
                     /db_xref="GI:379704210"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818367"
                     /translation="MDFKGLDLNLLVAFDALMEERNVTRAASKAAVSQPAMSAALSRL
                     RTHFADPLFIRSTSGLLPTARAKEIGLHVSKALNELSHLLAPDDNFAPENRKISFTLG
                     TSEYPLMVLLPGIMRAISEQAPGVTLHVRTFIDRDASVSMLDAGEVDLVIGIPPTRPE
                     NRILSLPLFSDEFVTLIRRDSDAARNGMTLEAYLAMSHILVSPEGNHYGLVDEQLRKM
                     GLTRELRLTLPTMAGVAGVVQQTGYVATVLKRSVIVSEKHQNILMTPPPVALPEIPFY
                     LLWHRRSDDSNGQKWLRKLICAQARELL"
     misc_feature    311881..312768
                     /locus_tag="Rahaq2_4858"
                     /note="leucine transcriptional activator; Reviewed;
                     Region: leuO; PRK09508"
                     /db_xref="CDD:181918"
     misc_feature    311893..312072
                     /locus_tag="Rahaq2_4858"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    312163..312765
                     /locus_tag="Rahaq2_4858"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators that involved in the
                     catabolism of nitroaromatic/naphthalene compounds and that
                     of related regulators; contains the type 2 periplasmic
                     binding fold; Region: PBP2_Nitroaromatics_like; cd08417"
                     /db_xref="CDD:176109"
     misc_feature    order(312181..312183,312187..312192,312202..312204,
                     312382..312384,312493..312495,312694..312696)
                     /locus_tag="Rahaq2_4858"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176109"
     misc_feature    order(312184..312186,312193..312198,312205..312210,
                     312217..312222,312226..312231,312238..312243,
                     312247..312261,312265..312267,312460..312462,
                     312544..312558,312565..312570,312577..312582,
                     312589..312591)
                     /locus_tag="Rahaq2_4858"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176109"
     gene            complement(312875..313735)
                     /locus_tag="Rahaq2_4859"
                     /note="IMG reference gene:2506711883"
                     /db_xref="GeneID:11818368"
     CDS             complement(312875..313735)
                     /locus_tag="Rahaq2_4859"
                     /note="PFAM: Aldo/keto reductase family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase, aryl-alcohol
                     dehydrogenase like protein"
                     /protein_id="YP_005220585.1"
                     /db_xref="GI:379704211"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="GeneID:11818368"
                     /translation="MSQPSMTYRLGDREVARLGYGAMQLAGPGVFGPVRDEARAIQVL
                     RDAVASGVNHIDTSDFYGPHETNKLIKKALYPYPDNLCIVTKVGALRDEKGGWLPAFS
                     PQELTQAVEDNLRNLGLNTMDVVNLRSMFDVRQPKEGSLEPQLEALLMLKERGLIRHI
                     GLSNVTAKQVADAQKLTTIACVQNMYNLANRHDDALVDSLAEQEIAYVPFFPLGGFSR
                     LQSTQLDEVAAQLQATPMQVALAWLLKRSPNILLIPGTSSPQHLQENLASSKVILSDE
                     VMEKLNGMAG"
     misc_feature    complement(312890..313717)
                     /locus_tag="Rahaq2_4859"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(312941..312946,312953..312955,
                     312968..312979,313028..313030,313091..313108,
                     313187..313189,313244..313249,313349..313354,
                     313478..313480,313553..313555,313568..313570,
                     313667..313675))
                     /locus_tag="Rahaq2_4859"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    complement(312890..313648)
                     /locus_tag="Rahaq2_4859"
                     /note="voltage-dependent potassium channel beta subunit,
                     animal; Region: Kv_beta; TIGR01293"
                     /db_xref="CDD:213602"
     misc_feature    complement(order(313352..313354,313478..313480,
                     313553..313555,313568..313570))
                     /locus_tag="Rahaq2_4859"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            313831..314766
                     /locus_tag="Rahaq2_4860"
                     /note="IMG reference gene:2506711884"
                     /db_xref="GeneID:11818369"
     CDS             313831..314766
                     /locus_tag="Rahaq2_4860"
                     /note="PFAM: Bacterial regulatory helix-turn-helix
                     protein, lysR family; LysR substrate binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220586.1"
                     /db_xref="GI:379704212"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818369"
                     /translation="MPMDIALLHAVVEVAKAGGFREAARVTGSNASRLSDAVRRAEQQ
                     LGIRLFHRTTRAVVLTEAGRALLEKLIPAMNEVDAALDVLNHYRNTPGGTLRLNVPVS
                     ATRLVLPALVPEFLRRYPDIQLEIIAESNVQDVFRDGCDAGIRYDERLEQDMVAIPIG
                     PHRQRYAAAASPDYLNAHGRPAHPRDLIQHRCLRGRYASGIMPDWEFEREGESLSVQV
                     SGPLVVSVGGAVDLAVETAVAGAGIIYLFEEWLRPAISSGKLEAILQPWWLSFSGPYL
                     YYNDRRLIPAPLQAFIDFVREDNLKRNCSVESIKP"
     misc_feature    313837..314721
                     /locus_tag="Rahaq2_4860"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    313843..314022
                     /locus_tag="Rahaq2_4860"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    314101..314715
                     /locus_tag="Rahaq2_4860"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_5; cd08474"
                     /db_xref="CDD:176163"
     misc_feature    order(314137..314139,314149..314151,314266..314268,
                     314308..314310,314320..314322,314509..314511,
                     314569..314571,314650..314652)
                     /locus_tag="Rahaq2_4860"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176163"
     misc_feature    order(314140..314145,314155..314160,314164..314169,
                     314176..314178,314188..314190,314194..314214,
                     314401..314403,314491..314505,314533..314538,
                     314545..314547)
                     /locus_tag="Rahaq2_4860"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176163"
     gene            314847..315035
                     /locus_tag="Rahaq2_4861"
                     /note="IMG reference gene:2506711885"
                     /pseudo
                     /db_xref="GeneID:11818370"
     gene            complement(315069..315644)
                     /locus_tag="Rahaq2_4862"
                     /note="IMG reference gene:2506711886"
                     /db_xref="GeneID:11818371"
     CDS             complement(315069..315644)
                     /locus_tag="Rahaq2_4862"
                     /note="PFAM: Domain of unknown function DUF"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220587.1"
                     /db_xref="GI:379704213"
                     /db_xref="InterPro:IPR003810"
                     /db_xref="InterPro:IPR022929"
                     /db_xref="GeneID:11818371"
                     /translation="MQLYTILILAFGMSMDAFAAAIGKGASLHRPPLKEALRTGLIFG
                     VIEAITPVIGWGIGLAASQFIMSWDHWVAFTLLLILGIRMIVEAFRKGHAEEDAQAPR
                     RHGFWVLVTTAVATSLDAMAVGVGLAFLQVNILVMALAIGAATTIMATSGMLLGRFLG
                     AAMGKWAEILGGVVLIGIGTSILVEHLGLLG"
     misc_feature    complement(315084..315644)
                     /locus_tag="Rahaq2_4862"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11469"
                     /db_xref="CDD:183151"
     misc_feature    complement(315402..315608)
                     /locus_tag="Rahaq2_4862"
                     /note="Domain of unknown function DUF; Region: DUF204;
                     pfam02659"
                     /db_xref="CDD:251451"
     misc_feature    complement(315108..315299)
                     /locus_tag="Rahaq2_4862"
                     /note="Domain of unknown function DUF; Region: DUF204;
                     pfam02659"
                     /db_xref="CDD:251451"
     gene            316147..316626
                     /locus_tag="Rahaq2_4863"
                     /note="IMG reference gene:2506711887"
                     /db_xref="GeneID:11818372"
     CDS             316147..316626
                     /locus_tag="Rahaq2_4863"
                     /note="PFAM: Protein of unknown function (DUF770);
                     TIGRFAM: type VI secretion protein, VC_A0107 family;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="YP_005220588.1"
                     /db_xref="GI:379704214"
                     /db_xref="InterPro:IPR008312"
                     /db_xref="GeneID:11818372"
                     /translation="MSNTQYKLSKARPPRVQITYDVEVGGAESKKELPLVMGVIGNFS
                     KDDMPLRDRRFTHIDKDNFNNVMEGMKPAVEMLVESTLPEKEGQMAIALEFNSMDDFS
                     PENVAMQVEPLRKLLELREQLSDLRNRTASNDRLKEQLVELLEGMTKNAEPAKGDAE"
     misc_feature    316165..316581
                     /locus_tag="Rahaq2_4863"
                     /note="Protein of unknown function (DUF770); Region:
                     DUF770; pfam05591"
                     /db_xref="CDD:253266"
     gene            316623..318104
                     /locus_tag="Rahaq2_4864"
                     /note="IMG reference gene:2506711888"
                     /db_xref="GeneID:11818373"
     CDS             316623..318104
                     /locus_tag="Rahaq2_4864"
                     /note="PFAM: Protein of unknown function (DUF877);
                     TIGRFAM: type VI secretion protein, EvpB/VC_A0108 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein EvpB"
                     /protein_id="YP_005220589.1"
                     /db_xref="GI:379704215"
                     /db_xref="InterPro:IPR010269"
                     /db_xref="GeneID:11818373"
                     /translation="MSDIQVMNAPAQAEQAGDYLDQIIDNTQAIRRESDRNKVKSQLD
                     NFLSEVASGAVIVSNDLVGSIEARIAAIDELLSSQVSKIIQAPEFQRMESSWRGLHKL
                     VQSSVTENTKVRVFNCTKKELLRDFKSASDFDQSSLFKSIYESEYGTFGGDPYSAFVG
                     DFEFDCMPEDVQLLEQISHVAAAAHAPFLSAANPGMFAMGSFSEMPRPRDLGKLFETS
                     DYARWKSFRQSDDSRYVGLTLPRVIGRLPYGAKTVSVDAFNFEEKIDENNDGSNYLWV
                     NAAYDLAGRMVEAFEEYSWCAAIRGVEGGGLVKSLPTYNYISQTGEKIMQCPTEVAIS
                     DRREKELAELGFIPLIYCKGTDYAAFFAVQSTNKPRKYDSELANANAKLSSQLQYIMT
                     TSRFAHYLKSIVRDKVGSFMSKSECQNFLQNWINQYVVGSDNVGPAIKASHPLREAVV
                     EVVDVPGSPGSYRAVAYLKPHFQLEGLSMSLRLVAELPASTDA"
     misc_feature    316671..318086
                     /locus_tag="Rahaq2_4864"
                     /note="type VI secretion protein, EvpB/VC_A0108 family;
                     Region: VI_chp_2; TIGR03355"
                     /db_xref="CDD:234179"
     gene            318129..318623
                     /locus_tag="Rahaq2_4865"
                     /note="IMG reference gene:2506711889"
                     /db_xref="GeneID:11818374"
     CDS             318129..318623
                     /locus_tag="Rahaq2_4865"
                     /note="PFAM: Protein of unknown function (DUF796)"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin-coregulated protein"
                     /protein_id="YP_005220590.1"
                     /db_xref="GI:379704216"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="GeneID:11818374"
                     /translation="MSDADNLFMQIEGITGCVSDKKYNGWIAVDYTSNSVFSSAAINN
                     GTGQMNSDGVRFEQVSFSKEMDATSTDLMNMVAEGTNIKKIIVAMNVKTDNKDNEMVR
                     WTYQNCILTSHQIGASKAGGIPHETLSFVFGRIEFETQMVEPGGTTKKYGPVGWNIIE
                     NTKL"
     misc_feature    318150..318542
                     /locus_tag="Rahaq2_4865"
                     /note="Protein of unknown function (DUF796); Region:
                     DUF796; pfam05638"
                     /db_xref="CDD:253294"
     gene            318677..319093
                     /locus_tag="Rahaq2_4866"
                     /note="IMG reference gene:2506711890"
                     /db_xref="GeneID:11818375"
     CDS             318677..319093
                     /locus_tag="Rahaq2_4866"
                     /note="PFAM: Gene 25-like lysozyme"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220591.1"
                     /db_xref="GI:379704217"
                     /db_xref="InterPro:IPR007048"
                     /db_xref="GeneID:11818375"
                     /translation="MKSLLQQLSDNNPKDQNDISEEEDKSSTLIDEILLLLSSRPRSY
                     RIDDIPLINESILNYGVSDVFSSDTPRLERNTIMQSRIQMALQRFEPRLKNVCVTPGE
                     ELGSLCSFIINAETLNGEVRYRLMWDDVISQFSLRD"
     misc_feature    318773..>318973
                     /locus_tag="Rahaq2_4866"
                     /note="Gene 25-like lysozyme; Region: GPW_gp25; pfam04965"
                     /db_xref="CDD:252910"
     gene            319106..320908
                     /locus_tag="Rahaq2_4867"
                     /note="IMG reference gene:2506711891"
                     /db_xref="GeneID:11818376"
     CDS             319106..320908
                     /locus_tag="Rahaq2_4867"
                     /note="PFAM: Bacterial protein of unknown function
                     (DUF879);
                     TIGRFAM: type VI secretion protein, VC_A0110 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="YP_005220592.1"
                     /db_xref="GI:379704218"
                     /db_xref="InterPro:IPR010272"
                     /db_xref="GeneID:11818376"
                     /translation="MLAKKLISYYQNELAYLKTQGKAFARHFPKVARRLGMSEGTSED
                     PHIERIIESFALVTAQIQQRLDEDMPEVTDALLTVLAPQFLRPFPSVCIVQMQPDSKV
                     SALTASNRIDAGTALYSRPVNGQVCRFRTIYPVTLQPVSLYKASLHLDADDMSWSLKI
                     QLSVWPGATLAADSLRLHLSGASRIVNIFYTLLCSEVESLTVFQQGQSYTLSAQAIRA
                     VGFGENESLLAGDSRVSPTHSLLQDYFFFPQKFHFIDIPLPAGMVAGSQSELSLVVKF
                     NRCMIARQLEKIAGAVNENLFLLNCTPAVNLFAHRAEPISPDHETAEYPIIPDIRHQD
                     AMEVWSVDSVSAMRKLGNETQSRPIYPLFGLDHSASDGESGLFWQCMRRETIQNNGVA
                     TSLFIAFSDRGESPLAPGCDIVSMNLTCTNRDIPGAMRNGDPDGDFESELPIAGMKII
                     ALTRPTLPVRPPVKQATRWRLISQLSLNHMLISGPEGARVLRESLALYNFVDNPGITR
                     LINLILRVDSSPVVTRLAPLDPRSMARGIEIRITFASEAAEEVEYFLLCRFIDCFLAL
                     YAPVNSFTRVITCIDSSGETARTWPVRAGRLSWI"
     misc_feature    319121..320905
                     /locus_tag="Rahaq2_4867"
                     /note="type VI secretion protein, VC_A0110 family; Region:
                     VI_chp_6; TIGR03359"
                     /db_xref="CDD:234182"
     gene            320899..321846
                     /locus_tag="Rahaq2_4868"
                     /note="IMG reference gene:2506711892"
                     /db_xref="GeneID:11818377"
     CDS             320899..321846
                     /locus_tag="Rahaq2_4868"
                     /note="PFAM: Protein of unknown function (DUF1305);
                     TIGRFAM: type VI secretion protein, VC_A0111 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="YP_005220593.1"
                     /db_xref="GI:379704219"
                     /db_xref="InterPro:IPR010732"
                     /db_xref="GeneID:11818377"
                     /translation="MDLSNILSPHNFFQQVRLMLRRLTRTQGKNSQQALETQLYFISP
                     LSLDAPKGDITSITPLDQQRWQVEVAAHGLTGALGALPTVYTEWMIDRYYRHGDKTAK
                     AFLDIFNHRLHSLRYLAWQKYHYYAMAEFSATRPLSQAIHALSGVANSTPSQQQEQFA
                     DLFAHSVRSMLNVETWLKHRFSVAAKVTPFTGGWQVMDQAQCCRLGEPSQTLAAAPML
                     GSVYWDRQSHFTVTLGPVPMKNAGLFLPKGKHYQNLWSHLREYVGQGLDFDIDLLIDN
                     TANVVTPLGSGQLGLDICLGPSGGAGQHKIRLPVCREGK"
     misc_feature    320926..321789
                     /locus_tag="Rahaq2_4868"
                     /note="Protein of unknown function (DUF1305); Region:
                     DUF1305; pfam06996"
                     /db_xref="CDD:254012"
     gene            321850..323763
                     /locus_tag="Rahaq2_4869"
                     /note="IMG reference gene:2506711893"
                     /db_xref="GeneID:11818378"
     CDS             321850..323763
                     /locus_tag="Rahaq2_4869"
                     /note="PFAM: Phage-related baseplate assembly protein;
                     TIGRFAM: Rhs element Vgr protein; type VI secretion system
                     Vgr family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhs element Vgr protein"
                     /protein_id="YP_005220594.1"
                     /db_xref="GI:379704220"
                     /db_xref="InterPro:IPR006531"
                     /db_xref="GeneID:11818378"
                     /translation="MSNVVGQDNRFIRFVGSAADSLTLMHIEGDEQFSDTFSYQIRFR
                     TSLITPQMGRFLGHEMACEIGRGNQKRYVHGVLTHIEEDNSVNGISTFTGTLEPRMAL
                     LRLGRNLAVFQNITVPDLVCKLLRQQNISHIDLRLRATYQPREYCIQYRESDFDFISR
                     LLEQEGIYYFFQHDAGQHTLVLADHPSSHQSGKTAELPFMPLQGRGDGVGILNWVACS
                     SLAASSVMLKGFNMVQAASVEGESKAVDADYSVPGVSYVDAHGHEKRELLQSEARLKM
                     EQLEADNQLFYAEASVWGLGCGDKFLLSGHPSCQGNYRIKSVHMHASSNIDDGQPDFG
                     CALTVLKDSLSWRPPCLTRQPEIAGILTAIVVGPKSEEVHTDEYGRIKIQFPWDRENK
                     HDDGSSCWVRVSQSWAGGRFGAMFLPRVNSEVTVSFVHGNPDYPLVTGSVYNGQNKPP
                     LSLPEEKNHAGFVSRSSLNGNVEEGHELRFDDKKGEERLLITSQKDLLLTVKNDVTTR
                     ITKNVNETIGENRTTELTKGNENLTLKQGDYVLDIKGNLQESLTSGNHQLNISGGGST
                     VKADKACVIESTQSIELKVGSSKITLSPSGITLSGTTIKIEGKGTAELKGAMVTVQGS
                     GMTQIKGGVTMIG"
     misc_feature    321904..323385
                     /locus_tag="Rahaq2_4869"
                     /note="type VI secretion system Vgr family protein;
                     Region: VI_Rhs_Vgr; TIGR03361"
                     /db_xref="CDD:234183"
     misc_feature    321940..322824
                     /locus_tag="Rahaq2_4869"
                     /note="Phage late control gene D protein (GPD); Region:
                     Phage_GPD; pfam05954"
                     /db_xref="CDD:253474"
     misc_feature    322924..323199
                     /locus_tag="Rahaq2_4869"
                     /note="Phage-related baseplate assembly protein; Region:
                     Phage_base_V; pfam04717"
                     /db_xref="CDD:252757"
     gene            323777..324292
                     /locus_tag="Rahaq2_4870"
                     /note="IMG reference gene:2506711894"
                     /db_xref="GeneID:11818379"
     CDS             323777..324292
                     /locus_tag="Rahaq2_4870"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220595.1"
                     /db_xref="GI:379704221"
                     /db_xref="GeneID:11818379"
                     /translation="MKEKLLTPEALAVYNPLQNGAENAAQLMIAERWEDALASVVADS
                     VQEKLLAWTLQQALGRPESHEPAVQQCASEIHQWLAEPDDDRRFRIFQQAERLGFDTP
                     VGALGLSLFWMQGSMTPAEFDAVYPEPHLSRLMLHCALKLLSVAIATEDAPLKGAQTL
                     LSQWHAARGGD"
     gene            324292..324591
                     /locus_tag="Rahaq2_4871"
                     /note="IMG reference gene:2506711895"
                     /db_xref="GeneID:11818380"
     CDS             324292..324591
                     /locus_tag="Rahaq2_4871"
                     /note="PFAM: PAAR motif"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220596.1"
                     /db_xref="GI:379704222"
                     /db_xref="InterPro:IPR008727"
                     /db_xref="GeneID:11818380"
                     /translation="MGQPAARVGDMHVCPMVTPGLPPIPHVGGPVTTPGTPTVLIGGM
                     PAATMGSMAVCVGPPDTVVMGSAKVLIGGKPAARMGDSTAHGGTIVAGCPTVLIS"
     misc_feature    324358..324567
                     /locus_tag="Rahaq2_4871"
                     /note="PAAR motif; Region: PAAR_motif; pfam05488"
                     /db_xref="CDD:253216"
     gene            324603..325667
                     /locus_tag="Rahaq2_4872"
                     /note="IMG reference gene:2506711896"
                     /db_xref="GeneID:11818381"
     CDS             324603..325667
                     /locus_tag="Rahaq2_4872"
                     /note="PFAM: ImpA-related N-terminal;
                     TIGRFAM: type VI secretion-associated protein, ImpA
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion-associated protein, ImpA
                     family"
                     /protein_id="YP_005220597.1"
                     /db_xref="GI:379704223"
                     /db_xref="InterPro:IPR010657"
                     /db_xref="GeneID:11818381"
                     /translation="MIMNFEPLFAPVSAEQPAGRNMEYEQVYNEIREARESDPDYLPQ
                     GEWATELRKADWSKVVRLSSQVLQKESKDLQVACWLIEGLSHQHGISGLLGGIGFLIP
                     FIQNYWQNGWPEMDEDGAVIRHGMINRLDRQLAQMMHCHPLFGQPESTLDHWRKVLAY
                     EHRVTMKPDSAAERGSDDDFSMDTFNRWAATLDPQKVIAQNEALTQLETTLDTLEALY
                     GQLNPQADSLAMGQMRSATAEMQEFVKRLFDRAAPAYDDVMTLNVLTPDEDEQGTDVS
                     SLMNNTKKQTMSRDLAISQMLTIAHFFRQTEPSSPVPFLMERAARWAAMTLTEWLEEM
                     LQDDSSMRDINKVLKGHGRE"
     misc_feature    324609..325646
                     /locus_tag="Rahaq2_4872"
                     /note="ImpA-related N-terminal; Region: ImpA-rel_N;
                     cl19907"
                     /db_xref="CDD:268260"
     misc_feature    324624..325634
                     /locus_tag="Rahaq2_4872"
                     /note="Predicted component of the type VI protein
                     secretion system [Intracellular trafficking, secretion,
                     and    vesicular transport]; Region: COG3515"
                     /db_xref="CDD:226046"
     gene            325694..326239
                     /locus_tag="Rahaq2_4873"
                     /note="IMG reference gene:2506711897"
                     /db_xref="GeneID:11818382"
     CDS             325694..326239
                     /locus_tag="Rahaq2_4873"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220598.1"
                     /db_xref="GI:379704224"
                     /db_xref="GeneID:11818382"
                     /translation="MLGVMLLTGCASDNDQGRQKAISEVAAPFANGAITLKLRAEPGL
                     NSLNEMPNSCTVLLLQARDKPTLDKILGNPATLKSLFAGAGSEGDVLQVDRYVMMPGQ
                     TNTVHIDRARDTRNVALVAGYYPFPMKKHMVSAGVPVESESTGWWEPVWQAHLAPVTL
                     SVTLGSESIVSSDVPVAGEKK"
     misc_feature    325772..326107
                     /locus_tag="Rahaq2_4873"
                     /note="Type VI secretion lipoprotein; Region: T6SS-SciN;
                     pfam12790"
                     /db_xref="CDD:257298"
     gene            326239..327633
                     /locus_tag="Rahaq2_4874"
                     /note="IMG reference gene:2506711898"
                     /db_xref="GeneID:11818383"
     CDS             326239..327633
                     /locus_tag="Rahaq2_4874"
                     /note="PFAM: Bacterial protein of unknown function
                     (DUF876);
                     TIGRFAM: type VI secretion protein, VC_A0114 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="YP_005220599.1"
                     /db_xref="GI:379704225"
                     /db_xref="InterPro:IPR010263"
                     /db_xref="GeneID:11818383"
                     /translation="MYPEQQQIYWHSGLYLQPQHFQSLDLHYEWNLAEHLRLAQPYNY
                     GLIEVSINEAALNDYVISVEQIRCILPGGTLLSQPGNSRVEQRNFRDFWKQRDQPMTL
                     WLAVRRFDPLHSNVTTLEKEHDRAVTRWINTSEERVMKDVYDHAPDAAVARLCYNVRL
                     LTDIEKDDAVDCECIPLTRLRYENERVILDPTFSPPSVTLFGSFSLGKLIDTIYFELS
                     ARARKLEEYKRSERLVSDAERGDQVTQLLAMRSLNRVLPQLKNFCQARQVHPWQVYNM
                     LCQLVGDLSSFNDSCSFLGEWHDGENPLQTYNHNDLLSCFESARKTLITLLNSLVLED
                     NTYITLENDLQGVFTGNFDSMQSKNAETVLLLLRSASMPMENRQIKNPGGIKLASPKM
                     IEPLIQHALPGIPVIRCPQPPRGVPNRSDSHYFLVEQDSELWNKARQHNSISFYWPDM
                     PEDLQVQIIFVVPS"
     misc_feature    326260..327621
                     /locus_tag="Rahaq2_4874"
                     /note="type VI secretion protein, VC_A0114 family; Region:
                     VI_chp_4; TIGR03353"
                     /db_xref="CDD:132396"
     gene            327630..328253
                     /locus_tag="Rahaq2_4875"
                     /note="IMG reference gene:2506711899"
                     /db_xref="GeneID:11818384"
     CDS             327630..328253
                     /locus_tag="Rahaq2_4875"
                     /note="PFAM: Uncharacterized protein conserved in bacteria
                     (DUF2077);
                     TIGRFAM: type IV / VI secretion system protein, DotU
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220600.1"
                     /db_xref="GI:379704226"
                     /db_xref="InterPro:IPR017732"
                     /db_xref="GeneID:11818384"
                     /translation="MMSLLNCYLPLFRYVTAFFIHPQEYPDYNAFREKSITLLQQALL
                     ESERHHETTECEDAYFAVVLWVDERVLRSRADWVKEWRGDLLQKYYFDISVGGEAFFD
                     RLDETDKNNIQLRMVYLFCLLMGFHGKYTSQDAQLLQQRIEDERQCLPQAWRQWPNDA
                     LLVEQDTGGEKNKTVVKRLRQRKGLLLALPVIIYLVILSTGLGIFFR"
     misc_feature    327633..328247
                     /locus_tag="Rahaq2_4875"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2077); Region: DUF2077; cl01370"
                     /db_xref="CDD:260904"
     gene            328257..331694
                     /locus_tag="Rahaq2_4876"
                     /note="IMG reference gene:2506711900"
                     /db_xref="GeneID:11818385"
     CDS             328257..331694
                     /locus_tag="Rahaq2_4876"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220601.1"
                     /db_xref="GI:379704227"
                     /db_xref="GeneID:11818385"
                     /translation="MFKKLLSFVAWTLFLCLLLIICVVMSVALEQTLLHAFILWLILI
                     VVVLFSRFVWGSVSGIAQAKYISSLKAKFKLTRLEYVLFEHWKTGAAVIKRIRRRKQP
                     IPWFVLTGGRSGKTTLMAGAGLPLFSNEPESSLVVPTRTLRWWFFRSAGFLDLSSHFL
                     SKTPAFERGWLRLVNWCARLPAPAGIVVCVSVSELLEQDDAELHLHARHIRTQIEPLV
                     SKVRRRLPVYLFITCCDRMPGFSHWANKLSAVQRQQPLGYYWRDSPVVDGKDPALLDP
                     LFACVKDGLDKVRVSMLSGGEPDGETLALMDFPEQLPQLQPAMQRYLAALCEPDAYFQ
                     PAALGGIWFTATEPVSKNSASRQAFFIHDLMTRLLPALSRQRDIEPVGFGRRYLHKWG
                     AMTCSALAIMYLLVSGYFTRHLTDGTPTQMDIMAQVQQLENIEGWNAHPLKYLPFVPV
                     INHRHAQLEASILAASPRDKVNLHEIADNYQQQFNDAVPQQKRALILDLASTLITKQA
                     MWEKQPVSALVKRAPVPAALSMTGATVPLPPQQDVVLQRALLQLPEGGEQLAVLRELL
                     GRLVNSDPQMAWLVAPSDDLTPVNLTDFLPWSEDKTQISGLWTLQGTAQIQNWLEEIR
                     RAGSQQVPMPELAAFEQRWPALRQTQWMTMMLAMDQQSAPALTHEQWQTALIALDQGN
                     SPSMKFARYINEQLEDISAHDAARWLRELRRLNQLQAMSVPGALVPRISKFQQSVQKK
                     IATWLKIDSKTLKPVVSDLNIKNWNAWQTSLHAAVADVFATPKSSDRLTRGLFQTGAA
                     GDSNPLQLLDSRFNVMRKSLSAEHDDFAINAVWALYQNDARWLVAHAMQRSACWLEQQ
                     WQSRVLWPMENNASRLEYDDQQDLAWQYLSDFIRGPAKSVLVVEDNGPKAGEFNGQTP
                     GLTPEFLRMVNHVLRPDDVLAMPERESTRNDDALSALKDEQSELEAQMAELEAKPLEL
                     TLKSLPATIPGGARLMPVGTRLTLFCDEQQWKLNSMNFSEQATFHWRPGHCSRATLMI
                     NFPGFDLTYEYFGDAAWPDFLHDISDGQHRFKAEDFPDEAAQLAALGIKEVMVRYQSA
                     AQNLIQDSWHQWQALSQALNDNAQAQQEAGSRNAEKKRPTALKSAFSQLPVRITECH"
     misc_feature    328758..329456
                     /locus_tag="Rahaq2_4876"
                     /note="ImcF-related N-terminal domain; Region:
                     ImcF-related_N; pfam14331"
                     /db_xref="CDD:258504"
     gene            331740..334310
                     /locus_tag="Rahaq2_4877"
