GenomeNet

Database: RefSeq
Entry: NC_016835
LinkDB: NC_016835
Original site: NC_016835 
LOCUS       NC_016835             463906 bp    DNA     circular CON 30-JUL-2015
DEFINITION  Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201,
            complete sequence.
ACCESSION   NC_016835
VERSION     NC_016835.1  GI:379703932
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02261385
            Assembly: GCF_000241955.1
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Rahnella aquatilis CIP 78.65 = ATCC 33071
  ORGANISM  Rahnella aquatilis CIP 78.65 = ATCC 33071
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Rahnella.
REFERENCE   1  (bases 1 to 463906)
  AUTHORS   Martinez,R.J., Bruce,D., Detter,C., Goodwin,L.A., Han,J., Han,C.S.,
            Held,B., Land,M.L., Mikhailova,N., Nolan,M., Pennacchio,L.,
            Pitluck,S., Tapia,R., Woyke,T. and Sobecky,P.A.
  TITLE     Complete genome sequence of Rahnella aquatilis CIP 78.65
  JOURNAL   J. Bacteriol. 194 (11), 3020-3021 (2012)
   PUBMED   22582378
REFERENCE   2  (bases 1 to 463906)
  AUTHORS   Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
            Peters,L., Ovchinnikova,G., Held,B., Detter,J.C., Han,C., Tapia,R.,
            Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Sobecky,P.,
            Martinez,R. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP003245.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4089211
            Source DNA and organism available from Robert Martinez
            (rmartinez@bama.ua.edu)
            Contacts: Robert Martinez (rmartinez@bama.ua.edu)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Rahnella aquatilis CIP 78.65
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Host
            num_replicons       :: 4
            ref_biomaterial     :: Missing
            biotic_relationship :: Missing
            trophic_level       :: Missing
            rel_to_oxygen       :: Facultative
            isol_growth_condt   :: Missing
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi06369
            Type Strain         :: Yes
            Funding Program     :: DOE-CSP 2010
            Gene Calling Method :: Prodigal 1.4, GenePRIMP
            Isolation Site      :: drinking water
            Host Name           :: Water, humans
            Cell Shape          :: Rod-shaped
            Temperature Range   :: Mesophile
            Gram Staining       :: Gram-
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 07/30/2015 21:11:58
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 4,920
            CDS                                       4,767
            Pseudo Genes                           :: 51
            CRISPR Arrays                          :: 2
            rRNAs                                  :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                         :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                                  :: 76
            ncRNA                                  :: 3
            Frameshifted Genes                     :: 17
            Frameshifted Genes On Monomer Runs     :: 0
            Frameshifted Genes Not On Monomer Runs :: 0
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..463906
                     /organism="Rahnella aquatilis CIP 78.65 = ATCC 33071"
                     /mol_type="genomic DNA"
                     /strain="CIP 78.65"
                     /isolation_source="drinking water"
                     /culture_collection="ATCC:33071"
                     /db_xref="taxon:745277"
                     /plasmid="pRahaq201"
     gene            88..2739
                     /locus_tag="RAHAQ2_RS21995"
                     /old_locus_tag="Rahaq2_4567"
     CDS             88..2739
                     /locus_tag="RAHAQ2_RS21995"
                     /old_locus_tag="Rahaq2_4567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_037040961.1"
                     /db_xref="GI:739177004"
                     /translation="MEHQSAVLLRRLNPYCAKALEAAATLCQTRAHSEITVEHWLLKL
                     LELGEGDITVLARRYEWDMDTLWQSLLAHLDALPRSVHSRPQLSQDLQALMKAGWLAA
                     SLQDDNQNIRSVNLLEALIEQPRLLHCEGLWPLFSLSEEHIRRLKPVLDTLSEERPEL
                     QQQESLKRMSSSLSDNTAISKHDAGMGGQSLSEALQAALDKFTLDVTAKAKAGQIDPV
                     FGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVSLR
                     TLDLGLLQAGAGVKGEFEQRLKNIIDAVQQSPTPVLLFIDEAHTIIGAGNQAGGADAA
                     NLLKPALARGELRTIAATTWSEYKQYFERDAALERRFQIVKVDEPDDEMACLMLRGLK
                     SRYAQHHGVHITDEAVKAAVSLSRRYITGRQLPDKAVDLLDTASARVRMSLDTLPEDL
                     IRLKAQITALEMEEQALLEDIVLGNKTHGDRLEQIEQQADNLCEQLTALNTQYHAEKN
                     LTQQLLETRQDISRQEEIASLQEQLSDLQGNTPLLSLDVDVRTVANVIADWTGVPLTS
                     LLKDEQTDLLQLEDHLNKRVVGQDHVLTDMAQRLRAAKTGLTSENGPLGVFLLVGPSG
                     VGKTETALSLADCLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGILTEAV
                     RKRPYSVVLLDEVEKAHRDVINLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDH
                     LMQLLDERPEATDSDLQELLRPILRDHFQPALLARFQTLIYRPLNAVALRTIVEMKLA
                     QVAKRLNKHYGLTCSIEESLYNTLVTACLLPDTGARNIDSLLNQQILPVLSQQLLQRK
                     AGQQCTTALALGWDEEEGITLEFDGEE"
     gene            2739..5126
                     /locus_tag="RAHAQ2_RS22000"
                     /old_locus_tag="Rahaq2_4568"
     CDS             2739..5126
                     /locus_tag="RAHAQ2_RS22000"
                     /old_locus_tag="Rahaq2_4568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
                     /protein_id="WP_014341591.1"
                     /db_xref="GI:504107605"
                     /translation="MSTSDVINRLLNQSRYRLDVSQSPAFLDVLRFEGEEQLSKPFEY
                     IIHVTSTATDLTAEQLVLKPATFTMQAPVFDIAGVAEPVRAVHGVIQHFSRISTSADQ
                     TIYRLVLVPRVALLDHTAKCALYLNQSVQEVVEKVLRAHGLEGPDFEFQLSRSYPARE
                     LITQWRETDLAFIQRLLAEVGIYWHLEMDTRLEHDVIIFADSQQQYKFGIRLPLRNQA
                     GMSDSGTESVWGLSTKHQVVTQQVSTRDYNYREALSPMDTTASAAGSDETTIGEVYQY
                     AEPFLQSGSEDGVETGAFYARLRHERILNAQKSVTGHSSCPHLAPGQVLEVDGTLPAV
                     LNEGILLTGIKTYGSRKSRFTAHLTGQPYSETVCFRPALPQRPVIAGTLPARVESTTK
                     GDIYSWLDNQGRYRVKLDFDRDEQEQGYAYLWLRMAKPYAGDTYGWHAPLIDGTEVAI
                     AFDSGDCDRPYIAYALHDSAHSDHVTDDNHTRNVLRTPSFNKLRMEDKRSEEHIKLAT
                     EFGKTQLNMGHLVDAGRAQRGAGFEIRTDEHGVMRAGKGIFVSAEEQLKAQGKVLDMD
                     PALGQIHQANNEMQALSDAATQATALASDIQKQLSFVDNRLTQLQSAAILASAPMGVA
                     LTSGEHLQLAARQNLMVNAGNNADVGVMKNLFIGAGEAMSMFVHKQDATLIANQGQVT
                     IQAQNNVMSLTARQTLTITSSDDEIIITTPKKMTLNGGGSYLTLEASKIEHGSSGDMT
                     IKCTNYLVPMVGAVLGYHVPSFSKVNLSLNSPNDQSKPDEQNEQDSQNTGNPASE"
     gene            5143..7794
                     /locus_tag="RAHAQ2_RS22005"
     CDS             5143..7794
                     /locus_tag="RAHAQ2_RS22005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007890092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="WP_014341592.1"
                     /db_xref="GI:504107606"
                     /translation="MAETTSPVIPKISFPVPAGATGTEFSTAADLLQRLDREASGLYL
                     VGGKGMWHGGIHITDTTAPWCALTGNAPPELTYAPTPHKGEQHLRCMADGDIVAFRVC
                     KEYPTIPWEKGTLYLSGSFVLVRHYVQPGTTAASGLTFYTLYMHLAPFSAYASQTGPR
                     QRTTKGGVKFYLTKEDVASNKVAGKFSAGNVVTLCDETMVRRSDNHQFSQVKMQDGRL
                     VWTVSDGGFLKMADSTGASPPPWWSQCSPAYPVTPSTAAVYKNKTALNYYRCSEDVTF
                     ETVVSGQNKKWGKPAGKLLPVNTPMTMETDNAAQTITRPDKRVFKLMTMTADVAGTPL
                     KRGERVWVVADGGNLEAVAAQSGSSPKFDEVITDQTIPVQAGAALGHLGFFQIPTETG
                     FRSRYMVHIECLTSDSKVASFLTNPEAAGRESPAFLKYPADAKLFSKDAKGAMAESTR
                     KTKAPGILTLSNVPAVSADGIPTHYQIRPEGGFLAAASVEVLSQFDLGKLGFSIIKDD
                     PESFQLLDAENQPQNVVKGIFEKLKAAAEDDPVFSNVLASHKYKQLLDVIDQNHDGYY
                     SVDEYRNAVHNPAYRDRLYQLIVQHPSEWYYEKTDGKWTKYLEKLEPDASKWKKYTEA
                     FLDKMIWMKKVAGMGPAPWHMHPVMFMGNLVGKQELIRVDEFMAGYEKLHSSFAPNTP
                     PLKSVSKENLRKIVNRLNSFYAEQIEYKPNLYKLAYMLATTRHETYHFTDQEYFSEQP
                     EVGNEAYFNKYDPIRADTQIRKDAAKANENTVEGDGFKYRGRGCVHLTWKINYRKAMV
                     KYGVNFVATPDLAGDFNYAVPIMIWGMENGVFTGRKLSSYINETTIDYLNARKIINGN
                     DQKSLIASYAEKFQLILEETSSAPQGF"
     repeat_region   5457..7100
     gene            7796..8731
                     /locus_tag="RAHAQ2_RS22015"
                     /old_locus_tag="Rahaq2_4570"
     CDS             7796..8731
                     /locus_tag="RAHAQ2_RS22015"
                     /old_locus_tag="Rahaq2_4570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007755144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341593.1"
                     /db_xref="GI:504107607"
                     /translation="MLKIILSSILLMVFQFSYAANSPVSYGYDKDHKQIYAKIGSDKK
                     TLYFEENYTGNPIVMFSFFNGNPSIVLSGRSVNDYTAYATLNYINDTFSIDCIYIDMK
                     SKENGISSKNGICGLDKKITDEYQDVIEGFVEDKGNRINNIETSYVINGGTKKLPILI
                     FRNNDNFLYQLYKNKNDFLNDKYSILSISNKTTCQSYEGTVWVVENFSNKGLPQVLNE
                     ITKNGVVFLEDAITNSHRPSEEGSCQSFQMFSVKSEKSFFYNENNEIKKSYLVHGDFV
                     NLLNMSEGEKWCEISYLNKANKKVNGRVLCATLKL"
     gene            9315..9830
                     /locus_tag="RAHAQ2_RS22020"
                     /old_locus_tag="Rahaq2_4572"
     CDS             9315..9830
                     /locus_tag="RAHAQ2_RS22020"
                     /old_locus_tag="Rahaq2_4572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341594.1"
                     /db_xref="GI:504107608"
                     /translation="MKNKTIWKSFLYLSMLILLPFGVNASANIKEDPVKITQSFYTQY
                     MQLYFKIVPPEAPAFKKLMQNNITPSFLKKIKSAKICQEGKDPVCTIEEVRPKDGYVY
                     IIRAQDAYDDWTHVIVEPIKISSGLSVVKVSLGGLHEKAHVLTVSLKKINTHWKIDSV
                     SDLSPAKYRFQ"
     gene            9847..>11841
                     /locus_tag="RAHAQ2_RS22025"
                     /old_locus_tag="Rahaq2_4573"
                     /pseudo
     CDS             9847..>11841
                     /locus_tag="RAHAQ2_RS22025"
                     /old_locus_tag="Rahaq2_4573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577834.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            11831..12148
                     /locus_tag="RAHAQ2_RS22030"
     CDS             11831..12148
                     /locus_tag="RAHAQ2_RS22030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015453659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049796159.1"
                     /db_xref="GI:908659709"
                     /translation="MNGYNFRGRGLIQVTGYEKYHGFMGEYNKYWKGDIPDTVSEPEK
                     INEMPYAIRSALWFWLHYEVYLFDHGEGYSDVVGVTKRVNGGSMGLDERQTAYTLCEK
                     VFL"
     gene            12145..12621
                     /locus_tag="RAHAQ2_RS22035"
                     /old_locus_tag="Rahaq2_4574"
     CDS             12145..12621
                     /locus_tag="RAHAQ2_RS22035"
                     /old_locus_tag="Rahaq2_4574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001469826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341596.1"
                     /db_xref="GI:504107610"
                     /translation="MKKISVFLFGALFSFMSIDSMASGGNSTEIISCTLPGELSRKVS
                     LSIDNKTKEINYSFEKEGKVELAVLFNEENKLKRLTDSKMGVTYYGFKRGAYSYIVDI
                     INGAEQEEYTISFDIKKNNKVVQSDDCLHSSFRSADITSKYISDVPYVDDDNFAFP"
     gene            12791..13252
                     /locus_tag="RAHAQ2_RS22040"
                     /old_locus_tag="Rahaq2_4575"
     CDS             12791..13252
                     /locus_tag="RAHAQ2_RS22040"
                     /old_locus_tag="Rahaq2_4575"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041682461.1"
                     /db_xref="GI:754019233"
                     /translation="MILLGARMHKIIFYLLMAISFSSMASSDVTGRWSPSCDDEEGIT
                     LTNGNSPVFFVVNHNQIVISMQTKTTKESIDFFLVKPVDLGSGGMKLSWSNFSKKSKI
                     ATLKLHEQSANFEWYGFYDEIKKVHSWVNDPDIIINNEIVGGGVVFYRCIK"
     gene            13273..15705
                     /locus_tag="RAHAQ2_RS22045"
     CDS             13273..15705
                     /locus_tag="RAHAQ2_RS22045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007890092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chitinase"
                     /protein_id="WP_014341598.1"
                     /db_xref="GI:504107612"
                     /translation="MGVKITPNIKFAFKFCSVLEFVCPTIPWEKGTLYLSGSFVLVRH
                     YIQPGTTAASGLTFYTLYMHLAPFSAYASQTGPRQRTTKGGVKFYLTKEDVASNKVAG
                     KFSTGNVVTLCDETMVRRSDNHQFSQVKMQDGRLVWTVSDGGFLKMADSTRASPPPWW
                     SQCSPAYPVTPSTAAVYKNKTALNYYRCSEDVTFETVVSGQHKKWGKPAGKLLPVNTQ
                     MTMETGNAAQTITRPDKRVFKLMTMTADVAGTPLKRGERVWVVADGGNLEAVAAQSGS
                     SPKFDEVITGQTIPVQAGAALGHLGFFQIPTETGFRSRYMVHIECLTSDSKVASFLTN
                     PEAAGRESPAFLKYPADAKLFSKDAKGAMAESTRKTKAPGILTLSNVPAVSADGIPTH
                     YQIRPEGGFLAAASVEVLSQFDLGKLGFSIIKDDPESFQLLDAENQPQNVVKGIFEKL
                     KAAAEDDPVFSNVLASHKYKQLLDVIDQNHDGYYSVDEYRNAVHNPAYRDRLYQLIVQ
                     HPSEWYYEKTDGKWTKYLEKLEPDASKWKKYTEAFLDKMIWMKKVAGMGPAPWHMHPV
                     MFMGNLDRKPTNLVSCSFCQSGIEINPELLIHCFGISKEKADLYAPLLTTGFIKYEIN
                     NCLRISHFLGQIGIETQRLTKLKESLYYTNGDRLWGIYYSLLNAGLKRRFPTYSEEQR
                     KQYTKDHLVRNEDELAQTLFPSNYEGMDYRGRGLIHLTHEENYNKYKIFSENDVITNP
                     KIIETNSALAVDSACWYWSKFANINPLADADNLSMVTYKINAARLEMAARGTIKDLAI
                     NYIKQNNIGCKK"
     repeat_region   13341..14984
     gene            15702..16244
                     /locus_tag="RAHAQ2_RS22055"
                     /old_locus_tag="Rahaq2_4577"
     CDS             15702..16244
                     /locus_tag="RAHAQ2_RS22055"
                     /old_locus_tag="Rahaq2_4577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018927457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341599.1"
                     /db_xref="GI:504107613"
                     /translation="MILRKLVLLIALISGNCLACDNGKISDYINNNQGFLVQALSSDR
                     ISSGSTIFFHYTSKNDEHPDIIASYASDRCVASQSITFDTYSYDGSVANIESVFWGRG
                     KYKKNLFIIVSWNYNADGVSTVGKYYSVFAYDYEKTKITKNENLTIKFKEGHDGFVDG
                     KVVKYRFKTASDVLSYLEKN"
     repeat_region   16412..17561
     gene            16428..18251
                     /locus_tag="RAHAQ2_RS22060"
     CDS             16428..18251
                     /locus_tag="RAHAQ2_RS22060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014715900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341600.1"
                     /db_xref="GI:504107614"
                     /translation="MTFETVVSGQHKKWGKPAGKLLPVNTQMTMETDNAAQTITRPDK
                     RVFKLMTMTADVAGTPLKRGERVWVVADGGNLEAVAAQSGSSPKFDEVITDQTIPVQA
                     GAALGHLGFFQIPTETGFRSRYMVHIECLTTDSKVASFLTNPEAAGRESPAFLKYPAD
                     AKLFSKDAKGAMAESTRKTKAPGILTLSNVPAVSADGIPTHYQIRPEGGFLAADSVEK
                     LSQFDLGKLGFSIIKDDPESFQLLDAENQPQNVVKGLFEKLKAAAEDDPVFSNVLASH
                     KYKQLLDVIDQNHDGYYSVDEYRNAVHNPAYRDRLYQLIVQHPSEWYYEKTDAKWTKY
                     LEKLEPDASKWKKYTEAFLDKMIWMKKVAGMGPAPWHMHPVMFMNTIRDSENDEMDTK
                     WLKVPKGQLTFNVEGNDIENSIYFSRHPHVPNNKGVVIGISGVTFGRGLDLDQQSKTY
                     INTLFMDMERDAKPLPPALQKWLLGSVGLKGSTALTYCLDIDKFVPRTEQYLTRKQQH
                     FLFNAVYENLYDVTKRVISNGAKVDGVQISAELGSYSQKVQDVLVDLTFRGDNSPRTR
                     RYFMKDLKAGEDQFKSNISNSHWKSSFGVPEQRFNERKGYL"
     gene            18251..18622
                     /locus_tag="RAHAQ2_RS22065"
                     /old_locus_tag="Rahaq2_4579"
     CDS             18251..18622
                     /locus_tag="RAHAQ2_RS22065"
                     /old_locus_tag="Rahaq2_4579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341601.1"
                     /db_xref="GI:504107615"
                     /translation="MNKYFALMLAVSSLSTVVYADSSSEQGNYLKIKSEYAKADSELN
                     NIYRQQILEYKNVGAEFYGQRESKDIYLKKSQIAWIKIRDADCDYETYESRTGTAFSS
                     IYEQCLLDKTSERIKYLNENN"
     repeat_region   18720..19281
     gene            18768..19331
                     /locus_tag="RAHAQ2_RS22070"
     CDS             18768..19331
                     /locus_tag="RAHAQ2_RS22070"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041198.1"
                     /db_xref="GI:739177250"
                     /translation="MVRRSDNHQFSQVKMQDGRLVWTVSDGGFLKMADSTGASPPPWW
                     SQCSPAYPVTPSTAAVYKNKTALNYYRCSEDVTFETVVSGQNKKWGKPAGKLLPVNTQ
                     MTMETANTAQTITRPDKRVFKLMTMTADVAGTPLKRGERVWVVADGGNLEAVAAQTGS
                     SPKFDEVITGQSRMGMRRLRLLYDFIY"
     gene            <19276..19557
                     /locus_tag="RAHAQ2_RS22075"
                     /old_locus_tag="Rahaq2_4581"
                     /pseudo
     CDS             <19276..19557
                     /locus_tag="RAHAQ2_RS22075"
                     /old_locus_tag="Rahaq2_4581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577837.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            19621..19884
                     /locus_tag="RAHAQ2_RS22080"
                     /old_locus_tag="Rahaq2_4582"
     CDS             19621..19884
                     /locus_tag="RAHAQ2_RS22080"
                     /old_locus_tag="Rahaq2_4582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341603.1"
                     /db_xref="GI:504107617"
                     /translation="MLPIIRIGDKTTHGGAVMTGSGTMSFGNIPVARKGDKVSCPIPF
                     HGPTFITEGNPNYLDNGIPVAFHGHKCACGCTLISSLATAQVG"
     gene            19887..21089
                     /locus_tag="RAHAQ2_RS22085"
                     /old_locus_tag="Rahaq2_4583"
     CDS             19887..21089
                     /locus_tag="RAHAQ2_RS22085"
                     /old_locus_tag="Rahaq2_4583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341604.1"
                     /db_xref="GI:504107618"
                     /translation="MPVNLDVIPDKAPGIARPRTRRWLLFLPFMLLAGATSTLWFWKN
                     EHTGIAFWFTAIGLPAATWGILFSLRRIGYKCDQIWATSWNRERDQLIEEETQRGQRY
                     LWWHGGVSFTSVGKSTEKLLSAVLKNTPLMSSVIPRAGGFAVRHTRLGSITNTIPVLL
                     QEWHDHLKQRISALLDTLPAGMPCYVLLDVHIDQDPQVNAKHAQEVMAMFSRPLRQIN
                     GAGFVALDQWIDMTWGIPSALLVIGTQINNRPEINSGEAATAMLLTNCPMPDERKTVR
                     IHRPECGTNAALTKTLSRALLWANVQPASVAQAWLTGGALLTDSEWSTACEKNTLGMN
                     IQKQCSVIDNVTGYTGCTAPWLALLMAATQCGEDGITQTVAVQIATDKIWVGCVSAPA
                     SDIQDTSL"
     gene            21086..24502
                     /locus_tag="RAHAQ2_RS22090"
                     /old_locus_tag="Rahaq2_4584"
     CDS             21086..24502
                     /locus_tag="RAHAQ2_RS22090"
                     /old_locus_tag="Rahaq2_4584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein VasK"
                     /protein_id="WP_014341605.1"
                     /db_xref="GI:504107619"
                     /translation="MTIRSLIGSAFLFLIFTVIVVGGILTFYPQWAASSVGVGPLSPS
                     GIWTLCLSIAAGLGAIFWLIERMFDRLGKAGVRIQWRKRKNQQTEAPTVSDTVNPSPS
                     FFTGLDEQMRFRYGRFWRRKVQILWLNGETELVEKIVPGLTEQNWQEGDDTLLLWGGL
                     PDVPVDPERAMAARQLRPRRPLDGIVHVLDGNQLPGTTSLDETLRQRQKTDALLGWQA
                     PVYFWVLDTCKWSQEGRETQPVGCLLSGKTSAESVITALDALIPALREQGMSQLAQDT
                     RYDFLLRLTERLRKEWRAGLSNVLTTVSRGSSPMMLRGLMFSLPSGADKGSSHSWGAL
                     PEWQGILQDCRNAQGKRTGWPWEKILQCALLSLAVVWGTGVLLSLFINQHQIADSHKQ
                     ATIAADTSQPLASRLNNQLALQQEIAKLQYRATAGSPWYTRFGLNQNTVQLAALWPLY
                     QANNNVLIRDVSATKLKAKLTDFIRLPPGSPQRDALTQQTYAELKAYLMMSRPDKADA
                     PFLNQTLMTLWPKRTGVPDGQWQHVGPKLIAFWGQNLPAHPEWKIAQDKNLVTAVRQI