                     /note="IMG reference gene:2506711901"
                     /db_xref="GeneID:11818386"
     CDS             331740..334310
                     /locus_tag="Rahaq2_4877"
                     /note="PFAM: AAA domain (Cdc48 subfamily); C-terminal,
                     D2-small domain, of ClpB protein; Clp amino terminal
                     domain; ATPase family associated with various cellular
                     activities (AAA);
                     TIGRFAM: type VI secretion ATPase, ClpV1 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion ATPase, ClpV1 family"
                     /protein_id="YP_005220602.1"
                     /db_xref="GI:379704228"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR023150"
                     /db_xref="GeneID:11818386"
                     /translation="MGNYLKQIVEKMNVEARECLDAAISLAVSRTHHEVDVEHLLLAL
                     MTRNPALIEQLCLSAGLRGDTLIDALKISLNHLRSGNTRSPVLSELLVEHLEKSWLHA
                     SACWQQTQLPVQAFLGSLIASEKDNQIHLSSALQQALLCQTDRADRLLHDACAPAQAT
                     NHPAATRHNTDSAVMKFTRNLTEQARNASLDPALGREQEIRQLIDVLLRRRQNNPVLT
                     GEPGVGKTALVEGLAQRIADGTVPQALKTMEILSLDMGLLQAGASVKGEFENRLQTLL
                     REVKEYPSPVILFIDEAHTLIGAGGQAGQNDAANLLKPALARGEMRVVAATTWAEYKK
                     YFEKDAALARRFQVIKVAEPDEESATAMLRSLKPALSKHHGVQILESALVAAVRLSSR
                     YISGRQLPDKSISLLDTACARVAISQCHEPKEIEDLNAMIANIHTERESLLKEGDNLS
                     RVKWLDQRESELMQSLEALLPLWRQQQQIVAQINRTEDVAQIAALRLQLAEMHKEQAM
                     VYDCVDATCVADVVAGWTGIPLGRMMEKEQQQLGDLVARLESRVIGQSHALADIAQQI
                     RIGRANLADPVKPTGVFMLAGPSGVGKTETALALSELLFGGEQSLITINMSEYQEAHS
                     VSGLKGSPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEKAHPDVMEIFYQVFDKGVME
                     DAEGQLINFRNTLIILTSNLASDRVMTACASGNTDQKSLTALLRPEFDQFFRPALMGR
                     LQLIPYLPVVGETLAKIIRLKIDKVCKRFSGAGEGHSSLSYSEKVVEFIASRCEVEQS
                     GAREIDAVLNRELLPLLTDRLLALENKTAIRLQLGVSKGQLTLIKQPAAKNSVAKQSV
                     "
     misc_feature    331773..334166
                     /locus_tag="Rahaq2_4877"
                     /note="type VI secretion ATPase, ClpV1 family; Region:
                     VI_ClpV1; TIGR03345"
                     /db_xref="CDD:234172"
     misc_feature    332322..332801
                     /locus_tag="Rahaq2_4877"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    332394..332417
                     /locus_tag="Rahaq2_4877"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(332397..332420,332610..332612,332721..332723)
                     /locus_tag="Rahaq2_4877"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    332598..332615
                     /locus_tag="Rahaq2_4877"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    332772..332774
                     /locus_tag="Rahaq2_4877"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    333423..333857
                     /locus_tag="Rahaq2_4877"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    333498..333521
                     /locus_tag="Rahaq2_4877"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(333501..333524,333714..333716,333840..333842)
                     /locus_tag="Rahaq2_4877"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    333702..333719
                     /locus_tag="Rahaq2_4877"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    333993..>334169
                     /locus_tag="Rahaq2_4877"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            334331..335668
                     /locus_tag="Rahaq2_4878"
                     /note="IMG reference gene:2506711902"
                     /db_xref="GeneID:11818387"
     CDS             334331..335668
                     /locus_tag="Rahaq2_4878"
                     /note="PFAM: ImpA-related N-terminal; ImpA domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220603.1"
                     /db_xref="GI:379704229"
                     /db_xref="InterPro:IPR010657"
                     /db_xref="InterPro:IPR021069"
                     /db_xref="GeneID:11818387"
                     /translation="MKNRVNLRALKINGHDPRLSKSFLLLSSELSHLSGSLPARLDWN
                     ALEERCFQLFHEYGYDLQSGMWFCLINLRLKSWKGLALALDLLSTAFTHNSQRCWPPV
                     AAVQQRQQLIDWFNANVATHIYTLEYGPENSGEMRQVERSIGILCGQSKNLQSRSHDS
                     LNNLHYFLQVRCRSVPYPVQLKVTKPLPVAVENTSQPANDKKASEAVTDDIMPHVQAP
                     EIQLAEAPRLRPLLWGLGGMAAGIAVCAVAAAFWFSSQTRSLSEKLSAPLLALQRSER
                     QLNDAWNNVQESELSAQKEAVLADAAPVLTWISEQPADILLRHGEILSDHLEKAYPGN
                     EYSLQWRRTLDEKAGDIPALDGFILANKHLDELEIRLLNAEKKHSQYMTVSELKTAVY
                     QIRQDLQRNGTTAETLLWMMQQDKENHREVNPALLKQFTQRTVALNAYRFANE"
     misc_feature    334454..334639
                     /locus_tag="Rahaq2_4878"
                     /note="ImpA-related N-terminal; Region: ImpA-rel_N;
                     cl19907"
                     /db_xref="CDD:268260"
     misc_feature    335243..335647
                     /locus_tag="Rahaq2_4878"
                     /note="ImpA domain protein; Region: DUF3702; pfam12486"
                     /db_xref="CDD:193049"
     gene            335739..336494
                     /locus_tag="Rahaq2_4879"
                     /note="IMG reference gene:2506711903"
                     /db_xref="GeneID:11818388"
     CDS             335739..336494
                     /locus_tag="Rahaq2_4879"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220604.1"
                     /db_xref="GI:379704230"
                     /db_xref="GeneID:11818388"
                     /translation="MHPAEERLKRLLPFIITTAKQQVNVALEALERRKLSDDTRKILK
                     ELLNEDDSATVKKLTHSLNKIRRRMTSLAPEHFDLAEELYEAGGDTIGYVKATDAKDF
                     KKGTNKKYIALSYIHTGRMHVDDIAATVIHELSHLILNTEDHAYSICMSKQASGLFTP
                     WSVKELHSYARGKNSNPLNNAETLSRIVLLIYFSVSKLAAYKKAYALYWESGDNKILA
                     FHRMEPGQNPRISSPVLARKSNKLRIVNGHVVI"
     misc_feature    335811..336212
                     /locus_tag="Rahaq2_4879"
                     /note="Peptidase M35 family; Region: M35_like; cl03449"
                     /db_xref="CDD:261741"
     misc_feature    order(336132..336137,336144..336146,336165..336167,
                     336174..336176)
                     /locus_tag="Rahaq2_4879"
                     /note="active site"
                     /db_xref="CDD:199911"
     misc_feature    order(336132..336137,336144..336146,336165..336167)
                     /locus_tag="Rahaq2_4879"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:199911"
     gene            336657..338531
                     /locus_tag="Rahaq2_4880"
                     /note="IMG reference gene:2506711904"
                     /db_xref="GeneID:11818389"
     CDS             336657..338531
                     /locus_tag="Rahaq2_4880"
                     /note="PFAM: K+ potassium transporter;
                     TIGRFAM: potassium uptake protein"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium uptake protein"
                     /protein_id="YP_005220605.1"
                     /db_xref="GI:379704231"
                     /db_xref="InterPro:IPR003855"
                     /db_xref="InterPro:IPR023051"
                     /db_xref="GeneID:11818389"
                     /translation="MKQTKNKSSLLTVTVACIGVVYGDIGTSPLYTLRECLTGQAGIA
                     VTQSALFGFLSLIFWLLMLVVSVKYISFVMRADNDGEGGILTLMALAIRNLNPRWIPC
                     IMFIGLVGGSFFYGDGVITPAISVLSAIEGLEIIAPSLDRFIIPFSIAVLTLLFFIQK
                     NGTGGVGKIFAPVMVVWFITIGALGIGGILRNPDVLQALNPYWAMHFFVEFKTVSFFA
                     LGMVVLSVTGGEALYADMGHFGKKPIRIAWFVLIGPSLVMNYFGQGALLLSQPAAIKN
                     PFFLLAPDWALVPLLVLATLATVIASQAVISGVFSLTRQAVRMGYLPPMRIIYTSDVE
                     SGQIYIPVVNWLLYSAVLIAIVSFKHSSNLASAYGIVVTGTMVITSVLIGIVMIKNWG
                     WKSWAGGLVITAMLLIDVPLFAANLSKIFSGGWLPVAIGLTILVIMLTWKTERSRLLR
                     RLRQDPEALEALITSLEKSPPQRVPGTAVVMSRGQYEVPLVLLHNLKHNKILHERVVL
                     LTIVTEDVPYVHNVQRVIIEPLSPTFWRVIARYGWREKPNVTDILYRCGLEGLQSNMN
                     ETSFFMSRDTFILGEPRPWYLKARGKLFQVLQRNSLRAPEHYHIPPNRVIELGAVVKY
                     "
     misc_feature    336666..338522
                     /locus_tag="Rahaq2_4880"
                     /note="K+ potassium transporter; Region: K_trans; cl15781"
                     /db_xref="CDD:265782"
     gene            complement(338577..339374)
                     /locus_tag="Rahaq2_4881"
                     /note="IMG reference gene:2506711905"
                     /db_xref="GeneID:11818390"
     CDS             complement(338577..339374)
                     /locus_tag="Rahaq2_4881"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220606.1"
                     /db_xref="GI:379704232"
                     /db_xref="GeneID:11818390"
                     /translation="MSYRFTLAAVAAVLTLTGCAKSKTAEQAPAFDFGSTRVTVTHIP
                     TKTDDGTKLYVTIDGKDAGTLGIGESMEVQLPEGKHKVGGYARSLIGRVTISPVEVAT
                     SRDVISHVTYSVANLKPTFLVRASTPVPKPKSESIPAEPVPSMPKQIEAPAAAEQAQA
                     ATPAAPVTAPQTQAATPAAPVTAPQTQAATPAAPVTAPQTQAATPAAPVTAPQTQAAT
                     PAAPVTPQETQTPKVTELTPTTQSQTSQATQGSATPVITDLTSAPQT"
     misc_feature    complement(<339126..339332)
                     /locus_tag="Rahaq2_4881"
                     /note="Protein of unknown function (DUF2846); Region:
                     DUF2846; pfam11008"
                     /db_xref="CDD:256244"
     gene            339446..339676
                     /locus_tag="Rahaq2_4882"
                     /note="IMG reference gene:2506711906"
                     /db_xref="GeneID:11818391"
     CDS             339446..339676
                     /locus_tag="Rahaq2_4882"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220607.1"
                     /db_xref="GI:379704233"
                     /db_xref="GeneID:11818391"
                     /translation="MRMPGSQRSLLPAFLRFSDEIADDLRPKRLTSPALIITGMLNCA
                     PPDSKSHWKRPYRGHLKDNFRLKRFVELGIFM"
     gene            339763..340650
                     /locus_tag="Rahaq2_4883"
                     /note="IMG reference gene:2506711907"
                     /db_xref="GeneID:11818392"
     CDS             339763..340650
                     /locus_tag="Rahaq2_4883"
                     /note="PFAM: Beta-lactamase"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein, beta-lactamase class
                     C"
                     /protein_id="YP_005220608.1"
                     /db_xref="GI:379704234"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="GeneID:11818392"
                     /translation="MHKFHSYCISASGEERGDGDFDARFPYWSFTKTTTAICALKLSE
                     NGFVDLDCCIDGAAYTLRQLLNHTAGLPDYGALKAYHDAVAAGEQPWSREKLLSAALA
                     KGMLFAPGEGWSYSNVGYMLAREHIEAASGLDFAQLVADIITTPLGLTSVSQVTTREQ
                     FAELHCEAAGKYHPGWVYHGCLAGNVRDAARLLHGLFTGKLLSPASLAEMRVAYPLGG
                     ALEGRPWTACGYALGLMSGAMGKAGAAAGHSGGGPSCVNAVYHFPDLSEPVTGACFTD
                     GYYEGEAETELGRLVQNFA"
     misc_feature    339826..340467
                     /locus_tag="Rahaq2_4883"
                     /note="Beta-lactamase; Region: Beta-lactamase; pfam00144"
                     /db_xref="CDD:249626"
     gene            340835..341833
                     /locus_tag="Rahaq2_4884"
                     /note="IMG reference gene:2506711908"
                     /db_xref="GeneID:11818393"
     CDS             340835..341833
                     /locus_tag="Rahaq2_4884"
                     /note="PFAM: ROK family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator/sugar kinase"
                     /protein_id="YP_005220609.1"
                     /db_xref="GI:379704235"
                     /db_xref="InterPro:IPR000600"
                     /db_xref="GeneID:11818393"
                     /translation="MFTPLNRTTREMKINNVVLVTDALKSLGSATKADLAVATGLSIA
                     TCGAVLNELSLRHEVLALEMEVSRGGRPAQRYAYNADFFSVLSLYAQGSDAAAQIIWS
                     VNSATGESLAQGEVRFLPLTLATFYQQIASLLADYPNIKALGVGLPGVVVKGTVATCD
                     ITAFAGIAIEQQLRDRFGLYVQVDNDMNYTAWGFYRSSCAGVTAPVAYVFKPDVPCLG
                     CGMVINGQVLQGASQFAGEVSNLPFEHLNKLPVAEEMAKVIVSLTAIINPVTIALSGP
                     KISEALIPQLTALCQQYIPAQHMPELTYRPSMRKDYLQGITELTLHNYNLHVAFGE"
     misc_feature    341114..341548
                     /locus_tag="Rahaq2_4884"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     misc_feature    341204..>341548
                     /locus_tag="Rahaq2_4884"
                     /note="Transcriptional regulator/sugar kinase
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: NagC; COG1940"
                     /db_xref="CDD:224851"
     gene            341922..343094
                     /locus_tag="Rahaq2_4885"
                     /note="IMG reference gene:2506711909"
                     /db_xref="GeneID:11818394"
     CDS             341922..343094
                     /locus_tag="Rahaq2_4885"
                     /note="PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily transporter"
                     /protein_id="YP_005220610.1"
                     /db_xref="GI:379704236"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818394"
                     /translation="MSLSSEMESVDAHAGSPARRVATRAIFFVTGMAMGLWAALVPYA
                     QLRTHSEAGDLGLLLLCLGAGSLLSMLGSGRIIGRFGCRAVIVAAVVLYCLMLPLLAV
                     FSAIWLLALSLFIFGMGIGLADVAVNVQGTLVEQAADKPLMSGFHCLWSVGGIAGAGG
                     GALLLSAGITPLGSTFFAVALVALVTAWSFRGMLPFGAHEEEGAEGKPKARPNFRLVL
                     MAVMAMICFMAEGAVLDWGGVFLTRERGLALEHAGWGFAVFAVTMSLMRLTGDAIVSA
                     LGRKRILVVGGVLGIAGYLMVVLLPGWILPLCGFALVGIGAANIVPVLITLAGQEKVM
                     PVNMSVAMVATLGYLGVLGGPAVIGFIAHLSSLYVAFSVVAAAFLIITLGAYKLKY"
     misc_feature    341994..343088
                     /locus_tag="Rahaq2_4885"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    341994..342905
                     /locus_tag="Rahaq2_4885"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(342021..342023,342030..342038,342042..342047,
                     342096..342098,342105..342110,342117..342119,
                     342129..342134,342138..342143,342279..342284,
                     342291..342296,342303..342308,342315..342317,
                     342351..342356,342363..342368,342384..342386,
                     342600..342602,342609..342614,342621..342626,
                     342633..342635,342675..342677,342687..342689,
                     342699..342701,342708..342710,342720..342722,
                     342861..342863,342870..342875,342882..342884,
                     342894..342899,342906..342908,342936..342941,
                     342948..342953,342960..342965,342972..342974)
                     /locus_tag="Rahaq2_4885"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            343124..343951
                     /locus_tag="Rahaq2_4886"
                     /note="IMG reference gene:2506711910"
                     /db_xref="GeneID:11818395"
     CDS             343124..343951
                     /locus_tag="Rahaq2_4886"
                     /note="PFAM: haloacid dehalogenase-like hydrolase;
                     TIGRFAM: Cof subfamily of IIB subfamily of haloacid
                     dehalogenase superfamily; HAD-superfamily hydrolase,
                     subfamily IIB"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="YP_005220611.1"
                     /db_xref="GI:379704237"
                     /db_xref="InterPro:IPR013200"
                     /db_xref="GeneID:11818395"
                     /translation="MAVKLIAVDMDGTFLNPQHEYNKTRFREQYQQLLAREIKFVVAS
                     GNQYYQLKSFFDDIDEQIAYVAEGGGYVVDKKEEIYCGKLEPEQVADVLHWISRTPGI
                     NTIVCGRNGAYVLNGTDDVFIRRMRRYYHRLSKVSDYAEINDTIFKFALSYREDDVYP
                     LMGEITRHLGNIVAPVTSGHGSVDLIISGNHKACGLQKIQKIYGIRDEEVLAFGDSGN
                     DLEMLSYCGFGFAMENASAPAKAAAKYTAPSNSNEGVLKVIDDVLNDRAPFVCTTHN"
     misc_feature    343124..343915
                     /locus_tag="Rahaq2_4886"
                     /note="Predicted hydrolases of the HAD superfamily
                     [General function prediction only]; Region: Cof; COG0561"
                     /db_xref="CDD:223635"
     misc_feature    343136..343447
                     /locus_tag="Rahaq2_4886"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(343148..343156,343253..343258)
                     /locus_tag="Rahaq2_4886"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    343148..343165
                     /locus_tag="Rahaq2_4886"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    343253..343255
                     /locus_tag="Rahaq2_4886"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <343709..343819
                     /locus_tag="Rahaq2_4886"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     gene            complement(344016..344555)
                     /locus_tag="Rahaq2_4887"
                     /note="IMG reference gene:2506711911"
                     /db_xref="GeneID:11818396"
     CDS             complement(344016..344555)
                     /locus_tag="Rahaq2_4887"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220612.1"
                     /db_xref="GI:379704238"
                     /db_xref="GeneID:11818396"
                     /translation="MKRFTPLAVVALAAALSGCVSPPTRPDVMVLPGTGKDYQQFRMD
                     EMTCRNDAYSRVNGGAQTANNNAVNTAAAGTVVGAAAGALLGAASHQAGAGALVGAGS
                     GLLIGSAMGSNGAGASSGNLQDQYDTVYTQCMYAKGNKVPVDASYGYRSPPQAQSEVP
                     PDYYPPPSGNNDVPPDYVP"
     misc_feature    complement(344145..344504)
                     /locus_tag="Rahaq2_4887"
                     /note="Glycine-zipper containing OmpA-like membrane
                     domain; Region: Gly-zipper_OmpA; pfam13436"
                     /db_xref="CDD:257761"
     gene            complement(344570..344920)
                     /locus_tag="Rahaq2_4888"
                     /note="IMG reference gene:2506711912"
                     /db_xref="GeneID:11818397"
     CDS             complement(344570..344920)
                     /locus_tag="Rahaq2_4888"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220613.1"
                     /db_xref="GI:379704239"
                     /db_xref="GeneID:11818397"
                     /translation="MKRLLLLMLTAGVLMSASFASSAYGYYGHGYYGHGYYHGGYGGP
                     RIIVGIPWGPPPPPVYYGPPPVVYVTPAQPQTYVEKTPDYAYYCQNPAGYYPHVQRCP
                     RGWMKVVVGDSAPR"
     gene            complement(345179..345622)
                     /locus_tag="Rahaq2_4889"
                     /note="IMG reference gene:2506711913"
                     /db_xref="GeneID:11818398"
     CDS             complement(345179..345622)
                     /locus_tag="Rahaq2_4889"
                     /note="PFAM: Iron dependent repressor, metal binding and
                     dimerisation domain; Iron dependent repressor, N-terminal
                     DNA binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Mn-dependent transcriptional regulator"
                     /protein_id="YP_005220614.1"
                     /db_xref="GI:379704240"
                     /db_xref="InterPro:IPR001367"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR022687"
                     /db_xref="GeneID:11818398"
                     /translation="MKEKKINPLLDVEEHAQGFLQVREAHRRELMDDYVELISDLIHE
                     FGEARQVDLAARLGVSQPTVAKTLKRLANAGLVHQLPYRGTFLTPEGERLAAENRERH
                     NVVEAFFIALGISPETARLDAEGVEHHVSDETLEAFRRFTAEKKS"
     misc_feature    complement(345197..345616)
                     /locus_tag="Rahaq2_4889"
                     /note="manganese transport regulator MntR; Provisional;
                     Region: PRK11050"
                     /db_xref="CDD:182927"
     misc_feature    complement(345371..345538)
                     /locus_tag="Rahaq2_4889"
                     /note="Iron dependent repressor, N-terminal DNA binding
                     domain; Region: Fe_dep_repress; pfam01325"
                     /db_xref="CDD:110335"
     misc_feature    complement(<345200..345361)
                     /locus_tag="Rahaq2_4889"
                     /note="Iron dependent repressor, metal binding and
                     dimerization domain; Region: Fe_dep_repr_C; pfam02742"
                     /db_xref="CDD:251507"
     gene            345810..346751
                     /locus_tag="Rahaq2_4890"
                     /note="IMG reference gene:2506711914"
                     /db_xref="GeneID:11818399"
     CDS             345810..346751
                     /locus_tag="Rahaq2_4890"
                     /note="PFAM: Periplasmic solute binding protein family"
                     /codon_start=1
                     /transl_table=11
                     /product="metal ion ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005220615.1"
                     /db_xref="GI:379704241"
                     /db_xref="InterPro:IPR006127"
                     /db_xref="InterPro:IPR006128"
                     /db_xref="InterPro:IPR006129"
                     /db_xref="GeneID:11818399"
                     /translation="MGKGQNILKLFSYSPFRLRLMLVGMIVALITGNAQAAEKDKKKF
                     KIVTTFTVIQNIAQNVAGDAATVESITKPGAEIHDYQPTPRDIVKTQSADLILWNGFN
                     LERWFGRFFANIKNVPSVTVTDGIAPLPIQEGPYVGNPNPHAWMSAKNALVYVENIRA
                     ALVKYDPENAAVYDRNAKSYAEKISQLDAPLRERLAKIPAGQRWLVTSEGAFSYLAKD
                     YGLKEAYLWPINAEEQGTPQQVKKIIDLVRQQNIPVVFSESTISDKPAKQVSKETGAK
                     YGGLLYVDSLSAADGPVPTYIDLLKVTVGTIAEGFGQ"
     misc_feature    345855..346748
                     /locus_tag="Rahaq2_4890"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface adhesin [Inorganic ion transport and
                     metabolism]; Region: LraI; COG0803"
                     /db_xref="CDD:223874"
     misc_feature    345876..346745
                     /locus_tag="Rahaq2_4890"
                     /note="Metal binding protein PsaA.  These proteins have
                     been shown to function as initial receptors in ABC
                     transport of Mn2+ and as surface adhesins in some
                     eubacterial species.  They belong to the TroA superfamily
                     of periplasmic metal binding proteins that...; Region:
                     PsaA; cd01137"
                     /db_xref="CDD:238557"
     misc_feature    order(346041..346043,346236..346238,346434..346436,
                     346659..346661)
                     /locus_tag="Rahaq2_4890"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238557"
     gene            346748..347527
                     /locus_tag="Rahaq2_4891"
                     /note="IMG reference gene:2506711915"
                     /db_xref="GeneID:11818400"
     CDS             346748..347527
                     /locus_tag="Rahaq2_4891"
                     /note="PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Mn/Zn ABC transporter ATPase"
                     /protein_id="YP_005220616.1"
                     /db_xref="GI:379704242"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818400"
                     /translation="MNDTALDLNVDDISVTYNNGHTAIENASFTLRGGSICALLGVNG
                     SGKSTLFKTIMGMIRPTHGRVTLDGLNVAKALKQNLIAYVPQSEEVDWNFPVLVRDVV
                     MMGRYGKMSFLRIPSQEDKKQVASALARVGLTELAHRQIGELSGGQKKRVFLARALAQ
                     QGRVMLLDEPFTGVDIKTENAIIELLRQLREEGHLILVSTHNIASVPDFCDRVVLINR
                     TVIASGPLETTFTHQNLESTFGGALRNIGYLMPQEPVRRVV"
     misc_feature    346769..347479
                     /locus_tag="Rahaq2_4891"
                     /note="ABC-type Mn/Zn transport systems, ATPase component
                     [Inorganic ion transport and metabolism]; Region: ZnuC;
                     COG1121"
                     /db_xref="CDD:224046"
     misc_feature    346775..347419
                     /locus_tag="Rahaq2_4891"
                     /note="ATP-binding cassette domain of the metal-type
                     transporters; Region: ABC_Metallic_Cations; cd03235"
                     /db_xref="CDD:213202"
     gene            347524..348378
                     /locus_tag="Rahaq2_4892"
                     /note="IMG reference gene:2506711916"
                     /db_xref="GeneID:11818401"
     CDS             347524..348378
                     /locus_tag="Rahaq2_4892"
                     /note="PFAM: ABC 3 transport family"
                     /codon_start=1
                     /transl_table=11
                     /product="Mn2+/Zn2+ ABC transporter permease"
                     /protein_id="YP_005220617.1"
                     /db_xref="GI:379704243"
                     /db_xref="InterPro:IPR001626"
                     /db_xref="GeneID:11818401"
                     /translation="MTELLLEPFQYNYMVKAIWVSAGVGAVCAFLSAYLMLKGWSLMG
                     DALSHSVVPGVAGAYALGFPYAIGAFGTGILAALSMTLLRHFTKLREDAIIGFVFSTF
                     FALGLLLVSLNPTSVNVQSILFGNILGIDDADILQVQIIVGVSLLVLCVIWRDLLAVF
                     FDEAHAVSVGLSPLWLKVIFFTIFSACSVAALQTVGAILVIAMVITPGATAYLLSDRF
                     SHLLIISVIIGAVTSAAGAWLSYFLDGATGGVIVCLQTTVFLLAFLFAPKHGWLVNHL
                     RIKNRSRA"
     misc_feature    347563..348312
                     /locus_tag="Rahaq2_4892"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(347617..347619,347629..347637,347971..347976,
                     347980..347988,347992..347997,348001..348018,
                     348022..348030,348154..348156,348175..348177)
                     /locus_tag="Rahaq2_4892"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(347632..347634,347638..347640,347653..347655,
                     347794..347796,347800..347805,347812..347817,
                     347824..347829,347836..347838,347845..347850,
                     347854..347856,347881..347886,347893..347895,
                     348121..348123,348268..348270,348277..348282,
                     348289..348291,348298..348303,348310..348312)
                     /locus_tag="Rahaq2_4892"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(347854..347856,347923..347925,348097..348099,
                     348109..348111,348244..348246,348259..348261)
                     /locus_tag="Rahaq2_4892"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            348375..349229
                     /locus_tag="Rahaq2_4893"
                     /note="IMG reference gene:2506711917"
                     /db_xref="GeneID:11818402"
     CDS             348375..349229
                     /locus_tag="Rahaq2_4893"
                     /note="PFAM: ABC 3 transport family"
                     /codon_start=1
                     /transl_table=11
                     /product="Mn2+/Zn2+ ABC transporter permease"
                     /protein_id="YP_005220618.1"
                     /db_xref="GI:379704244"
                     /db_xref="InterPro:IPR001626"
                     /db_xref="GeneID:11818402"
                     /translation="MMSWFDVLMEPLSFDFMQRALLTAAATSIVCAIFSCFLVLKGWS
                     LMGDAISHAVLPGVVLAYLAGIPLVIGAFGSGLFCAVATGFIKEHCRVKEDSVMGIVF
                     SGMFAAGLVLFSRVNTEQHLSHILFGNVLGVTDSEMLQTLIIAAVVTLAIILKFKDLM
                     LFCFDPVQAKVIGLPVRFYHYALLCMLALTIVAALQAVGVVLVVAMLITPGITAFLLC
                     KTLPKMLMVSVTTSLFAAVSGTFISFYIDAATGPTIVLVQAAIFLLALTANLLRKTIK
                     PHQAAPNV"
     misc_feature    348423..349172
                     /locus_tag="Rahaq2_4893"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(348477..348479,348489..348497,348831..348836,
                     348840..348848,348852..348857,348861..348878,
                     348882..348890,349014..349016,349035..349037)
                     /locus_tag="Rahaq2_4893"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(348492..348494,348498..348500,348513..348515,
                     348654..348656,348660..348665,348672..348677,
                     348684..348689,348696..348698,348705..348710,
                     348714..348716,348741..348746,348753..348755,
                     348981..348983,349128..349130,349137..349142,
                     349149..349151,349158..349163,349170..349172)
                     /locus_tag="Rahaq2_4893"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(348714..348716,348783..348785,348957..348959,
                     348969..348971,349104..349106,349119..349121)
                     /locus_tag="Rahaq2_4893"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            349369..349548
                     /locus_tag="Rahaq2_4894"
                     /note="IMG reference gene:2506711918"
                     /db_xref="GeneID:11818403"
     CDS             349369..349548
                     /locus_tag="Rahaq2_4894"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220619.1"
                     /db_xref="GI:379704245"
                     /db_xref="GeneID:11818403"
                     /translation="MSEVASSISVGDSFTVKNGTTHEVTGFVKKGERIYPTVKTDHGD
                     SNFTFIKEIVSVNKA"
     gene            complement(349728..350972)
                     /locus_tag="Rahaq2_4895"
                     /note="IMG reference gene:2506711919"
                     /db_xref="GeneID:11818404"
     CDS             complement(349728..350972)
                     /locus_tag="Rahaq2_4895"
                     /note="PFAM: Tryptophan/tyrosine permease family;
                     TIGRFAM: aromatic amino acid transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid transport protein"
                     /protein_id="YP_005220620.1"
                     /db_xref="GI:379704246"
                     /db_xref="InterPro:IPR002091"
                     /db_xref="InterPro:IPR013061"
                     /db_xref="InterPro:IPR018227"
                     /db_xref="GeneID:11818404"
                     /translation="MATLSVTAPQHSVLGGAMIISGTIIGAGMFSLPVVMSGAWFFWS
                     VAALIFTWFCMLHSGLMILEANLNYPVGSSFNTVTGDLLGKNWNRLNGITIAFVLYIL
                     TYAYISASGSVIQHTLREMSVSFSPRLGGLLTALVVAFIVWLSTRAVSRMTAIVLGAK
                     IIAFFLTFGSLLWHIKPVNLLNSVELNPSYAPYVLATLPFCLASFGYHGNVPSLMKYY
                     GKNPHVIKKCLLLGTLMALGLYVIWMLGTMGNIPRPEFIGIAERGGNIDVLVQSLSQI
                     LNSAGLDLLLTIFSNFAVACSFLGVTLGLFDYLADLFKFDDNRTGRFKTALVTFVPPI
                     VGGVIYPDGFIYAIGFAGLAATVWAVIVPALMALASRQRFGSPLYRVWGGNKMIVLVL
                     LFGVLNAVVHILSSVSLLPVYR"
     misc_feature    complement(349731..350972)
                     /locus_tag="Rahaq2_4895"
                     /note="tryptophan permease; Provisional; Region: PRK10483"
                     /db_xref="CDD:182492"
     misc_feature    complement(349743..350963)
                     /locus_tag="Rahaq2_4895"
                     /note="Amino acid permeases [Amino acid transport and
                     metabolism]; Region: SdaC; COG0814"
                     /db_xref="CDD:223884"
     gene            complement(351208..351396)
                     /locus_tag="Rahaq2_4896"
                     /note="IMG reference gene:2506711920"
                     /db_xref="GeneID:11818405"
     CDS             complement(351208..351396)
                     /locus_tag="Rahaq2_4896"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220621.1"
                     /db_xref="GI:379704247"
                     /db_xref="GeneID:11818405"
                     /translation="MHREIKFSFHFSLVLSSNLLAINRVSTLYLRTVFLIDAILENIM
                     KSVTYTKDIDKTINQKVE"
     gene            complement(351934..352668)
                     /locus_tag="Rahaq2_4897"
                     /note="IMG reference gene:2506711921"
                     /db_xref="GeneID:11818406"
     CDS             complement(351934..352668)
                     /locus_tag="Rahaq2_4897"
                     /note="PFAM: Pirin"
                     /codon_start=1
                     /transl_table=11
                     /product="Pirin-like protein"
                     /protein_id="YP_005220622.1"
                     /db_xref="GI:379704248"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="GeneID:11818406"
                     /translation="MFNVLRAEPKTTFEYGPFRIRRMRPGKIVPDSSDDAFGPLSVID
                     HANLELGTLVKMHEHNNDEIFSYLWRGSMVHEDSAGHRASLSPKKLMMMNAGESFWHE
                     ESTPLVPAEMLQIFIRPRKADLKGRVQFMERPDGVKQNEWTLLAAPEGIESPLEIRQA
                     VYVYDIRMDEKSTTEIPAHPGFAQWLYVMDGEISIADVSLSKGDAISDEESALPAASA
                     KRETTLVCFLVCLGAEAILEGTISGK"
     misc_feature    complement(351955..352641)
                     /locus_tag="Rahaq2_4897"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    complement(352318..352617)
                     /locus_tag="Rahaq2_4897"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     gene            complement(352739..354472)
                     /locus_tag="Rahaq2_4898"
                     /note="IMG reference gene:2506711922"
                     /db_xref="GeneID:11818407"
     CDS             complement(352739..354472)
                     /locus_tag="Rahaq2_4898"
                     /note="PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_005220623.1"
                     /db_xref="GI:379704249"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:11818407"
                     /translation="MTTLLSAQSLSFDNAFGPLLAEISFGLKKGDRIGLIGHNGCGKS
                     TLLKILSGELAASSGTVTLANQCLMARVEQHLPVELNDCTLLESVLGYLPGSLHQPEP
                     WQAQVLLSSLGFDENAWELTAGTLSGGQHTRLLLARALIRQPDLLLLDEPSNHLDLPT
                     LLWLERFLKDWAGSFVLVSHDRSLLDSVTNATWILRDKTLQFIRLPCTQARQALKEKD
                     IADALRRKAEQKEIDRVTLSAKRLAVWGSVYDNEGLARKAKQMEKQVVRMKEDQTDVT
                     AGNQWKLRLNGEALAADRVLALSDLQVRPAADAPVLFTLDEMRVKSGDRIALVGRNGC
                     GKSSLLHSLWQAFICPETATCGVVFHPRLRMGYYDQNQHQLQDNDSLSDALAHFAPLT
                     EEQRKMALIGAGFPYIRHQQKVGTLSGGERSRLLFIGLTLANYSLLLLDEPTNHLDLE
                     GKEELAETLKTFSGAVLMVSHDRTLIEQSCNRFWLIDQQRLEEWHSPAPVYAILAGAV
                     PVTSTPVSDVMAHSTAIQDTEEERLLATLMELENKLEEDLARKPKHQKPALQRQWQQK
                     IAELNALLDLL"
     misc_feature    complement(353012..354463)
                     /locus_tag="Rahaq2_4898"
                     /note="ATPase components of ABC transporters with
                     duplicated ATPase domains [General function prediction
                     only]; Region: Uup; COG0488"
                     /db_xref="CDD:223562"
     misc_feature    complement(353876..354460)
                     /locus_tag="Rahaq2_4898"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    complement(353003..353542)
                     /locus_tag="Rahaq2_4898"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     gene            complement(354761..355999)
                     /locus_tag="Rahaq2_4899"
                     /note="IMG reference gene:2506711923"
                     /db_xref="GeneID:11818408"
     CDS             complement(354761..355999)
                     /locus_tag="Rahaq2_4899"
                     /note="PFAM: Bacterial protein of unknown function
                     (DUF894)"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005220624.1"
                     /db_xref="GI:379704250"
                     /db_xref="InterPro:IPR010290"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818408"
                     /translation="MSASAGHSDSLLQHRSFVAFWIARAASSFGFQMLSIVVSWQIYS
                     ITGRAFDLGLIGLVQFVPSVALALVAGHVADQFDRRRVVLLGQIAEWVATGALAYLTL
                     THHVNEVIVLGLIFVISTAKAMEAPSLQSMLPALVPPNLLARAMAATSVSGQAASMVG
                     PALGGFLYVAGAGVAYAVCACLYLLSIVMVSRLRYEQVPPRRVPATFKTLFAGIGFIR
                     ARPDVLGVISLDLFAVLLGGATALLPIFAHDILHTGPWGLGLLRGAPAVGGLIVGFWL
                     SHRALNRNVGKIMFAAVAGFGAATLVFAFSTSLWLSMFALFALGGFDMISMVIRGALV
                     QLDTPDDMRGRVSAVNSIFINTSNQLGEFESGLLAAWVGAVPAAAIGGVGTLIVVGLW
                     MTWFPGLRKRQKLENETVEA"
     misc_feature    complement(354764..355972)
                     /locus_tag="Rahaq2_4899"
                     /note="enterobactin exporter EntS; Provisional; Region:
                     PRK10489"
                     /db_xref="CDD:236700"
     misc_feature    complement(354812..355951)
                     /locus_tag="Rahaq2_4899"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(354926..354928,354935..354940,
                     354947..354952,354959..354964,354995..354997,
                     355004..355009,355019..355021,355028..355033,
                     355040..355042,355193..355195,355202..355204,
                     355214..355216,355226..355228,355268..355270,
                     355277..355282,355289..355294,355301..355303,
                     355529..355531,355547..355552,355559..355564,
                     355598..355600,355607..355612,355619..355624,
                     355631..355636,355787..355792,355796..355801,
                     355811..355813,355820..355825,355832..355834,
                     355883..355888,355892..355900,355907..355909))
                     /locus_tag="Rahaq2_4899"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(356137..357060)
                     /locus_tag="Rahaq2_4900"
                     /note="IMG reference gene:2506711924"
                     /db_xref="GeneID:11818409"
     CDS             complement(356137..357060)
                     /locus_tag="Rahaq2_4900"
                     /note="PFAM: alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="YP_005220625.1"
                     /db_xref="GI:379704251"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="GeneID:11818409"
                     /translation="MTDITPSAVVSAAPFAVADLTLSGFTHRYATVDGVRLHYVSGGN
                     PQGKVLLLLAGFPQTWYAWRNVMKALAEDFWLVAPDLPGQGDSDRPQTGYDTQSLAQK
                     IHGLMQLLGHKRYSLAAHDVGAWVAYPYAAMYGGEVQRLALLDAGIPGITLPDALPVT
                     PDKSWKTWHFAFHTLPDLPEALIAGNERVYLDWFLRRKTAAPDAFTDDDISEYLRVFL
                     KSGGLRAGLAYYRSVTESAEQNRELNRRGKLKMPVLAVSADQGSIPDMAIPLHAFAEN
                     VTGIIIPHSGHFIPDEQPEALARELHNFFTM"
     misc_feature    complement(<356416..356988)
                     /locus_tag="Rahaq2_4900"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(356143..356982)
                     /locus_tag="Rahaq2_4900"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     gene            complement(357135..357737)
                     /locus_tag="Rahaq2_4901"
                     /note="IMG reference gene:2506711925"
                     /db_xref="GeneID:11818410"
     CDS             complement(357135..357737)
                     /locus_tag="Rahaq2_4901"
                     /note="PFAM: Bacterial regulatory proteins, tetR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220626.1"
                     /db_xref="GI:379704252"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011075"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR015893"
                     /db_xref="GeneID:11818410"
                     /translation="MASSSPKDRGRPREFDTELALDNAMTVFREKGFHAASISDLSQA
                     MNLTAGSIYKAFSDKRTLFLNVFERYTSLRNIQLRQQIERAATGRERIAEVLRFYLRS
                     SHEIEGRRGCLVVGSTVGLLTLDDELAALVRQAIMRNKSFLASLIEQGQQDGSVAADI
                     DAQAASSLLLWIVLGMRVAGKVENNQASETTLKLALKILD"
     misc_feature    complement(357201..357719)
                     /locus_tag="Rahaq2_4901"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(357546..357677)
                     /locus_tag="Rahaq2_4901"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(357825..358502)
                     /locus_tag="Rahaq2_4902"
                     /note="IMG reference gene:2506711926"
                     /db_xref="GeneID:11818411"
     CDS             complement(357825..358502)
                     /locus_tag="Rahaq2_4902"
                     /note="PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005220627.1"
                     /db_xref="GI:379704253"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:11818411"
                     /translation="MTDSKKALIIGASRGIGLGVVDVLAKRGWQVTATTRDAVPAKTP
                     AAVEWVKLDINKSEAREAVKDALSESHFDLIFVNAGVFGPDHQDLHQASDEEIIQLFL
                     TNAISPVRCAGELLPFLNHRTGVLALMTSELSSLNENDVATYPLYSASKAALNMLTRG
                     LLEQIEKQELTLLSVHPGWVQTDMGGENATLTVTESATGIVDQFEAWRGKGGHHFVEY
                     SGRELRW"
     misc_feature    complement(357828..358490)
                     /locus_tag="Rahaq2_4902"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(358020..358490)
                     /locus_tag="Rahaq2_4902"
                     /note="short chain dehydrogenase; Region: adh_short;
                     pfam00106"
                     /db_xref="CDD:249592"
     misc_feature    complement(order(357963..357974,358050..358052,
                     358062..358064,358110..358118,358263..358271,
                     358392..358400,358455..358457,358461..358466,
                     358470..358472))
                     /locus_tag="Rahaq2_4902"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(358050..358052,358062..358064,
                     358110..358112,358191..358193))
                     /locus_tag="Rahaq2_4902"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            358838..359611
                     /locus_tag="Rahaq2_4903"
                     /note="IMG reference gene:2506711927"
                     /db_xref="GeneID:11818412"
     CDS             358838..359611
                     /locus_tag="Rahaq2_4903"
                     /note="PFAM: Protein of unknown function (DUF3750)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220628.1"
                     /db_xref="GI:379704254"
                     /db_xref="InterPro:IPR022224"
                     /db_xref="GeneID:11818412"
                     /translation="MIAIKWVSLGFVLVLLLSFGYSYARATQTRTEPAGQSWSTARRT
                     SAGIAPDPVRLKSIAIIQIYAAPTYGWRGLVAVHPWIIYKREGETAFTRYDVISWGST
                     NVVRRDYAIPDGYWFGSQPRILVDHRGAQAQIMIPKIEAAIKSYPYPHTYHAWPGPNS
                     NTFIAHIGREVPDLALDLPSNAIGKDYRGITNPIGLPPSGRGVQVSLLGLLGVTLGVE
                     EGVEVNVLGLNLGIDVKNPALRLPFVGRVGFDNPGKAEL"
     misc_feature    359012..359398
                     /locus_tag="Rahaq2_4903"
                     /note="Protein of unknown function (DUF3750); Region:
                     DUF3750; pfam12570"
                     /db_xref="CDD:153004"
     gene            complement(359775..361421)
                     /locus_tag="Rahaq2_4904"
                     /note="IMG reference gene:2506711928"
                     /db_xref="GeneID:11818413"
     CDS             complement(359775..361421)
                     /locus_tag="Rahaq2_4904"
                     /note="PFAM: Fumarase C-terminus; Fumarate hydratase
                     (Fumerase);
                     TIGRFAM: hydro-lyases, Fe-S type, tartrate/fumarate
                     subfamily, beta region; hydro-lyases, Fe-S type,
                     tartrate/fumarate subfamily, alpha region"
                     /codon_start=1
                     /transl_table=11
                     /product="hydro-lyase, Fe-S type, tartrate/fumarate
                     subfamily,hydro-lyase family enzyme, Fe-S type,
                     tartrate/fumarate subfamily"
                     /protein_id="YP_005220629.1"
                     /db_xref="GI:379704255"
                     /db_xref="InterPro:IPR004646"
                     /db_xref="InterPro:IPR004647"
                     /db_xref="InterPro:IPR011167"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="GeneID:11818413"
                     /translation="MSNKPFYYQNPFPVSKDDTEYYLLTKEHVSVSTFDGEDVLKVEP
                     QALTLLAQQAFHDASFMLRPAHQQQVASILHDPESSENDKYVALQFLRNSEIAAKGIL
                     PTCQDTGTAIIMGKKGQRVWTGGGDEASLSQGVYNTFIEDNLRYSQNAALDMYKEVNT
                     GTNLPAQIDLYSVDGDEYKFLCIAKGGGSANKTYLYQETKALITPAKLKDYLVDKMRT
                     LGTAACPPYHIAFVIGGTSAEATLKTVKLASTHYYDGLPTEGNEHGQAFRDVNLEQEL
                     LAEANNLGLGAQFGGKYFAHDIRVVRLPRHGASCPVGMGVSCSADRNIKAKINRDGIW
                     IEKLEDNPGQYIPEALREQGEAGVVKVDLNRPMPEILAQLSEYPVSTRLSLSGTIIVG
                     RDIAHAKLKERLDNGEGLPQYIKDHPIYYAGPAKTPEGYASGSLGPTTAGRMDSYVDL
                     LQSNGGSMIMLAKGNRSQQVTDACHKHGGFYLGSIGGPAAVLAQQSIKSLECVEYPEL
                     GMEAIWKIEVENFPAFILVDDKGNDFFQQIHANTCAKCVK"
     misc_feature    complement(359811..361418)
                     /locus_tag="Rahaq2_4904"
                     /note="fumarate hydratase; Provisional; Region: PRK15389"
                     /db_xref="CDD:237955"
     misc_feature    complement(360390..361310)
                     /locus_tag="Rahaq2_4904"
                     /note="Tartrate dehydratase alpha subunit/Fumarate
                     hydratase class I, N-terminal domain [Energy production
                     and conversion]; Region: TtdA; COG1951"
                     /db_xref="CDD:224862"
     misc_feature    complement(359808..360428)
                     /locus_tag="Rahaq2_4904"
                     /note="Fumarase C-terminus; Region: Fumerase_C; pfam05683"
                     /db_xref="CDD:253320"
     gene            complement(361612..363045)
                     /locus_tag="Rahaq2_4905"
                     /note="IMG reference gene:2506711929"
                     /db_xref="GeneID:11818414"
     CDS             complement(361612..363045)
                     /locus_tag="Rahaq2_4905"
                     /note="PFAM: Sodium:sulfate symporter transmembrane
                     region;
                     TIGRFAM: anion transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="anion transporter"
                     /protein_id="YP_005220630.1"
                     /db_xref="GI:379704256"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="GeneID:11818414"
                     /translation="MALPVLVSVLLLLVPVPAGLEPHAWHFFAIFVGVIIGLIFEPLP
                     GAVIGLTGVVVIALFSQWLLFSPAELADPKFKTAAQSFKWAVSGFGNSTVWLIFGAFM
                     FAAGYDKTQFGRRLALILVKYLGRRSLTLGYAITFADLLLAPFTPSNTARSGGTIYPI
                     IANLPPLYGSKPNDPSARKIGSYLMWVAITAACITSSMFLSALAPNLLALGIVNSVTG
                     INISWGTWFIAFLPVGLLLLLTMPLLAYWFYPPEVKINDEVPRWATAELAKLGRMSRH
                     EILLLVFVCCALAMWIFAASFIEPAMAALLVVVLMLWTGVLNWNDITSNKPAWNTFAW
                     FATLVALADGLSRTGFIAWLGKEGAALMGGISPGAATIALLLAFYLLHYLFASTTAHT
                     TALLPAMLTIGAAIPGINMQVFCLLMVTSLGVMGIITPYGTGPSPIYYGSGYLPTKDY
                     WRLGTIFGAIFLIALLVIGYPWMVMMF"
     misc_feature    complement(361615..362994)
                     /locus_tag="Rahaq2_4905"
                     /note="Sodium:sulfate symporter transmembrane region;
                     Region: Na_sulph_symp; pfam00939"
                     /db_xref="CDD:250243"
     misc_feature    complement(361630..362994)
                     /locus_tag="Rahaq2_4905"
                     /note="anion transporter; Region: dass; TIGR00785"
                     /db_xref="CDD:233126"
     misc_feature    complement(order(361633..361671,361744..361803,
                     361876..361923,362011..362067,362110..362154,
                     362176..362214,362305..362310,362317..362355,
                     362431..362502,362542..362595,362599..362604,
                     362611..362655,362722..362775,362872..362913,
                     362932..362943))
                     /locus_tag="Rahaq2_4905"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            363862..366639
                     /locus_tag="Rahaq2_4906"
                     /note="IMG reference gene:2506711930"
                     /db_xref="GeneID:11818415"
     CDS             363862..366639
                     /locus_tag="Rahaq2_4906"
                     /note="PFAM: FAD binding domain; NADH:flavin
                     oxidoreductase / NADH oxidase family; FMN-binding domain;
                     TIGRFAM: flavocytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="flavocytochrome c"
                     /protein_id="YP_005220631.1"
                     /db_xref="GI:379704257"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR007329"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:11818415"
                     /translation="MSTNDLLLSPFTLPNGTELKNRILMAPMTTCTGFYDGTVTRELV
                     EYYRARAGSIGTVIVECCFVDDRGLAFPGAIGIDNDAKIDGLAKIAAAVKSQGSKAVL
                     QIYHGGRMSEPKLIGGQQPVAPSALAAPRDGAATPVALTAGEVEDMITKFGEGVRRAI
                     EAGFDGVEIHGANTYLIQQFFSPNSNQRDDKWGGSRENRARFPLAVLDITHEMAKKYA
                     DSSFIIGYRFSPEELEEPGIRFADTLYLLEQLAARGLDYLHFSLGYSLRPSIVDTTDP
                     TPLIDKYVAMRSDTLAKIPVMGVGGIVNKSDAELALEHGYDMVAIGKACIAYPDWTDR
                     IAADHKLELFIDSTQREALTIPEPLWRFSLVDAMIRDMSMSSKKFKAGVFREKVQDPA
                     HELAVNVSLDTDRIADIALDAGADLDVEFTTSFDIIRSRILDANSPHFDAVTGATEQS
                     EAVKKAVSKAIAKSCKAQLLEEGGSLNAPQSYDVVVVGSGGAGLAAAIQACDEGAKVL
                     IVEKMSTIGGNTIKASVGMNAAETRYQRLKGIEDSKDLFYQETLKGGQFKNNTVLLKE
                     FIEHAPRAVEWLADHHIELSDITITGGMSVDRTHRPADRSAVGGFLISGLVKNLNKRN
                     IDVMLDTSVTEIRYSNGAVQGVQLLNDDNDVLTINAKSVIVATGGFSANREMVVKYRP
                     ELDGFVTTNHKGATGSGIAILQNIGAGTVDMGEIQIHPTVEQTTSYLISEAIRGGGAI
                     LVSQAGKRFFNEMETRDKVSANIIALPEKFAYVVFDEQVRLNNKAADEYIAKGFVISG
                     SSPRDLAAKLEMNSDTFLATLESYNVAVDKQDDAEFGRKTALRHPINQGPFYAIRIAP
                     GVHHTMGGVTINTDTCVLDAQQQVLGGAFAAGEVVGGIHGGNRIGGNAVADIIIFGIL
                     AGQNAAKFAMR"
     misc_feature    363880..364941
                     /locus_tag="Rahaq2_4906"
                     /note="Old yellow enzyme (OYE)-related FMN binding domain,
                     group 4.  Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a reducing
                     agent with oxygens, quinones, and alpha,beta-unsaturated
                     aldehydes and ketones, and can act as...; Region:
                     OYE_like_4_FMN; cd04735"
                     /db_xref="CDD:240086"
     misc_feature    order(363940..363942,363946..363948,364042..364044,
                     364168..364170,364384..364386,364552..364554,
                     364825..364830)
                     /locus_tag="Rahaq2_4906"
                     /note="putative active site [active]"
                     /db_xref="CDD:240086"
     misc_feature    order(363940..363942,363946..363948,364042..364044,
                     364168..364170,364552..364554,364825..364830)
                     /locus_tag="Rahaq2_4906"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240086"
     misc_feature    order(364378..364380,364384..364386)
                     /locus_tag="Rahaq2_4906"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240086"
     misc_feature    364384..364386
                     /locus_tag="Rahaq2_4906"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240086"
     misc_feature    <364975..365250
                     /locus_tag="Rahaq2_4906"
                     /note="FMN-binding domain; Region: FMN_bind; cl01081"
                     /db_xref="CDD:260782"
     misc_feature    365353..366612
                     /locus_tag="Rahaq2_4906"
                     /note="flavocytochrome c; Region: flavo_cyto_c; TIGR01813"
                     /db_xref="CDD:233583"
     misc_feature    365365..366615
                     /locus_tag="Rahaq2_4906"
                     /note="L-aspartate oxidase; Provisional; Region: PRK06175"
                     /db_xref="CDD:180442"
     gene            366664..367626
                     /locus_tag="Rahaq2_4907"
                     /note="IMG reference gene:2506711931"
                     /db_xref="GeneID:11818416"
     CDS             366664..367626
                     /locus_tag="Rahaq2_4907"
                     /note="PFAM: ApbE family"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-associated lipoprotein involved in
                     thiamine biosynthesis"
                     /protein_id="YP_005220632.1"
                     /db_xref="GI:379704258"
                     /db_xref="InterPro:IPR003374"
                     /db_xref="GeneID:11818416"
                     /translation="MTPDDRVYAYSAVLMGSPILLKLFEHNESLASGVFRLIKQQENI
                     FTVNRPHSDIMAINHAAGRDPVTVSAPVFALIRRAKAISCLPDSSFNFTIGPLVKRWK
                     IGFSGHSIPAAHDLRTLLALTDPQDVILDEQTRSVFLQQAGMEIDLGAMAKGYIADVV
                     RDYLREQQVESALINLGGNVQTLGSGAEGAWAIGLKKPFSDPEALIGVINVIGKSVVT
                     SGVYERYFELDGHCYHHILDPKTGYPLDNELLSVTIISEDSIDGDIWTTLLYGMGVKK
                     SLACLAKTPHIEAIFVTRDGQVILSSQRQFTFTPLDDSYRIVAY"
     misc_feature    366703..367599
                     /locus_tag="Rahaq2_4907"
                     /note="Membrane-associated lipoprotein involved in
                     thiamine biosynthesis [Coenzyme metabolism]; Region: ApbE;
                     COG1477"
                     /db_xref="CDD:224394"
     gene            complement(367637..368356)
                     /locus_tag="Rahaq2_4908"
                     /note="IMG reference gene:2506711932"
                     /db_xref="GeneID:11818417"
     CDS             complement(367637..368356)
                     /locus_tag="Rahaq2_4908"
                     /note="PFAM: Response regulator receiver domain"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator of citrate/malate metabolism"
                     /protein_id="YP_005220633.1"
                     /db_xref="GI:379704259"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="GeneID:11818417"
                     /translation="MINVLIVDDDAMVAELNRCYVGQIDGFACCGTASTLQQAKDLVL
                     NSELSIDLILLDVYMQQDNGLDLLPELRNARRPVDVIVISSAADAETIKKSLNYGVVD
                     YLIKPFQFSRFEEALTGWQQKKTLMDNQQYYEQSDVDRLIHGSNPAAADNKKLPKGLT
                     LQTLRTLCQWIDAHPTIEFSTDELATSVNISRVSCRKYLIWLAQMNILFTSIHYGVTG
                     RPVYRYRLQADHYSLLKQYCQ"
     misc_feature    complement(367640..368356)
                     /locus_tag="Rahaq2_4908"
                     /note="DNA-binding transcriptional activator DcuR;
                     Provisional; Region: PRK10430"
                     /db_xref="CDD:182454"
     misc_feature    complement(368006..368344)
                     /locus_tag="Rahaq2_4908"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(368036..368041,368048..368050,
                     368105..368107,368165..368167,368189..368191,
                     368330..368335))
                     /locus_tag="Rahaq2_4908"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(368189..368191)
                     /locus_tag="Rahaq2_4908"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(368165..368173,368177..368182))
                     /locus_tag="Rahaq2_4908"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(368033..368041)
                     /locus_tag="Rahaq2_4908"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(368353..369972)
                     /locus_tag="Rahaq2_4909"
                     /note="IMG reference gene:2506711933"
                     /db_xref="GeneID:11818418"
     CDS             complement(368353..369972)
                     /locus_tag="Rahaq2_4909"
                     /note="PFAM: Histidine kinase-, DNA gyrase B-, and
                     HSP90-like ATPase; PAS fold"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase regulating