                     LLKQIGQRNAEASLYQAMLKKVANNYPDMTLTDMVGDTDASYLFNTDEVVPGMFTRQA
                     WEEQVQDAIDQVVTTRRNEIDWVLTSKSQPASEDISPEALKARLTERYFTDFSNAWLN
                     MVNSLRWQEPGSLSGAISQLTLMADVRQSPMVALMNTLAWQGKTGQKNEALADTLVNS
                     AKVLVGKKQQPVIKQTGGPQGPLDAAFGPLLTIMDGKSNGLNNGNLSFQAYLTRVTQV
                     RLKLQQVTTAPDPQAMTQMLAQTVFQGKAVDLTDTRDYGSLVAASLGQEWSGFGKAMF
                     VEPMELAWRQVLQPAAGSLNAQWQSTVVNQWDTSFAGRYPFASTGSDASLPVVAQYLR
                     SDSGRISQFLKTQLGGILHQEGNRWVPDAITSQGLTFNPAFLDAINQLGQLSDIVFAE
                     GDAGLRFELMARPSKNVVRTQLAIDGQNLDYFNQMESWQSFKWPGNSYYAGVQLSWRS
                     VSSGMQLFGDFSGNWGLIRLLEKAQVTQLDSSRYQLVWKTPDGLPLKYILRTEMGNGP
                     LALLALRNFSLPKKVFLDDAPVSSVVAADPGPVLTDDQDIPAGTGSAGDE"
     gene            24602..26371
                     /locus_tag="RAHAQ2_RS22095"
                     /old_locus_tag="Rahaq2_4585"
     CDS             24602..26371
                     /locus_tag="RAHAQ2_RS22095"
                     /old_locus_tag="Rahaq2_4585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein ImpG"
                     /protein_id="WP_014341606.1"
                     /db_xref="GI:504107620"
                     /translation="MDDLTLRYYEAEMRYLREAGREFAHAHPDRAAMLNLDKSGARDP
                     YVERLFEGFAFLMGRLREKLDDDLPELTEGLVSLLWPHYMRTIPSLAIVELKPDYRQL
                     KQVEIVPRGFSVLSQPVGQKHTCCQYQVTRDMPLMPINISQAKLHTETDGRSTVRLRF
                     DCGPLADWRKIDLSRVAIYLDADSPVSSALHLALTRKVQAMYIRQPELGQDRRAIDGW
                     FKPMGFEENERLWPKGSSAFSGYQLLLEYFTFRPKFMFVELNGLQNVHLVPGTTWFEL
                     DIVLSELWPYDLPFDTDTFRLHCVPVINLFSLEADPLQIDPLANEYLLRPLRMQDGHV
                     EIYSVDQVHGSVKNGKHDYVPFTSFRHRGGMMRHDAPERYFHTRVKRGPSGLHDTWLI
                     LGGKSFEAEQLAEQREALSLRITGTNGQLPRKALESTLLNRVVKAGKVPVQVRNLTTP
                     TMPVYPPANDRFHWRVMSHLGSSFLSMMDNPEVLRGTLALYDWTDDEMNCRRLEAIVA
                     VEHHLIQRFEKGFMLRGVDIEITLNTDNFAGEGDVNLFGEMLHRFFALYADIHLFNQL
                     TLVLQPTGKRLRWNENHSQHVPG"
     gene            26335..27417
                     /locus_tag="RAHAQ2_RS22100"
                     /old_locus_tag="Rahaq2_4586"
     CDS             26335..27417
                     /locus_tag="RAHAQ2_RS22100"
                     /old_locus_tag="Rahaq2_4586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341607.1"
                     /db_xref="GI:504107621"
                     /translation="MERESQPTRTGLIDALSPRASYLNFYRFCQLLEQAGGDAPLLGT
                     TSTPATDPIRFRPHPGMGFPVSEIRVIEADREHVHATPTVRTTFMGLYGVDAPLPTGY
                     LDDISQRREGYESVEHFLDIFNHRLMTQFYRIWRKYAYPASFQAGGTDETSQCLLGLI
                     GLGIPGTAKHIATPISRFLALLSTMRLPTRTAEGIRALVNLLAPLTQAYIQGHDPVSV
                     EMRSRSGFCAENRIALAQRSVLGRKGKDGNSRVLVSLMTSDPEEAEGWLPGGHLHTDL
                     LVLMRVYLGYRCNARLQLTVPTRLLPEPRLGGSRRIQLGRTGVLGLQESKRDSLPQSL
                     TVSLGTYQGVHEEPLLPAESGEYRFR"
     gene            27481..28023
                     /locus_tag="RAHAQ2_RS22105"
                     /old_locus_tag="Rahaq2_4587"
     CDS             27481..28023
                     /locus_tag="RAHAQ2_RS22105"
                     /old_locus_tag="Rahaq2_4587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341608.1"
                     /db_xref="GI:504107622"
                     /translation="MAKIIPSHTGWQYGSLFLLVVLLSGCGLTQKVVDGTKGVTKAIF
                     YKQIKTLHLDFSPRTSMNTDEGDQSSLATMVRVYQLKDRKAFDAADYEKLLLQSDDLL
                     KADSLASKEVLVMPGGDVSLDMPMEPDAQFVAVVALFRNPDRQHDTWRVVLKREEFDP
                     DKPRTLELSNGQLTLLPLKD"
     gene            28024..30391
                     /locus_tag="RAHAQ2_RS22110"
                     /old_locus_tag="Rahaq2_4588"
                     /pseudo
     CDS             28024..30391
                     /locus_tag="RAHAQ2_RS22110"
                     /old_locus_tag="Rahaq2_4588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014333418.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
     repeat_region   29386..29568
     gene            30388..30897
                     /locus_tag="RAHAQ2_RS22115"
     CDS             30388..30897
                     /locus_tag="RAHAQ2_RS22115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012776699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049796160.1"
                     /db_xref="GI:908659710"
                     /translation="MNTAAYSAVMNQLISHPECGGFALVDGLQYERHFGEEIKTEKGI
                     VAPLFDSGPDSRIQFAGPWLFSLNTTIEYREKLQQLECIYPSVSWFLSCWTMENVVNH
                     FKPFLNLQLPDGRGALFRFYDPRILKDIELLLAEKDYEELIAGIECWFLTLNGETYDI
                     KSKGKYFWD"
     gene            30926..31282
                     /locus_tag="RAHAQ2_RS22120"
                     /old_locus_tag="Rahaq2_4590"
     CDS             30926..31282
                     /locus_tag="RAHAQ2_RS22120"
                     /old_locus_tag="Rahaq2_4590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009982284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341611.1"
                     /db_xref="GI:504107625"
                     /translation="MVVKISTEQLSNLRELESNNYINSLHQIIIKHSPSLADDGGLKF
                     HLIDAEQFVNENGFTDKKIKTEFLIMNAYEPGFYKTNTMQNWILNGTESPEREYVKYQ
                     QIRSNFLKRNSGVENE"
     gene            31275..31946
                     /locus_tag="RAHAQ2_RS24700"
                     /old_locus_tag="Rahaq2_4591"
     CDS             31275..31946
                     /locus_tag="RAHAQ2_RS24700"
                     /old_locus_tag="Rahaq2_4591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012353902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341612.1"
                     /db_xref="GI:504107626"
                     /translation="MSNVGATMPVPAGRTGTIPGTRGRLGGVVGILSDLEAHRQEYLA
                     YMAEMENVKEEAASLTKELSEEGCDQCVYTQGEVTLQNIKGWSDISIAYQFYICKLPI
                     HFQVMKIMEWTYGVAFDGFVPKECLLIETKANYDQFFDMNEELKFFMNITKGTDGLFL
                     KQARSQNSCALKGMPPGRLHWYFMQPISARYARSEFAEEGLDISVIDKPMPTEYVRTI
                     ITNKQ"
     gene            31955..32647
                     /locus_tag="RAHAQ2_RS24705"
                     /old_locus_tag="Rahaq2_4592"
     CDS             31955..32647
                     /locus_tag="RAHAQ2_RS24705"
                     /old_locus_tag="Rahaq2_4592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006814491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341613.1"
                     /db_xref="GI:504107627"
                     /translation="MFYKIQGLIYRKNKVTSENIFNELIKFINTLPNWSEKPKLWFIA
                     TPKGSVKGIENGQTSQDALSYVDEMIKSNNSISVILADENEDDSILTLWFKNTQAISE
                     DRYTFSLTIKSLSKLNDFNVFLDIFNKLTSLDEWKFKYIFLDTEQYRRKELSVFEDRL
                     AVGWILFLPQLISSEHARSAFKVIQRKEINGTIIISSEIFDGKNPLHISHANNVEIEL
                     AADGFLPLLKGL"
     gene            32945..33568
                     /locus_tag="RAHAQ2_RS22135"
     CDS             32945..33568
                     /locus_tag="RAHAQ2_RS22135"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041152.1"
                     /db_xref="GI:739177203"
                     /translation="MVGILVGGMPVTSGTPAPTARPMRSWTPPLAPGQVLEPQNHPFS
                     ELPDGILITRIAAKGSRTDHFRLNIWGMAYRETICFRPEPPARPELSGTIPARVESPI
                     KGDPDRPYIAAALHDSEHPDHVTERNHTRNVLRTPSNNKLRMENRRGEEHIKLATEYG
                     KTQLYSYEFNVGLAKKAAPTHNNIIWNILNLLLLVYFLLLNLFFSSG"
     repeat_region   33254..33436
     gene            33642..35246
                     /locus_tag="RAHAQ2_RS22140"
                     /old_locus_tag="Rahaq2_4595"
     CDS             33642..35246
                     /locus_tag="RAHAQ2_RS22140"
                     /old_locus_tag="Rahaq2_4595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341614.1"
                     /db_xref="GI:504107628"
                     /translation="MATLHTLLALCPQENPDILMQKAKVQTALWEKWLNPVSSDNATG
                     EDPGYDDDFQRMREEVNKLSGADTELVCQLAEKLLTTVCKDVRVATYYLWARLHRDGE
                     SGLAEGLELLSGLVSRYGDQLLPSRKNSRRAAMEWLAGSKVLDSLSLYPEVDKPKFER
                     ILAALTLFEDVITSWEDVNRPQLGGLYDALESRLAQSGGFDAVVPQNSGGQATSDSRS
                     LSPDMPTLKVIQSGRELLDQAKALAQYLRDQPQGWLSGHRLMTTIRWDTVDQLPPLDA
                     KGCTRLAPPRTEYRAQLKRLYLQQSWTELLENADRMFTEGVNHFWLDIQWYLHQALSK
                     SGAPYDSWAEFIEQDLRLLLLRLPGLETLAYSDGTPFADEVTAGWITRDIQDNDGRWQ
                     SEPNAVSASGDEDVLQLETEALAQADSEGIEAALNWLQIRPGITTPRQRWLIRLLMAR
                     VAEQYGKNEMALHLLGELDSTGNRLTLKQWEPALLFEVKARRLKLLRMQFQRGDTDKA
                     KLTLEMDKLLAGLVSIDPARAAVLCA"
     gene            35265..35696
                     /locus_tag="RAHAQ2_RS22145"
                     /old_locus_tag="Rahaq2_4596"
     CDS             35265..35696
                     /locus_tag="RAHAQ2_RS22145"
                     /old_locus_tag="Rahaq2_4596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341615.1"
                     /db_xref="GI:504107629"
                     /translation="MNSKSPSLYEILTGNFAGGLDLHNVSEENQVILSVLDNMQRILN
                     CRAGTLSHLPDYGLPDMSKILQGMPGTAHSLLDVLSETLLKYEPRIKKLHVILLPQSS
                     PGHLEYAIDAELKELGLVRFGTEFMPEGRVLMRHMKQQNYV"
     gene            35857..36666
                     /locus_tag="RAHAQ2_RS22150"
                     /old_locus_tag="Rahaq2_4597"
     CDS             35857..36666
                     /locus_tag="RAHAQ2_RS22150"
                     /old_locus_tag="Rahaq2_4597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341616.1"
                     /db_xref="GI:504107630"
                     /translation="MFKGIFLLTTASLFSLSAQAGLFGGEDFKCGRNDAVKAVQDYIK
                     SEAGAKLQNDYITSPEIFHKKDIQEFQSKIDSIPMTISNVSTTSTTDGMLNCSATIAA
                     QLPPETLEVLKNNPEYLSGIISDNGKMNNGKVVWSNYPYSLSLADNKKDISVNRINYI
                     QNSLYQMSTLAVNKDYIITSKFTVKLSSSKNNYARSDRNLNDIWKSLPDSIKTSMKKS
                     QQAWVNDKALKCGKLSDADMETTPIQNRINTYDCQTKMTNERIAFLGGDNY"
     gene            36749..38146
                     /locus_tag="RAHAQ2_RS22155"
                     /old_locus_tag="Rahaq2_4598"
     CDS             36749..38146
                     /locus_tag="RAHAQ2_RS22155"
                     /old_locus_tag="Rahaq2_4598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein ImpA"
                     /protein_id="WP_014341617.1"
                     /db_xref="GI:504107631"
                     /translation="MMAQDINRQLRTGGDPRALADYAVLREELSKLTHPARPDVDWKK
                     VEQLCLNLFQQNGIELQTASWYTQARTRLTGMSGLNEGLAILEALISRQWPGLWPQPV
                     HARMEILSGLSQRLQQTLRSMTLDYHDLSQIYQAEKLINALCEVLQRLELKHVSQLEA
                     LSSFMHGAAVRLENMHAASDTTIVLPAAATENTEKRWATQAREQWVYVAQAEPAEPQV
                     TITPPAPVKHPVQWKGFIAGIMATLLAGGGVCAAITAFYHPPSGEQLMATLPVMPKPL
                     NAQTLETLKNRQAEMLHREAPAYLAAMQQQTRQLATLSPRWAQDTGSHLVSQALILWP
                     DNPATAALAKSWTQQLNANAVPLENLSGWQQANTQLQQLADKLNGLDEQRGKYMTVSQ
                     LKSSVFAIQQALNGSPPVEESLRKLAQDKQQNKDVSPQLMMQLDNQFTQLLNRYVLLT
                     QTLPATAGKNGQADN"
     gene            38212..38682
                     /locus_tag="RAHAQ2_RS22160"
                     /old_locus_tag="Rahaq2_4599"
     CDS             38212..38682
                     /locus_tag="RAHAQ2_RS22160"
                     /old_locus_tag="Rahaq2_4599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341618.1"
                     /db_xref="GI:504107632"
                     /translation="MSAKERFLKKLQDSQPRTGSFENKGQADIAEFRQRITLLQENIE
                     EWLEGTGIRVESTTVSLVECLIGGKSFSIPGIRLTYEDSQVTFTPVFLYGQGVTGCVE
                     TSLCTQGRVTVLCRLFMRAGENRDWTWRPANPFTAQERTFGEELFFELIEGLLP"
     gene            39230..40654
                     /locus_tag="RAHAQ2_RS22165"
                     /old_locus_tag="Rahaq2_4600"
     CDS             39230..40654
                     /locus_tag="RAHAQ2_RS22165"
                     /old_locus_tag="Rahaq2_4600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome D ubiquinol oxidase subunit I"
                     /protein_id="WP_014341619.1"
                     /db_xref="GI:504107633"
                     /translation="MFGLDALELARIQFAFTVSFHIIFPAITIGLASFLAVLEGMWLK
                     TKKEAYRDLYHFWSKIFAVNFGMGVVSGLVMAYQFGTNWSMFSSFAGSITGPLLTYEV
                     LTAFFLEAGFLGVMLFGWNRVGPGLHFFSTCMVALGTLMSTFWILASNSWMQTPQGYE
                     IVNNLVVPVSWMKVIFNPSFPFRLMHMTTAAFLASAFFVGSAAAWHLLRGRDTPAIRT
                     MLSMAMWMALIVSPIQAFLGDAHGLNTLKYQPAKIAAIEGHWENKDNKPSPLVLIGYP
                     DMNREETRYAIEIPYLGSLILTHSLTHQIPALKSFPKEDRPNSSVIFYTFRIMAGLGM
                     LMILLGVLSLILRRGGKMYTSKAFLRFAFLMGPSGLLALLAGWITTEMGRQPWVVYGL
                     LRTKDAVSNHNVLQMSVSLILFIVIYCSVFGVGYGYMMRLIRKGPQAHEGESVDHGGP
                     GQHRTPARPLSAISESLTDENKGA"
     gene            40657..41664
                     /locus_tag="RAHAQ2_RS22170"
                     /old_locus_tag="Rahaq2_4601"
     CDS             40657..41664
                     /locus_tag="RAHAQ2_RS22170"
                     /old_locus_tag="Rahaq2_4601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol oxidase subunit II, cyanide
                     insensitive"
                     /protein_id="WP_014341620.1"
                     /db_xref="GI:504107634"
                     /translation="MGIDLPLIWFLIIIFGVMMYIVMDGFDLGIGLLFPLVKKEHDRD
                     VMMNTVAPVWDGNETWLVLGGAALYGAFPLAYSVILDALTIPLTLMLFGLIFRGVAFE
                     FRFKASPAKRHVWDKSFICGSVIATFCQGVVLGAVINGIPVVNRTYAGGALDWLTPFT
                     LFCGFALVVAYALLGCTWLIMKTEGELQEAMHKIAKPLLMVFLLVTLAVSLWTPLTHS
                     DIATRWFSRPNLYWFLPVPVLVVLVSAWMYRAISKNAHHAPFLLTLALVFLGYTGLGI
                     SIWPNIIPPSISIWEAASPPQSQGFILVGALFIIPIILVYTFWSYYVFRGKVTPDQGY
                     H"
     gene            complement(42034..43548)
                     /locus_tag="RAHAQ2_RS22175"
                     /old_locus_tag="Rahaq2_4603"
     CDS             complement(42034..43548)
                     /locus_tag="RAHAQ2_RS22175"
                     /old_locus_tag="Rahaq2_4603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014341621.1"
                     /db_xref="GI:504107635"
                     /translation="MKQKHFNVVAAGVLLALSLVSEVAQAAGVLTIGRREDSTTFDPI
                     RSAQNADNWVFSNVFDPLVRVDNTGTQLLPGLAESWTISPDGKTYTLKMRDAKFSDGT
                     PVTASDAVFSLTRIRDDAGSLWKDSYSIIDTLKAPDAHTLVITLKTPSAAFLSQLALP
                     NASVISQQALTRQGADDFAEHPVGSGAFSVKEWTRGEKVELVKNPYYWDAAKVKLDGV
                     EWLTLPDDNTRMLKVQAGEIDAALSIPFSRISSLQKDPKLAVELDTSTREDHLLINHS
                     HGDLGKVEVRQALDFAIDKKAIIDTVTFGYGKIANSYIPDGALYHYAGNLQRPYDPEK
                     ARQLLAAAGVKNLTLKYLVNAGDEVDEQIAVLLQQQLAKAGITANLQKVDPSQSWDML
                     VAGDYDISVMYWTNDILDPDQKTTFTLGHDSNMNYMTRYHNDKVKALVAAARVEMDPK
                     KREQMYIDLQKMAKADVNWIDLYYSPYRNVTRKNIKDFHQNPLGRFTLEETVKE"
     gene            complement(43529..44578)
                     /locus_tag="RAHAQ2_RS22180"
                     /old_locus_tag="Rahaq2_4604"
     CDS             complement(43529..44578)
                     /locus_tag="RAHAQ2_RS22180"
                     /old_locus_tag="Rahaq2_4604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_014341622.1"
                     /db_xref="GI:504107636"
                     /translation="MSHLPDLKPQPYPLLEVEALCVTFPVSGLGFTKRHVQAVNDVSL
                     HIRAGETLGLVGESGSGKSTLGRAMLQLENVSAGRVRFNGQLITGGMKPDIARLRQQT
                     AMIFQDPFSSLNPRQTIGESIGEVLRVHRKVTKAEIPARINTLLTLVGLSPEHATRRP
                     QALSGGQCQRAGIARALAIEPRLIVADECVAALDVSIQAQIINLLMDLRESMGLAILF
                     IAHDLAIVRRLCDRVAVMYLGRIVESGPTQTVFNAPRHPYTAALVAAIPEIDPDRPLP
                     EHPLQGEPPSPVSLPAGCAFHPRCAFALPECRHGAVPETRHIADHAFACVLENHKSDG
                     INPMTEGMLHETKAF"
     gene            complement(44562..45539)
                     /locus_tag="RAHAQ2_RS22185"
                     /old_locus_tag="Rahaq2_4605"
     CDS             complement(44562..45539)
                     /locus_tag="RAHAQ2_RS22185"
                     /old_locus_tag="Rahaq2_4605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_014341623.1"
                     /db_xref="GI:504107637"
                     /translation="MTLMQVSGLTIEDRQGVALVDRLSLTLNAGDILGLVGESGSGKT
                     LSCRAMMRLLPGEGLHIRAGEIRLNGTDLLTLNDKRMTAIRGREIGMIFQNPASHLNP
                     VMTIGQQIAESRRLHFGASRREAQRQAVELLRQVGIPDPQRRADNYPHEFSGGMRQRA
                     MIAVALACEPKMLIADEPTTALDVTVQMQILHLLRDLRDRLGIAIILITHDLGVVAQT
                     CDRIAVMYGGRLCETGDKRPVLAQAQHPYTRGLIDCQPVSEGGAGRLITLPGQPPVAA
                     RFPSGCRFHPRCTQATALCRDSQPAMQTGSHATACHHPLIHGRENESFA"
     gene            complement(45536..46363)
                     /locus_tag="RAHAQ2_RS22190"
                     /old_locus_tag="Rahaq2_4606"
     CDS             complement(45536..46363)
                     /locus_tag="RAHAQ2_RS22190"
                     /old_locus_tag="Rahaq2_4606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel ABC transporter permease"
                     /protein_id="WP_037041176.1"
                     /db_xref="GI:739177227"
                     /translation="MGYFHLRGLPRQQALRLGIVMLSVWVLIALLSPWIAPFDPIAQD
                     ATVTLSPPSFTHPFGTDNFGRDILSRVMWGARIDLQICLIGVIFPFTFGTLTGAFAGY
                     LGGAVDTFFMRVIDVVLAFPFLVLMLSIIAILGPGLGSFYIAMAMVGWVSYARLVRSQ
                     VLTLKHRDFILAARSLGYSHPRILLLHLLPNALTSSLVFSMSDCVLVLLSGASVSYLG
                     LGVQPPVAEWGVMVAEGQSFITTAWWITTFPGLAIVVLAMSFSLLADGLGDKLGERP"
     gene            complement(46393..47331)
                     /locus_tag="RAHAQ2_RS22195"
                     /old_locus_tag="Rahaq2_4607"
     CDS             complement(46393..47331)
                     /locus_tag="RAHAQ2_RS22195"
                     /old_locus_tag="Rahaq2_4607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014341625.1"
                     /db_xref="GI:504107639"
                     /translation="MHRYRFLLWRPLQLLPVLLGISILTFVMVRAIPGDPARILLGVR
                     STPEAIARIRVQYGLDLPVWQQYLYFLRNLFHGEMGKSLIYRVDTLKLIMSRIEPTLY
                     LVLGSVVLAMLFTVPLAAGAARHRGRLADQVIRLLSTIGLGLPAFWLAIMMILLFSLS
                     LGWFPVSGYGSDFGERVHHLFLPCLTVALALSAVLTRNLRASLLMELQNDYVTAARAR
                     GQNENRIFWRHVMPNSLVPTVNLLAVNIGWLIGSTVVIESVFAIPGMGQLLVKAIISR
                     DYMVVQGVVLVFALATVAVNLLADLLTVALDPRVKL"
     gene            47560..48315
                     /locus_tag="RAHAQ2_RS22200"
                     /old_locus_tag="Rahaq2_4608"
     CDS             47560..48315
                     /locus_tag="RAHAQ2_RS22200"
                     /old_locus_tag="Rahaq2_4608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_014341626.1"
                     /db_xref="GI:504107640"
                     /translation="MKLAVQESAVSLRETTVDGAFDQLFAQTSRLGFDALIYDYTPVP
                     RTLEGELITPSLLRMCNVPGDMQRLWLENGYYQVDPVQHYALESCAPFVWSYQRPDNT
                     SLQNRLSDLNKPVTHYMCDNNMPSGATVPLHLPNGGFVTVTGIHTGAGHELDIHDVLA
                     ELSLLALTFQECVFPLFDSSILTCRHVRLSKRERECLTWAAEGLTAKEIARKLNRSIA
                     TVTLHLNTAARKLGASNRVQAVVRAMHYRLLDS"
     gene            48406..49305
                     /locus_tag="RAHAQ2_RS22205"
                     /old_locus_tag="Rahaq2_4609"
     CDS             48406..49305
                     /locus_tag="RAHAQ2_RS22205"
                     /old_locus_tag="Rahaq2_4609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid amidase"
                     /protein_id="WP_014341627.1"
                     /db_xref="GI:504107641"
                     /translation="MYNITEGYAPFQEYQTWYRICGDLHNGKTPLVIAHGGPGCTHDY
                     VDAFRDIAGTGRAVIHYDQIGNGRSTHLPDKPADFWQPSFFLAELDNLLHHLGIGQNY
                     ALLGQSWGGMLGAEHAVTQPPGLKALVIANSPASMALWLQAAARLRSELPPDVQETLL