                     citrate/malate metabolism"
                     /protein_id="YP_005220634.1"
                     /db_xref="GI:379704260"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="InterPro:IPR016120"
                     /db_xref="InterPro:IPR016121"
                     /db_xref="GeneID:11818418"
                     /translation="MSDSQQRHSVRKHPMKLSTSVSLMISAVIASVLLVVHMLYFVQV
                     SDTTRDGVKDKALAVARTMADLPETKRALLLPPDSNIIQPIASAVQKRNDLLFIVVTN
                     MDGIRYSHPNPDVISHHFIGDDINPALLGNENVSINKGTLDKALRVFTPVYDEHHKQI
                     GVVAIGISLVKVTEQINKSRWSILWTVLFGLMVGALGTYCLVKLLKRILFGLEPYEIS
                     TLFEQRQAMLQSIKEGVIAVDAQAHVTLINQTARQTFRETAIDVMPDADSLPLIANLR
                     DVLNTGVPRRDEEINFKGRLLLSNTVPVRNNGVIIGAICTFRDKTEVSQLMQRLSGMV
                     NYADSLRERSHEFMNKLHVILGLLHMKSYAQLEDYILKTANNYQAEIGSLLLKIKSPV
                     IAGFLLSKINRASDTRHRLTLSDDSLLPDNNNEDQVAALITVLGNLIENALDALGDQP
                     DGEVSVLLHYQNGSLACIVSDDGPGIQPENIDAIFEKGVSSKGDQRGMGLFLAKQQVE
                     SLGGTITVESEPDVYTQFFVQLPWDAERTSS"
     misc_feature    complement(368359..369969)
                     /locus_tag="Rahaq2_4909"
                     /note="sensory histidine kinase DcuS; Provisional; Region:
                     PRK11086"
                     /db_xref="CDD:236839"
     misc_feature    complement(369457..369804)
                     /locus_tag="Rahaq2_4909"
                     /note="Sensory domain of two-component sensor kinase;
                     Region: Cache_3; pfam14827"
                     /db_xref="CDD:258964"
     misc_feature    complement(369016..369282)
                     /locus_tag="Rahaq2_4909"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(369103..369105,369178..369189,
                     369220..369222,369232..369234))
                     /locus_tag="Rahaq2_4909"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(369073..369075,369079..369081,
                     369148..369153,369160..369162,369184..369186))
                     /locus_tag="Rahaq2_4909"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(368809..368997)
                     /locus_tag="Rahaq2_4909"
                     /note="Sensor_kinase_SpoOB-type, alpha-helical domain;
                     Region: SPOB_a; pfam14689"
                     /db_xref="CDD:258827"
     misc_feature    complement(368383..368682)
                     /locus_tag="Rahaq2_4909"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(368395..368397,368401..368406,
                     368419..368421,368425..368427,368473..368484,
                     368545..368550,368554..368556,368560..368562,
                     368566..368568,368641..368643,368650..368652,
                     368662..368664))
                     /locus_tag="Rahaq2_4909"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(368650..368652)
                     /locus_tag="Rahaq2_4909"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(368476..368478,368482..368484,
                     368548..368550,368554..368556))
                     /locus_tag="Rahaq2_4909"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(370213..370530)
                     /locus_tag="Rahaq2_4910"
                     /note="IMG reference gene:2506711934"
                     /db_xref="GeneID:11818419"
     CDS             complement(370213..370530)
                     /locus_tag="Rahaq2_4910"
                     /note="PFAM: Domain of unknown function (DUF3315)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220635.1"
                     /db_xref="GI:379704261"
                     /db_xref="GeneID:11818419"
                     /translation="MRHSKIVMLSALVVSSLLPLANTAFAASNSHEIKSFYDDSKLYS
                     IGDQVPALYRTKPYEIVGWQERHLPAPDAGSHWTYIGGSYALITDTDGKILKAENGDI
                     YFQ"
     misc_feature    complement(370249..>370449)
                     /locus_tag="Rahaq2_4910"
                     /note="Domain of unknown function (DUF3315); Region:
                     DUF3315; cl02275"
                     /db_xref="CDD:261232"
     gene            370897..373305
                     /locus_tag="Rahaq2_4911"
                     /note="IMG reference gene:2506711935"
                     /db_xref="GeneID:11818420"
     CDS             370897..373305
                     /locus_tag="Rahaq2_4911"
                     /note="PFAM: Pyrrolo-quinoline quinone coenzyme
                     N-terminus; Pyrrolo-quinoline quinone coenzyme C-terminus;
                     PQQ enzyme repeat;
                     TIGRFAM: membrane-bound PQQ-dependent dehydrogenase,
                     glucose/quinate/shikimate family"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound PQQ-dependent dehydrogenase"
                     /protein_id="YP_005220636.1"
                     /db_xref="GI:379704262"
                     /db_xref="InterPro:IPR002372"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR019551"
                     /db_xref="InterPro:IPR019556"
                     /db_xref="GeneID:11818420"
                     /translation="MRNERFFSWSFMTGLVTGVIGLAYLVLGVWLAALGGSPWYMLFG
                     SGYLLSGIFIARRHASGIWLYLLTFLLCCVWSVWEVGLDGWQLMPRLFVMALLGVWCS
                     LPLITRQVMATRGNHRTGTFAGLVYVVAIVGIFYSGWQVTGSRFVHRQPVPAQSGDVQ
                     ATSPESNDWRYYGRTEAGQRYSPLTQITPANVSQLKPAWEFHTGDVMRKGEDKDGREF
                     NFEVTPVKVGNSLFICTPHREVIALNATTGAQRWKFDPKSDTSANEYLACRGVAYSQS
                     AGDKVCPEKIIATTSEARMVALNAQTGEPCSSFGQNGFVSLTDHMGDVPPGFHFITSQ
                     PMVMDGRIVLGGWIYDNQSTGEPSGVVRAFDVNTGQLAWAWDMGRDPQNAPLKPGEVY
                     TRGTPNGWGTYTGDPKLGLVYIPLGNATPDYYGAGRRPFDEKYSSSLVALDIHTGEER
                     WHFQTVHHDVWDFDLPIGPTLVDLPSPEGITVPALVQTTKMGQLFLLDRRTGKPLAQV
                     NEKPVNTSPSLPGEHLSPTQPDSVGMPSLSPPDLKETDAWGATPIDQLYCRIQFKSAR
                     YQGQFTPPAEGKSIAYPAFDGVMDWYGASVDPIRHVLIANTSYIPFTMELKKSADAIK
                     EGLMHKWAGWGSNQPYPKPKEFSVGPQYGTPWAAIVKPWLSFLQAPCNAPPWGKLVAV
                     DLTARKIAWERPAGTTRDMNIFGTHTNVPLPTGIFMMGGNIITQSGLIFTGATADNYF
                     RAFDETTGNELWRARLPAGGQATPMTYTGDDGRQFVVIAAGGHGGLGTTSGDALVAYA
                     LPAR"
     misc_feature    370924..371337
                     /locus_tag="Rahaq2_4911"
                     /note="Colicin V production protein; Region: Colicin_V;
                     pfam02674"
                     /db_xref="CDD:251465"
     misc_feature    370984..373296
                     /locus_tag="Rahaq2_4911"
                     /note="membrane-bound PQQ-dependent dehydrogenase,
                     glucose/quinate/shikimate family; Region: PQQ_membr_DH;
                     TIGR03074"
                     /db_xref="CDD:234101"
     misc_feature    371401..373293
                     /locus_tag="Rahaq2_4911"
                     /note="Membrane-bound PQQ-dependent glucose dehydrogenase;
                     Region: PQQ_mGDH; cd10280"
                     /db_xref="CDD:199838"
     misc_feature    order(371476..371484,371491..371493,371620..371622,
                     371626..371628,371635..371643,371650..371652,
                     371785..371787,371791..371793,371800..371808,
                     371815..371817,371983..371985,371989..371991,
                     371998..372006,372013..372015,372217..372219,
                     372223..372225,372232..372240,372247..372249,
                     372382..372384,372388..372390,372397..372405,
                     372412..372414,372937..372939,372943..372945,
                     372952..372960,372967..372969,373120..373122,
                     373126..373128,373135..373143,373150..373152,
                     373282..373284,373288..373290)
                     /locus_tag="Rahaq2_4911"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199838"
     misc_feature    order(371557..371559,371686..371691,371701..371703,
                     371890..371892,371935..371940,372094..372096,
                     372364..372366,373051..373053)
                     /locus_tag="Rahaq2_4911"
                     /note="putative active site [active]"
                     /db_xref="CDD:199838"
     gene            373411..374316
                     /locus_tag="Rahaq2_4912"
                     /note="IMG reference gene:2506711936"
                     /db_xref="GeneID:11818421"
     CDS             373411..374316
                     /locus_tag="Rahaq2_4912"
                     /note="PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005220637.1"
                     /db_xref="GI:379704263"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11818421"
                     /translation="MNNKTIPTSLNEPHVDAYPTPPFEHQKQPFPGLASKMNPVPDHG
                     EKTYKGSARLEGRKALITGGDSGIGRAVAIAFAREGAQVAINYLPDEEADAKEVIDLL
                     WAEGRKVIAIPGDIRDEKFCQQLVKEAEEKLGGLDLLVNNAGRQQFCDSIKDLTTEAF
                     DATFKTNVYAMFWITKAALEFIPRGGAIINTTSVQAFSPSDNLLDYSSTKASIMAFTK
                     GLAKQLAGDGIRVNGVAPGPYWTPLQISGGQPQEKIESFGQQAPLKRPGQPAEIAPLY
                     VTLASNENSYASGQVWCSDGGTGTV"
     misc_feature    373462..374307
                     /locus_tag="Rahaq2_4912"
                     /note="oxidoreductase; Provisional; Region: PRK06128"
                     /db_xref="CDD:180413"
     misc_feature    373501..374304
                     /locus_tag="Rahaq2_4912"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(373597..373599,373603..373608,373612..373614,
                     373669..373677,373834..373842,373981..373989,
                     374026..374028,374038..374040,374116..374127)
                     /locus_tag="Rahaq2_4912"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(373909..373911,373987..373989,374026..374028,
                     374038..374040)
                     /locus_tag="Rahaq2_4912"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            374531..374956
                     /locus_tag="Rahaq2_4913"
                     /note="IMG reference gene:2506711937"
                     /db_xref="GeneID:11818422"
     CDS             374531..374956
                     /locus_tag="Rahaq2_4913"
                     /note="PFAM: Predicted membrane protein (DUF2231)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220638.1"
                     /db_xref="GI:379704264"
                     /db_xref="InterPro:IPR016923"
                     /db_xref="InterPro:IPR019251"
                     /db_xref="GeneID:11818422"
                     /translation="MQTHPISPRRGVAVALYELLNPVPLGFFVAAWIFDILYMKTFIT
                     MWTDAASWLIVFGLIIAIIPRLINLAQVWTGGKTPAGSPVKTHFWLNLLAVLLAIFNA
                     FIHSRDAYAVVPMGVMLSTLVVVLLLLGNVQLALRARTV"
     misc_feature    374573..>374872
                     /locus_tag="Rahaq2_4913"
                     /note="Predicted membrane protein (DUF2231); Region:
                     DUF2231; cl01730"
                     /db_xref="CDD:242671"
     gene            374969..376273
                     /locus_tag="Rahaq2_4914"
                     /note="IMG reference gene:2506711938"
                     /db_xref="GeneID:11818423"
     CDS             374969..376273
                     /locus_tag="Rahaq2_4914"
                     /note="PFAM: Glucose / Sorbosone dehydrogenase; Membrane
                     bound L-sorbosone dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose/sorbosone dehydrogenase"
                     /protein_id="YP_005220639.1"
                     /db_xref="GI:379704265"
                     /db_xref="InterPro:IPR011041"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR012938"
                     /db_xref="GeneID:11818423"
                     /translation="MKNYQRALLALTLAALLSSCDDSSQIDPNKQTGADPELPKAQNF
                     LMPPMKVPEGIPWKTGEMPKVADGLKIEKIADGLKHPRQVYVLPNNDVLVAESNGPAK
                     KPIFRPKQLIMGLVQKSSGKGGEGGNSITLLRYTGGKWEKHLFITGVNAPFGIQLTGN
                     RLWVASADSLIKYPYQEGETQITAPGEVVTELPGGPINHHWTKSLLASPDGSKLYVGV
                     GSNSNITENGIGAEDRRAAILEVDAATGASRIFASGLRNPTGLQWEPESGKLWAVVNE
                     RDEIGSDLVPDYMTSVQEHGFYGWPYSYFGQHVDERVKPPRPDLVEKAIKPDYAISSH
                     VAPLGLLFYTGDNMAQYRGGAFVSEHGSWNRKPLNGYQVMWVKFENGKPVGLPQPVVT
                     GFLTDDQKQVRGLPVGLAMDKQGGVLIADDAGNSIWRVSKAE"
     misc_feature    375059..376267
                     /locus_tag="Rahaq2_4914"
                     /note="Glucose/sorbosone dehydrogenases [Carbohydrate
                     transport and metabolism]; Region: COG2133"
                     /db_xref="CDD:225044"
     misc_feature    375380..376081
                     /locus_tag="Rahaq2_4914"
                     /note="dehydrogenase, PQQ-dependent, s-GDH family; Region:
                     non_repeat_PQQ; cl19645"
                     /db_xref="CDD:267998"
     gene            376541..376762
                     /locus_tag="Rahaq2_4915"
                     /note="IMG reference gene:2506711939"
                     /db_xref="GeneID:11818424"
     CDS             376541..376762
                     /locus_tag="Rahaq2_4915"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220640.1"
                     /db_xref="GI:379704266"
                     /db_xref="GeneID:11818424"
                     /translation="MPDITIVCGQCGSDRFVAAVNTPLAEIVHSLVCAECQHPVPVNE
                     VVIFREGMYISGSYDTFPAGPGKLYNFDI"
     gene            complement(376834..377745)
                     /locus_tag="Rahaq2_4916"
                     /note="IMG reference gene:2506711940"
                     /db_xref="GeneID:11818425"
     CDS             complement(376834..377745)
                     /locus_tag="Rahaq2_4916"
                     /note="PFAM: Helix-turn-helix domain, rpiR family; SIS
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220641.1"
                     /db_xref="GI:379704267"
                     /db_xref="InterPro:IPR000281"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818425"
                     /translation="MATTPVKKRIDVFGERYRARASTLSPGLQAVASYIQNNRESVLE
                     ATAMDIAAATDVSDATVVRAVQALGFAGLRDMKQTLEAWFGTAVNSEEKMITTVSELA
                     SDINSGISFVLDGHKRACDALAEPANRQAISEAIALLINARQVAVFGLNASGILADYS
                     TRLFTRIGIPAVSLNRSGIALAEQLINLQRGDVLIMMAQKSAHREGRTAIQEAKRLSI
                     PLILLTNASDSFFAKQADIVINVPRGGENGRMPLHGTVLVCLEMLILSVASATASRTM
                     KTMKRIQDLNQSLKSANKIRKLQDGVA"
     misc_feature    complement(376873..377703)
                     /locus_tag="Rahaq2_4916"
                     /note="Transcriptional regulators [Transcription]; Region:
                     RpiR; COG1737"
                     /db_xref="CDD:224651"
     misc_feature    complement(377503..377703)
                     /locus_tag="Rahaq2_4916"
                     /note="Helix-turn-helix domain, rpiR family; Region:
                     HTH_6; pfam01418"
                     /db_xref="CDD:201784"
     misc_feature    complement(376999..377358)
                     /locus_tag="Rahaq2_4916"
                     /note="RpiR-like protein. RpiR contains a SIS (Sugar
                     ISomerase) domain, which is found in many phosphosugar
                     isomerases and phosphosugar binding proteins. In E. coli,
                     rpiR negatively regulates the expression of rpiB gene.
                     Both rpiB and rpiA are ribose phosphate...; Region:
                     SIS_RpiR; cd05013"
                     /db_xref="CDD:240144"
     misc_feature    complement(order(377152..377154,377287..377289))
                     /locus_tag="Rahaq2_4916"
                     /note="putative active site [active]"
                     /db_xref="CDD:240144"
     gene            378030..380216
                     /locus_tag="Rahaq2_4917"
                     /note="IMG reference gene:2506711941"
                     /db_xref="GeneID:11818426"
     CDS             378030..380216
                     /locus_tag="Rahaq2_4917"
                     /note="PFAM: TonB-dependent Receptor Plug Domain; TonB
                     dependent receptor;
                     TIGRFAM: TonB-dependent siderophore receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="YP_005220642.1"
                     /db_xref="GI:379704268"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:11818426"
                     /translation="MIINCIMGIDVIFNTGFTEMNNNKLFDFKRKSHPAILAAIYGVA
                     MLTPVSGHSAGENDTLTITGQGADDGGYSAGTSSVASKIPTPRLNEAQSVSVVTRQQL
                     DDYQATSLSDAMRFVSGVSEGNTLAGTEDGFVRRGFGSNSDGSIYRDGVRSSQGLNFD
                     ATTERVEVLKGSASLLYGIQNPGGVINLVSKKPQYDWHTKVSGRYASEGGGAGTVDVT
                     GPLGNGFALRMIAEKQDQDYWRNFGSDKHTLISPSLQWYGEKASFLISYSDYRYDIPY
                     DRGTAFINGKAIDIGYKNRLDDKSNRAWGHNKTLNAHYDWQFSDDWSTRLTVGWNQRR
                     YNNDEVRVTAVNTTTGAVTRRADANRGFNHKTKYVSWDLLGSQDILGMNHDLVLGTDY
                     EMNQTYRAHQYQGKANSSFNYFDPQYDILSPVANSTTENTANGNNLNRIHSRSVYAKD
                     SISLTSDWIAVLGGRYQHYEQRASKGFDPVVQTLDSEGNKFLPQAGLIYKVTPDVSLY
                     SSVSKSFTPSTDVDDDGNVGKPEQGTTWEVGSKWQMTPRMFASVALYRIDERDMSLSI
                     NGETRAIDKARSSGAEFELNGEILPDWEVSASYSYDKAEIVDDGENAANNGNRLQNAP
                     RHSGALYLSHNLVINGLPGDFRIGGGARYVGTRAGDPENSFTLPDYTVADSFVAWNNR
                     LFGEKTQLKLNLNNLFNKHYYTSSGGNLRVREGETRNLMVQASVEF"
     misc_feature    378300..380213
                     /locus_tag="Rahaq2_4917"
                     /note="TonB-dependent siderophore receptor; Region:
                     TonB-siderophor; TIGR01783"
                     /db_xref="CDD:233575"
     misc_feature    378306..380213
                     /locus_tag="Rahaq2_4917"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(378306..378335,378363..378392,378426..378443,
                     378465..378485,378519..378539,378573..378599)
                     /locus_tag="Rahaq2_4917"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    order(379032..379034,379113..379115)
                     /locus_tag="Rahaq2_4917"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            380206..381360
                     /locus_tag="Rahaq2_4918"
                     /note="IMG reference gene:2506711942"
                     /db_xref="GeneID:11818427"
     CDS             380206..381360
                     /locus_tag="Rahaq2_4918"
                     /note="PFAM: Periplasmic binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe3+-hydroxamate ABC transporter periplasmic
                     protein"
                     /protein_id="YP_005220643.1"
                     /db_xref="GI:379704269"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:11818427"
                     /translation="MNSDLWFTPGAHPVRIRAVMTMLFMLLLTLTGFGVQARTVTDID
                     GNHVDIPDNPQRIVLGESRMLYTLALLETGDPVKRIVGWPLDLKKYDSQTWNIFAQRF
                     PQMLAIPSLGLGGTNDMNPEKVLALKPDLVILPSLARYDDADLRLNAMLKAAHIPVVK
                     VDLRVHLLKNTTRSVNILGEVLNQTARAQAFNHFYDAHMQVIHDRLAAYSGHKPTVLL
                     QLHLGRRNECCVTAVKGSLGELLNFAGGDNIASKTVQGVFGRLNEETVIMAQPEVYFA
                     TGAGSAEDQNDLKLGPAITLEMAQHSLQELTARQNGLRELKALHNGRTGMIWQNFYLS
                     PWHVAATEFMAKTLYPDVFADIEPEQTLKQIFHDYLPIPYSGTYFAHGSP"
     misc_feature    380311..381270
                     /locus_tag="Rahaq2_4918"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    380320..381342
                     /locus_tag="Rahaq2_4918"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    order(380650..380655,380662..380664,380743..380745)
                     /locus_tag="Rahaq2_4918"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            381625..383178
                     /locus_tag="Rahaq2_4919"
                     /note="IMG reference gene:2506711943"
                     /db_xref="GeneID:11818428"
     CDS             381625..383178
                     /locus_tag="Rahaq2_4919"
                     /note="PFAM: POT family;
                     TIGRFAM: amino acid/peptide transporter (Peptide:H+
                     symporter), bacterial"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid/peptide transporter (peptide:H
                     symporter)"
                     /protein_id="YP_005220644.1"
                     /db_xref="GI:379704270"
                     /db_xref="InterPro:IPR000109"
                     /db_xref="InterPro:IPR005279"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018456"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818428"
                     /translation="MHSSVNKNESRTFFGHPYPLGSLFFTEMWERFSFYGIRPLLILF
                     MAATVYDGGMGLARENASAIVGIFAGCMYLAALPGGWLADNWLGQQRAVWYGSILIAL
                     GHLSIALSAFMGDSLFFIGLMFIVLGSGLFKTCISVMVGTLYKKGDARRDGGFSLFYM
                     GINMGSFIAPLISGWLIKTHGWHWGFGIGGIGMLVALIIFRLYAVPAMKRYDSEVGLD
                     STWNSPVAKKNGVGVWLLALAAGVAVIVALISQGVIVINPVAVASVLVYVIAASVALY
                     FIYLFLFAGLNRKERARLLVCFILLVSAAFFWSAFEQKPTSFNLFANDYTNRMIGDFE
                     IPAVWFQSINALFIILLAPVFSWAWPLLARKNVRPSSITKFIIGILCAAAGFGIMMMA
                     AQNVLNSGGAGVSPLWLVGSILMLTLGELCLSPIGLATMTLLAPERMRGQMMGLWFCA
                     SALGNLAAGLIGGHVKADQLDMLPDLFARCSIALLICAAVLFVLIIPVRRMLENAQSK
                     TEQKPVTHA"
     misc_feature    381652..383133
                     /locus_tag="Rahaq2_4919"
                     /note="Dipeptide/tripeptide permease [Amino acid transport
                     and metabolism]; Region: PTR2; COG3104"
                     /db_xref="CDD:225646"
     misc_feature    381652..383130
                     /locus_tag="Rahaq2_4919"
                     /note="POT family; Region: PTR2; cl17359"
                     /db_xref="CDD:266649"
     misc_feature    381691..>382233
                     /locus_tag="Rahaq2_4919"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(381724..381726,381733..381741,381745..381750,
                     381817..381819,381826..381831,381838..381840,
                     381850..381855,381859..381864,382009..382014,
                     382021..382026,382033..382038,382045..382047,
                     382087..382092,382099..382104,382120..382122)
                     /locus_tag="Rahaq2_4919"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(383248..383679)
                     /locus_tag="Rahaq2_4920"
                     /note="IMG reference gene:2506711944"
                     /db_xref="GeneID:11818429"
     CDS             complement(383248..383679)
                     /locus_tag="Rahaq2_4920"
                     /note="PFAM: ArsC family;
                     TIGRFAM: arsenate reductase (glutaredoxin)"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin-dependent arsenate reductase"
                     /protein_id="YP_005220645.1"
                     /db_xref="GI:379704271"
                     /db_xref="InterPro:IPR006660"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="GeneID:11818429"
                     /translation="MSNITIYHNPACGTSRNTLELIRNSGAEPAIILYLETPPAREEL
                     VTLIADMGITVRALLRKNVGPYEQLKLADNHFSDDQLIDFMLQYPILINRPVVVTPLG
                     TRLCRPSEEVLAILPDEQRGAFTKEDGEAVIDESGKRITKI"
     misc_feature    complement(383335..383670)
                     /locus_tag="Rahaq2_4920"
                     /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
                     arsenic reductases similar to that encoded by arsC on the
                     R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
                     the reduction of arsenate [As(V)] to arsenite [As(III)],
                     the first step in the...; Region: ArsC_ArsC; cd03034"
                     /db_xref="CDD:239332"
     misc_feature    complement(order(383359..383361,383398..383400,
                     383500..383502,383644..383646))
                     /locus_tag="Rahaq2_4920"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239332"
     gene            complement(383731..385020)
                     /locus_tag="Rahaq2_4921"
                     /note="IMG reference gene:2506711945"
                     /db_xref="GeneID:11818430"
     CDS             complement(383731..385020)
                     /locus_tag="Rahaq2_4921"
                     /note="PFAM: Arsenical pump membrane protein;
                     TIGRFAM: arsenical pump membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical pump membrane protein"
                     /protein_id="YP_005220646.1"
                     /db_xref="GI:379704272"
                     /db_xref="InterPro:IPR000802"
                     /db_xref="GeneID:11818430"
                     /translation="MWLAGTIFLLTLILVIWQPRGLGIGWGAMLGAGLALLTGVVHPS
                     DIPVVWQIVWNATATFIAVIIISLLLDESGFFEWAALHVARWGNGRGRLLFTWIILLG
                     AMVAALFANDGAALILTPIVMAMLLALGFSRGATLAFVMAAGFIADVASLPLIVSNLV
                     NIVSADFFNLGFTEYAAVMGPVNLAAIATTLVMLHLFFRQDIPPVYDISLLKRPEEAI
                     RDAGTFKAGWLVLILLLAGFFGLEPLGVPVSLVAAIGALILYVIARKGHAINTGKVLR
                     GAPWQIVIFSLGMYLVVYGLRNAGLTHTLSALLNQLAEQGLWASTLGTGFLTAFLSSI
                     MNNMPTVLIGALSIEGSSATGVIREAMIYANVIGSDLGPKITPIGSLATLLWLHVLSQ
                     KNMTITWGYYFRVGIVMTLPVLFVTLAALALRLSVVL"
     misc_feature    complement(383755..385014)
                     /locus_tag="Rahaq2_4921"
                     /note="Anion permease ArsB.  These permeases have been
                     shown to export arsenate and antimonite in eubacteria and
                     archaea.  A typical ArsB permease contains 8-13
                     transmembrane helices and can function either
                     independently as a chemiosmotic transporter or as a...;
                     Region: ArsB_permease; cd01118"
                     /db_xref="CDD:238538"
     misc_feature    complement(383914..384999)
                     /locus_tag="Rahaq2_4921"
                     /note="Citrate transporter; Region: CitMHS; pfam03600"
                     /db_xref="CDD:252049"
     misc_feature    complement(order(383764..383802,383878..383937,
                     384016..384063,384133..384189,384232..384276,
                     384307..384345,384433..384477,384541..384612,
                     384631..384684,384688..384738,384808..384861,
                     384910..384951,384970..384981))
                     /locus_tag="Rahaq2_4921"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238538"
     gene            complement(385065..385385)
                     /locus_tag="Rahaq2_4922"
                     /note="IMG reference gene:2506711946"
                     /db_xref="GeneID:11818431"
     CDS             complement(385065..385385)
                     /locus_tag="Rahaq2_4922"
                     /note="PFAM: Bacterial regulatory protein, arsR family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005220647.1"
                     /db_xref="GI:379704273"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018334"
                     /db_xref="GeneID:11818431"
                     /translation="MLQPVQLFKLLADETRATIVMLLRESGELCVCDICAATAESQPK
                     ISRHLALLREAGLVTDRREGKWVHYRLSPQMPAWSATIIDSAWNCDRENIRHKLNNKS
                     PVSC"
     misc_feature    complement(385167..385364)
                     /locus_tag="Rahaq2_4922"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(385218..385220,385311..385313,
                     385320..385325,385332..385337,385344..385346,
                     385353..385355,385359..385364))
                     /locus_tag="Rahaq2_4922"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(385179..385187,385200..385208,
                     385224..385229,385233..385238,385245..385250,
                     385254..385265,385290..385298,385338..385346,
                     385356..385361))
                     /locus_tag="Rahaq2_4922"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(385287..385289,385296..385298))
                     /locus_tag="Rahaq2_4922"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(385538..385711)
                     /locus_tag="Rahaq2_4923"
                     /note="IMG reference gene:2506711947"
                     /db_xref="GeneID:11818432"
     CDS             complement(385538..385711)
                     /locus_tag="Rahaq2_4923"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220648.1"
                     /db_xref="GI:379704274"
                     /db_xref="GeneID:11818432"
                     /translation="MINSGDVWSSREKKHSLIIEIKVNRSGNGETFPPATQCQVRQDK
                     GQILSECGVYYRI"
     gene            385767..387041
                     /locus_tag="Rahaq2_4924"
                     /note="IMG reference gene:2506711948"
                     /db_xref="GeneID:11818433"
     CDS             385767..387041
                     /locus_tag="Rahaq2_4924"
                     /note="PFAM: Uncharacterised BCR, COG1649"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220649.1"
                     /db_xref="GI:379704275"
                     /db_xref="InterPro:IPR003790"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11818433"
                     /translation="MAFALLLASCSSTPPKSLVTPLPPVTKHPLPGQPVLSHEPVRGV
                     WLATVSRLDWPPVNSVNTGSTSLRISQQQQALTAKLDKLKSLGINTVFFQVKPDGTAF
                     WPSKILPWSDMLTGKIGQDPGYDPLQFMLDEAHKRGMKVHAWFNPYRVSVNTKSSTVA
                     ELNQTLPLHPASVFVLHRDWIRTSGDRFVVDPGIPEARDWITSIVAEVVARYPVDGVQ
                     FDDYFYSESPGSALDDSLTFRKYGQGYASKADWRRHNTQQLIEQVSRTIKQLKPGVEF
                     GVSPAGVWRNVSHDPAGSQTSGAAAYDEAYADTRLWVQQGLLDYIAPQLYWPFSRKAA
                     RYDVLANWWANVVKPTHTRLYIGVALYKVGEPSKNEPDWTVSGGVPELKKQLDMNESV
                     SQINGTILFRENYLNQPQTQDAVRYLKSRWGS"
     misc_feature    385767..387035
                     /locus_tag="Rahaq2_4924"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1649"
                     /db_xref="CDD:224563"
     gene            complement(387109..387696)
                     /locus_tag="Rahaq2_4925"
                     /note="IMG reference gene:2506711949"
                     /db_xref="GeneID:11818434"
     CDS             complement(387109..387696)
                     /locus_tag="Rahaq2_4925"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220650.1"
                     /db_xref="GI:379704276"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:11818434"
                     /translation="MRFIEKNPQGRKPLTLSLDEEKETPPEYERHAMNFSLFTDNHEN
                     VAAGRCSVQSESGSSDYLYISAIYVEGNTNTPTKSNPNRFIGLGQILLFSAIRYGLEL
                     NIENASLLPVDDSQGFYLKMGFHPNIAGSVNRMDTTGVSLSSGSGKLNAQWVNRFAHA
                     SFLNRHFRGSNWTGNIRNIHLNLRQKVMNNWTIIA"
     misc_feature    complement(387322..387579)
                     /locus_tag="Rahaq2_4925"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            387950..388285
                     /locus_tag="Rahaq2_4926"
                     /note="IMG reference gene:2506711950"
                     /db_xref="GeneID:11818435"
     CDS             387950..388285
                     /locus_tag="Rahaq2_4926"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220651.1"
                     /db_xref="GI:379704277"
                     /db_xref="GeneID:11818435"
                     /translation="MRRIALLLTLMIAGPAVAEDTTAQHTPATYINILCSSALNKPDG
                     TAAYFREQIKDVSTQSQSPSSINKTEFDEDEADKVIQTWTSLSKADREKVKTQQQCQD
                     TLHKRYQEG"
     gene            388531..389163
                     /locus_tag="Rahaq2_4927"
                     /note="IMG reference gene:2506711951"
                     /db_xref="GeneID:11818436"
     CDS             388531..389163
                     /locus_tag="Rahaq2_4927"
                     /codon_start=1
                     /transl_table=11
                     /product="cAMP-binding protein"
                     /protein_id="YP_005220652.1"
                     /db_xref="GI:379704278"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="GeneID:11818436"
                     /translation="MVTESDKGKDLSRATAELLAELIPYLQFRTVPAGSRFYLYENGE
                     FHCYFIRKGWFKTFHNDEPVLIGVISVPGIIGIGGAVPADAKMFIQAQDEGEIARATV
                     AEMHALIERLDLWEALTKHLLRMTNKLYVKSTLLTAPTSYEILRHQLMELMNEPPEIR
                     ENIPAAHYIQLKTHLSRSTIMKVLSQLKLGGYLRLDNGILKEVIRLPLKY"
     misc_feature    388561..388863
                     /locus_tag="Rahaq2_4927"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cl00047"
                     /db_xref="CDD:260155"
     misc_feature    388576..389130
                     /locus_tag="Rahaq2_4927"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    <388714..389160
                     /locus_tag="Rahaq2_4927"
                     /note="putative DNA-binding transcriptional regulator;
                     Provisional; Region: PRK11832"
                     /db_xref="CDD:183332"
     misc_feature    order(388756..388761,388786..388794)
                     /locus_tag="Rahaq2_4927"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    388849..388857
                     /locus_tag="Rahaq2_4927"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     gene            complement(389220..389606)
                     /locus_tag="Rahaq2_4928"
                     /note="IMG reference gene:2506711952"
                     /db_xref="GeneID:11818437"
     CDS             complement(389220..389606)
                     /locus_tag="Rahaq2_4928"
                     /note="PFAM: YebG protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220653.1"
                     /db_xref="GI:379704279"
                     /db_xref="InterPro:IPR009813"
                     /db_xref="GeneID:11818437"
                     /translation="MAVETKFVVVRKGEEKMTFANKKEADAYDKMLDMADAFTEWLLQ
                     SNIDMDETLAENIALHLAEQKDTVQHILRTSKLPEAESAPQPAAETSTQAADVAENVV
                     IEETVAEEIVAEKPAAAKKVRTVKAA"
     misc_feature    complement(389385..389603)
                     /locus_tag="Rahaq2_4928"
                     /note="YebG protein; Region: YebG; pfam07130"
                     /db_xref="CDD:254067"
     gene            389730..389869
                     /locus_tag="Rahaq2_4929"
                     /note="IMG reference gene:2506711953"
                     /pseudo
                     /db_xref="GeneID:11818438"
     gene            389930..390619
                     /locus_tag="Rahaq2_4930"
                     /note="IMG reference gene:2506711954"
                     /db_xref="GeneID:11818439"
     CDS             389930..390619
                     /locus_tag="Rahaq2_4930"
                     /note="PFAM: B3/4 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220654.1"
                     /db_xref="GI:379704280"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR020825"
                     /db_xref="GeneID:11818439"
                     /translation="MIVVNPSLDPTLARIAPGFRVLSISAQAAPIINPALAQETLQNA
                     CRFVLENDFSWTDEHLSAWGEVFKAFGAKPKRTPCSADALRKRVLKDGTMPAIDPVVD
                     LYNAVSIQYAIPVGGENISAYIGHPLLTFATGSEPFDTLKAGEPVMESPDAGEVIWRD
                     DAGVTCRRWNWRQGIRTRLDSDAQNMWFILESLPAMPLQALHDAGDMLIHGLEQMMPG
                     VQTDVKLITLP"
     misc_feature    389945..390595
                     /locus_tag="Rahaq2_4930"
                     /note="Solo B3/4 domain (OB-fold DNA/RNA-binding) of
                     Phe-aaRS-beta [General function prediction only]; Region:
                     COG3382"
                     /db_xref="CDD:225917"
     gene            complement(390632..391030)
                     /locus_tag="Rahaq2_4931"
                     /note="IMG reference gene:2506711955"
                     /db_xref="GeneID:11818440"
     CDS             complement(390632..391030)
                     /locus_tag="Rahaq2_4931"
                     /note="TIGRFAM: conserved hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220655.1"
                     /db_xref="GI:379704281"
                     /db_xref="GeneID:11818440"
                     /translation="MSTHPIRQVIEACDKAISVRDFDALMAHYAEDAALVIKPGMIAR
                     GKTDIRKAFVAISDYFQDQLVVEQGEMQVIEGADDALVIMETVLHFPDGQGGKVTTTR
                     RATYVFRHEPDGRWLCTIDNSYGTSLLDKE"
     misc_feature    complement(390653..391015)
                     /locus_tag="Rahaq2_4931"
                     /note="Ketosteroid isomerase homolog [Function unknown];
                     Region: COG4319"
                     /db_xref="CDD:226769"
     gene            complement(391034..391759)
                     /locus_tag="Rahaq2_4932"
                     /note="IMG reference gene:2506711956"
                     /db_xref="GeneID:11818441"
     CDS             complement(391034..391759)
                     /locus_tag="Rahaq2_4932"
                     /note="PFAM: Sulfite exporter TauE/SafE"
                     /codon_start=1
                     /transl_table=11
                     /product="putative permease"
                     /protein_id="YP_005220656.1"
                     /db_xref="GI:379704282"
                     /db_xref="InterPro:IPR002781"
                     /db_xref="GeneID:11818441"
                     /translation="MYVVIGLTGILAGVISGIVGTGSSIMLLPALTYTFGPKTAIPVM
                     AISAIVGNISRVILWRKDINIRAFLLYAVPGIPAAILGANTLWEMPARLSNICIGTFF
                     FLLIPLRHYARCRAFTLSSMQLALAGALTGFLTGVVFSTGPLTIPVFAGFGLVKGALL
                     STEAAASFAIYFAKASTFSAIGAMPWPVLFSGLLVGSTLAAGMLIGKKFVIKMSETYF
                     NRLIDILLFLAGISLFWNSAKGD"
     misc_feature    complement(391061..391747)
                     /locus_tag="Rahaq2_4932"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            391867..392757
                     /locus_tag="Rahaq2_4933"
                     /note="IMG reference gene:2506711957"
                     /db_xref="GeneID:11818442"
     CDS             391867..392757
                     /locus_tag="Rahaq2_4933"
                     /note="PFAM: LysR substrate binding domain; Bacterial
                     regulatory helix-turn-helix protein, lysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005220657.1"
                     /db_xref="GI:379704283"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:11818442"
                     /translation="MHALPPITALRAFLVACHAGSFTAAAQELCITHGAVSRHIQVVE
                     KWFGVNLFSKEGQRRVPTPYALKLARELGSAFDTLSDIALRYGNGGRNNVFNVSVPTT
                     MSLKWLLPRLDDFYTQFPEANLQISTANTEQLHIVGHYDLLIRRETGATEYSAIPFLA
                     DTHCLMASPALLGRFQLKTPEDVLKCPRIETLTRPGHWNMWLAAAGLEKTPVSGLRRY
                     DHFHVSLHAMLEGIGVGLGPVRTLSAEIRRGNLVLLFPQITVAPCHYHALTPAGVQKT
                     LLHQAFERWLVAQGECGDQS"
     misc_feature    391876..392733
                     /locus_tag="Rahaq2_4933"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    391885..392061
                     /locus_tag="Rahaq2_4933"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    392146..392724
                     /locus_tag="Rahaq2_4933"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(392191..392196,392200..392205,392212..392214,
                     392224..392226,392230..392250,392509..392526,
                     392542..392547,392551..392556)
                     /locus_tag="Rahaq2_4933"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(392748..394418)
                     /locus_tag="Rahaq2_4934"
                     /note="IMG reference gene:2506711958"
                     /db_xref="GeneID:11818443"
     CDS             complement(392748..394418)
                     /locus_tag="Rahaq2_4934"
                     /note="PFAM: Trehalase"
                     /codon_start=1
                     /transl_table=11
                     /product="neutral trehalase"
                     /protein_id="YP_005220658.1"
                     /db_xref="GI:379704284"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR018232"
                     /db_xref="GeneID:11818443"
                     /translation="MQNAKYQTNQNAMFDSENADSEETRLTELEPIELILDRMMDAEP
                     EPEMIEGLPPSDALTPADRYLELFTSVQSSGLFEDSKTFPDCPPKMDPLDILLRYRRI
                     KKHPGFDLKRFVDAHFWLPEHRDDEYVSDPGDSLKEHIDKLWPVLTRQPEDHVPWSSL
                     MPLPQAYVVPGGRFSETYYWDSYFSMLGLAESGRNDLLRTMADNFAWIIEMYGHIPNG
                     NRTYYLSRSQPPVFALMVELFEEDGVRGARRYLDHLKMEYEFWMDGAESLAPNQAYRH
                     AVCLPDGTLLNRYWDDRDTPRDESWREDVETARQSGRPANEVYRDLRAGAESGWDYSS
                     RWLRDGHRLASIRTTQFIPVDLNAFLHKLESAIANISGLKGDKITETLFRRKAETRRE
                     AINRYLWDDNEGCFRDYDWHRQQMALFSAASVVPLYVGLASHYQAERLSEVVRARLLT
                     PGGIMATEYETGEQWDKPNGWAPLQWMAIQGFKQYGNDVLGDEIARNWLKTVNQYYQQ
                     HHKLIEKYHISGGTPREGGGGEYPLQDGFGWTNGVVRRLIGLYGENYD"
     misc_feature    complement(392760..394418)
                     /locus_tag="Rahaq2_4934"
                     /note="Trehalase; Region: Trehalase; cl17346"
                     /db_xref="CDD:266637"
     misc_feature    complement(392760..394343)
                     /locus_tag="Rahaq2_4934"
                     /note="Neutral trehalase [Carbohydrate transport and
                     metabolism]; Region: TreA; COG1626"
                     /db_xref="CDD:224541"
     gene            complement(394447..395853)
                     /locus_tag="Rahaq2_4935"
                     /note="IMG reference gene:2506711959"
                     /db_xref="GeneID:11818444"
     CDS             complement(394447..395853)
                     /locus_tag="Rahaq2_4935"
                     /note="PFAM: Glycosyltransferase family 20;
                     TIGRFAM: alpha,alpha-trehalose-phosphate synthase
                     [UDP-forming]"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-forming alpha,alpha-trehalose-phosphate
                     synthase"
                     /protein_id="YP_005220659.1"
                     /db_xref="GI:379704285"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="GeneID:11818444"
                     /translation="MSRLVVVSNRIAIPDGSKSAGGLAVGILDALKNTSGLWFGWNGE
                     ISEISGEEEDDLNLTEDDGITYASVPLNQNDYDLYYCQFSNAVLWPALHYRIDLVDFQ
                     REAWDGYCRVNDMLAKRLQPLIKADDILWIHDYHLLPFAAALRKLGVKNRIGFFLHIP
                     FPTPEIFNAVPTHDELLEMMCEYDLLGFQTEGDRLAFLDNLKALTDIKDCDAHQHQAF
                     GKTFATGVYPISIAPESIREMAEGPLPPKMAAMEREIRESKNIISCERLDYTKGLPER
                     FLAFEALLEKFPQHRGKVRYSQIAPTSRGDVQAYQELRHQLETEVGRINGKYGGINQT
                     PLFYLNQHFQRSLLMKLFRLTDVGLVTPLRDGMNLVAKEYVAAQDPQDPGVLVLSQFA
                     GAANELTSALIVNPYDRDDVAAALDKALTMPLEERLERYNDMMAVLRKNDIANWGETY
                     LRDLYAVSPHGEKHRAVV"
     misc_feature    complement(394489..395847)
                     /locus_tag="Rahaq2_4935"
                     /note="Trehalose-6-Phosphate Synthase (TPS) is a
                     glycosyltransferase that catalyses the synthesis of
                     alpha,alpha-1,1-trehalose-6-phosphate from
                     glucose-6-phosphate using a UDP-glucose donor. It is a key
                     enzyme in the trehalose synthesis pathway. Trehalose is
                     a...; Region: GT1_TPS; cd03788"
                     /db_xref="CDD:99963"
     misc_feature    complement(394489..395847)
                     /locus_tag="Rahaq2_4935"
                     /note="alpha,alpha-trehalose-phosphate synthase
                     [UDP-forming]; Region: trehalose_OtsA; TIGR02400"
                     /db_xref="CDD:233848"
     misc_feature    complement(order(394735..394737,394744..394749,
                     394810..394812,395041..395043,395056..395058,
                     395380..395382,395446..395448,395452..395454,
                     395614..395616,395788..395793,395824..395826))
                     /locus_tag="Rahaq2_4935"
                     /note="active site"
                     /db_xref="CDD:99963"
     misc_feature    complement(395053..395079)
                     /locus_tag="Rahaq2_4935"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99963"
     gene            complement(395850..396644)
                     /locus_tag="Rahaq2_4936"
                     /note="IMG reference gene:2506711960"
                     /db_xref="GeneID:11818445"
     CDS             complement(395850..396644)
                     /locus_tag="Rahaq2_4936"
                     /note="PFAM: Trehalose-phosphatase;
                     TIGRFAM: trehalose-phosphatase; HAD-superfamily hydrolase,
                     subfamily IIB"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose-phosphatase"
                     /protein_id="YP_005220660.1"
                     /db_xref="GI:379704286"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="GeneID:11818445"
                     /translation="MTAEIQENTTETPLLPVLDSRQYAFFFDVDGTLAEIRSEPDAVT
                     IPAEVRDHLQTLFAASSGALALVSGRPVEQLDQLVSPLELPAAGVHGAEMRDGSGTLH
                     RVTLPANVAQEVQQTLEAGMAALPGTLLETKGMAFALHYRQAMLHQQQVLALAESVVA
                     KFPELVLQPGKCVLEIKPRGKDKGAAIYTFMQQTPFSGRIPVFVGDDLTDEKGFEVVN
                     AMQGISVKVGEGSSLAQYRVKTVRDVYRWIEALQRHTLTFKKESEL"
     misc_feature    complement(395892..396626)
                     /locus_tag="Rahaq2_4936"
                     /note="trehalose-6-phosphate phosphatase; Provisional;
                     Region: PRK10187; cl17105"
                     /db_xref="CDD:266518"
     misc_feature    complement(395991..396575)
                     /locus_tag="Rahaq2_4936"
                     /note="HAD-superfamily hydrolase, subfamily IIB; Region:
                     HAD-SF-IIB; TIGR01484"
                     /db_xref="CDD:233434"
     gene            complement(396857..397537)
                     /locus_tag="Rahaq2_4937"
                     /note="IMG reference gene:2506711961"
                     /db_xref="GeneID:11818446"
     CDS             complement(396857..397537)
                     /locus_tag="Rahaq2_4937"
                     /note="PFAM: Oligogalacturonate-specific porin protein
                     (KdgM)"
                     /codon_start=1
                     /transl_table=11
                     /product="Oligogalacturonate-specific porin protein
                     (KdgM)"
                     /protein_id="YP_005220661.1"
                     /db_xref="GI:379704287"
                     /db_xref="InterPro:IPR001702"
                     /db_xref="InterPro:IPR009331"
                     /db_xref="GeneID:11818446"
                     /translation="MKNSRLMICGLLLASASSQAVTIDLRHEWLDDSKQHKDRALVSH
                     RFANGFGFSLEAKWKSGGDNENKPFNNLVDNGTESTISYQVKVTPEVFVQPGFTLESS
                     SDSSIYKPFLTAGYTFDSGIYFNARYRYEYTRYTKENTEDRKTNRGEIWLGYKMADWR
                     FEYNYIYKHSDQILYDNDKWDYEQNLKVAYNINKQWTPYAEIGDVSVRKTTDERQTRL
                     RLGIQYNF"
     misc_feature    complement(396860..397495)
                     /locus_tag="Rahaq2_4937"
                     /note="Oligogalacturonate-specific porin protein (KdgM);
                     Region: KdgM; cl11629"
                     /db_xref="CDD:264451"
     gene            complement(397606..399774)
                     /locus_tag="Rahaq2_4938"
                     /note="IMG reference gene:2506711962"
                     /db_xref="GeneID:11818447"
     CDS             complement(397606..399774)
                     /locus_tag="Rahaq2_4938"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220662.1"
                     /db_xref="GI:379704288"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="GeneID:11818447"
                     /translation="MWASKFVITALTLGISAQCLAVTLPDSGKLVWHSMTFGQSTDVN
                     FATNVLPEKIGMNETLLAGGKAVPATGTVLSTPFTLESRGGKIGNSHDGLTFFYTRLP
                     ADVNFQLEAEITLNQFGPENGAKPAGQEGAGLLVRDILGNPREPVTKPGIEELPAASN
                     MVMNSIMAIGDKPPVLALIARQGVQQPWGNTGIGIVRESYHPLSTPARFSLRLTRTDT
                     GFTVAYAPQGSDQWVSKSVQHADSVTQLDKTGYYVGFFASRNAKMTVEHARLTLSEAH
                     VQPSAPYVTPSLNARIEVMSSPVIARRDSVFQLRTNGDGKVQIDQNGKPLLSQITVRG
                     GEVVAVPFHAEQPVTALKITYTPADGKPVMQEFQVNMALVSNPDHLYVSPAGAAGNDG
                     SAEHPLDFDSAVNLLAPGGTLWLAEGDYPASLIPATASGTGKNRKTLRAQGDNVVFNG
                     LTLNASYWNIQGITVTQKSFHVAGSYNHIDRVKAHHADDTGIWVASPDGIGRALWASH
                     NLISNSESWGNQDPGRKNADGFAVKMRVGEGNRLVNCYSHDNIDDGFDLFNKIEDGPN
                     GSVTLENSLSVNNGSNGFKLGGEGLPVGHVVRHNVAVGNGMDGFTDNFNPGALVIEDN
                     RAVDNKRFNFLFRPSPYTTADKQGTFRDNISLRTTAGKYDDAVTGNVDNSNYFYTDHK
                     TVNNRHQEIKPGDYISLRLPDPITRLSDGGFNYADFLKNK"
     misc_feature    complement(397903..398367)
                     /locus_tag="Rahaq2_4938"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     gene            complement(399861..401426)
                     /locus_tag="Rahaq2_4939"
                     /note="IMG reference gene:2506711963"
                     /db_xref="GeneID:11818448"
     CDS             complement(399861..401426)
                     /locus_tag="Rahaq2_4939"
                     /note="PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/melibiose symporter-like transporter"
                     /protein_id="YP_005220663.1"
                     /db_xref="GI:379704289"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="GeneID:11818448"
                     /translation="MNAEKPILFKHQLAYGGGNLLGSGALAIAGIWLLYFYTTFCGLT
                     LLQASAIFSVASIIDAISNPLMGYLSDNFGKTRLGKRFGRRRFFILLGVPLMMFYPLL
                     WVEGFGFWYYLSTYVMFELIYTSVMVPYETLATEMTTDFSARSKLTGYKAIFGKVANF
                     LAAFIPGQFILIYGKDSAQPFFFTALTYGVILFIAIGMLYLSSWERPVEETTPVDEKK
                     MTLGKTMLTLVRDMKSTFHLRVFRKHLGMYLCGFGAEWLFASVFTYFIIFVLQYDPTM
                     VAGLSSLNSLLQLFSTAIFIGICVKHGFSKPYILALGIVIFSVICYSLLHVLHLPQQY
                     ATAAMLTITVIFGIGTGGVYYIPWTVYTFLADIDEAFTGRRREGIYAGAMTFSGKLMR
                     SVIVFVMGAILSFYGFQSKSHTQPESAVMAIALVFCIGVIALALMAIVFSNQMKLNRK
                     THLVVLGEVARIKAGGQISEVQPEVRAVMEELIGYPYEQCWGNSVVCRKIFDTPAVVV
                     TEPKPMVSTTQQP"
     misc_feature    complement(400002..401423)
                     /locus_tag="Rahaq2_4939"
                     /note="Na+/melibiose symporter and related transporters
                     [Carbohydrate transport and metabolism]; Region: MelB;
                     COG2211"
                     /db_xref="CDD:225121"
     misc_feature    complement(400113..401330)
                     /locus_tag="Rahaq2_4939"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(400251..400253,400260..400265,
                     400272..400277,400284..400289,400341..400343,
                     400350..400355,400365..400367,400374..400379,
                     400386..400388,400548..400550,400560..400562,
                     400569..400571,400581..400583,400593..400595,
                     400629..400631,400638..400643,400650..400655,
                     400662..400664,400950..400952,400968..400973,
                     400980..400985,401022..401024,401031..401036,
                     401043..401048,401055..401060,401226..401231,
                     401235..401240,401250..401252,401259..401264,
                     401271..401273,401322..401327))
                     /locus_tag="Rahaq2_4939"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(401815..402795)
                     /locus_tag="Rahaq2_4940"
                     /note="IMG reference gene:2506711964"
                     /db_xref="GeneID:11818449"
     CDS             complement(401815..402795)
                     /locus_tag="Rahaq2_4940"
                     /note="PFAM: Protein of unknown function (DUF535)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220664.1"
                     /db_xref="GI:379704290"
                     /db_xref="InterPro:IPR007488"
                     /db_xref="GeneID:11818449"
                     /translation="MEHIPLNETESLSEAYPVEQTTKKTSGFSLFVDLLSGACVPDNL
                     WRDRMFRVKYAVRTLLHPLDTLKVLNKMAAETLWQEAFQVQTKLPSKIHKPYLYLGLH
                     SAGRADALVDHYAFVKSLENARLRNTFLSATGNTITRFTGKDGEAFRVELGSIGKSER
                     EGEANMFLYMEDTLLAALTFSIVQRPEGRTLIIGGFQGAHRSTAHEVIKQATKSCYGL
                     FPKRLLLESLQRVAAGTGVQRILAVSDTGHVFRSLRYRHRKKNVFVASYNEFWDSISA
                     TPASSALYHVPLELPRKPMEEIASKKRSEYRKRYTLLDELHESTASLLNA"
     misc_feature    complement(401824..402669)
                     /locus_tag="Rahaq2_4940"
                     /note="Protein of unknown function (DUF535); Region:
                     DUF535; pfam04393"
                     /db_xref="CDD:252565"
     gene            403091..403828
                     /locus_tag="Rahaq2_4941"
                     /note="IMG reference gene:2506711965"
                     /db_xref="GeneID:11818450"
     CDS             403091..403828
                     /locus_tag="Rahaq2_4941"
                     /note="PFAM: PAP2 superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-associated phospholipid phosphatase"
                     /protein_id="YP_005220665.1"
                     /db_xref="GI:379704291"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="InterPro:IPR001011"
                     /db_xref="InterPro:IPR011158"
                     /db_xref="InterPro:IPR016118"
                     /db_xref="InterPro:IPR018296"
                     /db_xref="GeneID:11818450"
                     /translation="MKIITTFCLASLFSVNAFALTGNDATTKPDLYYLKNDQAINSLA
                     LLPPPPAVGSIAFLNDQAMYEQGRLLRSTERGKLAAEDANLSAGGVANAFSGAFGSPI
                     TAKDSPELHKLLTNMIEDAGDLATRSAKEKYMRIRPFAFYGVPTCNTTEQDKLSKNGS
                     YPSGHTSIGWATALVLTEINPQRQDQILQRGFDLGQSRVICGYHWQSDVDAARIVGSA
                     VVATLHTNPAFQQQLQKAKEEFAKQHP"
     misc_feature    403157..403813
                     /locus_tag="Rahaq2_4941"
                     /note="PAP2, bacterial acid phosphatase or class A
                     non-specific acid phosphatases. These enzymes catalyze
                     phosphomonoester hydrolysis, with optimal activity in low
                     pH conditions. They are secreted into the periplasmic
                     space, and their physiological role remains...; Region:
                     PAP2_acid_phosphatase; cd03397"
                     /db_xref="CDD:239491"
     misc_feature    order(403478..403480,403499..403501,403577..403585,
                     403682..403684,403700..403702,403712..403714)
                     /locus_tag="Rahaq2_4941"
                     /note="active site"
                     /db_xref="CDD:239491"
     misc_feature    <403550..403750
                     /locus_tag="Rahaq2_4941"
                     /note="Membrane-associated phospholipid phosphatase [Lipid
                     metabolism]; Region: PgpB; COG0671"
                     /db_xref="CDD:223743"
     gene            403997..404488
                     /locus_tag="Rahaq2_4942"
                     /note="IMG reference gene:2506711966"
                     /db_xref="GeneID:11818451"
     CDS             403997..404488
                     /locus_tag="Rahaq2_4942"
                     /note="PFAM: Protein of unknown function (DUF796);
                     TIGRFAM: type VI secretion system effector, Hcp1 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="YP_005220666.1"
                     /db_xref="GI:379704292"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="GeneID:11818451"