                     AHEAAGTLDSAEYKAASQVFYARHVCRLDPWPEEVKRTFAAMDADPTVYLAMNGPTEF
                     HVIGSMKNWTVIDRLPAINVPVLLISGRYDEAAPEVVQPFADLIKGAEWVIFENSSHM
                     PHVEEREACMKCVEAFLASHGSL"
     gene            complement(49384..50370)
                     /locus_tag="RAHAQ2_RS22210"
                     /old_locus_tag="Rahaq2_4610"
     CDS             complement(49384..50370)
                     /locus_tag="RAHAQ2_RS22210"
                     /old_locus_tag="Rahaq2_4610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014341628.1"
                     /db_xref="GI:504107642"
                     /translation="MIHNPCFLTITPEMTQHDPFALSSDLISELLTGMRLRGVQYRRI
                     QTGPEFGMAFKPRPGHAYFHYLAVGSAVLKTGDGVLHPLSAGDVVFMPHGMAHQLLSE
                     PDNTAQDIDDFDVAPLGDAVSGVDTCPSRDTIPGVILFYGCMEFDLGGMQSLGKLMPD
                     TMVADAKGERYPGLLPVIDAMKREICSGRIGFAGILARLAEVAAAMIVRGWVECGCEN
                     ASGIAAALREPRLARAILALHRQPGRNWTVAELAAESHISRSVFAARFQSMIGVSPLR
                     YVTELRMQLATQWLADSKIPIETVAFRLGYTSQAAFSRAYKRISGQSPGASR"
     gene            50431..51669
                     /locus_tag="RAHAQ2_RS22215"
                     /old_locus_tag="Rahaq2_4611"
     CDS             50431..51669
                     /locus_tag="RAHAQ2_RS22215"
                     /old_locus_tag="Rahaq2_4611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014341629.1"
                     /db_xref="GI:504107643"
                     /translation="MNHKTQGSTPAIQRDVQQAPPAWMAVFSLTMGVFGLLTAEYLPA
                     SLLTPMASDLQVTEALAGQAVTVTAVIALFAGLLVPGLTRKLDRRTVLLSFTVLMIAS
                     NLLVALSSSLVVLLAMRILLGVALGGFWSMAAAVAMRLVPEKFVPRALSVIFSGIAVG
                     TVVSVPLGSFLGELYGWRSAFIAAALVGGVTLAFQWFTLPRMAPRQVTHTESVLTLLR
                     RPGIATGMFGCVLAHTGQYALFTYIRPSLESVSHVDAGGLALLLLGFGVANFAGTLLA
                     GWVMTYSLRLTLIVMPCLVGIAALGMILLPVQITGLTLLVLLWGLAFGGVPVAWSNWV
                     TRSVPDQAESAGGMVVAAVQSSIAAGAALGGVMFGLGGISGVFITAGIVMLSAALIIA
                     LCVRVGLPGYGAETASLQQG"
     gene            52204..53637
                     /locus_tag="RAHAQ2_RS22220"
                     /old_locus_tag="Rahaq2_4612"
     CDS             52204..53637
                     /locus_tag="RAHAQ2_RS22220"
                     /old_locus_tag="Rahaq2_4612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome D ubiquinol oxidase subunit I"
                     /protein_id="WP_014341630.1"
                     /db_xref="GI:504107644"
                     /translation="MFGLDAFHLARIQFAFTVSFHIIFPAITIGLASFLAVLEGMWLK
                     TGNRSYRDLYHFWSKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGGITGPLLTYEV
                     LTAFFLEAGFLGVMLFGWNRVGPGLHFFATCMVALGTLISTFWILASNSWMHTPQGYE
                     IVNGVVVPTDWFKVIFNPSFPYRLFHMSIAAFLASAFFVGASGAWHLLRGNDTPAVRT
                     MFSMALWMALIVAPIQAMVGDAHGLNTLEHQPAKIAAIEGHWENPPGEATPLILFGMP
                     DMEQERTKYALEIPYLGSLILTHSLQKQVPALKSFPKEDRPFSPVIFWSFRIMVALGL
                     LMITAGVLGAWLRYKKRLYQSRPFLWFTLLMGPSGLIALLAGWFTTEIGRQPWVVYGV
                     QRTRDAVSAHGEMHMSLSLLAFLLVYSSVFGIGYVYLMRLIKKGPVTGEGDEVSHGGP
                     GKKSTPARPLSAAHEGLSNPEGSKKYD"
     gene            53630..54634
                     /locus_tag="RAHAQ2_RS22225"
                     /old_locus_tag="Rahaq2_4613"
     CDS             53630..54634
                     /locus_tag="RAHAQ2_RS22225"
                     /old_locus_tag="Rahaq2_4613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol oxidase subunit II, cyanide
                     insensitive"
                     /protein_id="WP_014341631.1"
                     /db_xref="GI:504107645"
                     /translation="MIDYTIIWFGIIVFANLMYIVMDGFDLGIGILFPFNKDKTERDM
                     MVNTVAPVWDGNETWLVLGGAALYGAFPLAYSVIADALTIPLTLMLFGLIFRGVAFEF
                     RFKATEKHRPFWDKSFITGSVVATFSQGVAVGAVLNGFEVTGRTFTGSALSWLAPFPL
                     FCGVGLVVAYALLGCTWLIMKTENSLHQKMCRLAKPLVITLLVIMGIISIWTPLTHAD
                     IAHRWFSMPNLIAFLPVPVLVLASTWGILRAIKSNAHYMPFLLTLALVFLGFSGLGIS
                     IWPNIIPPAISIWDAASSQKSLAFMLVGAALIIPVILIYTFWSYYVFRGKIKENEGYH
                     "
     gene            complement(54874..55635)
                     /locus_tag="RAHAQ2_RS22230"
                     /old_locus_tag="Rahaq2_4615"
     CDS             complement(54874..55635)
                     /locus_tag="RAHAQ2_RS22230"
                     /old_locus_tag="Rahaq2_4615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014341633.1"
                     /db_xref="GI:504107647"
                     /translation="MPIKKLENPRIYRQIADQLKTLIDNKEFPPGSRLPSERELASQL
                     QVSRASVREALIALEVIGLVDVRVGNGVIVRQPPAVPLTPSQEPVMSQAGRNQWTDVD
                     DELNIALDFTAELPPFSLLQTRRLIEPETAALAARNATDAELAAIRQAYEQNCRDNRN
                     GSATHPGDRLFHIRIAQASGNPAYAFIIAHLLGHRYGTMFRSLQLHYTPQDMPHRSEI
                     EHLEILTALEARDSRAAKKAMKEHLDAVIKIFGQG"
     gene            55859..56599
                     /locus_tag="RAHAQ2_RS22235"
                     /old_locus_tag="Rahaq2_4616"
     CDS             55859..56599
                     /locus_tag="RAHAQ2_RS22235"
                     /old_locus_tag="Rahaq2_4616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014341634.1"
                     /db_xref="GI:504107648"
                     /translation="MNLAGKKVLITAAGQGIGFNTATLFALEGAEVIATDINIEALHN
                     IPGITPRLLDVTDPQAIAALAEETGALDVLFNCAGVVHSGDILTCTEREWQFALDLNV
                     TAMFRMIRAFLPAMLERNSGSVINMSSVASSIKGVPNRFAYSASKAAVIGLTRSVAAD
                     YVTRGIRCNAICPGTVESPSLRQRIAAQAKAEGRSEAEVYAAFVSRQPIGRIGKTEEI
                     AQLALYLASDASSYTTGTVQIIDGGWSN"
     gene            56663..57505
                     /locus_tag="RAHAQ2_RS22240"
                     /old_locus_tag="Rahaq2_4617"
     CDS             56663..57505
                     /locus_tag="RAHAQ2_RS22240"
                     /old_locus_tag="Rahaq2_4617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate lyase"
                     /protein_id="WP_014341635.1"
                     /db_xref="GI:504107649"
                     /translation="MKLLRYGNPGSERPGLLDDHGKLRDLSAHVADISGEFLQSETLD
                     KLRQLDPQNLPLVSGEPRLGPCVGKVGKFICIGLNYADHAAETGAEIPKEPVVFSKWT
                     SAIVGPNDDVEIPRDSVKTDWEVELGVVIGTGGRYISEADALSHVAGYCVINDVSERE
                     FQIERGGTWDKGKGCDTFGPTGPWLVTADEIPDPHQLNLWLEVDGKRYQNGNTRTMIF
                     RIPEIISYLSRFMSLQPGDIISTGTPPGVGLGQKPPVYLKAGQVMRLGIEGLGEQRQK
                     TVQA"
     gene            57532..58809
                     /locus_tag="RAHAQ2_RS22245"
                     /old_locus_tag="Rahaq2_4618"
     CDS             57532..58809
                     /locus_tag="RAHAQ2_RS22245"
                     /old_locus_tag="Rahaq2_4618"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fuconate dehydratase"
                     /protein_id="WP_014341636.1"
                     /db_xref="GI:504107650"
                     /translation="MTTITALRVEDVRFPTSLALDGSDAMNPDPDYSAAYVILDTDNP
                     ALKGHGLTFTIGRGNEICCVAIKALEHLIVGRELAAIIADMGQFWRDFTSDSQLRWIG
                     PDKGAIHLATGAVVNAVWDLWSKAAGKPLWQLVADMSPEELVRCIDFRYITDCITPQE
                     ALALLRQRADNKAQRREKLLAEGYPCYTTSAGWLGYPDDKLRRLCQEAVNAGFDYLKL
                     KVGRDLEDDIRRVRIAREVIGPDRKLMIDANQVWETDEAIPWVNALAFAKPWFIEEPT
                     SPDDIEGHRKIRQGVAPVKVATGEMCQNRIMFKQFIMREAIDVVQIDACRMGGVNEVL
                     AVMLMAAKYNLPVCPHAGGVGLCEYVQHLSMIDYLCIAGTHEGRVIEYVDHLHEHFVH
                     PCDIRGAAYMPPQAPGFSIEMHQASVERYRHHT"
     gene            58844..59704
                     /locus_tag="RAHAQ2_RS22250"
                     /old_locus_tag="Rahaq2_4619"
     CDS             58844..59704
                     /locus_tag="RAHAQ2_RS22250"
                     /old_locus_tag="Rahaq2_4619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_037041173.1"
                     /db_xref="GI:739177224"
                     /translation="MIRIDSHQHFWRYTPQDYRWISDEMAVLKQDFLPETLKNTLQRH
                     DIQGTVLVQACPSAGETRWLLELAEHTDFVRAVTGWVDMSSSALQRDLDAISHPLLRG
                     FRHQVQDEPSPAQWLADPAINAGIRQIQRQDYVYEILVTHRHLRDAVQFAARHDGHFL
                     VLDHLGKPDLSLGAAYWKKQIAPLAALEHVSCKLSGLLTEPRPGGMSARDLLPYFDAA
                     LEVFGTGRLMFGSDWPVCLLAGGDENPWNLWQQATGSLSSDEQAALYGGNACTVYRLQ
                     EMTDESASAK"
     gene            59682..60458
                     /locus_tag="RAHAQ2_RS22255"
                     /old_locus_tag="Rahaq2_4620"
     CDS             59682..60458
                     /locus_tag="RAHAQ2_RS22255"
                     /old_locus_tag="Rahaq2_4620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014341638.1"
                     /db_xref="GI:504107652"
                     /translation="MNLHLQNKVVMVTGGGSGIGAAISLTLAEEGAIPVIISNTEPAN
                     ELMHKLQQLSPQASFVLTELRDEASCKAAVNEVLTRYGSIDGLVNNAGANDSVGLEAG
                     REAFVQSLEQNLIHYYLMAHLSLNALRASRGAIVNISSKTALTGQGNTSGYASAKGGI
                     LALTREWAAALLGDGIRVNAVIPAEVMTPLYERWIKSFDHPEEKLQQITSHIPLEQRM
                     TTPQEIANTVVFLLSSRTSHTTGQWLTVDGGYMHLDRALT"
     gene            60455..60799
                     /locus_tag="RAHAQ2_RS22260"
                     /old_locus_tag="Rahaq2_4621"
     CDS             60455..60799
                     /locus_tag="RAHAQ2_RS22260"
                     /old_locus_tag="Rahaq2_4621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341639.1"
                     /db_xref="GI:504107653"
                     /translation="MKRRYCQALDLADDPALIEEYQRYHREIWPEITAHLRRYGITEM
                     EIYRLGNRLMMVMETTEDFDSGLFERRSLEDPKVCEWEALMWKYQRPTPWTPAGEKWV
                     EMERIFSLTEQK"
     gene            61093..62331
                     /locus_tag="RAHAQ2_RS22265"
                     /old_locus_tag="Rahaq2_4622"
     CDS             61093..62331
                     /locus_tag="RAHAQ2_RS22265"
                     /old_locus_tag="Rahaq2_4622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014341640.1"
                     /db_xref="GI:504107654"
                     /translation="MLADKTAAPAYAQRKTTSGFRLAFILVTTLFFLWGLSYGLLDVL
                     NKHFQDVLHVNKAQSGLLQAAYFGAYFIIALPAGFFMDRFGYKAGILVGLCLYALGAL
                     LFVPAASAGSFGMFLFALFVIALGLGCLETAANPFATVLGDPAGAERRLNLSQSFNGL
                     GQFIGPIIGGSLFFSATQGTTTDGLSSVKTTYVAIAVLVLLIAFLFGRTKLPDIREQS
                     APEDHGIGKGLWQHGHFTGGVIAQFFYVAAQVGVGAFFINYTTEHWHTLSNQNASYLL
                     SVGMISFMVGRFFSTWLMGFVRPVTLLVVYAIINIVLCGVVVAGIDNVSVIALVAIFF
                     FMSIMFPTIFAMGVKNMGKQTKRASSVMIMAIVGGAVMPYLMGAIADHYNTAVSYALP
                     MVCFAVVLIYAVKQRAKAAI"
     gene            62963..63946
                     /locus_tag="RAHAQ2_RS22270"
                     /old_locus_tag="Rahaq2_4624"
     CDS             62963..63946
                     /locus_tag="RAHAQ2_RS22270"
                     /old_locus_tag="Rahaq2_4624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341641.1"
                     /db_xref="GI:504107655"
                     /translation="MNKKLTFTIKSIRFDENYNPSENTRITTNFANLARGEKRQENLR
                     NTLVMIDNRFNSLVHWDNPKKDRYSVELDIITAQLNIDAEGKADSFPVIEILKTTVVD
                     KKTNQRIEGIVGNNFSSYVRDYDFSVLLPEHNKNQPEFSLPDNFGELHGNIFKRFVKS
                     DAYKDNFTKAPVICLSVSSKNTYYRTGNKHPVLGVEYQQDELSLTDEYFAKMGLRARY
                     FMPENSVAPLAFYFSGDLLSDYTHLELISTISTMETFQKIYRPEIYNANSAAGIQYQP
                     SLNYQDYSLTRIVYDREERSHLAIEQGKFTEECFIKPYQNVLEQWSAHSAL"
     gene            63978..65009
                     /locus_tag="RAHAQ2_RS22275"
                     /old_locus_tag="Rahaq2_4625"
     CDS             63978..65009
                     /locus_tag="RAHAQ2_RS22275"
                     /old_locus_tag="Rahaq2_4625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004946619.1"
                     /note="catalyzes the formation of
                     tetrahydropteroyl-L-glutamate and methionine from
                     L-homocysteine and
                     5-methyltetrahydropteroyltri-L-glutamate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="WP_014341642.1"
                     /db_xref="GI:504107656"
                     /translation="MKKLLPTSTAGSLPKPSWLAQPEVLWSPWKLQDQELIDGKLDAL
                     RLCLEDQQQAGIDIVSDGEQTRQHFVTTFIEHLEGVDFEKRETVKIRNRYEASVPTVV
                     GPVSRKKAVFVEDAKFLRQQTTQPIKWALPGPMTMIDTLYDNHYKSREKLAWEFAKIL
                     NEEARELEAAGVDIIQFDEPAFNVFFDEVNDWGIATLERAIEGLKCETAVHICYGYGI
                     KANTDWKKTLGTEWRQYEEIFPKLQKSNIDIISLECHHSHVPMELMELIRGKKVMVGA
                     IDVATNTIETPEEVAATLRKALQFVDADKLYPCTNCGMIPLPRGVARGKLDALSAGAE
                     IVRKELLAK"
     gene            complement(65157..65885)
                     /locus_tag="RAHAQ2_RS22280"
                     /old_locus_tag="Rahaq2_4626"
     CDS             complement(65157..65885)
                     /locus_tag="RAHAQ2_RS22280"
                     /old_locus_tag="Rahaq2_4626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase A"
                     /protein_id="WP_014341643.1"
                     /db_xref="GI:504107657"
                     /translation="MKFASKNRRNFRHYSLIAGLMLASAFVFENNAWSWGAGAEPAVV
                     IPAPAKDEPAGTAHSETALFAGGCFWGIQGVFQHVKGVTSAVSGYTGGAAQTARYEQV
                     STGETGHAESVKVTFDPTQVTYGELLQIFFSVGHNPTELNRQGPDTGSQYRSAVFPLS
                     AAQAEVAKAYIAQLDASHSYNEPLVTKVESHAHFYPAEAYHQNFLNDNPDYPYIVVND
                     LPKIKYLKQYFPAQYREQPVLVKE"
     gene            complement(65904..66410)
                     /locus_tag="RAHAQ2_RS22285"
                     /old_locus_tag="Rahaq2_4627"
     CDS             complement(65904..66410)
                     /locus_tag="RAHAQ2_RS22285"
                     /old_locus_tag="Rahaq2_4627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase B"
                     /protein_id="WP_014341644.1"
                     /db_xref="GI:504107658"
                     /translation="MINRRNFLLGSGAVSAAALMGLVPSLFSRSAGAQTTSEKFEITL
                     TDAQWHQRLSEDQYRILREAGTERPYSSPLNDEHRVGEFACAGCNLALFSSATKFDSH
                     TGWPSFWKPLGNAAQTSRDTSLGMVRDEVHCRRCGGHLGHVFDDGPQPTGLRYCMNGL
                     AMTFTPKA"
     repeat_region   66680..66782
     gene            complement(67137..69176)
                     /locus_tag="RAHAQ2_RS22290"
                     /old_locus_tag="Rahaq2_4628"
     CDS             complement(67137..69176)
                     /locus_tag="RAHAQ2_RS22290"
                     /old_locus_tag="Rahaq2_4628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="family 31 glucosidase"
                     /protein_id="WP_014341645.1"
                     /db_xref="GI:504107659"
                     /translation="MSELIAEKNRILWHFDQQTLVIEPWGEHSLRVRATCRPELNDSL
                     WALLPAGAQPQAEISRSAETLTLRNGNITASVNIKGQLAFYNQRGELILEEFWRQRST
                     VGIGATEKSQDKYISALKMDAREFKAIPGGKHQLTVRFESRPDEKIYGMGQYQQNCLD
                     LKGCTLELAQRNSQASVPFMLSSLGYGMLWNNPAIGEVTFGKNITRWEAQVTEQMDYW
                     ITAGDTPADIMHQYGRATGTAPQMPEYATGFWQCKLRYRTQQEVLEVAREYKRRNLPV
                     SVIVIDFFHWPNQGTWCFDPVDWPDPKAMVAELKSLGIETMVSVWPTVDSRTDNYKEM
                     KSKGYLVNTDRGVSVNLDFLGNCTFFDATHPGARQFVWEKVKQNYYDLGIRTFWLDEA
                     EPEYRAYDFDNYRYHLGPVLEVGNIYPQKFAQGFYDGLQQEGENEIVNLVRCAWAGSQ
                     RYGVLAWSGDIHSSFHALRNQIAAGLNMGLAGIPWWTTDIGGFQGGNVNDPAFQELLI
                     RWFQWGVFCPVMRLHGYREPQIQPPEPWRDGIAQCNSGAANEVWSYGEENYQLMKNGL
                     FLREKLRPYISRVMQEAHEKGDPVMRTMFYQYPAQAESWQVEDQYMLGADILVAPVLY
                     AGQREREVWLPAGETWVALNGERYEGGRTITVATPMSEIPVFVREGADSTARAIL"
     gene            complement(<69245..70552)
                     /locus_tag="RAHAQ2_RS22295"
                     /old_locus_tag="Rahaq2_4629"
                     /pseudo
     CDS             complement(<69245..70552)
                     /locus_tag="RAHAQ2_RS22295"
                     /old_locus_tag="Rahaq2_4629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007753781.1"
                     /exception="unextendable partial coding region"
                     /note="may be involved in the transport of
                     galactosides-pentoses-hexuronides; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
     gene            70919..71401
                     /locus_tag="RAHAQ2_RS22300"
                     /old_locus_tag="Rahaq2_4630"
     CDS             70919..71401
                     /locus_tag="RAHAQ2_RS22300"
                     /old_locus_tag="Rahaq2_4630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="WP_014341647.1"
                     /db_xref="GI:504107661"
                     /translation="MAIPAYLWLKDDGGADIKGSVDVNGREGSIEVLGFGHGLFLPTD
                     NNTGKITGTRVHSALTFEKEFDSSSPYLYKAVAKGQTLKSAEIRWYRINDAGQEAEYF
                     NMLMENVKVVSVCPLMHDCKNPATEKHNHLESISLRYERITWKHCDGNIIFSDAWNDR
                     "
     gene            71398..71873
                     /locus_tag="RAHAQ2_RS22305"
                     /old_locus_tag="Rahaq2_4631"
                     /pseudo
     CDS             71398..71873
                     /locus_tag="RAHAQ2_RS22305"
                     /old_locus_tag="Rahaq2_4631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016156367.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            71873..72115
                     /locus_tag="RAHAQ2_RS22310"
                     /old_locus_tag="Rahaq2_4632"
     CDS             71873..72115
                     /locus_tag="RAHAQ2_RS22310"
                     /old_locus_tag="Rahaq2_4632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341649.1"
                     /db_xref="GI:504107663"
                     /translation="MKPYQYVLIWMAGSASFVVILVTIFALIPENIAYSLLTEKTGFI
                     TEESWANIFMTFIHLTSFLLNISLIWLVAFLLKKKK"
     gene            72164..72490
                     /locus_tag="RAHAQ2_RS22315"
                     /old_locus_tag="Rahaq2_4633"
     CDS             72164..72490
                     /locus_tag="RAHAQ2_RS22315"
                     /old_locus_tag="Rahaq2_4633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341650.1"
                     /db_xref="GI:504107664"
                     /translation="MVNNQDVIDWYNLGWNKTGKWPVTIDTSLTTGRYVWVWETGEEI
                     MTSYFKTFGVDTEGFNFLKYWPDEKGMIPNFLLPKSCRVKYIEPAPLTLRMLAESARA
                     GKWLYD"
     gene            72759..73292
                     /locus_tag="RAHAQ2_RS22320"
                     /old_locus_tag="Rahaq2_4634"
     CDS             72759..73292
                     /locus_tag="RAHAQ2_RS22320"
                     /old_locus_tag="Rahaq2_4634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341651.1"
                     /note="catalyzes the rearrangement of isopentenyl
                     diphosphate to dimethylallyl phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl-diphosphate delta isomerase"
                     /protein_id="WP_014341651.1"
                     /db_xref="GI:504107665"
                     /translation="MIEEVVLLDVKNQPAGTMDKALVHTDQTPLHLAFSCYIHNDRGE
                     ILLTRRALSKVAWPGVWTNSVCGHPLPGESLQAAVYRRCQYELGLSVEHITSLVDEFQ
                     YRATDASGIVENEFCPIFAAFTRQPPAPRDSEVMDYQWVKPEDLQNSVRATPWAFSPW
                     MVLQLGQITQENLSLLG"
     gene            complement(73245..73781)
                     /locus_tag="RAHAQ2_RS22325"
                     /old_locus_tag="Rahaq2_4635"
     CDS             complement(73245..73781)
                     /locus_tag="RAHAQ2_RS22325"
                     /old_locus_tag="Rahaq2_4635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_014341652.1"
                     /db_xref="GI:504107666"
                     /translation="MKINVIGTSGSGKSTLARNISQKLNIPYIELDALFWKPDWQGTP
                     DDEFFARLAGKLAASDGWVIDGNYKRTQPVKWREIDMIVWVDYSFGRTLYQAVKRVFI
                     RAWGQKEIWAGTGNRESFRKSFFSRDSIILWTLKTYAKNRRYYQALFNDPDWQHVRFV
                     RLKSPQQTQVFLRNLTEL"
     gene            74287..74544
                     /locus_tag="RAHAQ2_RS22330"
                     /old_locus_tag="Rahaq2_4636"
     CDS             74287..74544
                     /locus_tag="RAHAQ2_RS22330"
                     /old_locus_tag="Rahaq2_4636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biofilm development protein YmgB/AriR"
                     /protein_id="WP_014341653.1"
                     /db_xref="GI:504107667"
                     /translation="MQIEAEQTVTEISDYLNARETPTLSEVEILGTLVSGLLASHYPV
                     SNKAIIQGLVRQLEQETNISNQQACRNLLELVLLSTQDDVI"
     gene            complement(74604..75461)
                     /locus_tag="RAHAQ2_RS22335"
                     /old_locus_tag="Rahaq2_4637"
     CDS             complement(74604..75461)
                     /locus_tag="RAHAQ2_RS22335"
                     /old_locus_tag="Rahaq2_4637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_014341654.1"
                     /db_xref="GI:504107668"
                     /translation="MIAITGATGQLGRLVIAALLKKVPANQIIAAVRNPQKAQDLADL
                     GIEVRQADYSQPATLDSAFKGVEKLLLISSSEVGQREAQHNAVIDAAKRAGVKLLAYT
                     SLLHADKSPLGLGVEHRATEKALSESGVPFVLLRNGWYTENYAASIAPALAHNAFIGS
                     VGEGKISSAARQDYAEAAAAVLTQENQAGKIYELAGDDAYTLTEFTAEIARQSGKKVD
                     YINLPEAEFAKALLGAGLPEGLANMLADSDAGAGKGGLFDDSHTLSKLIGRPTTPVKD
                     VIAATLKTL"
     gene            75576..75992
                     /locus_tag="RAHAQ2_RS22340"
                     /old_locus_tag="Rahaq2_4638"
     CDS             75576..75992
                     /locus_tag="RAHAQ2_RS22340"
                     /old_locus_tag="Rahaq2_4638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014341655.1"
                     /db_xref="GI:504107669"
                     /translation="MKIISSEQPAERLPLSEQIRRGEVLNPNCPSREILRHITSRWGL
                     LILIALSDNTLRFSELRRKVGGVSEKMLAQTLQSLEEDGFIDRRSYPVVPPHVEYSLT
                     PLGIEVKDQVAGLADWLESNLHRVMKQRSLRIAGTQ"
     gene            76111..76677
                     /locus_tag="RAHAQ2_RS22345"
                     /old_locus_tag="Rahaq2_4639"
     CDS             76111..76677
                     /locus_tag="RAHAQ2_RS22345"
                     /old_locus_tag="Rahaq2_4639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_014341656.1"
                     /db_xref="GI:504107670"
                     /translation="MSPSQTHKQHVTLVITHKIAPASEAQYEAWLNKIMPQASTFPGH
                     LGVNVIRPSRSGDAYTILVRFDTLENLNAWHNSDLRKQLVAEVSPLLLQNDNTEVRPG
                     AEFWFTPPNANVRPPARWKQYLLTLGVIYPSTHLVPWFWGQFLPQLKGTEGGHLLNDA
                     TVVGLVVFLWMPIVTRVFHSWLTRSSAQ"
     gene            76692..78572
                     /locus_tag="RAHAQ2_RS22350"
                     /old_locus_tag="Rahaq2_4640"
     CDS             76692..78572
                     /locus_tag="RAHAQ2_RS22350"
                     /old_locus_tag="Rahaq2_4640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_014341657.1"
                     /db_xref="GI:504107671"
                     /translation="MNSINNVASLILLNGKFHTVDREKPLANAVAIKDGKFLAVGTEN
                     EVMQFADAQTQVVDLHGHTAIPGLNDSHLHLIRGGLNYNLELRWEGVPSLADALRMLK
                     EQALRTPSPQWVRVVGGWTEFQFAERRMPTLDEINQAAPDTPVFILHLYDRALLNRAA
                     LNVVGYTKDTPNPPGGEIQRDSNGNPTGMLIAKPNAMILYSTLAKGPKLPLEQQVNST
                     RQFMRELNRLGLTSAIDAGGGFQNYPEDYQIIDELHQKNQLTVRIAYNLFTQRPQHEL
                     EDFELWTDMLKPGQGTDFYRHNGAGEMLVFSAADFEDFLQPRPDLPPGTEVELERVVR
                     HLVEHRWPFRLHATYDESISRMLDVFEKVNSDIPFNGLHWFFDHAETITERNIERVKA
                     LGGGIAVQHRMAFQGEYFADRYGIEATKHTPPVAKMLSAGVPVGLGTDATRVASYNPW
                     TALYWLVSGRTVGGMAMYDDDARIDRETALMLWTQGSSWFSSEQGKKGQIKIGQLADL
                     AVLSEDFFSVPEERIKGIESVMTVVDGKVVYAAGSFSPLAPPAIPVLPDWSPVTTVPG
                     HYRSAPPQGAARVGLVRQGHQCVGPCGVHKHSHDIARGSDVPVSDDNAFWGALGCSCF
                     SF"
     gene            78702..79607
                     /locus_tag="RAHAQ2_RS22355"
                     /old_locus_tag="Rahaq2_4641"
     CDS             78702..79607
                     /locus_tag="RAHAQ2_RS22355"
                     /old_locus_tag="Rahaq2_4641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_037041145.1"
                     /db_xref="GI:739177196"
                     /translation="MRDLPPTTTLRTFEVVTRHTTFTSAAEELFITQSAVSHQLKKLE
                     EIWGLQLFQRGKTLSLTPAGAALAPLVREFFSKLETTLADLREQKGRVRLRVSTTYSF
                     ALKWLLPRLPELARLHPEILVTLESTDKAIHFASADSDVAIRFGHGNYAALHTEFMFR
                     EQLFPVASPAFLASFGTPSEPAELLRFPLLTRDGADLVPKWDAWFKQVGVNTDVLHES
                     VRFADTNMTIEAALLGQGIALARSGHVEKEIRDGSLVRLFDVNFPSPAAYYFVCPEGI
                     ESQPHIMEFRNWLLAESQQAQLSYR"
     gene            79683..80510
                     /locus_tag="RAHAQ2_RS22360"
                     /old_locus_tag="Rahaq2_4642"
     CDS             79683..80510
                     /locus_tag="RAHAQ2_RS22360"
                     /old_locus_tag="Rahaq2_4642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug DMT transporter permease"
                     /protein_id="WP_014341659.1"
                     /db_xref="GI:504107673"
                     /translation="MPAHIILLTLLAALLHASWNALLRGGTDRLWSMTIMCVAIALSC
                     VAIAPFLPLPERESVKYAMLSALLHVGYNLCLIRSYQSGDLGQTYPIARGSSPLMVTC
                     GAALFAGEKIAFNTFVGIALISGGILMLALGRRRPAMPGLKYTLATGAFIAAYSVVDG
                     IGVRVSGNSFSYTVWMSMLWGALMPALYIILRDTKSLLRWRPGLLSAAAGGVVSLLAY
                     GMIIYAMTAAPMGAVSALRETSVLFAAVLGYLFLGETLTLRKMLACAVIATGTLLIG"
     gene            80531..81421
                     /locus_tag="RAHAQ2_RS22365"
                     /old_locus_tag="Rahaq2_4643"
     CDS             80531..81421
                     /locus_tag="RAHAQ2_RS22365"
                     /old_locus_tag="Rahaq2_4643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="WP_014341660.1"
                     /db_xref="GI:504107674"
                     /translation="MSDRPATALLGPGAIGTTIAAVLHEVNRTPLLCGRTAHPQLILH
                     HDDGEIVVPGPVLNNPSAADRPFGLVFVAVKTTQVADSADWLAALCDENTIVCALQNG
                     VEQKTLLEPYVNGATVVPSVVWFPAQREPDASVRLRAKPRLTLPDVPQAKRIADALSG
                     TRCAVELSSDFLSIAWRKLLQNAVAGLMVLANRRAGMFSRGDITQLALAYLHECLTVA
                     RAEGAVLSDSVAQEIVDGFHRAPADLGTSILADRQANRPLEWDIRNGVVQRSGHAKGI
                     PTPVSDILVPLLAAGSEGPG"
     gene            complement(81486..82244)
                     /locus_tag="RAHAQ2_RS22370"
                     /old_locus_tag="Rahaq2_4644"
     CDS             complement(81486..82244)
                     /locus_tag="RAHAQ2_RS22370"
                     /old_locus_tag="Rahaq2_4644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341661.1"
                     /db_xref="GI:504107675"
                     /translation="MDKLLIVNADDFGLCKAQNYGIIEAFNNGVVTSTTAMVNMATTE
                     HAAVLSAAHPELAVGMHFVLTLGRPLSPMPGLVRDGELGKWIWEMAEQGTLPLDEIAQ
                     ELQCQFDRFVAVFGRLPTHLDSHHHVHMFPQIFPIVEAFAKDQGIPVRIDRNEIRRRD
                     IALRGAKSTDGFDSSFYGEAISDALFLQTLDNATQRGDRTLEIMTHPSFIDNTILASK
                     YCTPRLAELDVLTSASLKAAIAERGFRLGSFKDL"
     gene            complement(82290..83633)
                     /locus_tag="RAHAQ2_RS22375"
                     /old_locus_tag="Rahaq2_4645"
     CDS             complement(82290..83633)
                     /locus_tag="RAHAQ2_RS22375"
                     /old_locus_tag="Rahaq2_4645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341662.1"
                     /note="catalyzes the fromation of N-acetyl-D-glucosamine
                     and N-acetyl-D-glucosamine-6-phosphate from
                     diacetylchitobiose-6-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacetylchitobiose-6-phosphate hydrolase"
                     /protein_id="WP_014341662.1"
                     /db_xref="GI:504107676"
                     /translation="MRNKLKVVTIGGGSSYTPELLEGFIKRYDELPITELWLVDVEAG
                     KEKQDIIFNLCQRMVERAGVPIVMHKTLDRREALADADFVTTQLRVGQLKARELDERI
                     PLSHGYLGQETNGAGGLFKGLRTIPVIFDIIRDVEEICPDAWVINFTNPAGMVTEAVF
                     RHTKFKKFIGVCNIPVGMKMFIQDVLKLTPQEELSIDLFGLNHMVFIKDVLVNGESRF
                     AELLDGVASGTLTAGSVKNIFDLPFSEGLIRSLNLLPCSYLLYYFKQKEMLAIEMGEF
                     YKGGARATVVQKVEKQLFDLYKNPDLNVKPKELELRGGAYYSDAACEVISAIYNDKQT
                     EQYVNFPHNGHIDNIPADWAVEMTCTIGRDGAKPHPRITHFDEKVLGLIYTIKGFEIA
                     ASEAALSGEFNDVLLAMNLSPLIHSDKDAEILAREMLLAHEKLLPNFAETIATLK"
     gene            complement(83694..84533)
                     /locus_tag="RAHAQ2_RS22380"
                     /old_locus_tag="Rahaq2_4646"
     CDS             complement(83694..84533)
                     /locus_tag="RAHAQ2_RS22380"
                     /old_locus_tag="Rahaq2_4646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577911.1"
                     /note="represses the celABCDF-ydjC operon involved in
                     carbon uptake; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_037041141.1"
                     /db_xref="GI:739177192"
                     /translation="MMQPPVLSMEIKTARENQLFDGQNFHMFIYNKVESISGLHEHDY
                     YEFTVVLTGRYYQNVNGKRVLLERGDFVFIPLGSNHQSFYEFGATRILNVGISKAFFE
                     QHYLSLLPPRFVASQVYQIKTEFLAYIESVIASLNFRNGEFNEFLEMVTFYIVNRLHH
                     HRESEITTDAPGWLKNAIEKMHDKAQFGDKALTNMVALSGKSQEYLSRATQRHYGKTP
                     MQIINEIRIDFAKKQLEITNYSVTDIAFESGYSSPSMFIKNFKKLTSFTPNHYRKKLC
                     SIN"
     gene            complement(84545..84892)
                     /locus_tag="RAHAQ2_RS22385"
                     /old_locus_tag="Rahaq2_4647"
     CDS             complement(84545..84892)
                     /locus_tag="RAHAQ2_RS22385"
                     /old_locus_tag="Rahaq2_4647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416577.1"
                     /note="catalyzes the phosphorylation of incoming sugar
                     substrates concomitant with their translocation across the
                     cell membrane; involved N,N'-diacetylchitobiose transport;
                     protein IIA transfers a phosphoryl group to IIB which then
                     transfers the phosphoryl group to the sugar; IIC forms the
                     translocation channel for the sugar uptake; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS N'-diacetylchitobiose transporter subunit
                     IIA"
                     /protein_id="WP_014341664.1"
                     /db_xref="GI:504107678"
                     /translation="MMDLDSIVETESEMQDLEEVVMGLIINSGQARSLAYAALRKAKE
                     GDFEQAYAVMAQSKMALNEAHLVQTKLIEDDQGEGKTKVSLVLVHAQDHLMTSMLARE
                     LIAELIELHEKIK"
     gene            complement(84956..86314)
                     /locus_tag="RAHAQ2_RS22390"
                     /old_locus_tag="Rahaq2_4648"
     CDS             complement(84956..86314)
                     /locus_tag="RAHAQ2_RS22390"
                     /old_locus_tag="Rahaq2_4648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341665.1"
                     /note="catalyzes the phosphorylation of incoming sugar
                     substrates concomitant with their translocation across the
                     cell membrane; involved in N,N'-diacetylchitobiose
                     transport; protein IIA transfers a phosphoryl group to IIB
                     which then transfers the phosphoryl group to the sugar;
                     IIC forms the translocation channel for the sugar uptake;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS N'-diacetylchitobiose transporter subunit
                     IIC"
                     /protein_id="WP_014341665.1"
                     /db_xref="GI:504107679"
                     /translation="MSKAIDSLEKILLPFAVKIGKQAHINAIKNGFIKLMPLTLAGAM
                     FVLINNVFLNFGAGSFFYSLGVRLDPSTIDTLTGLKTIGINVYNGTLGIMSLMAPFFI
                     GMALAEERKVDPLSAGLLAVAAFMTVTPYSVGEAYAVGANWLGGANIISGMVIGLVVA
                     EMFTFVIRRNWVITLPASVPSSVSRSFSALIPGFIILFIFGVISWLLGLYGHNFHQII
                     MDSISKPLAAMGSVVGWAYVIFNSLLWFFGVHGSLALTALDNGIMTPWALENIALYTE
                     YGSVSAAVEAGKTFHFWAKPMLDSYIMLGGSGATLGLIIAIFIASRRADHRQVAKLAL
                     PSGIFQINEPILFGLPIIMNPVMFIPFVLVQPILAAITLAAYSMGIIPPVTNLAPWTM
                     PTGLGAFFNSNGSIAALLVALFNLGIATLVYMPFVILSNKAQTIIEEEESEEDIAAAL
                     KF"
     gene            complement(86437..86757)
                     /locus_tag="RAHAQ2_RS22395"
                     /old_locus_tag="Rahaq2_4649"
     CDS             complement(86437..86757)
                     /locus_tag="RAHAQ2_RS22395"
                     /old_locus_tag="Rahaq2_4649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341666.1"
                     /note="catalyzes the phosphorylation of incoming sugar
                     substrates concomitant with their translocation across the
                     cell membrane; involved in N,N'-diacetylchitobiose
                     transport; protein IIA transfers a phosphoryl group to IIB
                     which then transfers the phosphoryl group to the sugar;
                     IIC forms the translocation channel for the sugar uptake;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS N'-diacetylchitobiose transporter subunit
                     IIB"
                     /protein_id="WP_014341666.1"
                     /db_xref="GI:504107680"
                     /translation="MEKKVIYLFCSAGMSTSLLVSKMKVQAEKYEVPVIIEAFPETLA
                     AEKGAGADVILLGPQIAYMLDEIKKVLPGKPVEVIDSGLYGKIDGLGVLKAAVAAIKK
                     AAAQ"
     gene            87116..88138
                     /locus_tag="RAHAQ2_RS22400"
                     /old_locus_tag="Rahaq2_4650"
     CDS             87116..88138
                     /locus_tag="RAHAQ2_RS22400"
                     /old_locus_tag="Rahaq2_4650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_049796165.1"
                     /db_xref="GI:908659715"
                     /translation="MNNKINTQKGRSRTATLEDVAQAAGLSPMTVSRALNNPKVVRPA
                     TIARVMEAVNSTGYIPNMLAGGLATRRTKLIAVVVPQINNNMFVDTVQAISDQLAARG
                     YHMLLCIVGYEPEDETDIVATLLSRRPDGIVLTGIHHTSELKRIILNANVPVVEIWDL
                     TPTPIDMLIGFSHEKVGNAIGDYFLGKGFTRFGFICASDRRAMVRKNGAISVLRTLAG
                     HDIKEVIVSRPANMEVGRHALRQLLATGERFDAIICSSDTLAQGAIMEAEAQGLSVPD
                     DFSVIGFADLNFAAHNRPAITTVSVEKWDLGIRAADMLADKIEGIAVEEPIVDMGYRL
                     VIRESA"
     gene            88666..89391
                     /locus_tag="RAHAQ2_RS22405"
                     /old_locus_tag="Rahaq2_4651"
     CDS             88666..89391
                     /locus_tag="RAHAQ2_RS22405"
                     /old_locus_tag="Rahaq2_4651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341668.1"
                     /db_xref="GI:504107682"
                     /translation="MLLQKKTTRRKFLLGSLMALPVGTIMMKGMSAAQAAEMAAPDLL
                     DYKPIFFSADEWQFIMAAADRLIPAGGKGKAPGALETNVPIFIDQQMHGDFGEEIYMQ
                     GPFNVHAPATMGYQIPFRPQQIYKTGIRLANSWCQQNHQKAFHELADQDKDNVLTQLQ
                     KNGIHFADLGEENLVASQFFSELLSDTKHGYLADPIYGGNKGMKAWIAIGFPGARASF
                     TEWVKQHNVPYPLGPVSLQGARA"
     gene            89437..91206
                     /locus_tag="RAHAQ2_RS22410"
                     /old_locus_tag="Rahaq2_4652"
     CDS             89437..91206
                     /locus_tag="RAHAQ2_RS22410"
                     /old_locus_tag="Rahaq2_4652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMC family oxidoreductase"
                     /protein_id="WP_014341669.1"
                     /db_xref="GI:504107683"
                     /translation="MAKVTKPEVDVVVVGLGWAGSLMSIELAMAGLTVRALERGGDRG
                     YEEFAYPKPADEYAYAVRNKVMATPAEAAVTVRYNMSETALPTRKWGAFAPGTGVGGS
                     GLHWTAVLIRPTPTDLKLKTYADEAYKPGILQEDMRIMDFPFSWDEIEPYYTKFEHIC
                     GQSGKTGNLRGQIMEGGDPFEGPRSEPYPLPALEDTLNSSMFAEVTKKMGYHPFPNPS
                     ACVSRAWTNPYGNQIAPCNYCGYCSKYPCLNYSKASPQTAVMDALKRMDNFSYEVHAN
                     VLKVELHDDKKTAKGVIYMDADGNECFQPAKIVVLSSFQFCNVRLMLLSGIGKPYNPI
                     TEEGAIGRNYAFLSNGGSTLFFKDKNFNPFATAGATGQMFNDISPGNFDGPSLGFIGG
                     AKIHSSQATGTPISTSLPKGTPAWGTGWKEGMEEWYGHSMKISITTTCQSYRDIYLDL
                     DPNYKDEYGYPLLRMTFDWKQNELKLQQYLKGIVGNITKELNPDSYSESFLPMDAHFD
                     LTKYVSTHNVGGAVMGDNPKTSALNKFLQSWDVHNVFVPGGNAFPQNFQANPTDTIGA
                     ITLMAAQAIKDQYLKNPGPLVQA"
     gene            91213..92493
                     /locus_tag="RAHAQ2_RS22415"
                     /old_locus_tag="Rahaq2_4653"
     CDS             91213..92493
                     /locus_tag="RAHAQ2_RS22415"
                     /old_locus_tag="Rahaq2_4653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_037041138.1"
                     /db_xref="GI:739177189"
                     /translation="MNRMKLKSLFIANALLLGAGFMANAQAVTNAQPDNAALIKQGEY
                     VARLGDCGACHTVAGKPAFSGGLAINSNLGTIYSTNITPDKDHGISGYSEAQFSDAVR
                     KGVLPDGTRLYPAMPYPDYAKINDEDMHALYVYFMQGVKPSAEQPPETDLSFPFSQRW
                     GMRFWNWAFASDKPFQPIGGASAQVNRGAYLVESLGHCGSCHTPRGFGMNEKALDSSD
                     ADFLAGGSLNNWDVPSLRGVAHWNEQEIVDYLGKGRNDKAAVGGEMTSVVENSTAHMT
                     DDDLKAIAAYIKFLGGNPPVPAEDTQKVSATEARLTAAKNLSEGERLYLDNCGACHFV
                     TGKGAPGVFPQLDQATIVNAKDPTGLIHTILAGAQQPSTARAPSTLVMPGFASRLTDE
                     EAAQLSTFIRQGWSNNAPAVTAKDVSEVRKTLTK"
     gene            complement(92550..92939)
                     /locus_tag="RAHAQ2_RS22420"
                     /old_locus_tag="Rahaq2_4654"
     CDS             complement(92550..92939)
                     /locus_tag="RAHAQ2_RS22420"
                     /old_locus_tag="Rahaq2_4654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341671.1"
                     /db_xref="GI:504107685"
                     /translation="MNRFVKEVFDAHVLIQRWFSDSAAPGQVCDELLARFSPAYSMVT
                     ITGHRLDHPALCAFFRAQRGAKSGLKIEVEKPVVIAESEKGAVVAYQERQQLPGQPVT
                     LRYSTVVFVVNAEGKILWRHLHETPAA"
     gene            complement(92936..94324)
                     /locus_tag="RAHAQ2_RS22425"
                     /old_locus_tag="Rahaq2_4655"
     CDS             complement(92936..94324)
                     /locus_tag="RAHAQ2_RS22425"
                     /old_locus_tag="Rahaq2_4655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_014341672.1"
                     /db_xref="GI:504107686"
                     /translation="MSHRARVAAVYLLGFFVDLINMFIANVAYPGIAREFQAPVSALA
                     WVSTGYILGLTLVIPLSRWLAERFGARRVFILSLTIFMLASLGAGIAGSLTALTGWRI
                     VQGLGGGLLIPLGQTMTYALYRSHERARLSAVIMLVGLLAPALSPAIGGIIVDSFSWR
                     WVFIASLPLALLAWMLALCWLPETPREPTGKLDLKGFVLLNSGLTLVLCGLTRLGDNR
                     EWLSGSALLLAGAGLMMMFVRASQKNPNPLLDLSLIKDPLLRVSMLIYQCIPGVFTGV
                     SLIAMLYLQNVHHFSATQSGGLMVPWSLASFAAISFTGKMFNRIGPRALFIPGCLIQG
                     AGIGLLALLSVFPAQPWLAVTAFTLMGAGSSLCSSTAQSAAFLHIGTQRLADASALWN
                     INRQLSFCLGVTLVSVLLNMLQIYLPQSAFRLAFIFASASVIVPVMLCLGLPGRDIVQ
                     ERHQQELQKERR"
     gene            94441..95355
                     /locus_tag="RAHAQ2_RS22430"
                     /old_locus_tag="Rahaq2_4656"
     CDS             94441..95355
                     /locus_tag="RAHAQ2_RS22430"
                     /old_locus_tag="Rahaq2_4656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014341673.1"
                     /db_xref="GI:504107687"
                     /translation="MLNLQRLEIFVAVVNAGSFTGGAASLGLTKAVVSFNVKQLESET