                     /translation="MASPAYLWLYDANGALLYGGSEVLSREGAIEIQSFTHGLSVPFD
                     GNTGRLTSTRVHQTMGLVKEFDKSTPYLYRAVATSEKLQKAVIKWYRINAAGMEEEFL
                     NMTMEGVRILNINPHMHNFKHADGQASMPTESIGLGYQKITWLYLDGHISFTDQWNSS
                     IYA"
     misc_feature    404000..404473
                     /locus_tag="Rahaq2_4942"
                     /note="Protein of unknown function (DUF796); Region:
                     DUF796; cl01226"
                     /db_xref="CDD:260845"
     gene            404501..405025
                     /locus_tag="Rahaq2_4943"
                     /note="IMG reference gene:2506711967"
                     /db_xref="GeneID:11818452"
     CDS             404501..405025
                     /locus_tag="Rahaq2_4943"
                     /note="PFAM: Protein of unknown function (DUF2778)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220667.1"
                     /db_xref="GI:379704293"
                     /db_xref="InterPro:IPR021225"
                     /db_xref="GeneID:11818452"
                     /translation="MISCRVDFNRLYEGGKIAKLYCAGVGIFPVFSGLGSLLNRQGCS
                     DLKNGAIPPGKYWIVDRPAGGLNSWIVQMRKEWKTGNDYDSWFALYRQDSLIDDWTNI
                     GARERGNFRLHPLRSDGTGVSDGCITFYNHADFKVLRDRLLRAHTMIIPVLGKKAYGE
                     VEVFGDINAPCIHF"
     misc_feature    404576..404953
                     /locus_tag="Rahaq2_4943"
                     /note="Protein of unknown function (DUF2778); Region:
                     DUF2778; pfam10908"
                     /db_xref="CDD:256198"
     gene            405003..405305
                     /locus_tag="Rahaq2_4944"
                     /note="IMG reference gene:2506711968"
                     /db_xref="GeneID:11818453"
     CDS             405003..405305
                     /locus_tag="Rahaq2_4944"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220668.1"
                     /db_xref="GI:379704294"
                     /db_xref="GeneID:11818453"
                     /translation="MRHVYIFSTLKIVWRLILFVAITLFLTPLNESFTHYLYLITDPV
                     VEFYHSTLGVDSGDRWDMEELTFLIFAVTATSIIAVCSIAVIEALFKKLMRVLRGI"
     gene            complement(405482..406564)
                     /locus_tag="Rahaq2_4945"
                     /note="IMG reference gene:2506711969"
                     /db_xref="GeneID:11818454"
     CDS             complement(405482..406564)
                     /locus_tag="Rahaq2_4945"
                     /note="PFAM: Iron-containing alcohol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol dehydrogenase"
                     /protein_id="YP_005220669.1"
                     /db_xref="GI:379704295"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="InterPro:IPR016205"
                     /db_xref="InterPro:IPR018211"
                     /db_xref="GeneID:11818454"
                     /translation="MSDTDIRVVTGPANYFSFPGAIDRLTQFYSPEQLDKALWIYGER
                     ALTAAQDFLPEAFTASQAKRVLFAAHCSETEVQRIADIGGPDRQVVIGIGGGAVLDTA
                     KVVARRLGLPVVAIPTIAATCAAWTPLSVWYNDEGQALRYEIFNDANHLVLVEPRIIL
                     HAPKEYLLAGIGDTLAKWYEAVVLSPQPEKLPLTVQLGLNTALTLRDVLLNESEAALQ
                     AQDDNRLTQPFLNVLDAIIAGGGLVGGLGDRYTRIAAAHSVHNGLTALPQTDAFLHGT
                     KVAYGILVQSALLNQPEVVQQLTALYKVLDLPVSLAQLQVDIHDEKQLSRLIERTLQP
                     GESIHLLPGNPNAEQLRLAFEFVENK"
     misc_feature    complement(405500..406534)
                     /locus_tag="Rahaq2_4945"
                     /note="Glycerol dehydrogenases-like; Region: GlyDH-like1;
                     cd08172"
                     /db_xref="CDD:173931"
     misc_feature    complement(order(405743..405745,405782..405784,
                     405794..405796,406034..406036,406046..406048,
                     406067..406069,406091..406093,406151..406156,
                     406202..406204,406208..406213,406256..406258,
                     406265..406267,406274..406282,406439..406441))
                     /locus_tag="Rahaq2_4945"
                     /note="putative active site [active]"
                     /db_xref="CDD:173931"
     misc_feature    complement(order(405743..405745,405794..405796,
                     406046..406048))
                     /locus_tag="Rahaq2_4945"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173931"
     gene            406786..407853
                     /locus_tag="Rahaq2_4946"
                     /note="IMG reference gene:2506711970"
                     /db_xref="GeneID:11818455"
     CDS             406786..407853
                     /locus_tag="Rahaq2_4946"
                     /note="PFAM: family"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter periplasmic protein"
                     /protein_id="YP_005220670.1"
                     /db_xref="GI:379704296"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:11818455"
                     /translation="MKLFSASLLALSLFSVLPSFAAGTAPVPKAIADHQGPVRIAVIR
                     NLGSDDNTTQFLSGVIQEGRKLGFQVSTFLSNGDDAKFQDFVNQAISQKYDGIILSQG
                     RDPYSTDLLKRITASGIAVSVFDTAVNGNIPGVTVTQQDDASLTDLSVGQLVKDFNGK
                     ANIVKLWVAGFPPMERRQDAYKKVLAAHPGIHELESVGAVSSDVQGDTANKIGALLAK
                     YPKGKIDAIWGTWDAFSQGAYKALQENGRTEIKLYSIDISNQDIGLMRAANSPWKLSV
                     AVDPKLIGAINLRLVASKIAGEKTPATYEFKAAAIPQALLTSNPDAVNVASLAKVIPG
                     WGKSDDFIAPWFATLEAQHKK"
     misc_feature    406786..407691
                     /locus_tag="Rahaq2_4946"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     RbsB; COG1879"
                     /db_xref="CDD:224791"
     misc_feature    406900..407721
                     /locus_tag="Rahaq2_4946"
                     /note="Methylthioribose-binding protein-like of ABC-type
                     transport systems that belong to a family of
                     pentose/hexose sugar-binding proteins of the type I
                     periplasmic binding protein (PBP1) superfamily; Region:
                     PBP1_methylthioribose_binding_like; cd06305"
                     /db_xref="CDD:107300"
     misc_feature    order(406936..406938,407158..407160,407314..407316,
                     407551..407553,407617..407619)
                     /locus_tag="Rahaq2_4946"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107300"
     gene            407869..409110
                     /locus_tag="Rahaq2_4947"
                     /note="IMG reference gene:2506711971"
                     /db_xref="GeneID:11818456"
     CDS             407869..409110
                     /locus_tag="Rahaq2_4947"
                     /note="PFAM: LVIVD repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220671.1"
                     /db_xref="GI:379704297"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR013211"
                     /db_xref="GeneID:11818456"
                     /translation="MQTLPTPEYSRNMRLIGHSDQGGKPDGVQVMVHRGYAYIGHMVS
                     QGFSIVDVRDPKNPRPAGFIPAPPGTWNVHLQAHDDLLLVINARDLFADVRFADEKVY
                     YTRSVSETVQGTQQRGWSAGVRIFDISVPDQPKEISFLGLEGIGVHRIWYVGGRWAYV
                     SALIDGYSDYIFLTIDLADPRHPQVAGRWWLPGMHTAGGEKPDWPEGKRYALHHAIIS
                     GDTAYASWRDGGLTLLDIKDRSAPQLISHRNWSPPFGGGTHTALPLPDRDLLVVLDEA
                     VLDNQEDGEKLIWLFDVREPSNPVSISTFPQPGERDYISKGAHFGPHNLHENRPGSFI
                     SSTLIFATYQNAGVRAYDISNPYQPKETGALVPAAPATMMDKRPGRPQVIQSCDVFVD
                     TQGIIYSTDYNGGLSIIEYLG"
     misc_feature    407872..409107
                     /locus_tag="Rahaq2_4947"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5276"
                     /db_xref="CDD:227601"
     gene            complement(409131..410054)
                     /locus_tag="Rahaq2_4948"
                     /note="IMG reference gene:2506711972"
                     /db_xref="GeneID:11818457"
     CDS             complement(409131..410054)
                     /locus_tag="Rahaq2_4948"
                     /note="PFAM: EamA-like transporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="DMT(drug/metabolite transporter) superfamily
                     permease"
                     /protein_id="YP_005220672.1"
                     /db_xref="GI:379704298"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:11818457"
                     /translation="MKSGDYCRLLLLAAIWGGSFLFMRVAAPAFGAINTAFLRVLFGF
                     VGLVVILAVMRTPRDYQHKFGRSLLLGVINSGLPFLMYCLAARWLPAGYSAILNATTP
                     LMGVVLGGLFFHETVTLKKALGVLTGLFGITLLTTTGSAESVPQLLAGVIACLVATGC
                     YAVAGFLTRRWITERGGLDPKLVATGSQLGATLFLLPFFLYTSATEAPVSWAQPLVWL
                     CVLAVGFICTAWAYILYFRLIADIGPLRSMTVTFLIPPFGILWGYLLLNEKLSEGFFA
                     GGILICVAVWLVLSPGKSVTGKTKTPAPETR"
     misc_feature    complement(409644..410012)
                     /locus_tag="Rahaq2_4948"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    complement(409200..410009)
                     /locus_tag="Rahaq2_4948"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:233205"
     misc_feature    complement(409188..409523)
                     /locus_tag="Rahaq2_4948"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            410194..410916
                     /locus_tag="Rahaq2_4949"
                     /note="IMG reference gene:2506711973"
                     /db_xref="GeneID:11818458"
     CDS             410194..410916
                     /locus_tag="Rahaq2_4949"
                     /note="PFAM: 2-phosphosulpholactate phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphosulfolactate phosphohydrolase-like
                     enzyme"
                     /protein_id="YP_005220673.1"
                     /db_xref="GI:379704299"
                     /db_xref="InterPro:IPR005238"
                     /db_xref="GeneID:11818458"
                     /translation="MTDFSQADFDVRLEWGAQAVDHLAAEVDCIVIIDVMSFSTCVSV
                     ANERGGVIFPYPWKDASAQQYAVERNAQCAQFDRRFQGPGFTLSPCSLQEMATGTRLV
                     LPSPNGSALTFKAKIHNAAIFTACLRNLTATACACKKYQRILVIPAGEKWPDNSLRPA
                     LEDLVAAGGLISRLQNRQLSAEARAAKAVYQNLTLEKLADCGSARELTRRGFSADVTL
                     CLQEDVSDFACQLQGEFFTAVS"
     misc_feature    410239..410907
                     /locus_tag="Rahaq2_4949"
                     /note="2-phosphosulpholactate phosphatase; Region:
                     2-ph_phosp; cl00895"
                     /db_xref="CDD:260686"
     gene            411047..412492
                     /locus_tag="Rahaq2_4950"
                     /note="IMG reference gene:2506711974"
                     /db_xref="GeneID:11818459"
     CDS             411047..412492
                     /locus_tag="Rahaq2_4950"
                     /note="PFAM: Major Facilitator Superfamily;
                     TIGRFAM: drug resistance transporter, EmrB/QacA subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose efflux permease family protein"
                     /protein_id="YP_005220674.1"
                     /db_xref="GI:379704300"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818459"
                     /translation="MSHSKPDASEHPQEESAVNSGISVIALLVAAAFFMEFIDGTVIA
                     TALPQMAISFGVSAVDLNAGMSAYMLTLAVLIPASGWAAERFGARNVFTFALAVFTLA
                     SLFCAMASGVREFIILRIIQGIGGALMVPVGRLTVLKTTPKPQLIKAIATLTWPALVA
                     PILGPPLGGFITHYASWHWIFYINVPLGIIAMMLAWRLFPQAPSAEPKHFDKPGFVLT
                     GLAMLSLVTGLELISQDHILWTVAILLLAAGAALSVLAIRHLYRAPAPMVHLGTIVIP
                     TFRICMGGGSLFRVTISAVPFLLPLMLQVGFGMDPFHAGLLVLAVFAGNLAMKPATTP
                     LIRRFGFRPVLIVNGLLSVFSLLFCAFLTPGTPDWLVMLLLFLGGLSRSMQFTGISTL
                     AFSDVPAKQMADANTLFSTVLQLSVGLGITVGALGTRLGEQLTDLLHWSDIPGMSFKI
                     SFVVIAVLTLIGWLDMLRLQPDAGASVSGKK"
     misc_feature    411125..412324
                     /locus_tag="Rahaq2_4950"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    411131..412306
                     /locus_tag="Rahaq2_4950"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(411164..411166,411173..411181,411185..411190,
                     411239..411241,411248..411253,411260..411262,
                     411272..411277,411281..411286,411422..411427,
                     411434..411439,411446..411451,411458..411460,
                     411494..411499,411506..411511,411527..411529,
                     411911..411913,411920..411925,411932..411937,
                     411944..411946,411986..411988,411998..412000,
                     412010..412012,412019..412021,412031..412033,
                     412181..412183,412190..412195,412202..412204,
                     412214..412219,412226..412228,412259..412264,
                     412271..412276,412283..412288,412295..412297)
                     /locus_tag="Rahaq2_4950"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            412543..413433
                     /locus_tag="Rahaq2_4951"
                     /note="IMG reference gene:2506711975"
                     /db_xref="GeneID:11818460"
     CDS             412543..413433
                     /locus_tag="Rahaq2_4951"
                     /note="PFAM: Dihydrodipicolinate synthetase family"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase/N-acetylneuraminate
                     lyase"
                     /protein_id="YP_005220675.1"
                     /db_xref="GI:379704301"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:11818460"
                     /translation="MFTGLSAFPLTPLTEKGIDEKSFVRLMERLVAAGVDSIGALGST
                     GSYAYLKHSERDRVARLAVEHAGGIPVMVSIGSVRTSDVLHLAEDAQRAGVSAVLLAP
                     VSYQKLTSDEVFTLYETVTRHLSVPLCVYDNPGTTNFDFTDELYVRIAQLPHVASIKI
                     PGLSADPVTTRNRLDELRLLVPSHVTLGAAGDLAAATVLTQGGDVWYSVIAGLFPEIP
                     LAITRAAQNGDAQTALALSARLEPLWALFRQHGSLRVVAAAAEILGIVSAPCLPLPLQ
                     SLSGDARQHLISVLETLFQN"
     misc_feature    412555..413412
                     /locus_tag="Rahaq2_4951"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    order(412564..412566,412657..412659,412666..412674,
                     412933..412935,413017..413019)
                     /locus_tag="Rahaq2_4951"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    order(412657..412659,412666..412674,412933..412935,
                     413017..413019,413161..413163)
                     /locus_tag="Rahaq2_4951"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    order(412669..412671,412684..412689,412777..412782,
                     412852..412857,412876..412878,412888..412890,
                     413356..413358,413362..413364)
                     /locus_tag="Rahaq2_4951"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    413017..413019
                     /locus_tag="Rahaq2_4951"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            413675..414082
                     /locus_tag="Rahaq2_4952"
                     /note="IMG reference gene:2506711976"
                     /db_xref="GeneID:11818461"
     CDS             413675..414082
                     /locus_tag="Rahaq2_4952"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220676.1"
                     /db_xref="GI:379704302"
                     /db_xref="GeneID:11818461"
                     /translation="MPYGDNGQGLFRRGQLEQQIIRTTKFSIYAQAVYCVNRMLREAN
                     VGISEQAYQSISRNITAVTNGRLYETSASLSEARVFARDTVGAIKAGDFTSAAITASG
                     VAINAIGGPLFFGHYDRNKLIAIERHLYDNFHL"
     gene            complement(414207..415343)
                     /locus_tag="Rahaq2_4953"
                     /note="IMG reference gene:2506711977"
                     /db_xref="GeneID:11818462"
     CDS             complement(414207..415343)
                     /locus_tag="Rahaq2_4953"
                     /note="PFAM: CblD like pilus biogenesis initiator"
                     /codon_start=1
                     /transl_table=11
                     /product="CblD like pilus biogenesis initiator"
                     /protein_id="YP_005220677.1"
                     /db_xref="GI:379704303"
                     /db_xref="InterPro:IPR010888"
                     /db_xref="GeneID:11818462"
                     /translation="MNRVITALFLWSVAFILHAAIRPPAPSTVSIERTFDRMSPPSGN
                     ISIWSNESGGYDSDDPGKWGKNGWICGSSSDPKYGECQDSQLWGHSGETTIPLLFIEK
                     RSGMRITLNLSGYRVVKYHIDGGSCYDEGKLEIYSGVDSTCQGYGGAKSSEATLTVYI
                     PAAELSKLPVGGLWQADLHLKLMQWQNQFLADFNAHINLNVTDPSHIDIYFPAFSSAT
                     PLVELDLRPHGAPDESPFAQDSTTLDMCLYDGYNANSTRYEVRLKDEGDLPPGRAASD
                     FSIFRDGGERGPERDRIDYHVLLRDPETRGMRKVNNNETIVWTQINQNLIRPVRLPSI
                     TYPVLCVPTPLVFSVDKFYIKDKNAGHYRGVLTVIFTPTTPTVD"
     misc_feature    complement(414216..415262)
                     /locus_tag="Rahaq2_4953"
                     /note="CblD like pilus biogenesis initiator; Region: CblD;
                     cl06460"
                     /db_xref="CDD:262880"
     gene            complement(415343..418030)
                     /locus_tag="Rahaq2_4954"
                     /note="IMG reference gene:2506711978"
                     /db_xref="GeneID:11818463"
     CDS             complement(415343..418030)
                     /locus_tag="Rahaq2_4954"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220678.1"
                     /db_xref="GI:379704304"
                     /db_xref="GeneID:11818463"
                     /translation="MKKNLIILFAFFTFPVDASTLKIPAGFEILSQGMQERVDVIVAG
                     KHIGSYDAIVSLDGIKFINPESVLTALQLSVKPDDKDYKVIRQLLNNTFPRNDILACT
                     NAQQSKGCGFIASKSIDVIYDSSEGSVTLFIRKEWLADAERNDLYIKPTTNNVVNAFI
                     HQQDMNVIVQDDYSNFFIQGAGALGISDNSYIGGDWSFSAAQNEDESNNEADLNDLYY
                     RYDISQRYYSQLGRMDNRMLFNSQGGSFNFSFLPLGAIDGVRIGTTLSYLNREVASQG
                     TPLNVLLTRNSRVDAYRNDQLLGTFYLSPGNQSIDTSLFPSGSYSVQLRIYESNQLVR
                     TENSPFSKTGSLDDGSIHWFAQGGKITDSDTNENTAFQAGLRVPFTPALSFTVGSAAV
                     QSNTYAETGFDYSPDLGLAGTPNFNGRVFRSSDGNKGDSEQLSWSVGDWPSLSVYRYS
                     SSGDDCSDSGQNDNNDYTSQSCYESINTTLTSNVLSWNLMFGYIQTQNHASDDMSWQR
                     DKSFEDNILEQTTEESTSRTLQFSASRAFTQADWVYNGTFGLFRRDDDGYDGIDNGVY
                     LSLTLSQAPRQDNLGKSQSTRLSTDYRDSQDQSSQLSYNVSHSWYRDQNQHKELTLEA
                     GGINTDTLDTGLSGRMEGQYGNVSAVLSDSYDNEYNKHTSAFSGSWSSSFAASTKGVH
                     WGSAGISEPASAVLVNIDDLSDEDDGIAIDAQVSGNRTAHISRGGSALFPTTGFEPTT
                     VAVSDSSAPLNTDSSTNILNGAGERNIMLLPGKMRLRSVVVEHRYGYIGQLILPQSAS
                     NNIIIGLNSKMLMLSDDGGFTAEMATKAPALYLLSGDVIYQCPLQIKKQRGTVRYVGE
                     SSCQLIKRDSLPAEVNEQLLVKLKSRRDIETASNKEGDE"
     misc_feature    complement(415427..418018)
                     /locus_tag="Rahaq2_4954"
                     /note="fimbrial outer membrane usher protein TcfC;
                     Provisional; Region: PRK15310"
                     /db_xref="CDD:185210"
     misc_feature    complement(<417638..>417820)
                     /locus_tag="Rahaq2_4954"
                     /note="Hypothetical protein; Provisional; Region:
                     PHA03066"
                     /db_xref="CDD:165355"
     gene            complement(418216..418746)
                     /locus_tag="Rahaq2_4955"
                     /note="IMG reference gene:2506711979"
                     /db_xref="GeneID:11818464"
     CDS             complement(418216..418746)
                     /locus_tag="Rahaq2_4955"
                     /note="PFAM: CS1 type fimbrial major subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="CS1 type fimbrial major subunit"
                     /protein_id="YP_005220679.1"
                     /db_xref="GI:379704305"
                     /db_xref="InterPro:IPR007540"
                     /db_xref="GeneID:11818464"
                     /translation="MKKSMVKPLVIAALLVSFTGTTSAVQKDITVTANVDASIDMTLS
                     DGSALPKSVEMQYIPGNGLSPVSMMTKIWSNATTSDAGDVHLQLITDPQLINNTGPEA
                     NPIPLNVSWGGDALSVATPIDLTTAVLFPNGADAANTGSVAKELQISQATKGTVETGM
                     YKGVVSIYLFQDATTI"
     misc_feature    complement(418231..418674)
                     /locus_tag="Rahaq2_4955"
                     /note="CS1 type fimbrial major subunit; Region:
                     Fimbrial_CS1; cl04524"
                     /db_xref="CDD:262192"
     gene            complement(418827..419549)
                     /locus_tag="Rahaq2_4956"
                     /note="IMG reference gene:2506711980"
                     /db_xref="GeneID:11818465"
     CDS             complement(418827..419549)
                     /locus_tag="Rahaq2_4956"
                     /note="PFAM: Gram-negative pili assembly chaperone,
                     N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, chaperone PapD"
                     /protein_id="YP_005220680.1"
                     /db_xref="GI:379704306"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR016147"
                     /db_xref="GeneID:11818465"
                     /translation="MYLLRINKWFFMLAFFSFMTSANMTIYPMAVGLDTQGEGSVRLL
                     SKTNDVQFVKTKTLKITNPGTPEEKEVDVNSYSGNELVVMPPKFAIPGGSSKLVRFVA
                     MNVPEKEEIYRVMFQAVPSLDDDHVSENGKAIDTEVSVNLVWGILVSIPPLHPRIDVA
                     LSPDHHFLHNNGTQRIKIINIGLCKHGGKDKECVWKEDNHNLFPDKEYNLPDTAGYEK
                     LVIKYKDWIRKTNNERLEFSLK"
     misc_feature    complement(<419160..419525)
                     /locus_tag="Rahaq2_4956"
                     /note="P pilus assembly protein, chaperone PapD [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: FimC; COG3121"
                     /db_xref="CDD:225663"
     misc_feature    complement(418875..419516)
                     /locus_tag="Rahaq2_4956"
                     /note="putative fimbrial protein TcfA; Provisional;
                     Region: PRK15308"
                     /db_xref="CDD:237939"
     gene            420074..421426
                     /locus_tag="Rahaq2_4957"
                     /note="IMG reference gene:2506711981"
                     /db_xref="GeneID:11818466"
     CDS             420074..421426
                     /locus_tag="Rahaq2_4957"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220681.1"
                     /db_xref="GI:379704307"
                     /db_xref="GeneID:11818466"
                     /translation="MAKSFLRSGSLNDILALGENGQPVYASALQLRETLRLRKQPAIA
                     DCLAIPQLNEAGDRLDWYSPREGKVVSWAAATDTARASALRQLENCLDTVSQISKAAK
                     SSEKPATQFFGSLLEKAFRFPDQNHVYLVGGQPVLTFWGFLSLDSVSQPDPFAALRNT
                     LTAGEPLPALSLAAEKIKAPEPVVEQPEPVRVIKTIEARAAEQEIAVPEPVVAPRRKK
                     SPLIWALPVAALVVAGSAAGWLYSRVPAPKVETAKTEAPKPAPAAEPVVIAPPAVAEQ
                     VKAPEVKAPEPAPLPVAPAAVVVPSAQPVAEVEKTPIVTEPAAAPVSKNALVMPPDAV
                     KIGSTKFLNGNWQVVLDIKDPVTGKPPVLRYQFKQGQGTVKITYGAGVTCRAAANAGL
                     MQSGNLVINSRYRAKCSDGSRYQMPEISCTQGATGAAVCQGRYTGDTVYPMTIKREGK
                     "
     misc_feature    <420569..420910
                     /locus_tag="Rahaq2_4957"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK14950"
                     /db_xref="CDD:237864"
     gene            421431..424403
                     /locus_tag="Rahaq2_4958"
                     /note="IMG reference gene:2506711982"
                     /db_xref="GeneID:11818467"
     CDS             421431..424403
                     /locus_tag="Rahaq2_4958"
                     /note="PFAM: Virulence factor SrfB"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220682.1"
                     /db_xref="GI:379704308"
                     /db_xref="InterPro:IPR009216"
                     /db_xref="GeneID:11818467"
                     /translation="MLATLTDFKQKITLIRDSGIQFLDFALKPVWDDGLPAKFVRKSA
                     NGPLLRLDYNPQNGRHFLPGLEGGAPEVVRPEFSFPLEQSLKLLDQIWLPLPFLRFNP
                     PRTFMAGPDNWARVQIRQLDTPEADGSTHRVVIAFDTRVVEGDGEQTQLAPTQDDVKN
                     GISFALAWHNEELPDFLDQTWVDGWLREVFTEQSAIREEREARNIKVALREFEYQAHY
                     LNLLEMLGSQLGIPELKINGATLQEPAINVDLILDVGNSHTCGILVEDHVGETDGLKQ
                     TSELQLRDLSQPHFLYNELFESRVEFAQARFGKPNFSVESGRDDAFIWPSILRAGREA
                     SRLALLREGTEGSTGISSPRRYLWDEDSYTPGWRFSQGGHGAVTEPVAAAMPLTFLIN
                     DDGQPLSDLPAEDRLPVFSAHYSRSSVMTLMLSELLAQALMQINSPAQRTRMLRSFAP
                     RQLRNIILTLPSAMPKPEREIFRRRMQEAIGLVWKSMGWHPSDDAFKNQADKAKSSVP
                     VPDVQMEWDEATCGQMVYLYNETQVNFGGHTGEFFASMARPDRELADDEPVGKTLRIA
                     SIDIGGGTTDLAITQYWLDDGMGNNVKITPRLLFREGFKVAGDDILLDVIQLYVLPAL
                     QAALKKAGLANPDSLMTRLFGSEGRMDGHATLRQQSTLQIFIPLARSVLEVYERFDPL
                     DTHAEIDAPFGELLEQTPTQKVLDYLHTEIQRVLPAGSAVFDILQVPLVLKLSKLHSE
                     FLSNRMSITQNLRSLCEVVSLHDCDVLLLTGRPSRFPGIQALFRHLQPLPINRMLSLD
                     GYHTSGWYPFNKLGRIDNPKSTAAVGAMLCLLALDLRLPGFYFKAGDFQPYSTVRYLG
                     MLDGNQVLSEDNVCYGDIDLDAHDYKLDSAASFRIRGAICLGFRQLENDRWPASPLYT
                     LSIAEPELARKVAGDSVLRVKLAVKKGEDHPTPEFFDIASAVLDNGTKVPAHHLRLRL
                     NTLGESHYWIDSGSVFVS"
     misc_feature    421431..424397
                     /locus_tag="Rahaq2_4958"
                     /note="Virulence factor SrfB; Region: SrfB; pfam07520"
                     /db_xref="CDD:254256"
     gene            424400..426775
                     /locus_tag="Rahaq2_4959"
                     /note="IMG reference gene:2506711983"
                     /db_xref="GeneID:11818468"
     CDS             424400..426775
                     /locus_tag="Rahaq2_4959"
                     /note="PFAM: Putative bacterial virulence factor"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220683.1"
                     /db_xref="GI:379704309"
                     /db_xref="InterPro:IPR017030"
                     /db_xref="GeneID:11818468"
                     /translation="MTTSTTETNAGLTTNVLQRQFTAVSDTIGGALDWVETTRADAPR
                     LDLEADRLNLQLIRCREKAQRLALACELPPALGFYGHSQAGKSYLICSLASGNYGRLE
                     TRLGGVTLDYLTQINPGNRVARFATRFTRQADVRDRAFPVRVLLLNEADLARIVIRAF
                     QPDSHSPVADTQHITEHLSKLMMHRQPEPVDGFTCEQMMGLWDSMIRLDPRRFRHLNA
                     HYWPVAVKLAPYLNIDDRARLFSLLWGNEPALTAAYRHYAHTLQHLSGAESLLAPLSI
                     LVDEAMQPADGIFSQSPGWDMQIPVCPQFGDESAPPVTLSLTELTMLASEVQIPLLSP
                     PREVLFEQIDLLDLPGYGALPDESGDDENSALFRAKISYLPERYTDRHEMNMLMVCTA
                     ADVRDDVVAVGRTLEYWVKEMHGENTQVRGRRKPGLVWVLTPFDRRVNGSAHFDEAVQ
                     RHVGNPGDAWGALLAMDDRGLQRMADYLVAEIRPEIRLNRLNELRDELRRELADNLLG
                     RWYQAGDAADPAQKQRTVQTVIKALQTRTGVHGELLEKLLPGRDELHRIYHEHAGLPA
                     ETGEQDEGGAESFGIGIDIDLFAEQQDVPVWQEKPDDGTAFARQVQRYWINHLRSLPE
                     NEPLIALLGVAKPTVELLMEELITISFRLKMGDALVRSLGGALSAGAREHEHHADRQV
                     SRALTVLGDFVAWLGFEKQAEAERPESRINKGNKIFAKPKQSVASWKSSRRLTKLSAT
                     PTNSTAFYIYDWLVGLQESIMRNAGYAAGGEIPAQQRESLASLLRMLKAEN"
     misc_feature    424490..426751
                     /locus_tag="Rahaq2_4959"
                     /note="Putative bacterial virulence factor; Region:
                     Virul_Fac; pfam10139"
                     /db_xref="CDD:255784"
     gene            426963..428012
                     /locus_tag="Rahaq2_4960"
                     /note="IMG reference gene:2506711984"
                     /db_xref="GeneID:11818469"
     CDS             426963..428012
                     /locus_tag="Rahaq2_4960"
                     /note="PFAM: DeoC/LacD family aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="DhnA-type fructose-1,6-bisphosphate
                     aldolase-like enzyme"
                     /protein_id="YP_005220684.1"
                     /db_xref="GI:379704310"
                     /db_xref="InterPro:IPR002915"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:11818469"
                     /translation="MTDITKLLGKEADSLLQHQCSTITSDQLCLPGADFVDRVMIDNN
                     RSPRVLAAMQNLYNTGRLAGTGYLSILPVDQGVEHSAGASFAANPLYFDPKNIVELAI
                     EAGCNCVASTYGVLASVSRRYAHKIPFLVKLNHNETLSYPTQYDQTLYASVEQAFNLG
                     AQAVGATIYFGSEESRRQIEEISAAFERAHELGMVTVLWAYLRNPAFVKDGKDYHSSA
                     DLTGQANHLAATIGADIVKQKMAENNGGYKAVKFGYTDERVYSTLTTDHPIDLVRYQL
                     ANCYMGRAGLINSGGAAGENDIQESVRTAVINKRAGGMGLILGRKAFKKSMKEGVGLI
                     NAVQDVYLDQKVTIA"
     misc_feature    427164..427988
                     /locus_tag="Rahaq2_4960"
                     /note="Class I fructose-1,6-bisphosphate (FBP) aldolases
                     of the archaeal type (DhnA homologs); Region: DhnA;
                     cd00958"
                     /db_xref="CDD:188645"
     misc_feature    order(427719..427721,427812..427814,427881..427889,
                     427953..427961)
                     /locus_tag="Rahaq2_4960"
                     /note="putative active site; other site"
                     /db_xref="CDD:188645"
     misc_feature    427719..427721
                     /locus_tag="Rahaq2_4960"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188645"
     gene            complement(428077..428232)
                     /locus_tag="Rahaq2_4961"
                     /note="IMG reference gene:2506711985"
                     /pseudo
                     /db_xref="GeneID:11818470"
     gene            428335..430020
                     /locus_tag="Rahaq2_4962"
                     /note="IMG reference gene:2506711986"
                     /db_xref="GeneID:11818471"
     CDS             428335..430020
                     /locus_tag="Rahaq2_4962"
                     /note="PFAM: Hsp70 protein"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="YP_005220685.1"
                     /db_xref="GI:379704311"
                     /db_xref="InterPro:IPR001023"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="GeneID:11818471"
                     /translation="MLIGIDLGTSNCAVAIWQDGQSVLVPNVYGKNLTPSVIGLDDNG
                     HILVGAPAQARLFTHPDLTLSSFKRFMGTEHQFRLGHQHFRAEELSALLLRSLKADVE
                     QHCGREVTRAIITVPAYFNDIQRKAVKAAGELAGLQVERLLNEPTAASLAYGLVNQQE
                     QKFLVFDLGGGTFDVSIIDMFEGVIEVRASSGDVFLGGDDFTRSLAVWMLAQYPQLDK
                     DDSALFGQLITLAEKAKHQLTTQDSTTLRYTWKDSSLNWTLTTEILAQCCESTLERMK
                     KPVIQALRDARFSADEVDHVVLVGGATRMPLVRQAVARLFGRFPRSELQPDEAVALGA
                     GIQAGLVLQDQALDDIVLTDVMPFTLGIGISRPKGDGYEDGHFLPLIERNSFVPVSRV
                     EKIVTISDQQKYLNLSIYQGEARRVADNILLGSLTVDVPPRPAGEMAADVRFTYTLDG
                     ILEVECKITSTGLVEKLVIEKAPGSLTPAQITASLLKLENIKQHPREQLVNRQLVAEA
                     NAYYEQSLGDQRQFIADQLYRFEHVLDTQDARQITTARREFESLLMHLRSEWE"
     misc_feature    428335..430008
                     /locus_tag="Rahaq2_4962"
                     /note="Molecular chaperone [Posttranslational
                     modification, protein turnover, chaperones]; Region: DnaK;
                     COG0443"
                     /db_xref="CDD:223520"
     misc_feature    428341..429351
                     /locus_tag="Rahaq2_4962"
                     /note="Nucleotide-binding domain of Escherichia coli HscC
                     and similar proteins; Region: HscC_like_NBD; cd10235"
                     /db_xref="CDD:212677"
     misc_feature    order(428350..428352,428356..428367,428536..428538,
                     428683..428685,428767..428769,428833..428850,
                     428854..428856,428926..428931,429028..429030,
                     429037..429042,429232..429240,429244..429249,
                     429313..429315)
                     /locus_tag="Rahaq2_4962"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212677"
     misc_feature    order(428419..428421,428470..428472,428482..428484,
                     428491..428496,428641..428646,428998..429000,
                     429007..429012,429019..429021,429031..429033,
                     429073..429075,429079..429084)
                     /locus_tag="Rahaq2_4962"
                     /note="putative NEF/HSP70 interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212677"
     misc_feature    order(428698..428703,428707..428712,428755..428760,
                     428764..428766,428887..428898)
                     /locus_tag="Rahaq2_4962"
                     /note="SBD interface [polypeptide binding]; other site"
                     /db_xref="CDD:212677"
     gene            430025..430597
                     /locus_tag="Rahaq2_4963"
                     /note="IMG reference gene:2506711987"
                     /db_xref="GeneID:11818472"
     CDS             430025..430597
                     /locus_tag="Rahaq2_4963"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220686.1"
                     /db_xref="GI:379704312"
                     /db_xref="GeneID:11818472"
                     /translation="MGIWSVLGIEPTQDITAIKRAYARQLKSTRPDQDPEAYQHLREA
                     FESARRGDHFWNISDAVTYSFPLPSLTDDAVIRQTQVHFLVSDTVSLLLENEQAGLDL
                     LKVCLSEELLQNLQLREIFSQQLAWDLAEREGLTASVLAKVAVLMEWEIDHYQPAGIS
                     IYQLDALHQQIENTAGGRYRDDSGAPWGEG"
     misc_feature    430034..>430189
                     /locus_tag="Rahaq2_4963"
                     /note="curved DNA-binding protein CbpA; Provisional;
                     Region: PRK10266"
                     /db_xref="CDD:182347"
     gene            430638..431969
                     /locus_tag="Rahaq2_4964"
                     /note="IMG reference gene:2506711988"
                     /db_xref="GeneID:11818473"
     CDS             430638..431969
                     /locus_tag="Rahaq2_4964"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220687.1"
                     /db_xref="GI:379704313"
                     /db_xref="GeneID:11818473"
                     /translation="MSSQGIWSVLGIEPTQDLSVIKRAYARQLKNTRPDQDPEGYQRL
                     REAFDAAKHQGNNTVLSDVVTDEMPPAEVPAPPFLPRPAPFEPVNEISQETYRDTALR
                     RKVISQAAKITDEMMENETAGLEHLDAFIKSNVLQNIELHELFSQELAEQLSDRDGLY
                     SALLINVSGIMGWDIDHYQPEGISAYRLAALQRQVEMTDAKRYWSVMVREYQDCALNR
                     LRLRLLTVEGATVPWWAKLVPDFMTSLSNKLREIRMYHPALLPYLNSVLLKTLSETRV
                     ALSWGAVFLNGFWLLLIMLTTREHSEPWRSRILLIAIIGLYIHGYSYLERKLRYRPRM
                     LCVTECVLSVLSTAIMVKIMLGFFTMFKPDAGNLVMAATHYGVLSASSFCVLWMMSPK
                     HWKWYGVPLNAMIVLAMLPWQLMRKSAGMVSVVAFIALLGVYSLLIAFGFR"
     misc_feature    430662..430823
                     /locus_tag="Rahaq2_4964"
                     /note="DnaJ domain; Region: DnaJ; pfam00226"
                     /db_xref="CDD:249696"
     misc_feature    order(430749..430751,430758..430763,430770..430775)
                     /locus_tag="Rahaq2_4964"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     gene            complement(432002..433483)
                     /locus_tag="Rahaq2_4965"
                     /note="IMG reference gene:2506711989"
                     /db_xref="GeneID:11818474"
     CDS             complement(432002..433483)
                     /locus_tag="Rahaq2_4965"
                     /note="PFAM: Alpha amylase, catalytic domain; Domain of
                     unknown function (DUF1939)"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosidase"
                     /protein_id="YP_005220688.1"
                     /db_xref="GI:379704314"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR013776"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR015237"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:11818474"
                     /translation="MQNPTLFQFFHWYYPDGGKLWPEVAEKAAWLAEIGITAAWLPPA
                     CKGESGGYSVGYDTYDLFDLGEFEQKGSRATKYGDKEGLLAAIGALKQHNLGVILDVV
                     LNHKMGADEKERVQVNRVNMDNREEISDDIIEAEAWTRFIFAARNGKYSKFIWDFHCF
                     SGVDHIENPDEQGIFKIVNDYTGGGWNDQVDDEFGNYDYLMGANVDFRNNAVSEELKY
                     WGRWIMEQTHCTGFRLDAVKHIPAWFYKEWIDHIQAEAEQPMYVVAEYWSFDVQTLQN
                     YIHQVEGKTMLFDAPLQLNFHHASKQGADFDLTTIFDNTLVAADASHAVTLVANHDTQ
                     PLQSLEAPVEPWFKPLAYALILLREQGVPIVFYPDLFGASYEDQGEDGNTYTINLPAV
                     THLETLIKARQNYAWGAQTDYFDHPNCIAFSRSGTAEHPGCVVVMSNGEAGEKTIELG
                     DNFAGKKWRDILENRGDVIETDENGSAQFYCEAGSVSVWIMTE"
     misc_feature    complement(432014..433483)
                     /locus_tag="Rahaq2_4965"
                     /note="cytoplasmic alpha-amylase; Reviewed; Region:
                     PRK09441"
                     /db_xref="CDD:236518"
     misc_feature    complement(432272..433477)
                     /locus_tag="Rahaq2_4965"
                     /note="Alpha amylase catalytic domain found in bacterial
                     and fungal Alpha amylases (also called
                     1,4-alpha-D-glucan-4-glucanohydrolase); Region:
                     AmyAc_bac_fung_AmyA; cd11318"
                     /db_xref="CDD:200457"
     misc_feature    complement(order(432488..432493,432602..432604,
                     432680..432685,432689..432691,432767..432772,
                     432776..432781,432785..432787,432878..432886,
                     433169..433171,433274..433276,433448..433450))
                     /locus_tag="Rahaq2_4965"
                     /note="active site"
                     /db_xref="CDD:200457"
     misc_feature    complement(order(432872..432874,432890..432892,
                     433172..433174))
                     /locus_tag="Rahaq2_4965"
                     /note="Na/Ca binding site [ion binding]; other site"
                     /db_xref="CDD:200457"
     misc_feature    complement(order(432488..432490,432689..432691,
                     432779..432781))
                     /locus_tag="Rahaq2_4965"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200457"
     misc_feature    complement(432017..432181)
                     /locus_tag="Rahaq2_4965"
                     /note="Domain of unknown function (DUF1939); Region:
                     DUF1939; pfam09154"
                     /db_xref="CDD:149998"
     gene            complement(433607..435109)
                     /locus_tag="Rahaq2_4966"
                     /note="IMG reference gene:2506711990"
                     /db_xref="GeneID:11818475"
     CDS             complement(433607..435109)
                     /locus_tag="Rahaq2_4966"
                     /note="PFAM: Sugar (and other) transporter; Osmosensory
                     transporter coiled coil;
                     TIGRFAM: metabolite-proton symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="metabolite-proton symporter"
                     /protein_id="YP_005220689.1"
                     /db_xref="GI:379704315"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR015041"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:11818475"
                     /translation="MRLRKKRVKPMQINDITIIDDTKLKKAITAAALGNAMEWFDFGV
                     YGFVAFALGQVFFPGADPGIQMIAALATFSVPFLVRPLGGLFFGALGDKFGRQKVLSV
                     TIIIMSVSTFCIGLIPGYASIGIWAPILLLLAKLAQGFSVGGEYTGAAIFVAEYSPDR
                     KRGFLGSWLDFGSIAGFILGAGVVVLISSIVGEANFLEWGWRIPFFIAAPLGLIGIYL
                     RHALEETPTFQQHVDKIDSDARKDIAEPPRVSFREILTKQWRPLIICVGMVIATNVTY
                     YMLLTYMPSYLSHSLHYSEDHGVLIIIAIMVGMLFVQPFMGMLSDRFGRKPFVIIGSI
                     GLFILAIPCFILINSDVIGLIFLGLLILAVLLNCFIGVMASTLPAMFPTHIRYSALAI
                     AFNVSVLIAGLTPTIAAWLVETTNNLYMPAYYLMVVAMIGLVTGIFMKETANRPLKGA
                     TPAASDRAEAREILQEHHDNIEQKIEDIDAQIIELEAKRKNLIAQHPDIN"
     misc_feature    complement(433610..435079)
                     /locus_tag="Rahaq2_4966"
                     /note="proline/glycine betaine transporter; Provisional;
                     Region: PRK10642"
                     /db_xref="CDD:182611"
     misc_feature    complement(433793..435028)
                     /locus_tag="Rahaq2_4966"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(433907..433909,433916..433921,
                     433928..433933,433940..433945,433976..433978,
                     433985..433990,434000..434002,434009..434014,
                     434021..434023,434171..434173,434183..434185,
                     434192..434194,434204..434206,434216..434218,
                     434258..434260,434267..434272,434279..434284,
                     434291..434293,434579..434581,434597..434602,
                     434609..434614,434648..434650,434657..434662,
                     434669..434674,434681..434686,434846..434851,
                     434855..434860,434870..434872,434879..434884,
                     434891..434893,434960..434965,434969..434977,
                     434984..434986))
                     /locus_tag="Rahaq2_4966"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    complement(433610..433747)
                     /locus_tag="Rahaq2_4966"
                     /note="Osmosensory transporter coiled coil; Region:
                     Osmo_CC; pfam08946"
                     /db_xref="CDD:149880"
     gene            435402..436583
                     /locus_tag="Rahaq2_4967"
                     /note="IMG reference gene:2506711991"
                     /db_xref="GeneID:11818476"
     CDS             435402..436583
                     /locus_tag="Rahaq2_4967"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220690.1"
                     /db_xref="GI:379704316"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="GeneID:11818476"
                     /translation="MAKGSQIQFSFHTVQDPQTGVRVTRLTPPDVLCHRNYFYQKCFT
                     RDGNKLLFAGEFDGNRNYYLLDLGTQKAVQLTEGKGDNTFGGFLSPDDQFLYYVKNER
                     SLQRVTLADFSEHTVYQVPEEWVGYGTWVANSECTSLVGIEISREDWTPLSDWKIFQE
                     FYHSNPHCRLLRVDLLSGKSRVIHEKNEWLGHPIYRPFDDSTVAFCHEGPHDLVDARM
                     WLVNEDGSDVRKVKEHAPGESCTHEFWVPDGSALMYVSYLKGQHDRHIRRFDPQTGED
                     ICLMTMPACSHLMSNENGTLLVGDGSGTPVDVKDTASHTIENDPWLYIFDARTRRHAP
                     LAAHNSSWQVLDGDRQVTHPHPSFSPDDRHVLFTTDYEGLPALYLAEIPDALLSSLRK
                     D"
     misc_feature    435405..436553
                     /locus_tag="Rahaq2_4967"
                     /note="Oligogalacturonate lyase; Region: Pectate_lyase22;
                     pfam14583"
                     /db_xref="CDD:258721"
     gene            436587..436907
                     /locus_tag="Rahaq2_4968"
                     /note="IMG reference gene:2506711992"
                     /db_xref="GeneID:11818477"
     CDS             436587..436907
                     /locus_tag="Rahaq2_4968"
                     /note="PFAM: Cupin domain"
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="YP_005220691.1"
                     /db_xref="GI:379704317"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="GeneID:11818477"
                     /translation="MFTFKKDIPLQDLGDGVSRRVLAHDGTMMAVEVYFEEGAVGPMH
                     NHVHEQLTYVLSGRFKFTIGEETHEVSAGDTLYKKPYIMHGCVCLEKGVLLDTFTPQR
                     QDFL"
     misc_feature    436611..436886
                     /locus_tag="Rahaq2_4968"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            complement(436977..437615)
                     /locus_tag="Rahaq2_4969"
                     /note="IMG reference gene:2506711993"
                     /db_xref="GeneID:11818478"
     CDS             complement(436977..437615)
                     /locus_tag="Rahaq2_4969"
                     /note="PFAM: Ribose-5-phosphate isomerase;
                     Ribose/Galactose Isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 5-phosphate isomerase RpiB"
                     /protein_id="YP_005220692.1"
                     /db_xref="GI:379704318"
                     /db_xref="InterPro:IPR003500"
                     /db_xref="InterPro:IPR022133"
                     /db_xref="GeneID:11818478"
                     /translation="MKIALMMENSQAAKNAIILKELNAVASEKEYPVYNVGMSDEQDH
                     HLTYIHLGIMASILLNSKAVDFVVAGCGTGQGALMSLNIHPGVNCGYCIDPADAFLFA
                     QINNGNALSLPFAKGFGWGAELNVRFIFEKAFTGVKGEGYPADRKEPQVRNAGILNQV
                     KAAVVKENYLDTLRAIDPELVKTAVTGERFQKCFFENCQNKEIETFVREILA"
     misc_feature    complement(436980..437615)
                     /locus_tag="Rahaq2_4969"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09273"
                     /db_xref="CDD:181746"
     misc_feature    complement(437139..437615)
                     /locus_tag="Rahaq2_4969"
                     /note="Ribose 5-phosphate isomerase RpiB [Carbohydrate
                     transport and metabolism]; Region: RpiB; COG0698"
                     /db_xref="CDD:223770"
     misc_feature    complement(436986..437129)
                     /locus_tag="Rahaq2_4969"
                     /note="Ribose-5-phosphate isomerase; Region: DUF3666;
                     pfam12408"
                     /db_xref="CDD:257031"
     gene            complement(437684..438445)
                     /locus_tag="Rahaq2_4970"
                     /note="IMG reference gene:2506711994"
                     /db_xref="GeneID:11818479"
     CDS             complement(437684..438445)
                     /locus_tag="Rahaq2_4970"
                     /note="PFAM: short chain dehydrogenase;
                     TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-deoxy-D-gluconate 3-dehydrogenase"
                     /protein_id="YP_005220693.1"
                     /db_xref="GI:379704319"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11818479"
                     /translation="MILDNFSLQGKVAVVTGCDTGLGQGMAIGLAEAGCDIVGINIVE
                     PTETIERVGATGRRFLSLTADLSDTKVIPALLERAVAEMGHLDILVNNAGIIRREDAI
                     EFSEKNWDDVMNLNIKSVFFMSQAVAKQFIAQGTGGKIINIASMLSYQGGIRVPSYTA
                     SKSAVMGVTRLLANEWAKHNINVNAIAPGYMATNNTQQLRADEARSEEILGRIPAGRW
                     GLPSDLMGPVVFLSSPASDYINGYTIAVDGGWLAR"
     misc_feature    complement(437687..438445)
                     /locus_tag="Rahaq2_4970"
                     /note="2-deoxy-D-gluconate 3-dehydrogenase; Validated;
                     Region: PRK08993"
                     /db_xref="CDD:181605"
     misc_feature    complement(437690..438430)
                     /locus_tag="Rahaq2_4970"
                     /note="gluconate 5-dehydrogenase (Ga5DH)-like, classical
                     (c) SDRs; Region: Ga5DH-like_SDR_c; cd05347"
                     /db_xref="CDD:187605"
     misc_feature    complement(order(437858..437869,437873..437884,
                     437960..437962,437972..437974,438011..438019,
                     438101..438103,438161..438172,438248..438256,
                     438317..438325,438380..438391,438395..438397))
                     /locus_tag="Rahaq2_4970"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187605"
     misc_feature    complement(order(437918..437926,437930..437938,
                     437942..437947,437954..437959,437966..437971,
                     437978..437983,437999..438007,438062..438064,
                     438071..438073,438080..438085,438092..438094,
                     438107..438109,438116..438121,438128..438130,
                     438134..438148,438239..438241))
                     /locus_tag="Rahaq2_4970"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187605"
     misc_feature    complement(order(437960..437962,437972..437974,
                     438011..438013,438098..438100))
                     /locus_tag="Rahaq2_4970"
                     /note="active site"
                     /db_xref="CDD:187605"
     gene            complement(438839..439195)
                     /locus_tag="Rahaq2_4971"
                     /note="IMG reference gene:2506711995"
                     /db_xref="GeneID:11818480"
     CDS             complement(438839..439195)
                     /locus_tag="Rahaq2_4971"
                     /note="PFAM: Bacterial regulatory helix-turn-helix
                     proteins, AraC family"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding domain-containing protein"
                     /protein_id="YP_005220694.1"
                     /db_xref="GI:379704320"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="GeneID:11818480"
                     /translation="MRTEDFIHDLIEWIDHNLEERLDIKTVAKRAGYSRWYLQRMFKE
                     HTGLPMGEYIREKKLKKSADMLASSGEPIVSVAISLGFDSQQSFTRSFKRQFGQTPGD
                     WRRGLNLATECQGCLH"
     misc_feature    complement(438875..439195)
                     /locus_tag="Rahaq2_4971"
                     /note="DNA-binding transcriptional regulator SoxS;
                     Provisional; Region: PRK10219"
                     /db_xref="CDD:182314"
     misc_feature    complement(439031..439156)
                     /locus_tag="Rahaq2_4971"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(438881..438994)
                     /locus_tag="Rahaq2_4971"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            439553..440776
                     /locus_tag="Rahaq2_4972"
                     /note="IMG reference gene:2506711996"
                     /db_xref="GeneID:11818481"
     CDS             439553..440776
                     /locus_tag="Rahaq2_4972"
                     /note="PFAM: HlyD family secretion protein;
                     TIGRFAM: RND family efflux transporter, MFP subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter, MFP subunit"
                     /protein_id="YP_005220695.1"
                     /db_xref="GI:379704321"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:11818481"
                     /translation="MMNLQKSQVVVRGRSGGTPLTLRLSGVALMVALLAGCDNSVAQN
                     AAPPAPQVSAADVLIKPISQWDAFNGRVEAVQSVQLRPRVSGYIDKVNYQEGQEVKKG
                     QVLFTIDDRTYRAAQEQAKAELVRARNQASLARSESARTEALIGTLAVSKEVAEQRRS
                     AASQAQSDVLAAQAQLDMAQLNLDFTRVISPIDGRASRAMITTGNLVTAGDSASVLTT
                     VVSLDTVYVYFDVDEGTFLRYQALAREGKLNDSPQSRLPVHVGLVGENGYPHQGVVDF
                     TDNQLNAGTGTIRMRALLDNRDRTFTPGLFARVQMPGSAQFNALLVDDKAILTDQDRK
                     FVYVVDKEGKAQRRDVEIGRMFGGLRIVQKGLEAGDRVIIDGVQKVFMPGMPVNAKTV
                     SMAANTVTPAAPAVQ"
     misc_feature    439706..440713
                     /locus_tag="Rahaq2_4972"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    439778..439924
                     /locus_tag="Rahaq2_4972"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    440111..440464
                     /locus_tag="Rahaq2_4972"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            440793..443945
                     /locus_tag="Rahaq2_4973"
                     /note="IMG reference gene:2506711997"
                     /db_xref="GeneID:11818482"
     CDS             440793..443945
                     /locus_tag="Rahaq2_4973"
                     /note="PFAM: AcrB/AcrD/AcrF family;
                     TIGRFAM: The (Largely Gram-negative Bacterial)
                     Hydrophobe/Amphiphile Efflux-1 (HAE1) Family"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrophobe/amphiphile efflux-1 (HAE1) family
                     transporter"
                     /protein_id="YP_005220696.1"
                     /db_xref="GI:379704322"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="GeneID:11818482"
                     /translation="MDFSRFFIDRPIFAAVLSILILVTGAIAIPLLPVSEYPNVVPPS
                     VQVRAEYPGANPKVIAETVATPLEEAINGVENMVYMKSVAGSDGVLVTTVTFRPGTDP
                     DQAQVQVQNRVAQAEARLPEDVRRQGVTTQKQSPTLTLVVHLVSPSGKYDSLYLSNYA
                     TLKVKDELARLPGVGQIQIFGAGEYAMRVWLDPNKVAARGLTASDIVKAMQEQNVQVS
                     AGQLGAEPMPKDSDYLLSINAQGRLKDEDEFGKIILKSGDNGEIVRLRDVARIEMGSG
                     SYALRAQLNNKDAVGIGIFQSPGANAIDLSDAVRAKMDELATRFPEGMTWRAPYDPTV
                     FVRDSISAVVHTLLEAVVLVVLVVILFLQTWRASIIPLLAVPISVIGTFSILYLLGFS
                     LNTLSLFGLVLAIGIVVDDAIVVVENVERNIEEGLAPRDAAHQAMREVSGPIVAIALV
                     LCAVFVPMAFLSGVTGQFYKQFAVTIAISTVISAINSLTLSPALAALLLKSHGAPKDM
                     PSRLIDRLFGWIFRPFNRFFNASSHRYQNAVSKTLGRRGAVFAVYILLLCAAAFMFKA
                     VPGGFIPTQDKLYLIAGVKMPEGASLSRTDAVIRKISAMGLSTDGVIDAVAFPGLNAL
                     QFTNTPNTGTVFFALKPLSERTRTAAEINAEINAKISQIQEGFAFSIMPPPILGLGQG
                     SGYSLYVQDRAGLGYGALQTAINTMSGAIMQTPGMGYPISSYQANVPQLDAHIDRDKA
                     KAQGVSLDELFSTLQVYLGSAYINDFNRFGRTWKVMAQADGQFRDTVEDIANLRTRND
                     KGEMVPIGSMLNITTTYGPDPVIRYNGYPAADLIGDADPRVLSSTQAMTELIAMSKNL
                     LPNGMNIEWTDLSYQQSTQGNAALIVFPMSVLLAFLVLAALYESWTLPLAVILIVPMT
                     MLSALFGVWLTGGDNNVFVQVGLVVLMGLACKNAILIVEFARELELQGKGIIESALEA
                     CRLRLRPIVMTSIAFIAGTIPLILGHGAGAEVRGVTGITVFSGMLGVTLFGLFLTPVF
                     YVALRKLVTRKKAVLETQTA"
     misc_feature    440799..443915
                     /locus_tag="Rahaq2_4973"
                     /note="The (Largely Gram-negative Bacterial)
                     Hydrophobe/Amphiphile Efflux-1 (HAE1) Family; Region:
                     2A0602; TIGR00915"
                     /db_xref="CDD:233182"
     gene            complement(444035..444520)
                     /locus_tag="Rahaq2_4974"
                     /note="IMG reference gene:2506711998"
                     /db_xref="GeneID:11818483"
     CDS             complement(444035..444520)
                     /locus_tag="Rahaq2_4974"
                     /note="PFAM: Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005220697.1"
                     /db_xref="GI:379704323"
                     /db_xref="InterPro:IPR000944"
                     /db_xref="GeneID:11818483"
                     /translation="MLDYRFPTAMQMVFCIAQSQKAGQRCTSAILATGLEANSSFIRK
                     LMVPLTQHGIIVSTLGRTGSITLGRPAEEITLRDIYCAVIEDKRLWAARPDVPARCVV
                     SANACTYFKNIVSEAEEASFQVLARHTVADALAEFERGGKYKCTKDLAAQNAEDSLCS
                     K"
     misc_feature    complement(444104..444466)
                     /locus_tag="Rahaq2_4974"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG1959"
                     /db_xref="CDD:224870"
     gene            complement(444733..445890)
                     /locus_tag="Rahaq2_4975"
                     /note="IMG reference gene:2506711999"
                     /db_xref="GeneID:11818484"
     CDS             complement(444733..445890)
                     /locus_tag="Rahaq2_4975"
                     /note="PFAM: Gram-negative porin"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein (porin)"
                     /protein_id="YP_005220698.1"
                     /db_xref="GI:379704324"
                     /db_xref="InterPro:IPR001702"
                     /db_xref="InterPro:IPR001897"
                     /db_xref="InterPro:IPR013793"
                     /db_xref="GeneID:11818484"
                     /translation="MKLKALALIIPALLVAGAAHSAEVYNKEGNKLDLYGKVDARHQF
                     SDDAGQDGDETYVRVGFKGETQITDQLTGFGQWEYNVQANNSESSGTAGNATRLGFAG
                     LKFGDFGSFDYGRNYGVVYDIEAWTDMLPVFGGDTYTTTDNFMVGRTNGVATYRNTDF
                     FGEVKGWNFALQYQGANDGDNNSEDVNYNAAGEGTNNGRDVRHQNGDGYALSTTYDFG
                     MGITAGAAYASSDRTNDQTASAGENFAGGDKADVWTVGAKYDANNVYLATMYSETRNM
                     TMFGDSGVANKTQNFEVTAQYQFDFGLRPEVSYLQSKGKDLTADGSNTSDNNDKDLVK
                     YVSVGANYYFNKNMSTYVDYKINLLDSDDEFYTNQGISTDDVVGVGLQYQF"
     misc_feature    complement(444736..445803)
                     /locus_tag="Rahaq2_4975"
                     /note="Porins form aqueous channels for the diffusion of
                     small hydrophillic molecules across the outer membrane.