                     GVALLTRSTRRLALTGSGERFYQRCQNLLQEAESVLDDVRRDHGGLSGQLRITSTPEY
                     GARVVVPALAAFCVLHPQLRIQHVASSHHDDLIAGRFDLAIRLGQLTDSSHHAAALGR
                     FGIMPVASPAFLREQANISTLDQLAASRWIAHSRLPLPMNWPVTDAQGKQNPFRVTTP
                     PAIVADSASALLAFALAGAGVALLPDWLVQPEIDGQRLCHLLPDHRFAPQGIFALYPH
                     TRHVPEKVRRFIDFMQSRLAELPARAKI"
     gene            95384..95926
                     /locus_tag="RAHAQ2_RS22435"
                     /old_locus_tag="Rahaq2_4657"
     CDS             95384..95926
                     /locus_tag="RAHAQ2_RS22435"
                     /old_locus_tag="Rahaq2_4657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_014341674.1"
                     /db_xref="GI:504107688"
                     /translation="MIIETSRLLLRPVTAEDIHAFFAIYGDPQTNLFNPRGPLPDIAA
                     AQEKLNGWLGEWQENGYGHWAIAHNHQPDHIIGFGGLGIREGYENHRVFLGYRFATTA
                     WGKGLATEFASAVLNIGFKKLGIPRISATVRENHLASQRVLEKIGMQKVGFEGDPVHG
                     TGSYLYRQTGQRAVSDSSLS"
     gene            96095..96334
                     /locus_tag="RAHAQ2_RS22440"
                     /old_locus_tag="Rahaq2_4658"
     CDS             96095..96334
                     /locus_tag="RAHAQ2_RS22440"
                     /old_locus_tag="Rahaq2_4658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341675.1"
                     /db_xref="GI:504107689"
                     /translation="MRQNRHNGMSPDTSHSLYSQVFSEEETLGRVVVEILEAGKNLNR
                     KALCSKLLNRVEAAGSEEEEKHYMKLIRLVLERDS"
     gene            complement(96626..96808)
                     /locus_tag="RAHAQ2_RS22445"
     CDS             complement(96626..96808)
                     /locus_tag="RAHAQ2_RS22445"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041134.1"
                     /db_xref="GI:739177185"
                     /translation="MTFLIIGRPFSIEKVSHIVDIPHFVGDPRTLISQIMADLINNLL
                     AGSFSIYTVSTCSHKL"
     gene            96873..97127
                     /locus_tag="RAHAQ2_RS22450"
     CDS             96873..97127
                     /locus_tag="RAHAQ2_RS22450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biofilm development protein AriR"
                     /protein_id="WP_037041163.1"
                     /db_xref="GI:739177214"
                     /translation="MTDSVGNSEDYSYFNHTGELFLSETEVLGAAIRAILAEKGKVTN
                     KAIILHLITQLECTSDVVQLDILRSALEMVVGMTPPDSGV"
     gene            97227..97484
                     /locus_tag="RAHAQ2_RS22455"
                     /old_locus_tag="Rahaq2_4661"
     CDS             97227..97484
                     /locus_tag="RAHAQ2_RS22455"
                     /old_locus_tag="Rahaq2_4661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biofilm development protein YmgB/AriR"
                     /protein_id="WP_014341678.1"
                     /db_xref="GI:504107692"
                     /translation="MQDVSYTHVKLADYILTEDPELLIGNETVIRIYNNLKNQKEYVT
                     HKDIILCLIQKIEQESDSGKQDVYLEALEYVVYRTPDDDIA"
     gene            complement(97596..98837)
                     /locus_tag="RAHAQ2_RS22460"
                     /old_locus_tag="Rahaq2_4662"
     CDS             complement(97596..98837)
                     /locus_tag="RAHAQ2_RS22460"
                     /old_locus_tag="Rahaq2_4662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_014341679.1"
                     /db_xref="GI:504107693"
                     /translation="MLLTLVYRSHISDAVSPASLEEMVSRANIKNERNSITGILLFDG
                     MHFFQLLEGPEEAVDAIYSEICSDPRHNNVVVLMRDYAPSRRFGNVGMELFDLRHHHE
                     DVVLQAVLDKGTSRYRLTYEDRALQFLCTFVQAREKENYLEILPADSWSFIADESLKP
                     EAGFIFPEMKDYSFTFQPIVDPLSREIISYEARLCGPGGGSAMEYFSALSGKNIYDAD
                     LKSKKLAFALAQKTGISDKTLTIKLLPMTLVRVPDAIGFLVHEITAHGLVPEQIVVAI
                     TENGVVTREDNFVTALQQLKASGMRLAIDDFGAGSAGLLLLTQCQPEKIMIDRNMICD
                     IHTSGPKQAIVQAIIRFCSSLEISVIATGVEKPEEWMWLDAAGVCNFQGSLFASPRLN
                     GAPVVAWPEVKQEYPLSHQNL"
     gene            99041..99640
                     /locus_tag="RAHAQ2_RS22465"
                     /old_locus_tag="Rahaq2_4663"
     CDS             99041..99640
                     /locus_tag="RAHAQ2_RS22465"
                     /old_locus_tag="Rahaq2_4663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341680.1"
                     /note="with TehA confers resistance to tellurite; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein TehB"
                     /protein_id="WP_014341680.1"
                     /db_xref="GI:504107694"
                     /translation="MTQQPAPEDFYTEKYGLTRTHSEIINAVQYVQPGKALDLGCGSG
                     RNSLYLNLKGFDVTGWDNNAMSVAKVNDIIAAQSLTHIHISEADLNTHRFSGEYDFIF
                     STVVMMFLQRDSIPHIIEDMHAATKTGGYNLIVAAMDSPDYPCPLPFPFTFKPAELRD
                     YYRDWEIVKYNEEVGELHKRDENGDRYKLRFATLLARKV"
     gene            99723..99995
                     /locus_tag="RAHAQ2_RS22470"
                     /old_locus_tag="Rahaq2_4664"
     CDS             99723..99995
                     /locus_tag="RAHAQ2_RS22470"
                     /old_locus_tag="Rahaq2_4664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341681.1"
                     /db_xref="GI:504107695"
                     /translation="MSSQDFDKDPNRVEGKVENTVNEFAGEAQKQFGDFVDSPKHQLK
                     GAARKYSAQANEVVSDVADKIKENPLSGLIAAGAIGVVLGLLLGRK"
     gene            complement(100157..100354)
                     /locus_tag="RAHAQ2_RS22475"
                     /old_locus_tag="Rahaq2_4665"
     CDS             complement(100157..100354)
                     /locus_tag="RAHAQ2_RS22475"
                     /old_locus_tag="Rahaq2_4665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341682.1"
                     /db_xref="GI:504107696"
                     /translation="MKDESEKTGLIGLAIGAAVMGLISSGTSINRESIIEELRRLGRK
                     KGDGLEDEIFVKAAQLVGKGQ"
     gene            100532..102934
                     /locus_tag="RAHAQ2_RS22480"
                     /old_locus_tag="Rahaq2_4666"
     CDS             100532..102934
                     /locus_tag="RAHAQ2_RS22480"
                     /old_locus_tag="Rahaq2_4666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoketolase"
                     /protein_id="WP_037041129.1"
                     /db_xref="GI:739177180"
                     /translation="MMTLSSSQRCAEEELRQVDRYWRAANYLSVGQIYLMDNPLLREP
                     LKPEHIKPRLLGHWGTTPGLNFIYAHLNRAICQRDLDIIYICGPGHGGPGMVANTWLE
                     GSYSEIYPQISEDASGIQKLFRQFSFPGGIPSHAAPETPGSINEGGELGYSLSHAFGA
                     VFDNPGLIAACVIGDGEAETGPLASSWHGNKFLNPVRDGAVLPVLHLNGYKIANPTIL
                     GRMNDEDLRQLFSGYGYEPLFVSGHEPEQMHIQMARTLNIALDIIKDHQLRARAGRPT
                     KGVPRWPMIILRSPKGWTGPQSVDGKKVEGFWRAHQVPVSSCRENDEHRQILENWMRS
                     YQPDDLFDEQGRLKPELRALAPQGDKRMGASPFANGGRLRRELVPAERAKFAVELTSR
                     GEPQVQSTEMLGRYLADIFTLNPDNFRLFGPDETASNRLSDVFDVTNRTWLEDIEPYD
                     EQLAADGRVMEILSEHQCQGWLEGYLLTGRHGLFNCYEAFIHIVDSMFNQHAKWLKVT
                     RKLPWRKPISSLNYLLSSHVWRQDHNGYSHQDPGFMDHVANKKADIVRIYLPPDANTL
                     LWVADHCLQTWDRINVIVAGKQPAPQWLSAEEAAEHCAAGMGIWPWAGTEQDGTEPDV
                     VLACAGDVPTMETLAAADLLREYLPDLSVRVVNVVDIMALQTREQHPHGLSAEAFDGI
                     FTQNKPVIFAFHGYPSLIHRLTYQRNNHRNFHVSGFMEEGTTTTPFDMTVLNKLDRFH
                     LAQAAIVHTEKLQGKADDILDDLQEKIAAHHRYVREYGEDLPEVRNWKWPSQQGSGGA
                     PE"
     gene            <102948..103076
                     /locus_tag="RAHAQ2_RS22485"
                     /pseudo
     CDS             <102948..103076
                     /locus_tag="RAHAQ2_RS22485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416584.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
     gene            complement(103139..103570)
                     /locus_tag="RAHAQ2_RS22490"
                     /old_locus_tag="Rahaq2_4667"
     CDS             complement(103139..103570)
                     /locus_tag="RAHAQ2_RS22490"
                     /old_locus_tag="Rahaq2_4667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_014341684.1"
                     /db_xref="GI:504107698"
                     /translation="MTIHKKGQAHWEGDIKHGKGYISSESGALKEQPYGFNTRFEGKP
                     GTNPEELIGAAHSACFSMALSLMLGEAGHTPESIDTVADVSLDKVDGGFAITKIALDS
                     KVKLPGIDKDKFDEIIQKAKAGCPVSQVLKAEITLTYQLEN"
     gene            103705..103884
                     /locus_tag="RAHAQ2_RS22495"
                     /old_locus_tag="Rahaq2_4668"
     CDS             103705..103884
                     /locus_tag="RAHAQ2_RS22495"
                     /old_locus_tag="Rahaq2_4668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341685.1"
                     /db_xref="GI:504107699"
                     /translation="MFKPQDLVQSKTGGPKMIVRRVEGDTLWCSRTDDFSATEIEVKA
                     DTVDLYHEDGDFGVC"
     gene            104012..104347
                     /locus_tag="RAHAQ2_RS22500"
                     /old_locus_tag="Rahaq2_4669"
     CDS             104012..104347
                     /locus_tag="RAHAQ2_RS22500"
                     /old_locus_tag="Rahaq2_4669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="steroid delta-isomerase"
                     /protein_id="WP_014341686.1"
                     /db_xref="GI:504107700"
                     /translation="MDAVIPVEKQFQAYNNHDLDAFVSCYSTDFMAYRMPNMSPSLQG
                     KEALRTFYQNHRFNNKALRAELISRTLLGNKVFDHEMIYGIYDTPVNSIAVFEVENGL
                     IKTAWFYFE"
     gene            complement(104487..104945)
                     /locus_tag="RAHAQ2_RS22505"
                     /old_locus_tag="Rahaq2_4670"
     CDS             complement(104487..104945)
                     /locus_tag="RAHAQ2_RS22505"
                     /old_locus_tag="Rahaq2_4670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015698694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014333746.1"
                     /db_xref="GI:504099752"
                     /translation="MGDEKSLAHTRWNCKYHIVFAPKYRRQVFYGEKRRAVGSILRKL
                     CEWKNVHILEAECCADHIHMLVEIPPKMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRN
                     REFWCRGYYVDTVGKNTSKIQEYIKHQLEQDKLGEQLSIPYPGSPFTGGK"
     gene            complement(104955..105078)
                     /locus_tag="RAHAQ2_RS24710"
     ncRNA           complement(104955..105078)
                     /ncRNA_class="other"
                     /locus_tag="RAHAQ2_RS24710"
                     /product="Hfq binding sRNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(105148..105960)
                     /gene="metQ"
                     /locus_tag="RAHAQ2_RS22510"
                     /old_locus_tag="Rahaq2_4672"
     CDS             complement(105148..105960)
                     /gene="metQ"
                     /locus_tag="RAHAQ2_RS22510"
                     /old_locus_tag="Rahaq2_4672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014341687.1"
                     /db_xref="GI:504107701"
                     /translation="MRITLKFSVLALSLVGALALSACDQKSQENHIKVGISAGIDQQM
                     WETIKKTAKDKYNLDVEVVTFNDFVLPNSALSSGDIDVNSFQHRPYLDKQIKERGYKL
                     VEVGKTFVYPIAGYSRKIKSLDQLSDNAQVAVPNDPTNLGRSLLLLQKEGLIKLKEGV
                     GLLPTSLDIIENPKHLKIVEIEAPQLTRAIDDDKIELAIINTTYSGQVGLTPGKNGLF
                     VEDKDSPYVNIIVAREDNKDSQAVKELVEAYQTDATVKAADAIYHGDAVKGW"
     gene            complement(106204..107415)
                     /locus_tag="RAHAQ2_RS22515"
                     /old_locus_tag="Rahaq2_4673"
     CDS             complement(106204..107415)
                     /locus_tag="RAHAQ2_RS22515"
                     /old_locus_tag="Rahaq2_4673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014341688.1"
                     /db_xref="GI:504107702"
                     /translation="MTECSSLDTRPETSAFRRWLAVYSLACGTFALVNTEFLPIGLLS
                     PIAQSLGVTEGHAGLAVMLPGLVAAISAPLIMLFARKMDRRTLLLLLSATVIVANGIA
                     VMAQSFNILLIGRIILGVGVGGFWSFAIPSGRRLVSEEQGARAISLITAGVAVGTVAG
                     VPAGAFIGDLFGWRMAFMLNAVLALAFFVLQWLALPSLPAQHSIGLRAMLGVTKVAGI
                     RYALIIGVFMAGGHFAAYTYLEPWLRFSLHLTASHISLLLMGYGVAGLLGTLTTEITV
                     RELGVRKAFMLNMLLLSASVLVLSLFPVPLALACALVILWGLAFGALPVCLNIWTYQA
                     SPALFETGSALLVCVFQTSLALGALFGGILADSAGVSSAFLLGGVLTLLAGITIFLSR
                     PQPAVLHAAGK"
     gene            complement(107727..108062)
                     /locus_tag="RAHAQ2_RS22520"
                     /old_locus_tag="Rahaq2_4674"
     CDS             complement(107727..108062)
                     /locus_tag="RAHAQ2_RS22520"
                     /old_locus_tag="Rahaq2_4674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug DMT transporter"
                     /protein_id="WP_014341689.1"
                     /db_xref="GI:504107703"
                     /translation="MFKIYLILAVSICAETLATTMMKASNGFTRLIPSVIVVVGYAIS
                     FYGLSQVVKVMHIGIAYAIWAGMGIFLVSAMSFFIYKQRLDTPALIGMGCIALGIMII
                     QLYSKSVSH"
     gene            complement(108256..110055)
                     /locus_tag="RAHAQ2_RS22525"
                     /old_locus_tag="Rahaq2_4675"
     CDS             complement(108256..110055)
                     /locus_tag="RAHAQ2_RS22525"
                     /old_locus_tag="Rahaq2_4675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341690.1"
                     /note="with GsiBCD is involved in glutathione import; GsiA
                     contains 2 ATP-binding domains; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione ABC transporter ATP-binding protein"
                     /protein_id="WP_014341690.1"
                     /db_xref="GI:504107704"
                     /translation="MQTPVLQVDKLNTAFSVDGEWLNVVRDLSFSIGPKETLALVGES
                     GSGKSVTAMSVMRLLDEKQTRYSGRIHFDGRELLSLTPPEMQSIRGNRIGMIFQEPMT
                     SLNPVLKIGVQITEVLKRHRGMDDASARAEAVRLLEKVRIPAATSRLNEYPLSFSGGM
                     RQRVVIAIALACNPRLLIADEPTTALDVTIQAQILALIKSLQEEEGMSVLFITHDMGV
                     VAEVADRTLVLHRGEAVEQATTREIFHHPKHPYTRALLSAVPRLGTMQGVALPKRFPL
                     TDMHTGEPLPVAESVDTLRTGQPVLEIKNLVTRFDVKSGLLRRVSARIHAVEDVSFSL
                     QPGETLSLVGESGCGKSTTGRTILRLTEATSGDILIRGQDIRRADSARLADIRTQAQM
                     IFQDPYESLNPRMRIGQAIAEPMISLGLHDATSAKIRVAQLLEQVGLQSNMAMRFPHQ
                     FSGGQRQRICIARALALEPKMIIADEAVSALDVSVKAQVINLMLDLQQELGLAYLFIS
                     HDMAVVERISHRVAVMYQGEIVEIGSRADIFENPQHIYTRKLLAAVPVPDPDVHHTRT
                     VVPEELASPLRAATYQPPVRHYREVSAGHFVQI"
     gene            complement(110058..110975)
                     /locus_tag="RAHAQ2_RS22530"
                     /old_locus_tag="Rahaq2_4676"
     CDS             complement(110058..110975)
                     /locus_tag="RAHAQ2_RS22530"
                     /old_locus_tag="Rahaq2_4676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_014341691.1"
                     /db_xref="GI:504107705"
                     /translation="MASDSVHSRTAVQGKSQPAFYTTVRALLRNKFSLCGLIILGIAI
                     LLAVLAPWISPQNPYDLSQLDIMDGRLKPGTSSLSGMIYWLGTDDQGRDLLSAILYGT
                     RTSLLVGVSSAAIALTLGAALGLISAYAGGKTDALIMRIVDIQLSFPPILIALILLAV
                     LGQGVDKIILALVVTQWAYYARTLRGSALLERRRSYVDAARSMALSSPRILFRHILPN
                     CLPPLIVVATMRIAYAIMLEATLSFLGIGLPVTEPSLGLLIANGFDYLMSGDYWISFF
                     PGITLLVLIVAINLVGDALRDILNPRNKD"
     gene            complement(110975..111949)
                     /locus_tag="RAHAQ2_RS22535"
                     /old_locus_tag="Rahaq2_4677"
     CDS             complement(110975..111949)
                     /locus_tag="RAHAQ2_RS22535"
                     /old_locus_tag="Rahaq2_4677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014341692.1"
                     /db_xref="GI:504107706"
                     /translation="MSRYLLGRFGQTLLTLFVMSLLVFAGVYLVGNPVDLLLSTTATP
                     AERLSVIQSFGLDKPVWEQYGLFVVNALHGDMGNSFIYNQPALHLIFQRMPATLELAL
                     VAFALALVIGIPLGVYAGLRPDGWLSKSIMAVSILGFSLPTFWIGLMMIMLFSVKLGV
                     LPASGRGATVEVFGVPVSLFTADGLAHLILPALNLALFKISLIIRLTRAGVLECLQQD
                     FIRFARAKGLSESRIVLVHVLKNTLIPLITVIGLELGSLIAFAVVTETIYAWPGMGKL
                     IIDSIAMLDRPVILAYLMITVVMFSLINLLVDVLYVLVDPRVRLGGEN"
     gene            complement(111946..112920)
                     /locus_tag="RAHAQ2_RS22540"
                     /old_locus_tag="Rahaq2_4678"
     CDS             complement(111946..112920)
                     /locus_tag="RAHAQ2_RS22540"
                     /old_locus_tag="Rahaq2_4678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-uridine preferring nucleoside hydrolase"
                     /protein_id="WP_014341693.1"
                     /db_xref="GI:504107707"
                     /translation="MSQRIIIDTDPGVDDAIALWLALASPELDVLGVTVVAGNVALKD
                     SVRNACKIVALSGKIATPVFAGAPGPLARDQVYGKYAHIGAFNDELVPDTGLQPQAEH
                     AVDFLVRTLRQAAEDNDPISLCVIGPMTNIALALGMHPDVARGIKQIVTMSCAFTALG
                     HRVPWAEFNVYADPHAAEKVFNSGVPLIIMPLDMTFQALIGADDIEALKQDGGQPGES
                     VAALLNAFDRSDLSRFGREGGPVHDATTVAWLLQPGLFEGQPARVGVAVSGNTAGYTY
                     ADFWNKLATPANAVVMQSVDEYGFFSLMRRVFSRYGTRYSNTSGEMRA"
     gene            complement(112925..113875)
                     /locus_tag="RAHAQ2_RS22545"
                     /old_locus_tag="Rahaq2_4679"
     CDS             complement(112925..113875)
                     /locus_tag="RAHAQ2_RS22545"
                     /old_locus_tag="Rahaq2_4679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-uridine preferring nucleoside hydrolase"
                     /protein_id="WP_014341694.1"
                     /db_xref="GI:504107708"
                     /translation="MKTIPVVIDCDPGIDDAIALLSAFVAPQLNILGISTVCGNQPLV
                     NTTRNALQITELGYRLDIPVFAGCHQPLLRAPIHGQFHGENGLGNTAFPAPQKQAESL
                     HAVNFLISCCEQAIENNQPLTLCMLGPLTNLATALRIKPEITAGMGRVVLMGGAYREA
                     GNRTMTSEFNMLADPHAAHIVFSSDLNITVLPLDATHQVILTPEHVAKFIKVSGRISA
                     TLGELMAFWDRNDVRRYGSRGGPLHDPLVIAYVLAPELFGTEKARVFVEHDSELCMGQ
                     TVADWHDKSGQTPNVDIVTRVEAGKVFALFYELLSRYAGK"
     gene            complement(113872..114756)
                     /locus_tag="RAHAQ2_RS22550"
                     /old_locus_tag="Rahaq2_4680"
     CDS             complement(113872..114756)
                     /locus_tag="RAHAQ2_RS22550"
                     /old_locus_tag="Rahaq2_4680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_014341695.1"
                     /db_xref="GI:504107709"
                     /translation="MTSFSGVYPYLVSPVTDGGQIDKPVLTALVEHLIASGVHGLTPL
                     GSTGEFAYLSAEQRTEIVKTVVEAARGRVPVIAGVAATTIQDAVAQTARYVALGVDGI
                     LAILEAYFPVPEQGVEDYFRAIATAAGKLPVVLYTNPQFQRSDLSLPVIERLSYVENI
                     NYIKDASTNTGRLLSIIERTQGRMQVFAASAHIPACVMLIGGVGWMAGPACIVPKQSL
                     ALYEAARQGDWTKAMALQRPLWRINEIFARYSIAGCIKAALQLQGFEVGDPLPPQVPL
                     NQAARQEIAEVLRSVGAL"
     gene            complement(114838..116397)
                     /locus_tag="RAHAQ2_RS22555"
                     /old_locus_tag="Rahaq2_4681"
     CDS             complement(114838..116397)
                     /locus_tag="RAHAQ2_RS22555"
                     /old_locus_tag="Rahaq2_4681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014341696.1"
                     /db_xref="GI:504107710"
                     /translation="MRKSVLAGVLFSALATPFILQTVQAADLNIGLAASTTSMDPQFY
                     VGGANSAMARNIFDGLVNQDEKQHITPALAVSWKVINDTTWEFALRPGVKFHDGSNFT
                     AKDVIASVKRVALASKNSPSAYTPYVNDIADVTEVNPLTVRITTKTPSPLLLNNLSRV
                     AILPARLETVGSQTLNEGKDVTGTGPFKFVSWTPDDNVVLARNDQYWGGKAQWDKVTL
                     RVFKNPSARVAALRSGDVDMIESVPTADGRDLGKQTSLHLESVAGNRILYLHPDQDRD