                     Individual 16-strand anti-parallel beta-barrels form a
                     central pore, and trimerizes thru mainly hydrophobic
                     interactions at the interface. Trimers...; Region:
                     gram_neg_porins; cd00342"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(444736..444738,444742..444744,
                     444748..444750,444847..444849,444856..444861,
                     445438..445443,445447..445449,445546..445554,
                     445582..445596,445600..445605,445639..445650,
                     445654..445656,445660..445668,445672..445674,
                     445690..445704,445765..445773,445777..445779,
                     445795..445797,445801..445803))
                     /locus_tag="Rahaq2_4975"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238208"
     misc_feature    complement(order(445447..445449,445507..445509,
                     445600..445602,445717..445719,445780..445782))
                     /locus_tag="Rahaq2_4975"
                     /note="eyelet of channel; other site"
                     /db_xref="CDD:238208"
     gene            complement(446502..446690)
                     /locus_tag="Rahaq2_4976"
                     /note="IMG reference gene:2506712000"
                     /db_xref="GeneID:11818485"
     CDS             complement(446502..446690)
                     /locus_tag="Rahaq2_4976"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220699.1"
                     /db_xref="GI:379704325"
                     /db_xref="GeneID:11818485"
                     /translation="MSTTVHIAERRSLWQRITHPKFNNPQAERAQDTSRLLESFLATG
                     CLYGIDVGNSDPAWFRRS"
     gene            complement(446851..447261)
                     /locus_tag="Rahaq2_4977"
                     /note="IMG reference gene:2506712001"
                     /pseudo
                     /db_xref="GeneID:11818486"
     gene            447492..448271
                     /locus_tag="Rahaq2_4978"
                     /note="IMG reference gene:2506712002"
                     /db_xref="GeneID:11818487"
     CDS             447492..448271
                     /locus_tag="Rahaq2_4978"
                     /note="PFAM: short chain dehydrogenase;
                     TIGRFAM: acetoin reductases"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin reductase family protein"
                     /protein_id="YP_005220700.1"
                     /db_xref="GI:379704326"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="GeneID:11818487"
                     /translation="MSKNGKVALVTGGGQGIGRAIALRLAKDGFAVAVVDFNAETAKK
                     VAEEINHAGGKAIAQLADVSDREQVFAAVEAATKQLGGFDVIVNNAGIAPTTLIEDIT
                     PEIVDKVYNINVKGVIWGIQAAVKAFKSQGHGGKIINASSQAGHVGNPELAIYSSSKF
                     AVRGLTQTAARDLALLGITVNAYCPGIVKTPMWEEIDRQVSEAAGKPVGYGTQEFAKN
                     ITLKRLSEPEDVAACVSYLAGPDSDYMTGQALLIDGGMVFN"
     misc_feature    447501..448268
                     /locus_tag="Rahaq2_4978"
                     /note="acetoin reductase; Validated; Region: PRK08643"
                     /db_xref="CDD:181518"
     misc_feature    447501..448268
                     /locus_tag="Rahaq2_4978"
                     /note="meso-2,3-butanediol dehydrogenase-like, classical
                     (c) SDRs; Region: meso-BDH-like_SDR_c; cd05366"
                     /db_xref="CDD:187624"
     misc_feature    order(447525..447527,447534..447542,447597..447605,
                     447672..447680,447756..447764,447825..447827,
                     447909..447917,447954..447956,447966..447968,
                     448044..448055,448059..448070)
                     /locus_tag="Rahaq2_4978"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187624"
     misc_feature    order(447561..447563,447783..447788,447792..447794,
                     447798..447800,447807..447812,447819..447821,
                     447831..447836,447843..447848,447852..447857,
                     447927..447944,447948..447950,447960..447962,
                     447969..447974,447978..447986,447990..447998,
                     448002..448007,448011..448013,448146..448154,
                     448158..448160,448176..448178,448185..448190,
                     448197..448199,448212..448214,448218..448235,
                     448239..448256,448260..448268)
                     /locus_tag="Rahaq2_4978"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187624"
     misc_feature    order(447783..447788,447792..447794,447798..447800,
                     447807..447812,447819..447821,447831..447836,
                     447843..447848,447852..447857,447927..447944,
                     447948..447950,447960..447962,447969..447974,
                     447978..447986,447990..447998,448002..448007)
                     /locus_tag="Rahaq2_4978"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187624"
     misc_feature    order(447828..447830,447915..447917,447954..447956,
                     447966..447968)
                     /locus_tag="Rahaq2_4978"
                     /note="active site"
                     /db_xref="CDD:187624"
     misc_feature    order(447915..447920,447954..447956,448044..448049,
                     448068..448070)
                     /locus_tag="Rahaq2_4978"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187624"
     gene            complement(448337..449203)
                     /locus_tag="Rahaq2_4979"
                     /note="IMG reference gene:2506712003"
                     /db_xref="GeneID:11818488"
     CDS             complement(448337..449203)
                     /locus_tag="Rahaq2_4979"
                     /note="PFAM: Bacterial transcription activator, effector
                     binding domain; Bacterial regulatory helix-turn-helix
                     proteins, AraC family"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding domain-containing protein"
                     /protein_id="YP_005220701.1"
                     /db_xref="GI:379704327"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR010499"
                     /db_xref="InterPro:IPR011256"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="GeneID:11818488"
                     /translation="MQSEQKPDFHDDLIKELLYWIEVNLSDRLTMEKASKKTGYSPWY
                     LQRLFKSKTGYALGKYIRDRRLTMAAIALRLTNMPILDISLYYSYDSQQTFTRSFKKN
                     FAETPGTYRRNASWTMNGITAPLTVDEFPQPEYEIVELPEMAFEGNTVSHSYPIEALF
                     NSKNHVHRAELLRYLETPASLQAPVWGLSDCRPDTNDEVANALQMDYTVAHQVQTSDS
                     HNILVPASRYLKINYPYDLSRLNDFILYLYSVFLPTLGLEFIMQPDLEKYSRESALKG
                     VTCEYYIPLARQ"
     misc_feature    complement(448343..449170)
                     /locus_tag="Rahaq2_4979"
                     /note="right oriC-binding transcriptional activator;
                     Provisional; Region: PRK15121"
                     /db_xref="CDD:185076"
     misc_feature    complement(449018..449143)
                     /locus_tag="Rahaq2_4979"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(448346..448807)
                     /locus_tag="Rahaq2_4979"
                     /note="GyrI-like small molecule binding domain; Region:
                     GyrI-like; pfam06445"
                     /db_xref="CDD:253735"
     gene            complement(449293..449919)
                     /locus_tag="Rahaq2_4980"
                     /note="IMG reference gene:2506712004"
                     /db_xref="GeneID:11818489"
     CDS             complement(449293..449919)
                     /locus_tag="Rahaq2_4980"
                     /note="PFAM: Bacterial regulatory proteins, tetR family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220702.1"
                     /db_xref="GI:379704328"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011075"
                     /db_xref="InterPro:IPR015893"
                     /db_xref="GeneID:11818489"
                     /translation="MAYLCKEARRTTILEAAARVARREGLAATTVRRVALEAGAATGQ
                     VHHHFSSAAELRAQAYTQVMKVLKDQLLEQCQTLTARERLNLFLIDSKDEHSLMAIPL
                     WHEAMLLTEQEPLMKAAFALSVTDWHEMVSDAITLGRQKGEFVEGESPAHISWRLIGL
                     SSSMDAMARLESLGLTADCAEYHLHRAIENELYNREPDLKEASVFKIR"
     misc_feature    complement(449341..449919)
                     /locus_tag="Rahaq2_4980"
                     /note="TetR family transcriptional regulator; Provisional;
                     Region: PRK14996"
                     /db_xref="CDD:184958"
     misc_feature    complement(449755..449883)
                     /locus_tag="Rahaq2_4980"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(450089..451795)
                     /locus_tag="Rahaq2_4981"
                     /note="IMG reference gene:2506712005"
                     /db_xref="GeneID:11818490"
     CDS             complement(450089..451795)
                     /locus_tag="Rahaq2_4981"
                     /note="PFAM: Tannase and feruloyl esterase"
                     /codon_start=1
                     /transl_table=11
                     /product="tannase and feruloyl esterase"
                     /protein_id="YP_005220703.1"
                     /db_xref="GI:379704329"
                     /db_xref="InterPro:IPR011118"
                     /db_xref="GeneID:11818490"
                     /translation="MHIRRVFLNAQPPKDFFHWPFNDKLPLLSRRNERCLMKASLYLC
                     PLVLFTATVVAAPEKGLTEAQCVALKNTHINAAAIGLPTRGARVITVAMAGHPGNQHC
                     KIEGQIKPVALNAPDINFELYLPLNWNGKALQLGGSGFDGAIKDADTARLAPAATPGA
                     IKQGYATFGSDSGHQGGVSDASFTLNEEAWDNFAGAQIKKTHDVAIALIQQAYGRKPA
                     HMYFQGNSQGGHEALAAIQRFPLDYDGAIAIHPVYNVVELHIAGISIGKAIYNTPGAW
                     ISPAKAALIANAVTGACDKLDGLADGVVANPDACSTTFKLSHLRCPEGKDAGAHCLSD
                     TQIALVQMLNKPVPLGVSLLTGDHFAPWPILRGADASALVSVFGSGADRPKPEASNII
                     ISFPYMMGDQAVRYEVMRDANYDSLRFNPAAHEARLKVLAEQVDNNNADIRTFVQHGG
                     KLLLMHGTADMAVPPGNTVAYYEKLKAEFGDQELHQFARFYLAPGFTHSSGTYRASWD
                     SLGALDKWVVHGIDPGQQVMIDTNKVTAGREMPLCDYPLFPRYNGQGNPKVASSFTCA
                     AK"
     misc_feature    complement(450098..451492)
                     /locus_tag="Rahaq2_4981"
                     /note="Tannase and feruloyl esterase; Region: Tannase;
                     pfam07519"
                     /db_xref="CDD:254255"
     gene            452022..452189
                     /locus_tag="Rahaq2_4982"
                     /note="IMG reference gene:2506712006"
                     /db_xref="GeneID:11818491"
     CDS             452022..452189
                     /locus_tag="Rahaq2_4982"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220704.1"
                     /db_xref="GI:379704330"
                     /db_xref="GeneID:11818491"
                     /translation="MKNLFKLALLAAVVTTLSGCTGSVFNKEKNCDYTYLLHPAISIS
                     KMIGGCGPAEK"
     misc_feature    452022..452186
                     /locus_tag="Rahaq2_4982"
                     /note="Protein of unknown function (DUF4223); Region:
                     DUF4223; pfam13978"
                     /db_xref="CDD:206148"
     gene            452218..452391
                     /locus_tag="Rahaq2_4983"
                     /note="IMG reference gene:2506712007"
                     /db_xref="GeneID:11818492"
     CDS             452218..452391
                     /locus_tag="Rahaq2_4983"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220705.1"
                     /db_xref="GI:379704331"
                     /db_xref="GeneID:11818492"
                     /translation="MSGICDSAIPTFVIFTRSPFFIHEYQAKTFLVTTCNKFININNI
                     ENLTKRVWFIATA"
     gene            complement(452484..454625)
                     /locus_tag="Rahaq2_4984"
                     /note="IMG reference gene:2506712008"
                     /db_xref="GeneID:11818493"
     CDS             complement(452484..454625)
                     /locus_tag="Rahaq2_4984"
                     /note="PFAM: Methyltransferase domain;
                     Formylglycine-generating sulfatase enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220706.1"
                     /db_xref="GI:379704332"
                     /db_xref="InterPro:IPR005532"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR016187"
                     /db_xref="GeneID:11818493"
                     /translation="MLSKQNKAIGLPEPTQTILLSTGTAEEKRQEIRDYFIQTWELYE
                     SLFDCLADERAYYNKAISLRHPLIFYFGHTATFYINKLIAAGLIPQRIDSHIEAMLAI
                     GVDEMSWDDLDDQNYNWPSVVNLRQYRDKVREEVLGIIDTMTLSLPIGWDSPAWVILM
                     GIEHERIHLETSSVLIRQLPVEWVKPQSHWPACEIARHDRNSVPENSVLAVKGDIVTL
                     GKHDDTYGWDNEYGTSVQKIQAFSASKMLVSNAEFYTFVQAGGYHETRWWDEEGAGWR
                     DFARAEMPTFWVGSPGEPERLKLRLMTEEVPMPWDWPAEVNQLEAAAFCRWKAAQTGE
                     SVQLPTEAEWMILRDQVPGDQPDWKTAPGNINLAWWASSCPVDHFAQGDFYDVVGNVW
                     QWASTPISGFDGFRVHPLYDDFSTPTFDGKHSMIKGGSWISTGNEALKSSRYAFRRHF
                     FQHAGFRYVISSHQELVTVNPYETDGLVAQYLDFQYGPRHFDVMNYAAQLADIAVENT
                     IHRGRALDIGCATGRASFELARHFDSVVGMDYSARFIDVALALARGEACRYVIPEEGE
                     LVDYCQASLADVNISAEQTARVTFVQGDACNLKPQAELYDLVLAANLLDRLREPARFL
                     ADITPMIRSGGLLMLSSPYTWLEEFTPKEHWLGGFRENGEAVTTHQALKRLLASEFEE
                     VRKPTDVPFVIRETARKFQHTVAELTLWRKR"
     misc_feature    complement(453249..454580)
                     /locus_tag="Rahaq2_4984"
                     /note="5-histidylcysteine sulfoxide synthase; Region:
                     ovoA_Nterm; TIGR04344"
                     /db_xref="CDD:234555"
     misc_feature    complement(454113..454523)
                     /locus_tag="Rahaq2_4984"
                     /note="DinB superfamily; Region: DinB_2; pfam12867"
                     /db_xref="CDD:257360"
     misc_feature    complement(453246..453962)
                     /locus_tag="Rahaq2_4984"
                     /note="Sulfatase-modifying factor enzyme 1; Region:
                     FGE-sulfatase; cl19582"
                     /db_xref="CDD:267935"
     misc_feature    complement(<452685..453089)
                     /locus_tag="Rahaq2_4984"
                     /note="Methyltransferase domain; Region: Methyltransf_31;
                     pfam13847"
                     /db_xref="CDD:258120"
     misc_feature    complement(452706..453089)
                     /locus_tag="Rahaq2_4984"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(452793..452795,452841..452849,
                     453006..453011,453057..453077))
                     /locus_tag="Rahaq2_4984"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(454772..454909)
                     /locus_tag="Rahaq2_4985"
                     /note="IMG reference gene:2506712009"
                     /db_xref="GeneID:11818494"
     CDS             complement(454772..454909)
                     /locus_tag="Rahaq2_4985"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220707.1"
                     /db_xref="GI:379704333"
                     /db_xref="GeneID:11818494"
                     /translation="MKQALEAFSDNIQGIIDAPDYYNVRRQFEGESLHVRENSLLFME
                     R"
     gene            complement(455123..456670)
                     /locus_tag="Rahaq2_4986"
                     /note="IMG reference gene:2506712010"
                     /db_xref="GeneID:11818495"
     CDS             complement(455123..456670)
                     /locus_tag="Rahaq2_4986"
                     /note="PFAM: HAMP domain; Methyl-accepting chemotaxis
                     protein (MCP) signaling domain; Tar ligand binding domain
                     homologue"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_005220708.1"
                     /db_xref="GI:379704334"
                     /db_xref="InterPro:IPR003122"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:11818495"
                     /translation="MSLKKSSLLVLVILFALFFTSMLSNVWLLTRSNHSLDDVNKEIR
                     VVLSIIDPINHSRTSRVRVMEYMKEIENGDGQQSKPALDGVIEVVGKADAAFQAYLDA
                     PKLPGESGLAGEYRNTYQKYRQNGIQPLIEAAKAGDQIAFKTQIPEVVKLDRQYEIVL
                     DKVLALHEQYAKNLNSDAQSHFKFGIGLTVGFGLLFLIIIISVLMLMKRFVLTPLLSS
                     RDHCRQIAEGYLDTPVPVKAQSRSEIEELMQSIEHMRQSLTRIIGQVRDTSHTVAHAS
                     QEISAGNIDLASRTEQQAAALTQTAASMEELGATVKQNTENVSRASSLTREAVQNARA
                     GEKVAQDVIGTMGRINSSSKKIEDITGVINSIAFQTNILALNAAVEAARAGEQGRGFA
                     VVASEVRSLAQRSAVAAKEIESLISESVANIREGSDQVSRTGDSISAIISSVSQINVL
                     MEHISIASDEQSRGISQIEQAVTEIDGVTQQNAALVQESAAAAASLEEQVLHLTRSVS
                     AFRLATV"
     misc_feature    complement(456236..456625)
                     /locus_tag="Rahaq2_4986"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(order(456212..456214,456221..456226,
                     456236..456238,456242..456247,456464..456469,
                     456473..456478,456485..456490,456497..456502))
                     /locus_tag="Rahaq2_4986"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206638"
     misc_feature    complement(order(456224..456226,456236..456238,
                     456242..456247,456473..456475,456485..456487,
                     456500..456502))
                     /locus_tag="Rahaq2_4986"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:206638"
     misc_feature    complement(455891..456040)
                     /locus_tag="Rahaq2_4986"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(455897..455902,455909..455914,
                     455918..455923,455930..455935,455939..455944,
                     455996..455998,456002..456007,456014..456019,
                     456023..456028,456035..456040))
                     /locus_tag="Rahaq2_4986"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(455138..455881)
                     /locus_tag="Rahaq2_4986"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(455207..455764)
                     /locus_tag="Rahaq2_4986"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(455207..455209,455216..455218,
                     455225..455230,455237..455239,455246..455251,
                     455255..455260,455267..455272,455276..455281,
                     455288..455290,455297..455302,455309..455311,
                     455318..455323,455330..455335,455339..455344,
                     455351..455353,455360..455365,455372..455374,
                     455381..455386,455423..455428,455435..455440,
                     455444..455449,455456..455461,455468..455470,
                     455477..455482,455489..455491,455498..455500,
                     455510..455512,455531..455533,455540..455542,
                     455552..455554,455561..455566,455573..455575,
                     455582..455584,455591..455596,455603..455608,
                     455615..455617,455624..455629,455633..455635,
                     455645..455650,455654..455659,455666..455668,
                     455675..455680,455687..455692,455699..455701,
                     455708..455713,455720..455722,455729..455734,
                     455738..455743,455750..455752,455759..455764))
                     /locus_tag="Rahaq2_4986"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(455465..455566)
                     /locus_tag="Rahaq2_4986"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            457520..458014
                     /locus_tag="Rahaq2_4987"
                     /note="IMG reference gene:2506712011"
                     /db_xref="GeneID:11818496"
     CDS             457520..458014
                     /locus_tag="Rahaq2_4987"
                     /note="PFAM: Protein of unknown function (DUF770);
                     TIGRFAM: type VI secretion protein, VC_A0107 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="YP_005220709.1"
                     /db_xref="GI:379704335"
                     /db_xref="InterPro:IPR008312"
                     /db_xref="GeneID:11818496"
                     /translation="MSNSFQNEIPKARVNIKLDLHTGGAQKKVELPLKLMVMGDYSNG
                     KENRPLSEREKVNINKNNFNSVLAEFSPSLNLTVENTLAGDRSEENISLNFNEMKDFE
                     PEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKELETILKDPALSNELRSELNAL
                     APKA"
     misc_feature    457532..457999
                     /locus_tag="Rahaq2_4987"
                     /note="Protein of unknown function (DUF770); Region:
                     DUF770; pfam05591"
                     /db_xref="CDD:253266"
     gene            458052..459593
                     /locus_tag="Rahaq2_4988"
                     /note="IMG reference gene:2506712012"
                     /db_xref="GeneID:11818497"
     CDS             458052..459593
                     /locus_tag="Rahaq2_4988"
                     /note="PFAM: Protein of unknown function (DUF877);
                     TIGRFAM: type VI secretion protein, EvpB/VC_A0108 family"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein EvpB"
                     /protein_id="YP_005220710.1"
                     /db_xref="GI:379704336"
                     /db_xref="InterPro:IPR010269"
                     /db_xref="GeneID:11818497"
                     /translation="MSVNTENSSSSQTTVLDRPEAGTVYASLFDKINLTPVSSLGDLN
                     DFQDTSALADVTADQRVTAAVQVFLERLKLSGQTVERLDKTLLDHHIAELDSQISRQL
                     DVVMHHPEFQRIESGWRGLKFLVDRTDFRQNVKIELLDVSKDDLRQDFEDCPEIIQSG
                     LYRHTYIQEYDTPGGEPIGSVISNYEFDASAQDVALLRNISKVSAAAHMPFVGAVGPK
                     FFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDSDDSRYIGLTMPRVLARLPYGPDTV
                     PVRSFNYVEEVKGPDHEKYLWTNAAFAFAANMVKSFIKNGWCVQIRGPQAGGAVTDLP
                     IHLYDLGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPAL
                     YDTTDATANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELELNTWIRTLV
                     TEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYAVPHFQVEGMDVNLSLVSQM
                     PKAKA"
     misc_feature    458115..459578
                     /locus_tag="Rahaq2_4988"
                     /note="Protein of unknown function (DUF877); Region:
                     DUF877; cl05484"
                     /db_xref="CDD:262554"
     gene            459609..460958
                     /locus_tag="Rahaq2_4989"
                     /note="IMG reference gene:2506712013"
                     /db_xref="GeneID:11818498"
     CDS             459609..460958
                     /locus_tag="Rahaq2_4989"
                     /note="PFAM: Bacterial protein of unknown function
                     (DUF876);
                     TIGRFAM: type VI secretion protein, VC_A0114 family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220711.1"
                     /db_xref="GI:379704337"
                     /db_xref="InterPro:IPR010263"
                     /db_xref="GeneID:11818498"
                     /translation="MKIYRPLWSEGALLSPQQFQQQALWEAHNNQCVAHLSVVNPWGV
                     ATAEFDEGLLSVRRLQALQLTVRLPDGSLIDTGSSDLLPPARDLSQDIPAQVNELTVM
                     LAMPLLQANSSNVQLTDNAGDRPLRYRQEWVNVQDAFGQEEESMAVARYALSLRFDTE
                     QNEEYLICPVLRLVRDGQGGWRNDSTFIPPLLAMSAHHGLVLDMEQILTQLQAKRRRL
                     MGMRRESNQRMADFAVADVSLFWLLNALNTHVSALSELVKNPARHPEQVWFELSKLAG
                     SLLTFSLEHDIEAIPAYDHASPETVFPPLLDLIGELLEASLPSRVISLEMHKINGQQW
                     KAPLNDSRLREDADFYLSVRSTLPAYQLISQFPALCKVGAPDDVNNIVNIALNGIPLI
                     ALSHVPAAIPLRLENQYFTMDLKHPSAQAMLDAGTCMFYVPELLGELQLELYAVLRS"
     misc_feature    459660..460907
                     /locus_tag="Rahaq2_4989"
                     /note="Bacterial protein of unknown function (DUF876);
                     Region: DUF876; pfam05936"
                     /db_xref="CDD:253466"
     gene            460955..461629
                     /locus_tag="Rahaq2_4990"
                     /note="IMG reference gene:2506712014"
                     /db_xref="GeneID:11818499"
     CDS             460955..461629
                     /locus_tag="Rahaq2_4990"
                     /note="PFAM: Uncharacterized protein conserved in bacteria
                     (DUF2077);
                     TIGRFAM: type IV / VI secretion system protein, DotU
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="DotU family type IV/VI secretion system protein"
                     /protein_id="YP_005220712.1"
                     /db_xref="GI:379704338"
                     /db_xref="InterPro:IPR017732"
                     /db_xref="GeneID:11818499"
                     /translation="MRNEIDIDELLADTWLSVVQLRNGVVAEEGEALYERCRAQVERV
                     KDQLQLAGYDSESIEHITYAQCALLDETALGRQAEDKAPDNGHITWQRAPLQARFFGS
                     LQAGEALYERIRSVLRQPAPDITVLTCFHRVLLLGFQGQYSAQTINPQQREQTLTALA
                     GRVTPFNVVLPGALLSKTGRVRGGALLRSLWFWVLVAIVIVSGVWWGGHVWLQHLINQ
                     QLPGQF"
     misc_feature    460973..461590
                     /locus_tag="Rahaq2_4990"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2077); Region: DUF2077; pfam09850"
                     /db_xref="CDD:255604"
     gene            461631..463307
                     /locus_tag="Rahaq2_4991"
                     /note="IMG reference gene:2506712015"
                     /db_xref="GeneID:11818500"
     CDS             461631..463307
                     /locus_tag="Rahaq2_4991"
                     /note="PFAM: OmpA family"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein/peptidoglycan-associated
                     (lipo)protein"
                     /protein_id="YP_005220713.1"
                     /db_xref="GI:379704339"
                     /db_xref="InterPro:IPR006664"
                     /db_xref="InterPro:IPR006665"
                     /db_xref="GeneID:11818500"
                     /translation="MRIGSRLSVYCLTGMTGCLALLLCWGFSPFAVSTKSVITLITLV
                     LMAGFMLWGRRNHVFMDATTRLESLPEISFSQPVVLVCGDKLDALFGETTVRVTPLAC
                     YVKTDSVKPLSIFVDAVLSQRPGWIRQMAVLYSVSPEAHADEAVFRATIKSWRQQFYR
                     LQKRIGCRIPVLVSCWLNGSVSPWFVGAADGKMIVRDDDEGATLLSDWLPSSDINMQP
                     ARQSQAICLEAACSWLRDVVLDEMQHPETLSTPVCPVAVGVRFDAVSGVPDNLWSAAL
                     TRRTTLNALMPLQSESVATLPFPDPLLPLLSGTTRHIRAGLAPVIAVILMMCFAVTAI
                     AFVVNNNHRLITRIGMDLKRYLVIPMSNYVPKAQAVAVLKLDAQLLERYHRQGEPLRL
                     GLGLYQGERLWLALQQEIDRYIPPPPPPPPAEKHTPKTVRLDALSLFDTGQYELKPGS
                     LKMLVNALVDIKAKPGWLIVVAGHTDITGDAKANQILSLKRAESLRDWMLSTSDVSPT
                     CFAVQGYGATRPIATNDTPEGRAANRRVEISLVPQADACKASATPSSSND"
     misc_feature    462735..463259
                     /locus_tag="Rahaq2_4991"
                     /note="Outer membrane protein and related
                     peptidoglycan-associated (lipo)proteins [Cell envelope
                     biogenesis, outer membrane]; Region: OmpA; COG2885"
                     /db_xref="CDD:225439"
     misc_feature    462942..463250
                     /locus_tag="Rahaq2_4991"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    order(462951..462956,463053..463058,463065..463067,
                     463077..463082,463089..463091,463218..463220,
                     463230..463232)
                     /locus_tag="Rahaq2_4991"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            463340..463831
                     /locus_tag="Rahaq2_4992"
                     /note="IMG reference gene:2506712016"
                     /db_xref="GeneID:11818501"
     CDS             463340..463831
                     /locus_tag="Rahaq2_4992"
                     /note="PFAM: Protein of unknown function (DUF796);
                     TIGRFAM: type VI secretion system effector, Hcp1 family;
                     IMG reference gene:2506711594_SP"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="YP_005220714.1"
                     /db_xref="GI:379704340"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="GeneID:11818501"
                     /translation="MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQDHNLYIPTD
                     NNTGKLTGTRIHTPFLFTKEIDSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYF
                     NTKLENVKLVKVAPKMHDIKDPAKEKHNHLEAIELRYEKITWTYKDGNIIHSDSWNER
                     TTA"
     misc_feature    463343..463819
                     /locus_tag="Rahaq2_4992"
                     /note="type VI secretion system effector, Hcp1 family;
                     Region: VI_effect_Hcp1; TIGR03344"
                     /db_xref="CDD:213799"
CONTIG      join(CP003245.1:1..463906)
//
DBGET integrated database retrieval system