                     VSPFAKGPDGSNPLKKREVREAMSLAINRQAIVDRIMDGQGVPASQLVPKGYFGYTPS
                     IAAPVYDPAKAKQLLTQAGYPDGFTLTFHASNDRYPNDSKIAQALGQMFSRVGIKTDV
                     VTMPGSVYFSRASKRDFSLIMGGAAIETGEASGVLGPLLETFGPNGGQGNRGRYSNPE
                     FDKTLLQARETLDDGQREKLLQHATEIAMKDEGTIPLLFLSYTWAMKTPYTYVGRSDG
                     YTLPYFVHEKQ"
     gene            116539..117426
                     /locus_tag="RAHAQ2_RS22560"
                     /old_locus_tag="Rahaq2_4682"
     CDS             116539..117426
                     /locus_tag="RAHAQ2_RS22560"
                     /old_locus_tag="Rahaq2_4682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014341697.1"
                     /db_xref="GI:504107711"
                     /translation="MKINPRQVEAFHKVILTGGMTAAANMMNITQPAVSRLIRDFEYA
                     VDLKLFDRDGRGLIPRDDAIKLYREVERLYLGLEHISRIADEIRHSKGSVLRIGTVAA
                     LSALCVEHILPPLIERISDISLFLDIESTTHITDVVTGNQYDVGFIFGKPDVKGLEAE
                     MLARANAVAVMSPRHPLAKQDVVTAMDLTRYRPIIPGRKTPLREQLDQVMSRLDLYMN
                     NPIETSLNNCCVMAGNNLGIGVVDFITARSHKSDIVLKPFTPDISIAYLAVFPPQIPK
                     SRLVEHITQEMKTLIEGYL"
     gene            117823..120312
                     /locus_tag="RAHAQ2_RS22565"
                     /old_locus_tag="Rahaq2_4683"
     CDS             117823..120312
                     /locus_tag="RAHAQ2_RS22565"
                     /old_locus_tag="Rahaq2_4683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinate dehydrogenase"
                     /protein_id="WP_014341698.1"
                     /db_xref="GI:504107712"
                     /translation="MPTTNNKWTWLLWLLSALMVVIGLTLGIGGAYLATLGGSLYFLL
                     MGLALIVSAVLIFKGKPSGAWLYAVAFVLSIIWAVWDAGFTFWPLFSRLFTFGVLAFL
                     MALAYPLLQARAGLVVRKGPGFSLAAVLAVALIVAFGNTFVPTPIISADNDQVPVKPV
                     EKGAEQKNWESWGNTPAGDRFAALDQINKTNVDKLQVAWIAHTGDIPQSNGSGAEDQN
                     TPLQIGDKLFVCTAYSKVIALSVDDGKKLWSYDSNSTAPNWQRCRGLGYYQNNSENST
                     ASQAPAAQPAATPAAEPATPNAASEAAAPATDAPQAPAATGGTVSATCERRLFLPTID
                     ARLIAINADTGKPCADFGDNGVVDLKVGMGEVKPGYYQQTSTPLVAGNVVVVGGRVAD
                     NFSTGEPPGVVRAFDVHTGALVWAWDPGNPNITKLPPEGQTYTRGTPNVWSAMSYDPK
                     LGLIYMPTGNATPDFFGGTRTELDDKYSSSVVAVDVATGKVRWTFQTTHHDLWDFDLP
                     SQPLLYDLPDGKGGSTPVLVQTSKQGMIFMLNRETGQPVAKVENREVPQGNVPGERYA
                     KTQPFSVGMPNIGNQTLKESDMWGATPMDQLLCRIEFKGMRHEGVYTPPGLDRSLQFP
                     GSLGGMNWGSVSVDPNNAIMFVNDMRLGLANYMVPRAQVPTGASGIEMGMVPMEGTPY
                     GAVRERFLSPLGIPCQKPPFGTMSAVNLKTGKIVWQVPVGTVKDTGPLGIKMRMPMEV
                     GMPTLGASLSTQSGLLFFAGTQDFYLRAFDTANGKEIWKSRLPVGSQSGPMTYVSPKT
                     GKQYIIISAGGARQSAERGDYVIAYALPDEK"
     gene            complement(120372..121667)
                     /locus_tag="RAHAQ2_RS22570"
                     /old_locus_tag="Rahaq2_4684"
     CDS             complement(120372..121667)
                     /locus_tag="RAHAQ2_RS22570"
                     /old_locus_tag="Rahaq2_4684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_014341699.1"
                     /db_xref="GI:504107713"
                     /translation="MDKLTLALNGIAVGTLEKGGSGEMSFVYHQSWLDRPGARAISLS
                     LPLQADKFRGAVVYNFFDNLLPDNEQIRSRIQARFHIPTKQPFDLLSRIGGDCVGAIQ
                     LYPEGDQVAPVTEIHAQPLGEKDIEQLLQGYKDAPLGMEADIEDFRISLAGAQEKTAL
                     LWYRDQWHRPQGSTPTSHILKLPIGYIANNGIDLSESVENEWLCLKIAEKFGFPVARS
                     EIANFGSQKVLVVERFDRRWSQDGSWLMRLPQEDFCQALGVAPALKYEADGGPGIARS
                     MKLLLGSQRAGGDRDMFFKSQILFWMLAAIDGHAKNFSVYIEPGSAYRMTPLYDVMSA
                     FPLMHPTGIPAKKAKMAMAVLGSNRHFHWDRILPRHFVSTAQRVSYSQENVSAMMTEM
                     KEKTEQVIADVKATLPVDFPAKISHAIFEGLRRQAARLP"
     gene            complement(121671..121922)
                     /locus_tag="RAHAQ2_RS22575"
                     /old_locus_tag="Rahaq2_4685"
     CDS             complement(121671..121922)
                     /locus_tag="RAHAQ2_RS22575"
                     /old_locus_tag="Rahaq2_4685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014341700.1"
                     /db_xref="GI:504107714"
                     /translation="MNITSAKMLASALRNERKKRKLSQSKTAEAIGLKQSTVSEFENY
                     PDGTRLETLFKLLAALDLELQITPRDSNPQEKSSWDQEW"
     gene            122175..122885
                     /locus_tag="RAHAQ2_RS22580"
                     /old_locus_tag="Rahaq2_4686"
     CDS             122175..122885
                     /locus_tag="RAHAQ2_RS22580"
                     /old_locus_tag="Rahaq2_4686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014341701.1"
                     /db_xref="GI:504107715"
                     /translation="MKKSEFIAQDLLSKIYQHSGSLPEKLPPERQLAEEYGVSRFTVR
                     KALEKLVSIGAVRIVQGSGIYINPGVGSNPLVYNSITEKKFAEISFKMLELHKRRPDK
                     EEQQVFDLSADDFIWAFTRLRRISQRNVQIEYSRMPAREFSDLNQKTIEHSIQQYVLS
                     KGYAISHSLTRYQAVTVSKEQAHILGCKKGIAAMHITNRGILQGGKVYAFSDIIDIDY
                     SCTYVIPFNQDNLAFRQT"
     gene            complement(122891..124090)
                     /locus_tag="RAHAQ2_RS22585"
                     /old_locus_tag="Rahaq2_4687"
     CDS             complement(122891..124090)
                     /locus_tag="RAHAQ2_RS22585"
                     /old_locus_tag="Rahaq2_4687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
                     /protein_id="WP_014341702.1"
                     /db_xref="GI:504107716"
                     /translation="MQPVLITNIECQITHPDRHNLVVVRIETDCGVFGLGCATFQQRP
                     LAVKLMVDEYLKPLLIGRDANHIEDLWQMMMVNAYWRNGPVINNAIAGIDMALWDIKG
                     KLANMPLYHLFGGKSKDAVTAYSHAAGETLEELYGEVDRLLGEGYRHIRCQLGFYGGN
                     ARDFHSTREPTAGAYYDQDQYIDNTLAMFKALREKYGNQFHILHDVHERLFPQQAVQF
                     AKAVEQYRPYFIEDILPPDQNEWLAQIRSQTAVPLATGELFNNPAEWKDLIIHRRIDF
                     IRCHVSQIGGITPALKLAHFCQSFGVRLAWHCPPDMTPVGAAVNTHLNIHLHNAAIQE
                     FVAYPANTQRVFPGAQAPEKGYFYPGEEAGIGVGFDPQAAAEFPVVYRPHEWTQSRLP
                     DGVIHTP"
     gene            124415..125815
                     /locus_tag="RAHAQ2_RS22590"
                     /old_locus_tag="Rahaq2_4688"
     CDS             124415..125815
                     /locus_tag="RAHAQ2_RS22590"
                     /old_locus_tag="Rahaq2_4688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter"
                     /protein_id="WP_037041113.1"
                     /db_xref="GI:739177162"
                     /translation="MHSVIKLVGGAGNINKVWHCMTRLRFDLRDENKVAWDEIKNLPG
                     VLGAQSQSEQVQIIIGPRVNIWYDAIVSQLDPVTGNAETTTGNVSTKGRKSLVSMFMD
                     TVSGVFGPIVPAIAGAGMIKGLLAGLIALKVISAKSETVMIIDLIASGVFYFLPFFLA
                     VSAAKIFKTNEYLAAAVAACLMYPTLMDAAKALASHTTGAPTALYFMDVLPVSVFNYS
                     ASVIPVIFSVLALSYIHRWVDKIMPDVLKTVFTPTLTLFIAALVSLTLIGPAGIYLGK
                     LLAFGIQGLFDVSAVFAGFIVGAIRPVAILTGMHHAMTPIALQNFTDQGWDMLMPMMF
                     MANMAIAGSTFAIYFHVKTREQKSVVLSAAISGLLGITEPALFGVLTRYKKAFIATTL
                     SSSVASAFIAFFGVRLYGYILSSIFSLPAYIGPYFIYIVMGVVLSLGLSFTLTYLMVV
                     KNKGTEHTVPLVNQTR"
     gene            complement(125822..126694)
                     /locus_tag="RAHAQ2_RS22595"
                     /old_locus_tag="Rahaq2_4689"
     CDS             complement(125822..126694)
                     /locus_tag="RAHAQ2_RS22595"
                     /old_locus_tag="Rahaq2_4689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxopent-3-ene-1,2,5-tricarboxylate
                     decarboxylase"
                     /protein_id="WP_014341704.1"
                     /db_xref="GI:504107718"
                     /translation="MKIVNFIISKDHTKSFGIYQKDGIVDVGAHSGCRDINEFMAHHQ
                     MEELQRYVQLPADLQLNDISFLPVIDRPGKIFGVGMNYAEKRKEFNETSDAPTLFVRF
                     ADSQVGHNGTIIKPASSEQFDYEGELAIVIGRTGRNISADDALDYIAGYSCYMDGSVR
                     DWQHKWYTAGKNWPSTGAFGPWMVTPDEVGDPQNLSIKTWLNDRLVQDDTTANMVHSI
                     AQMIAYISTFTQLSPGDVIMTGSPGGVGKTRVPPLFLHENDKIEVEIENIGRLTNLIQ
                     NAPLSEMTHSKTAA"
     gene            126853..127776
                     /locus_tag="RAHAQ2_RS22600"
                     /old_locus_tag="Rahaq2_4690"
     CDS             126853..127776
                     /locus_tag="RAHAQ2_RS22600"
                     /old_locus_tag="Rahaq2_4690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014341705.1"
                     /db_xref="GI:504107719"
                     /translation="MLNNRDLDYFVTAAEMMNLRLASQNLNITQPALSKSITRLEREL
                     KIKLFKRAGRGLELTEAGRILYQRGVALQSAYLEIGEIMNELSSGAGGIVRVGVSGSA
                     TQFLLPEICKMLQSQVPNMKLEIQIGMNDVLFALLERHAIDVIIGPLVNYDSPVVQLP
                     VTADRVIVAASRDHPLAGKPASLRELSRYGWILPAKTVSMRQWLDKMFYENHCPAPDV
                     KVEISSLASVPGLIAKSGLLSFLSENILVEEEFLSRLIRIDNDQLVMERRVGITWLEG
                     AFLSPATQKVIDVTQSVGQKMQMEARRIMEE"
     gene            complement(127795..128760)
                     /locus_tag="RAHAQ2_RS22605"
                     /old_locus_tag="Rahaq2_4691"
     CDS             complement(127795..128760)
                     /locus_tag="RAHAQ2_RS22605"
                     /old_locus_tag="Rahaq2_4691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014341706.1"
                     /db_xref="GI:504107720"
                     /translation="MNAEYLIEVDGLKKYFPIRDGVFGQETGQLRAVDGVSFNIRKGT
                     IFGLVGESGSGKTTVGRTLLGLYDKTAGNVKFRGEDLHSLKPKQLKALRPKIQLVFQD
                     PYSSLNPRIRIGDAIGEAMLEHKRCTRAQLPEKVRDVMKICGLSPLHYNRFPHEFSGG
                     QRQRIGIARALILQPDFIIADEPISALDVSIQAQIINLFADLRDDHGVTFLFISHDLG
                     VVEHLCDDVAVMYLGQLVETASRDALFRKPLHPYTQALLAAVPTLDPDSEPVAMVSGE
                     IPDPSKPPAGCRFHTRCPRATDHCRQDIPVLREIESGHHVACHQV"
     gene            complement(128757..129761)
                     /locus_tag="RAHAQ2_RS22610"
                     /old_locus_tag="Rahaq2_4692"
     CDS             complement(128757..129761)
                     /locus_tag="RAHAQ2_RS22610"
                     /old_locus_tag="Rahaq2_4692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014341707.1"
                     /db_xref="GI:504107721"
                     /translation="MTQPLIRFNQLSLSFSSDQGRVRAVQDVTFDVQAGQTVGIVGES
                     GCGKSVTAMSLMGLLPPQAARIDGGEILFQGQNLLKLRPSQMADLRGNQLAMIFQEPM
                     TALNPVLTLGEQLVEPRIRHLGESPKLAWTHATKMITEVGLARAESLMTSYPHQLSGG
                     MLQRIMIAMALSCKPQLLIADEPTTALDVTVQAQILRLLREQAQQNHMALMLITHDLG
                     VIAQMADHVVVMYAGKIVEQGATAQVLRNPLHPYTQGLIASRPTPGERRRRLYSIPGQ
                     VPDLAALPPYCAFTERCARATDRCRQGIPPLEGQYRQAACFYSGLSAVSDNENRGLQP
                     "
     gene            complement(129758..130705)
                     /locus_tag="RAHAQ2_RS22615"
                     /old_locus_tag="Rahaq2_4693"
     CDS             complement(129758..130705)
                     /locus_tag="RAHAQ2_RS22615"
                     /old_locus_tag="Rahaq2_4693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_014341708.1"
                     /db_xref="GI:504107722"
                     /translation="MFGSLFSTNRRLREAQIPMLAQATPSPWRQAWRALRQNRLAMFC
                     LILLLVMAVWCIAGPDYSPWRDDATDALMINKAPNAEHWLGTDFLGRDVYTRLLLAGR
                     ISLIIGMLTMLLSVTLGYLMGAVSGYLGGVADKIIMRFADLVMTIPSLPLLIVMGAML
                     SELDFSPDSRVYMVIVMLSLLEWPKLARLVRGQILSLRERDFMLATQVLGLSSRRRLF
                     GHLLPNTVPILVVMATMAVANAILSESALSYLGLGVVPPTPSWGNMMDAANSLIDFQR
                     RPWLWMPPGVAIFITVIAINVLGDGLRDALDPKLKRSKT"
     gene            complement(130705..131664)
                     /locus_tag="RAHAQ2_RS22620"
                     /old_locus_tag="Rahaq2_4694"
     CDS             complement(130705..131664)
                     /locus_tag="RAHAQ2_RS22620"
                     /old_locus_tag="Rahaq2_4694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_014341709.1"
                     /db_xref="GI:504107723"
                     /translation="MRNFILRRLLQTIPMLFLASLLIFMLFAKTPGDFIDGNITLTAQ
                     RAAELKALYGLDQPLLSRYLHWLGNLLRGDLGFSLQYQIPVSQLLDQYIWNSFLLATI
                     AMVLYWGIALAVGIVSAMKPYSLFDHVVSVVIFAAMSFPTFFLCLLLIKWFAVDLHWL
                     PVGGMTNTGSDVTGWAWVMQVAAHLVLPVVALVMLQAGSLTRYFRASMLDVVRMDFIR
                     TARAKGLRERTVILKHALRNALLPIITLLGFELPGLFSGALITEKVFNWPGAGHIHID
                     SLAARDYPVLMGFTLFLAVLTILGNLIADVLYAWADPRIRVRS"
     gene            complement(131716..133428)
                     /locus_tag="RAHAQ2_RS22625"
                     /old_locus_tag="Rahaq2_4695"
     CDS             complement(131716..133428)
                     /locus_tag="RAHAQ2_RS22625"
                     /old_locus_tag="Rahaq2_4695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014341710.1"
                     /db_xref="GI:504107724"
                     /translation="MTTLLRSAFAPAAQRARRTASFKIALLASAVMLSSFAFADDVLK
                     EGITPATDASQVPAAAKLRTDTVIAGISEPQGIFNPYFFVNGWDENVTNVIFARLIDW
                     DSQGKLVPGLAQSWTVSPDGKTYTIKLRPDLKFSDGSSLTAEDVAFTLTVLYDPKYDG
                     DTDITLAHIAGGEEYKQGKAESISGLKVIDPLTLQVTTTQPGATTLQKIGGPVLSKAY
                     YGKGYQRGNLDYLRTLHGKPLGNGPYVYDKYIPGQEIRFHANANYYRGVPPTPRFIYR
                     VTNPSTNFQLFQTGDTDYDAFTSRPDDIEQLKMLGFANINLYGSSDYSKIEFNVHRPA
                     LQDVKVRQALIYGLDRQKLIDVVYQGYGTVAIEPIAPISWAYNTDGVNPYKFDPAQAS
                     KLLDEAGWKVGGDGIRVKDGKRLELTLLVSKKVLNDALIPIAKEDYQKIGVLLKPQVV
                     DFNALMSQRKAGNYDLASFSTSTLNDPHDGVWDYYSTEATESGYNNPEVDKLINEGNA
                     TLDIEKRKPIYHELYKVLANDPPAILLGNRKILSASSARVTGFKPDIYNGLTGSLPDV
                     KIVK"
     gene            134122..134526
                     /locus_tag="RAHAQ2_RS22630"
     CDS             134122..134526
                     /locus_tag="RAHAQ2_RS22630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015690419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041110.1"
                     /db_xref="GI:739177159"
                     /translation="MLIYNVFGRFLGVKKTPDGWQVFRADMAERKFSRLYDVIIPDDM
                     TEGEISEVATKDDFFNIKKASQNDLLCAHRVPPQMMGIIPENSGGFGDSVKASQVFVR
                     NELTPLQERFKELNAWFGEEVIEFSAYELTPE"
     gene            complement(134604..136040)
                     /locus_tag="RAHAQ2_RS22635"
                     /old_locus_tag="Rahaq2_4698"
     CDS             complement(134604..136040)
                     /locus_tag="RAHAQ2_RS22635"
                     /old_locus_tag="Rahaq2_4698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341712.1"
                     /db_xref="GI:504107726"
                     /translation="MESPKLFISYSWSNPTHEQWVIELANELTESGVHVILDKWDLKE
                     GHDSVAFMEKMVTDSDISKVAIICDEVYALKADGRAGGVGTETQIISREVYENQEQGK
                     FVAIISERDSQGKAFLPTYYKSRIYIDLSQPDSYADNFEKLLRWVYDKPLYTRPTIGK
                     QPSFLGESEGISLGTTSTYKRAVSAIKENKTFSAGALDEYFSTFITNLESFRIGKKEG
                     EFDDQIIDNIDKFLPYRNEIIMLFITIAQYAPKEENILKIHRFLEGLVPYMHRPQNVN
                     SWQEWDFDNFKFIIHEVFLYSIAIFMKFERFAEVNILLTQKYYVPGNTDYGKNTMVGY
                     QVFREHLHSMQHRNSRLNLRRLSLHADLLEQRSKSSGLEFRYLMQADFILFIRSEIQG
                     DDYYSRWFPTTLLYVGHFHSAFEVFARSSSKSYFDKVKCILAIDKPSDMNELMAAYET
                     GEKILPRWDFESFTPSQLLGFEKLAKDA"
     gene            complement(136284..136472)
                     /locus_tag="RAHAQ2_RS22640"
     CDS             complement(136284..136472)
                     /locus_tag="RAHAQ2_RS22640"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041107.1"
                     /db_xref="GI:739177156"
                     /translation="MFLHDPERIKKCLFAPTAGLRGALSHAVKTANQVRSGQAGNIAR
                     AEEPHDKKCRNLRHAMVF"
     gene            complement(136517..136705)
                     /locus_tag="RAHAQ2_RS22645"
                     /old_locus_tag="Rahaq2_4700"
     CDS             complement(136517..136705)
                     /locus_tag="RAHAQ2_RS22645"
                     /old_locus_tag="Rahaq2_4700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005276288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341714.1"
                     /db_xref="GI:504107728"
                     /translation="MEGLQTAALLERIALIVKLATSTDCDHDKREMVAIWIAEMAVAE
                     KEELLAVIFDVNGAGKIH"
     gene            136918..137409
                     /locus_tag="RAHAQ2_RS22650"
                     /old_locus_tag="Rahaq2_4701"
     CDS             136918..137409
                     /locus_tag="RAHAQ2_RS22650"
                     /old_locus_tag="Rahaq2_4701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="WP_014341715.1"
                     /db_xref="GI:504107729"
                     /translation="MAIPAYLWLKDDGGADIKGSVDVRGREGSIEIVGFTHDVSIPND
                     NNTGKPTGTRIHAPFTFDKEIDSSTPYIYKALCTGQTLKSAEIKYYRINDAGQEVEYF
                     NTLLENVKIIGIIPMMHDIKSAYGEKRNHIEYVELRYEKITWKYLDGNIQHSDSWNER
                     ATA"
     gene            137775..138281
                     /locus_tag="RAHAQ2_RS22655"
     CDS             137775..138281
                     /locus_tag="RAHAQ2_RS22655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014830981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341717.1"
                     /db_xref="GI:504107731"
                     /translation="MRFFAALLLFPVMAFAAATPQKLRNEIQKYGESEFSEKISSDDW
                     KTALDNIASGQKDWISLAPDLAPVINQQQAEQLSEALYYAIAPNSKETLNTLAILDKH
                     KYKHQQGSVLSCVSPLNKPKEEMMRIYNETRLALLDVPGVESATCLWSLEGWMEQVKQ
                     EDASKINK"
     gene            138347..138610
                     /locus_tag="RAHAQ2_RS22660"
     CDS             138347..138610
                     /locus_tag="RAHAQ2_RS22660"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041104.1"
                     /db_xref="GI:739177153"
                     /translation="MRWVKVFFASLGYLIAFCVLTVIFSQVIDNFITEDAMHHFAWFF
                     GIYDAEGILDLYLNTAMSVSALLAVGVVYLFHLYIRQQLRASE"
     gene            complement(138654..>139571)
                     /locus_tag="RAHAQ2_RS22665"
                     /pseudo
     CDS             complement(138654..>139571)
                     /locus_tag="RAHAQ2_RS22665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573906.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
     gene            complement(139994..140980)
                     /locus_tag="RAHAQ2_RS22670"
                     /old_locus_tag="Rahaq2_4705"
     CDS             complement(139994..140980)
                     /locus_tag="RAHAQ2_RS22670"
                     /old_locus_tag="Rahaq2_4705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein involved in initiation of plasmid
                     replication"
                     /protein_id="WP_014341718.1"
                     /db_xref="GI:504107732"
                     /translation="MELNKLTVVQGNDLLEGAYSVTLDEMRLLNLALAQIDSRKPQPD
                     TLYRLFPQDYQRIYGVNPTSSHRQLREAAESLMKKPVTIYKPDVKTGKVRTVQLSWFS
                     RLEYVSSDDHSAVVLRFGQDVAPYLYELKESFTKLNFANIAKLDTPFSVRLYGWLIKA
                     KNLYGRRSGKAIEVTLDLNWMREKAGLAGKYEDYRDFRQKLLEPTINRINANTDISVV
                     WEPVKQGRTVVSIKFAYVDESAPEASKPLRPRLPRRPRAVAGSALEGEWARRCISIFE
                     EYREKLSAYDVDEKATLPDLRKLSGWYKLIGEKNKQKEILAEVSARSKKAAA"
     gene            complement(141542..141754)
                     /locus_tag="RAHAQ2_RS22675"
     CDS             complement(141542..141754)
                     /locus_tag="RAHAQ2_RS22675"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041071.1"
                     /db_xref="GI:739177119"
                     /translation="MEAFPAPDLLNVETLSDPWKASSYPLSKIIFINQIIKIVVTMSL
                     FYMWNVFLIKDDDVRDVCPQKTSMRY"
     gene            complement(142357..142566)
                     /locus_tag="RAHAQ2_RS22680"
                     /old_locus_tag="Rahaq2_4706"
     CDS             complement(142357..142566)
                     /locus_tag="RAHAQ2_RS22680"
                     /old_locus_tag="Rahaq2_4706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_014341719.1"
                     /db_xref="GI:504107733"
                     /translation="MKMKLGQHRQLTTALEAVSKPPASVKKLQTNIDEELHRRFKTSC
                     FLQDREMKDVLTELIEAWLITNERT"
     gene            complement(142563..143189)
                     /locus_tag="RAHAQ2_RS22685"
                     /old_locus_tag="Rahaq2_4707"
     CDS             complement(142563..143189)
                     /locus_tag="RAHAQ2_RS22685"
                     /old_locus_tag="Rahaq2_4707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_014341720.1"
                     /db_xref="GI:504107734"
                     /translation="MAAKIISFLNGKGGVGKTTTSINIATCLARQGHKVVMVDTDPQG
                     SISNWYDESKCQFDLAEAASEKEVYTVRKQLKEYDYVVIDGAAAISAISSAAVMVSDL
                     VLIPVTPSPLDFAACGAILAVVEARENLQPVIARFLITKKVASAKMLEVLKESIADTG
                     VPALRTGTTQRQVYIRTMMDGGTVFDTTDGNAKGEIEIMTKEITELLK"
     gene            complement(144564..145649)
                     /locus_tag="RAHAQ2_RS22690"
                     /old_locus_tag="Rahaq2_4708"
     CDS             complement(144564..145649)
                     /locus_tag="RAHAQ2_RS22690"
                     /old_locus_tag="Rahaq2_4708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_014341721.1"
                     /db_xref="GI:504107735"
                     /translation="MRTYVSFKNIKKSYDGEKLVVKNLNLDVREGEFLTLLGPSGSGK
                     TTSLMMLAGFETPTQGEILLRDKPLHNLPPHQRDIGMVFQNYALFPHMTVAENLAFPL
                     TIRRLNKSDIKEKVDRILDMVKLKSLADRYPAQMSGGQQQRVALARALVFEPKLVLMD
                     EPLGALDKQLREHMQMEIKQLHKMLDLTIVYVTHDQSEAMTMSDRVAVFNDGVIQQMD
                     SPSVIYEKPDNAFVAQFIGENNSLLATNNAAEGDYYRASLDDGTQLRAVKIRPSSPGK
                     KILLSIRPERISVNSPQPGMEQVKARIQQFIYLGDHVRMMTEVAGQDNFMVKLSAAAM
                     DPDWKPGSEVLLSWQPEHLRALDVITH"
     gene            complement(145911..147455)
                     /locus_tag="RAHAQ2_RS22695"
                     /old_locus_tag="Rahaq2_4709"
     CDS             complement(145911..147455)
                     /locus_tag="RAHAQ2_RS22695"
                     /old_locus_tag="Rahaq2_4709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="decarboxylase"
                     /protein_id="WP_014341722.1"
                     /db_xref="GI:504107736"
                     /translation="MRSLLSDLILQRLTELSDALPGTLNKRLYQALQQAIFDGSISPG
                     SRLPASRDLAKELNISRNTVLAAYEQLQAEGYIQTRSGSGTFVPADLPKDGVFADKTP
                     TRCTPVRSHVSLSKRGSQLLTRTGVASHQWGAFMPGVPDVTKFPHDIWRKLQNRLSRR
                     LSPEFLTYSGHGGCPQLQHALADYLRIARSVDCTADQILITAGTHQALDLLAKMLCDP
                     GDTAWIEEPSYWGIRNVLTINGVDIQPVPVDENGLNPPDSPPQDRAPKLICVTPSHHY
                     PLGSVMSLARRQKILAIASQQGSWVVEDDYDSEFRYSGSPIPALQGLSSDAPVIYIGT
                     FSKTMYPAMRISYVVLPRPLASRLKIAHSELYRAGNGLTQLTLAQFIREGHYAAHIRR
                     MRLLYGRRRNALIRLIEQELGPEFLCENSNAGLHLILSLPDSIDDVALSAELEQKKIL
                     TRPLSAYYLRPAPRRGLLLGYGCVPEEEIETTFGHIVDCLRRRLQSGGAIPLTDNEAL
                     PKRGIA"
     gene            147601..148869
                     /locus_tag="RAHAQ2_RS22700"
                     /old_locus_tag="Rahaq2_4710"
     CDS             147601..148869
                     /locus_tag="RAHAQ2_RS22700"
                     /old_locus_tag="Rahaq2_4710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341723.1"
                     /note="catalyzes the formation of succinate semialdehyde
                     and glutamate from 4-aminobutanoate and 2-oxoglutarate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="WP_014341723.1"
                     /db_xref="GI:504107737"
                     /translation="MSHSELEKRRKEATPRGVGVMCDFYAAKAENATLWDEQGREYID
                     FTAGIAVLNTGHRHPKIVEAIRNQLDLFTHTSYQIVPYASFVDLAERINMISPVSGKA
                     KTTFFSTGAEAVENAVKIARSATGRPGIITFSGAFHGRTLLTMALTGKVVPYKVGFGP
                     FPASVFHAQYPNAVHGVTTEMALDSIERIFRSDIAPQQIAAILYEPVQGEGGFNIAPE
                     DFVKGLREICDRHGIVMIADEVQSGFARTGKMFASEYYPDAKPDIVTMAKSLGGGLPI
                     SGVTGRAELMDAPEPGGLGGTYAGNPLAVASALAVLDIIEEEKLCERANRLGAELAEV
                     LEKAKANCAALVDVRARGSMVAAEFNDPSTGKPSSELTRQYLRKALDAGLLMLSCGVH
                     GNVIRFLYPLTIPDVQFKAALTILSRVLAD"
     gene            149143..150171
                     /locus_tag="RAHAQ2_RS22705"
                     /old_locus_tag="Rahaq2_4711"
     CDS             149143..150171
                     /locus_tag="RAHAQ2_RS22705"
                     /old_locus_tag="Rahaq2_4711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014341724.1"
                     /db_xref="GI:504107738"
                     /translation="MFKKIVLTTLIAGMVFQAQAGSLTVISFGGLNKDAQDKAFYKPF
                     AAAGKGTIEPGEYNGEMARIRAMVETKQVGWDVVEVESPELIRGCDEGLFEPLDWSKL
                     GDKAQYVPGAVTECGAGIFLWSTVLTYDASKLKKAPTSWADFWDVKDFPGKRALRKSA
                     KFTLEIALLADGVKREDIYKVLATPAGVERAFKKLDQIKPNIQWWESGAQPLQWLVSG
                     DVVMTSAYNGRVSAAQGEGHDFKMVWDNSLYDLDSWAIVKGSQHKDLAEQFIAFANKP
                     ENQKVFAETIPYGPTEKSVTGMIDPKYAQNLPTAEKNLAGALQVDTHFWIEHGEDLEQ
                     RFNAWSSK"
     gene            150342..151607
                     /locus_tag="RAHAQ2_RS22710"
                     /old_locus_tag="Rahaq2_4712"
     CDS             150342..151607
                     /locus_tag="RAHAQ2_RS22710"
                     /old_locus_tag="Rahaq2_4712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014341725.1"
                     /db_xref="GI:504107739"
                     /translation="MSQTEMLTTPVPEESAEGPTLRQRLRKVDAAYTRRSLLLIAPLL
                     LFVIVSFLFPIASILGKSVTNPELGATMPETVALLSHWDGKSVPDEATFSALVADLRN
                     ARNSGQMATIAKRLSYEDNRYRSLITGTLRHVPEGGGAVREPLIRSMPLWGELSTWQT
                     VKRASAPVTSLYLLSVFDRKVDADSGKIVALPPDQALYVNVLLRTLWMALVVTVCCVA
                     LGYPLAYWLAKQPAGRANLLMILVLLPFWTSLIVRTASWIVLLQSGGLINRALLSTGI
                     IDHPLVMVFNRLGVYISMTHIMLPFIVLPLYAVMKGISPNYVRAAISLGAHPFTAFWR
                     VYVPQTYAGVTAGALLVFMMAMGYYITPALLGGPGDQMISYFVAFFTNTTMNWGMAAA
                     LGSQLLVIVVLLYIVYIRVTRTKAEIAAH"
     gene            151631..152458
                     /locus_tag="RAHAQ2_RS22715"
                     /old_locus_tag="Rahaq2_4713"
     CDS             151631..152458
                     /locus_tag="RAHAQ2_RS22715"
                     /old_locus_tag="Rahaq2_4713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter permease"
                     /protein_id="WP_037041090.1"
                     /db_xref="GI:739177138"
                     /translation="MRQKGALILRLWRWCFNFYSAAILLFLIVPVLIIVPLSFNAGSF
                     LSYPLTGFSLRWYQTFFHSDEWLSSLGNSLLIAPLATLLATVLGVLASVGLVRGEFRG
                     KSLVMAILISPMIAPVVIIAVGMFFFFARVSLLNSYLGLVLAHALLGVPFVVITVVAI
                     LKNYDRNLSRAAASLGASPWTVFRKVTLPLIAPGVFSGALFAFAASFDEVVVTLFLAS
                     PRQRTLPIQMFAGIRENLDPTIAAAASLMVGASLILLLVMELLRRRGERLRHSPATH"
     gene            152546..153289
                     /locus_tag="RAHAQ2_RS22720"
                     /old_locus_tag="Rahaq2_4714"
     CDS             152546..153289
                     /locus_tag="RAHAQ2_RS22720"
                     /old_locus_tag="Rahaq2_4714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014341727.1"
                     /db_xref="GI:504107741"
                     /translation="MTDTTQKKTLLLTGASRGIGHATVKHFYAAGWRIFTASRQNWVD
                     ECPWAEGFLNHIHLDLEDIDSVQKALPMIKERLGGRLDALVDNAGISPKTPTGGRLGV
                     LDSDYATWLQVFNVNLFSTAILATGLFDELKAAKGSIINVTSIAGSKVHPFAGVAYAC
                     SKAALSTLTREMAHEFGPHGVRVNAIAPGEIDTAILSPGTQDIVERSVPLQRLGKAEE
                     VASLIHFLCTSGASYVNGAEIHVNGGQHV"
     gene            153282..154346
                     /locus_tag="RAHAQ2_RS22725"
                     /old_locus_tag="Rahaq2_4715"
     CDS             153282..154346
                     /locus_tag="RAHAQ2_RS22725"
                     /old_locus_tag="Rahaq2_4715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_014341728.1"
                     /db_xref="GI:504107742"
                     /translation="MSDTPSLLLTGLLTTEVPRVSTLQAENIAAQVYGLEGKAEVLGG
                     ERDSNFCLTTDPGHAYMLRFVNPAEVPAEVDFQTAILSHLALHDSQLPVPRLLQSRHG
                     ELTPQVKVAGQFLTLRAVSYLPGTAQYQVPRTPRLMHELGDALARLDIALRDFEHPGA
                     KRDLLWDISDMSRLEGGITQFTDPEQRRTITRVLETHRQKVVPASQQLRRQVIHNDLN
                     AHNVLVNSADPQRLAGIIDFGDALHAPLINELATALAYQLNSEGDDLFLYCRPMIAAY
                     TGRLPLTGAELDILPELVASRLALSLLIARHRAALYPQNRDYILRNQAHAWGSLSRLM
                     SLPFTQTDLIFRQSCAFEQK"
     gene            154358..155614
                     /locus_tag="RAHAQ2_RS22730"
                     /old_locus_tag="Rahaq2_4716"
     CDS             154358..155614
                     /locus_tag="RAHAQ2_RS22730"
                     /old_locus_tag="Rahaq2_4716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="WP_014341729.1"
                     /db_xref="GI:504107743"
                     /translation="MLTSKQVSEGRQQFLGGGYRLFYQEPLHVVRGEGVWLYDSEGRR
                     YLDAYNNVASVGHCHPAVVEAIATQAAQLNTHTRYLNDAIVEFAEDFLTEFPPELRNL
                     TMTCTGSEANDLALRIARQVTGGQGVIVTRWAYHGVTSALAELSPSLGDGFEQGKNVW
                     LTDAPDTFRHPGKFAAGVERALDAMKQAGVKPAALLADTIFSSDGVFSPEPAEMQRAV
                     ARVRAAGGLFIADEVQPGFGRTGSQRWGFARYGVTPDLISLGKPMGNGHPVAGLVGRP
                     ELFTEFGRRQRYFNTFGGNPVSCRAAHAVLQILRREALQQNARMTGAILREGLQKLAK
                     RYPVIGDVRGDGLFIGVELVSDQYNTPAPERAAFVVNAMRRKRVLISATGPAANVLKI
                     RPPLVFQPEHATLLLETLAGVLAEMG"
     gene            complement(155744..156418)
                     /locus_tag="RAHAQ2_RS22735"
                     /old_locus_tag="Rahaq2_4717"
     CDS             complement(155744..156418)
                     /locus_tag="RAHAQ2_RS22735"
                     /old_locus_tag="Rahaq2_4717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_037041069.1"
                     /db_xref="GI:739177117"
                     /translation="MNYPISSINHAYLGSSVYATLREALITGRLKPNDRLRIRELAEQ
                     VGTSVTPVRDAILQLAKEQALEMRTPKDIRVPQLDEQQYQEIRTLRLELEGLGAEKAA
                     QSVTEYELQRIAQNIENNRQAISNEDLPEALRLNSEFHLMLAQSARMPLLSNFIDSLW
                     MRTGPLIAQAYAHFSERMAIEHHEEILIALRKGDGATARRAIQEDILDGSQKMVEFLA
                     VGREKA"
     gene            complement(156593..158050)
                     /locus_tag="RAHAQ2_RS22740"
                     /old_locus_tag="Rahaq2_4718"
     CDS             complement(156593..158050)
                     /locus_tag="RAHAQ2_RS22740"
                     /old_locus_tag="Rahaq2_4718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014341731.1"
                     /db_xref="GI:504107745"
                     /translation="MSKKINSGGQDEAAKASQPTEPLVKVIAFIATLGGLLFGYDTGV
                     IAGALLFMKHDLHLTSLTTGMVTSFLILGSAVGAVCAGRVADRFGRKKVILVMALIFM
                     AGSLGCATAPNVVIMIICRFILGLAVGGAAAIVPIYIAEIVPSHRRWQFVTLQELMIV
                     SGQLIAYTSNAAINEVWGGETTWRWMLGVACVPAVVLWVGMLFLPDTPRWYAMHGRYR
                     EARDVLERTRKASKVEKELSEIRSSMSSRSEKHSRRQKTISVWMKRLVFLGIGIAMLQ
                     QLSGVNTIMFYAPTMLQATGLSTNASLLATIANGVISVLMTFVGIMLLSRFGRRPLLL
                     TGQIGCTLTLLAIGLVTWLMPETVNGHPDTVRSYLVLGGMLVFLCFQQGALSPVTWLL
                     LSEIFPMRIRGMANGVSVFAMQMTNFSIAFMFPIMLESIGLTMSFFCFAAIGVAGGLF
                     AVIFAPETQGKTLEQIEKHFKKQLQDDPVPQEAGS"
     gene            158387..160762
                     /locus_tag="RAHAQ2_RS22745"
                     /old_locus_tag="Rahaq2_4719"
     CDS             158387..160762
                     /locus_tag="RAHAQ2_RS22745"
                     /old_locus_tag="Rahaq2_4719"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase subunit A"
                     /protein_id="WP_014341732.1"
                     /db_xref="GI:504107746"
                     /translation="MKNKCDIISNVTRRDFVKVSSMVAALPLVGFKFSHAADKSSVTS
                     SGLVPSPVNVVATCSTFDCGGKCDIRAHVQDGAVIQITTRPDAELDPDMPVMRACVRG
                     RSYRKFVYHPDRLKYPMKRVGKRGEGKFVRISWDEATTLIADNLQRITKKYGPSSRYV
                     HVGTAVSGGAFSGDTMARRLLNLTGGHLSSYHSVSMGNTAAATPYTYGTAASGNTLDT
                     LADTPLVILWGHNPTETIFGHTNHYFQQMKQNGTRFIVVDPRYSDTASSLADEWIPLR
                     PSTDNALMDAMMYVIVSENLHDNAFIERYTLGFDESSMPEDVPPDESLMSYLTGVKDG
                     VVKTPEWAEVITHVPAQTIRRLAREYATTKPAALIQGWGPQRHNCGERTARGSTLLAT
                     LTGNVGIKGGWAGGYGGIGNRKFTTGPEMPDNPVKQKISVMNWVQAADDASLVTPQDG
                     LTGGDKLDSNIRILFSLAGNYLANQNPDIHQAVKVLEDESKIEFIVASDLYLTPSAKY
                     VDLLLPETSFMERWNIGETWGTGNYLMLSEKLIEPPFESRSDYDWLREVAAKLGVEQE
                     FSQGRTEKEWITHIWEKTRQAMPDEKLPTFKELLVTRRHLFKSEPYVAFEDNIRDPKN
                     HPFQTPSGKIEIFSRRLYDMHHPEIPALSHYVPAHEGPEDPLAEKFPLQMITWKGKNR
                     ANSTQYANPWLQEVQEQKLWINPLDAHRRGIAQGDLVRIHNDRGVTQIPAEVTQRIMP
                     GVVAMQAGAWWQPDARGVDHGGCANVLSSARITALAKGNSHQTMLVEVIKA"
     gene            160759..161379
                     /locus_tag="RAHAQ2_RS22750"
                     /old_locus_tag="Rahaq2_4720"
     CDS             160759..161379
                     /locus_tag="RAHAQ2_RS22750"
                     /old_locus_tag="Rahaq2_4720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_014341733.1"
                     /db_xref="GI:504107747"
                     /translation="MSQFTDYPPVSDRQLGFYIDSSRCSGCKACQVACKDKNNLEVGR
                     RFRRIYEIKGGGFIPTGMGGMVNNVYAYTLSISCNHCNDPVCTKNCPTTAMHKRPGDG
                     IVRVNTDKCVGCGYCAWSCPYGAPQLNTQTGQMSKCDFCIDLQVTGQQPVCVSTCPLG
                     AIKFGPIDELRAKYGSLCDVQGLPDSALTQPNLVIKPHQGAEKRSQ"
     gene            161379..162227
                     /locus_tag="RAHAQ2_RS22755"
                     /old_locus_tag="Rahaq2_4721"
     CDS             161379..162227
                     /locus_tag="RAHAQ2_RS22755"
                     /old_locus_tag="Rahaq2_4721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase"
                     /protein_id="WP_014341734.1"
                     /db_xref="GI:504107748"
                     /translation="MLQEWPLIIFTLLLQLSVGSIVFITFTLIYGADNLNAQDKWRVA
                     TPAMLLAFITGALGLMVSTAHLGYPLNAFHALSHISSSWLSREIVFASLYLGMLGLTT
                     LIALMLKRVMTSLLLLASLLGLTDLFCMSAVYVHASVVTWMHVNTYVMFYGAALSLGA
                     IAGLWRISRCPWLPWQLARRLAGFGIGLLIAVTLMRLLEQLLYLGYLGGVNSDVITFP
                     HQPLVAFDQSQTLRLVAWVILIAGTGATAYSGQNHRIRGGLLSAGGILMLLAEIMLRF
                     NFFSIH"
     gene            162227..163102
                     /locus_tag="RAHAQ2_RS22760"
                     /old_locus_tag="Rahaq2_4722"
     CDS             162227..163102
                     /locus_tag="RAHAQ2_RS22760"
                     /old_locus_tag="Rahaq2_4722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyferredoxin"
                     /protein_id="WP_014341735.1"
                     /db_xref="GI:504107749"
                     /translation="MEVFSLNDRPRFTGAGKACVRNTVKNSRCVACAEVCPTGAVTFN
                     KEKMMVINPQACIGCGYCLFNCPTGAPEGISPAQRHYRGDRLVTPLSTIAPCPEELLM
                     WHSEYGIRFVEMTADSAAGWFLAVATLNVRLKQMQEPLWNIVPPSRQTFNGSRRRWLH
                     LKNEGASAGNVPVGRRSRRTRFTQISEYHLDLDKGRCALCGACSRICPEQAICLDNLA
                     LTLDPVKCTGCGNCEAVCFDGALFVRESNEGTLTVYSLEQAQCRVCRHLFPAWSARDN
                     ECPVCRRHAFGMREA"
     gene            163300..164496
                     /locus_tag="RAHAQ2_RS22765"
                     /old_locus_tag="Rahaq2_4723"
     CDS             163300..164496
                     /locus_tag="RAHAQ2_RS22765"
                     /old_locus_tag="Rahaq2_4723"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578012.1"
                     /note="enzyme from Treponema denticola exhibits
                     NADH-dependent trans-2-enoyl-CoA reductase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trans-2-enoyl-CoA reductase"
                     /protein_id="WP_014341736.1"
                     /db_xref="GI:504107750"
                     /translation="MIIKPRIRGFICVTAHPEGCKANVKEQIDYVTAQGKIAGGPKKV
                     LVIGASTGYGLAARISAAFGSDAATLGIFFERPGDESKTATAGWYNSAAFEEFADAKG
                     LYAKSINGDAFSDEVKQKTIELIKQDLGQVDLVVYSLAAPRRTHPKTGEVFNSTLKPI
                     GKQVTIRGINTDKETINETTLEPATPEEIAGTVAVMGGEDWQMWIDDLKAAGVLAEGA
                     KTTAFTYLGEEVTQDIYWNGSIGEAKKDLDKRVLDIRSTLAEQGGDARVSVLKAVVTQ
                     ASSAIPVMPLYLSLLFKVMKEKGTHEGCIEQVYGLYKDSLYGAEPLVDNEGRLRADLK
                     EIAPEVQEEVGKLWNEVTNDNIAELTDFAGYKSEFMRLFGFGLNGVDYAADTNPDVKI
                     KHLIQM"
     gene            complement(164641..164943)
                     /locus_tag="RAHAQ2_RS22770"
                     /old_locus_tag="Rahaq2_4724"
     CDS             complement(164641..164943)
                     /locus_tag="RAHAQ2_RS22770"
                     /old_locus_tag="Rahaq2_4724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013578013.1"
                     /db_xref="GI:503343352"
                     /translation="MGSMVFCRGCGKEIHESAKSCPHCGATQSINPQGTKSRVAAALL
                     AFFLGGFGVHKFYLGKIGQGFLYLIFCWTFIPSIIAFIEFIIYLCDSDENFAKKYG"
     gene            complement(165285..165545)
                     /locus_tag="RAHAQ2_RS22775"
                     /old_locus_tag="Rahaq2_4725"
     CDS             complement(165285..165545)
                     /locus_tag="RAHAQ2_RS22775"
                     /old_locus_tag="Rahaq2_4725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014341737.1"
                     /db_xref="GI:504107751"
                     /translation="MNNHDWHQADIIAALRKKGTTLAAVSRAAGLSSSTLSNALSRPW
                     PKGELLIAQALEIHPSTIWPSRYFDPRTRERIQRTVRSSNRI"
     gene            complement(166122..166427)
                     /locus_tag="RAHAQ2_RS22780"
                     /old_locus_tag="Rahaq2_4727"
     CDS             complement(166122..166427)
                     /locus_tag="RAHAQ2_RS22780"
                     /old_locus_tag="Rahaq2_4727"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341738.1"
                     /db_xref="GI:504107752"
                     /translation="MKGLVNDVLSIFSPKAVKPVLVRQGLSHREIASLQAVGVTTVSW
                     ATSMEELNNAFVKKALDAGAVGYHITHVESHKPGKEQQHVMAATATFYHINHKVAYG"
     gene            complement(166584..166790)
                     /locus_tag="RAHAQ2_RS22785"
     CDS             complement(166584..166790)
                     /locus_tag="RAHAQ2_RS22785"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041067.1"
                     /db_xref="GI:739177115"
                     /translation="MLAAASRVAGLNPSTLSSALSGPRTKGEMRIPQAGRKTPSFLYS
                     FQKYLTCNQVKISSFIFALIVAGD"
     gene            167067..168344
                     /locus_tag="RAHAQ2_RS22790"
                     /old_locus_tag="Rahaq2_4728"
     CDS             167067..168344
                     /locus_tag="RAHAQ2_RS22790"
                     /old_locus_tag="Rahaq2_4728"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014341739.1"
                     /db_xref="GI:504107753"
                     /translation="MEIFLSLVKTPAVIIAIIAFLGLVFQKASVSRIITGTALSFIGF
                     TMIKVGGSILMKVLTAFSTLFSNAFNIVGVVPSNEAIMAATIDQIGSTAAIILLFSMV
                     INILLARFTRLKFIYLSLHLVLFMSFALTAVLMQLGYSYYPIIIISSIFIGFYMAASP
                     FFLNRFSREIIGSDEYAISHAAISSYIIGSYMGKWFGNKKTDTEHLKISNKFDFLREP
                     NIATLLTMLVLLLISCVFATQPQIKTAMTLVYGAGAADKNTLIFILEQSAVFACGLYL
                     AKAGVNLFTAEIVPAFKGFSRVFAPGAVPAVDVMVLFTKAPNATLIGFLVSFSVELAC
                     ILIFPFVGLPIIVPGIMASFITGGAAAIFGNATGGFRGAMIASGINGLLLCVLPALTL
                     PLFSHLGAQGVTFADPDFTLSSLILNHLMGLFK"
     gene            complement(168474..169859)
                     /locus_tag="RAHAQ2_RS22795"
                     /old_locus_tag="Rahaq2_4729"
     CDS             complement(168474..169859)
                     /locus_tag="RAHAQ2_RS22795"
                     /old_locus_tag="Rahaq2_4729"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase"
                     /protein_id="WP_014341740.1"
                     /db_xref="GI:504107754"
                     /translation="MTTPDTHAISLNPFNGQRIAEYPFDTAPALEESVAQGSAAFKQW
                     RKTDIAQRASLLNNLATELRAAGEDIARMISREMGKPVKQARAEVEKSAGLCEWYARQ
                     GPAMLAPEPTMVDNGEAHIHYRPSGMILAIMPWNFPVWQILRGAVPALLAGNTFLLKP
                     APNVMGTTYLVKQAALKAGFPAGAFGVINVGNADVAALIADPRVVAVTVTGSVRAGGA
                     IAELAGKSLKKCVLELGGSDPFIVLNDASLDEAVKAAVAGRYQNTGQVCAAAKRMIVE
                     EGVLEAFTEKFVAATQALVIGNPLDDDTYIGPMARYDLRDELHKQVQDTLAEGATLLL
                     GGEKIAGDGNFYAPTILSNVTPQMTAFRQELFGPVAAITAARDAEHAVELANDSDFGL
                     SATIYTADLARAEQMTGELQTGGVFINGYSASDPRVAFGGVKKSGYGRELSHFGLREF
                     CNVQTVWSNRK"
     gene            169960..170844
                     /locus_tag="RAHAQ2_RS22800"
                     /old_locus_tag="Rahaq2_4730"
     CDS             169960..170844
                     /locus_tag="RAHAQ2_RS22800"
                     /old_locus_tag="Rahaq2_4730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014341741.1"
                     /db_xref="GI:504107755"
                     /translation="MNLSQLEMFRAVAQTGSISAAAQLVHRVPSNLTTRIKQLEAELG
                     VALFIRENQRLRLSPAGRNFLTYNNRILDLVDEARISVAGTEPQGIFALGALESTAAV
                     RIPALLARYHQQFSKVELALSTGPSGELLDKLLEGELEATFVDGPVLHPVLDGVPVYK
                     EEMVIVAPLHHAPVTRGQDVNGEILYAFRSNCSYRRHFESWFADDGAAPGKIYEMESY
                     HGMLACVIAGGGLALMPRSMLESMPGSTTVSIWPLADNYRFLTTWLIWRRGVLTRNLT
                     EFAALASQLTVNLPPPAI"
     gene            171390..171797
                     /locus_tag="RAHAQ2_RS22805"
                     /old_locus_tag="Rahaq2_4731"
     CDS             171390..171797
                     /locus_tag="RAHAQ2_RS22805"
                     /old_locus_tag="Rahaq2_4731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014341742.1"
                     /db_xref="GI:504107756"
                     /translation="MDNALNVLNNIRTLRAQAREMPLSTLEEILEKLTAIVEETRENA
                     KARSAQQQERDEKLLKYREMLANDGIAIDDLLGHQSAKVTTKAKRKPRPAIYEYTDTD
                     GSKKTWTGQGRTPSAIKAALDGGATLESFLIKR"
     gene            172003..172536
                     /locus_tag="RAHAQ2_RS22810"
                     /old_locus_tag="Rahaq2_4732"
     CDS             172003..172536
                     /locus_tag="RAHAQ2_RS22810"
                     /old_locus_tag="Rahaq2_4732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_014341743.1"
                     /db_xref="GI:504107757"
                     /translation="MRTRYSSVQIVIHWLVLVLVVLTYTTMDIKGAFIKGSQARELLT
                     LAHYSLGFCVLFLMCVRVFVRAMYTTPSVKPAPPHWQHNLSVLVHAVIYLMFIGLPVL
                     GILSKYYSGHDWTMFNLMMPKSVLPDLSLQKELKTLHTWLANAGYYLIGLHAFAALWH
                     HYRLRDNTLVRMLPGRK"
     gene            172697..173161
                     /locus_tag="RAHAQ2_RS22815"
                     /old_locus_tag="Rahaq2_4733"
     CDS             172697..173161
                     /locus_tag="RAHAQ2_RS22815"
                     /old_locus_tag="Rahaq2_4733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014341744.1"
                     /db_xref="GI:504107758"
                     /translation="MDTTEELSGTYFYHGHANLSNQELFGLIFIESLSNHLGLDTTAT
                     VLIITGQPYIPVQGKVVTAIPGTSVASKLSRALLKQAKLPFGLRAWTPVGKSFNTLTM
                     RKTTKWAALIDRYVPFVGYAMAVILIQQVAAETRSKYNLIARPEDRIAWTYF"
     gene            173146..173490
                     /locus_tag="RAHAQ2_RS22820"
                     /old_locus_tag="Rahaq2_4734"
     CDS             173146..173490
                     /locus_tag="RAHAQ2_RS22820"
                     /old_locus_tag="Rahaq2_4734"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041064.1"
                     /db_xref="GI:739177112"
                     /translation="MDVLLMEEKVLLMFREEIPGYYDFDLKREVPLEFDTELQDFAPG
                     DDFVCALEVYEKTFKVDLSVVNWSFYFPWENLPFFTRWFKVKRKDVEKTRKPLTVRMF
                     AESAKAGKWLYD"
     gene            complement(173512..173994)
                     /locus_tag="RAHAQ2_RS22825"
                     /old_locus_tag="Rahaq2_4735"
     CDS             complement(173512..173994)
                     /locus_tag="RAHAQ2_RS22825"
                     /old_locus_tag="Rahaq2_4735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013575296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="WP_014341746.1"
                     /db_xref="GI:504107760"
                     /translation="MAIPAYLWLKDDGGALIKGGVDVKDREYSIEVKGFHHNLMTPTD
                     DRTGKITGTRVHSPMMLVKDFDCSSPYIYKAVATGQCLASAEIKWYRINDAGQEVEYF
                     NMLLEKVRIVSITPAMAAASNPNENHMETIELRYEKIAWMHNDGNIIFADSWNDRQTA
                     "
     gene            complement(174174..175097)
                     /locus_tag="RAHAQ2_RS22830"
                     /old_locus_tag="Rahaq2_4736"
     CDS             complement(174174..175097)
                     /locus_tag="RAHAQ2_RS22830"
                     /old_locus_tag="Rahaq2_4736"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="WP_014341747.1"
                     /db_xref="GI:504107761"
                     /translation="MRILVVGAGATGGYFGARLAQAGQDVTFLLREKRAQAVQQDGLT
                     IHSPHGDFHFQPNVLQASQLTGSYDLILLTVKSFGLEAAIKDIAPVVGENTMVMPVLN
                     GMKHMETLSLRFGEHALIGGLCKINATLDADGHVHQMTPLHQIIYGELSGEKTERILK
                     VDQAFQSAGVEAILSETIITDLWEKWLLLSSFGAITCTMRGNIGQVASAPGGTEFAQA
                     IVTEALTTMKAFGYAERAAAVAKIRESVTDKSSPQTSSMYRDMMQGYPIEADQIIGDL
                     VGRATRVGINIPLLQAAYTHLCVYQKNFVKQ"
     gene            175254..176027
                     /locus_tag="RAHAQ2_RS22835"
                     /old_locus_tag="Rahaq2_4737"
     CDS             175254..176027
                     /locus_tag="RAHAQ2_RS22835"
                     /old_locus_tag="Rahaq2_4737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein Fic"
                     /protein_id="WP_014341748.1"
                     /db_xref="GI:504107762"
                     /translation="MAGYQPPYSITPQILNRVVDVGELLGRWAAHAEQSSVLLRKENR
                     IRTIQASLAIEHNSLSTPQVTAIMEGKRVLAPQKDIQEVRNAILTYEQLPVLKSHRLE
                     DVLKAHQTLMLGLVDAPGHLRSGNVGVYRDNQLIHMAPPAGQLPRLMSDLLNWLKETD
                     IHPLIASSIFHYEFEFIHPFADGNGRMGRLWQTLILSQWRSELAWLPVETLIHNQQQD
                     YYRILGECDRASDCTAFISFMLDNLAEALREGIETQSSP"
     gene            complement(176080..177042)
                     /locus_tag="RAHAQ2_RS22840"
                     /old_locus_tag="Rahaq2_4738"
     CDS             complement(176080..177042)
                     /locus_tag="RAHAQ2_RS22840"
                     /old_locus_tag="Rahaq2_4738"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_049796166.1"
                     /db_xref="GI:908659716"
                     /translation="MAVTPFFRRMMCWEGFLLLVTLLVFVVNAFASPYFLNIWNLSDA
                     TFNFTEKAIIVLPMAMLIIAREIDLSVASTMALSSTMMGFCAQAGLPTPALVGVGLSV
                     GLLCGLINGLLVTRLNLSSIVITIGTMSLFRGMTYVLLGDQSLNQYPASFAWFGQGYV
                     WGPLSFEFTLFLVLGAVFYFLLHKTNFGRRTYAIGNNPVAAWYSGINVKRHNLTLFVL
                     VGVMSGLAAVLLTSRLGSTRPTLALGWELSVITMAVLGGVSVLGGSGSMTGVIIAAFL
                     MGLLTFGLSLLNVPGIVMSVIVGAMLIVVISLPVLYRKVLARGK"
     gene            complement(177099..178112)
                     /locus_tag="RAHAQ2_RS22845"
                     /old_locus_tag="Rahaq2_4739"
     CDS             complement(177099..178112)
                     /locus_tag="RAHAQ2_RS22845"
                     /old_locus_tag="Rahaq2_4739"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_014341750.1"
                     /db_xref="GI:504107764"
                     /translation="MIKNLLKYRELLLAVVIVLMVLGVGARSPEFVGAGNLLEMFNDT
                     SILIILALGQMMVLLTKGIDLSMAANLALTGMIVALINFHHPDIPVWSLVLLATFLGL
                     VMGAINGLLVWKVGIPPIVVTLGTMSIYRGIIFLLSNGGWINAHQMSPDFLSLPRATF
                     IGLPLLGWCAIAALILVAYFLRYSRTGRALYTAGGNATAAYYTGINAGKMQFVSFCLS
                     GALAGFCGYLWISRFAVAYVDVANGFELQIVAACVIGGISTMGGIGSVVGCLLGALFL
                     GVINNALPVIEVSPFWQMAISGGVIVIAVILNERANKRKGRLILRHSPAVQPVRTETG
                     VSS"
     gene            complement(178109..179623)
                     /locus_tag="RAHAQ2_RS22850"
                     /old_locus_tag="Rahaq2_4740"
     CDS             complement(178109..179623)
                     /locus_tag="RAHAQ2_RS22850"
                     /old_locus_tag="Rahaq2_4740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341751.1"
                     /note="with RbsBCD acts to import ribose into the cell;
                     RbsA contains 2 ATP-binding domain; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter"
                     /protein_id="WP_014341751.1"
                     /db_xref="GI:504107765"
                     /translation="MSDSATPLLSLQGISKVFPGVRALNNVHVDLYPGKVTALIGENG
                     AGKSTLVKVMTGIYQPEEGELRYKAIPIKLPNPESAHKVGITAIHQETVLFDELSVTE
                     NIFVGHYLYRGIFKRLDWPAMHQQARDILTRLEVNIDPHAILKELSIAQRHMVAIARA
                     LSFDAQVVILDEPTAALSQHEIVEFYQIVERLKQEGKAILFISHKFDEIFSISDYYTV
                     LRDGSYVGSGKLSDISEQQMVTMMVGREVSQAYPKVNCEPGETVLEVQNLSHPTEFAG
                     INFSLRKGEILGFYGLVGAGRTELMQALFGVTQPNGGKILINGKEHHFSRPSQAIRAG
                     IVYVPEERQKQGAIIDLPISQNISLPQLSQLNPHGVLNDKKEWALADDYARRLQVKAS
                     SWKQAVGTLSGGNQQKVVIAKWLATRPDIIILDEPTKGIDIGSKAAVHQFMSELVGRG
                     LAVIMVSSELPEVMGMADRIIVMHEGLMVAEFNAGEATAEMIVSAASGAGEEAA"
     gene            complement(179691..180683)
                     /locus_tag="RAHAQ2_RS22855"
                     /old_locus_tag="Rahaq2_4741"
     CDS             complement(179691..180683)
                     /locus_tag="RAHAQ2_RS22855"
                     /old_locus_tag="Rahaq2_4741"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014341752.1"
                     /db_xref="GI:504107766"
                     /translation="MKLKHVLSLTLIAGSILLAGAASAEVKIALVAKSLGNGFFEAAN
                     VGAQQAAKELGDVKVIYTGPTTTTAEAQIEVLNGLIAQGVDAIAVSANDPDALVPVLK
                     KAMQRGIKVVSWDSGVAKDGRQIHLNPSNNALIGETNVKLAADALKALNVEKGDVAIL
                     SATPTSTNQNLWIAEMKKVLPKYPSVNLVTVAYGDDLSDKSYRETIGLLKSYPDLKVI
                     ISPSSVGIVAAAQAVKDQGKIGKVYVTGLGLPSEMAGAVKSGATKSFAIWNPIDLGYA
                     ATYLAYDLVKGTATKTEASMGRLGKVKLDADGSGAMAEPFVYDASNIDKFSKIF"
     gene            181085..181900
                     /locus_tag="RAHAQ2_RS22860"
                     /old_locus_tag="Rahaq2_4742"
     CDS             181085..181900
                     /locus_tag="RAHAQ2_RS22860"
                     /old_locus_tag="Rahaq2_4742"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014341753.1"
                     /db_xref="GI:504107767"
                     /translation="MTVLRSSEYFPSGDFPVAIEPRYPQETFPEHHHQDFNEIVLVEQ
                     GTGTHVFNDQPLILSAGSVCFVRHCDHHLYEDTENLHLTNVLYRSPDAFRFLNGVGDL
                     LPQEVDGMYPAHWRISPTQIVQAKTLIDLLARHPVMQSPESQAQQELYFMQLLLLLRK
                     GSRDVGYRGQGGDLNNLLDWMNEHYNEEIDWPELAAQFSMSLRTLHRQMKQQTGCTPL
                     NYLNRLRLLNARNMLRFSDSPITEIAHHCGFCDSNYFSTLFKREFGYAPRSIR"
     gene            182134..183573
                     /locus_tag="RAHAQ2_RS22865"
                     /old_locus_tag="Rahaq2_4743"
     CDS             182134..183573
                     /locus_tag="RAHAQ2_RS22865"
                     /old_locus_tag="Rahaq2_4743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416634.1"
                     /note="NAD-linked; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_014341754.1"
                     /db_xref="GI:504107768"
                     /translation="MSTVQKRMYINGGFVENTGGKWIDVVNPATEQVISQIPEGSAED
                     AKKAIDAAEAAQPGWEALPAVERGVWLHKIADGIREREAELTETIIAEGGKTYGLAQT
                     EVLFTADYLDYMAEWARRYEGEIIQSDRPNENIFVFRKAIGVTTGILPWNFPFFLIAR
                     KAAPALITGNTIVIKPSEITPNNAIIFAEIIHKVGLPKGVLNIVTGYGPTVGQELAAN
                     PKVGMVSLTGSVAAGIATMTAAAQNVTKVSLELGGKAPAIVMNDADLDLAVKAIVSSR
                     VINTGQVCNCAERVYVQEGVYDEFISRISEAMKKVTFGNTAEQKELDMGPLISAAALQ
                     RVEEKVAKAVSQGAKVLLGGKRHGDKGFFYQPTVLVDVRQEMPIMHEEVFGPVLPVAT
                     FKTLDEAIAMANDSEYGLTSSIYTSNINTAMKALKQLKFGETYINRENFEAMQGFHAG
                     WRKSGVGGADGKHGLQEYLQTHVAYLQFH"
     gene            183645..184226
                     /locus_tag="RAHAQ2_RS22870"
                     /old_locus_tag="Rahaq2_4744"
     CDS             183645..184226
                     /locus_tag="RAHAQ2_RS22870"
                     /old_locus_tag="Rahaq2_4744"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341755.1"
                     /db_xref="GI:504107769"
                     /translation="MNRNDFLTGIRQHKFMQTLFPPQTQKPNPPEDFGRALTLMGGIW
                     DDRFLRVPKNGYTTLNAYLRGLYPADSVFCSATPEIIADVDFDARTDAASLKDVDVGV
                     VRACFGVAETGAVFLSDHHLCVNTLSAMAKNLVVLLDVNLIIEHLHLAHRQPQPFNAR
                     YAIMVTGPAAMADSESALMLGAKGVKSLRVIAI"
     gene            184367..185437
                     /locus_tag="RAHAQ2_RS22875"
                     /old_locus_tag="Rahaq2_4745"
     CDS             184367..185437
                     /locus_tag="RAHAQ2_RS22875"
                     /old_locus_tag="Rahaq2_4745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341756.1"
                     /db_xref="GI:504107770"
                     /translation="MSVIQSLIKQAFGTGNSNEAATFLASACNRMKAMDKTTIAREVE
                     SALRGVSFSRTESDKAKVKTVYKDTAVTLEKLASLEKQVRSLTNELAVARNQTRDTED
                     AERMKGELLRLNTRISELLRESDIQRKQHVDELALLRSRQRAAGNSTSAELDAANSLI
                     AYTGSQMAAMAAARDTLQQRLTRLETETEHRLREEEDKRHAANRRADGNYALLGQQKE
                     LTAEANRKITQLRASLKLEEYEGQNAKNEKAKLKKQIAGLEDENSRLAERLRDNEEDC
                     ERLSNALERTNQELVAYKTQKERLTRWIHVPGAMMGVSVVALVLYSDAQPGHLFDSLA
                     PAVFLGCVVYALSLMIAFTRRA"
     gene            complement(185456..186214)
                     /locus_tag="RAHAQ2_RS22880"
                     /old_locus_tag="Rahaq2_4746"
     CDS             complement(185456..186214)
                     /locus_tag="RAHAQ2_RS22880"
                     /old_locus_tag="Rahaq2_4746"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014341757.1"
                     /db_xref="GI:504107771"
                     /translation="MRLRLVSTLLFAATAAFGSQAATAAPVKNIVLVHGAFVGGSGWR
                     PVYDILTHDGYKVTLVQEPLTSFTDDVAATKRILAMQDGPAILVGHSYGGAIITEAGN
                     DPHVAGLVYIAAHALDNGETEAINGKKFPNSAHPFVKTPDGFLYINPANFPSDFAADL
                     PRKQAEFEAQAQMLTSASVFTANIPDPAWKVKPSWYMVAKSDKIINPDLERMYAKRAH
                     SHTVEIAGASHSVYESHPKEVAALIEQAATGAVK"
     gene            187004..189157
                     /locus_tag="RAHAQ2_RS22885"
                     /old_locus_tag="Rahaq2_4747"
     CDS             187004..189157
                     /locus_tag="RAHAQ2_RS22885"
                     /old_locus_tag="Rahaq2_4747"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_014341758.1"
                     /db_xref="GI:504107772"
                     /translation="MNAKTSAFIITFLSFLNPVSVSYAQSATATPKGETDDASDASTM
                     MVIKQAGTGELSELDTPAAVSVIDGEDFRNSKAQVNLSESLGSVPGLQVQNRQNYAQD
                     LQLSVRGFGSRSMYGVRGVRIYVDGIPATMPDGQGQTSNIDLNSVERVEVLRGPFSAL
                     YGNASGGVVNVDTQTGSQPASLEAGTYFGSYGSFRNSVKASGATGDGTHAGDVNYLIS
                     GSRFTTDGYRDHSGTQKNLGNGKLGVRIDDASTLTLMFNSVSVDANDPGGLTESEWHD
                     DPKQARRADQYNARKSLDQTQVGLRYQRQMGENDEFSLMTYHGERHTTQYQTIPATSQ
                     KNPLNAGGVIVLERKYSGVDTRWKHDDQIGSVPFSVTGGLDYETMTERRFGYENFNSE
                     GDLGVKGDERRNEKNVMWNLDPYLQTTWNLTSRWTLDAGARYSTVSFDSQDYYITGSN
                     PDDSGSRRYHKLLPMASLNYAVTPALNTYISAGRGFETPTINELSYRTDGKSGLNLGL
                     EPSTSTTVELGSKWRVGNGLVTAAVFQTDTDDELIVAQSTGGRSSYTNAGKTRRRGLE
                     LSLDQQIEENWRVKMAWTLLDATFRNETCGAGDCTPAGNRLPGIARNMGYASLEWAPV
                     EGWHAGADIRYMSDIEVNDENSEQAPAYTVASVNAGYRFNWNNVTLDLFTRVDNLFDR
                     NYVGSVIVNEGNGRYFEPAPGRNYGGGATLSYSFE"
     gene            189324..191723
                     /locus_tag="RAHAQ2_RS22890"
                     /old_locus_tag="Rahaq2_4748"
     CDS             189324..191723
                     /locus_tag="RAHAQ2_RS22890"
                     /old_locus_tag="Rahaq2_4748"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341759.1"
                     /note="quinoprotein glucose dehydrogenase; catalyzes the
                     formation of D-glucono-1,5-lactone from D-glucose and
                     ubiquinone; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose dehydrogenase"
                     /protein_id="WP_014341759.1"
                     /db_xref="GI:504107773"
                     /translation="METKASLSRIVVIITALFAALSGIYLLAGGIWLAKLGGSLYYII
                     AGVISLVTAWLLYRRRSSALLLYAIFLFGTTVWAVWEVGTDFWALTPRLDVTFFLGLW
                     ILLPVVYNQMLAKNAFARGALAVSLLFTVIVLGYAIFNDPQVINGTIKAADSAPAKSE
                     SGIPDGDWPAYGRTQGGTRYSPLNQINDKNVSKLDVAWTFRTGDLKTPNDPGEITDEV
                     TPIKIGDMLYLCTPHQKLFALDAATGKEKWKFDPELKPNPTFQHVTCRGVSYHETTPA
                     AEGNATNGAAPAVCSRRIILPVNDGRLFALDAETGARCPAFGNNGELNLQGNMPYATP
                     GHYEPTSPPIITKSVIIVAGAVTDNYSNREPSGVIRGFDVETGKLLWAFDPGAAEPNK
                     IPEDGQHFTPNSPNSWAPAAYDDKLDLVYLPIGVATPDIWGGNRTPEMERFASGLLAL
                     NATTGKLAWFYQTVHHDLWDMDVPAQPTLADITDKSGNKVPAIYVPTKTGNIFVLDRR
                     DGKLIVDAPEKPVPQGAAKGDHVSPTQPFSKLTFRPEAKLTGKDMWGATIYDQLMCRV
                     IFHKLRYEGTFTPPSEQGTLVFPGNLGMFEWGGISVDTDRQVAIANPIALPFVSKLIP
                     RGPGNPIEPDANDKGGSGTETGIQPQYGVPFGVTLNPFLSPLGFPCKQPAWGYISGVD
                     LKTNDIVWKKRIGTVRDSSPLPLPFKMGMPMLGAPVSTAGNVFFIAATADNYLRAFNM
                     SNGDKLWEARLPAGGQATPMTYSVNGKQYVVIAAGGHGSFGTKLGDYIIAYALPDADA
                     K"
     gene            complement(191805..192155)
                     /locus_tag="RAHAQ2_RS22895"
                     /old_locus_tag="Rahaq2_4749"
     CDS             complement(191805..192155)
                     /locus_tag="RAHAQ2_RS22895"
                     /old_locus_tag="Rahaq2_4749"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SH3 domain-containing protein"
                     /protein_id="WP_014341760.1"
                     /db_xref="GI:504107774"
                     /translation="MNSLAKVIKEHRSSYPNPITLRENEIVMISHCDLEWRGWIWIRQ
                     SSGNAGWAPQQIFTLSAPDRGICTENYTAYELSVAPGEVLTLEKKLNGWFWACNKSGE
                     SGWVPEENLMNISK"
     gene            complement(192197..192655)
                     /locus_tag="RAHAQ2_RS22900"
                     /old_locus_tag="Rahaq2_4750"
     CDS             complement(192197..192655)
                     /locus_tag="RAHAQ2_RS22900"
                     /old_locus_tag="Rahaq2_4750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
                     N-acyltransferase"
                     /protein_id="WP_014341761.1"
                     /db_xref="GI:504107775"
                     /translation="MHHASRNVQIRNVKAGQNVVIYEPANVYDCTLHDDVFVGPFVEI
                     QANTSIGRGTKIQSHTFICEYVTVGENCFIGHGVMFANDMFKTGRPDAERNSWARIHV
                     GNDVSIGSGATILGVTICDGTVIGAGSVVTKDITIKGIYAGNPARWLRTL"
     gene            192870..193232
                     /locus_tag="RAHAQ2_RS22905"
                     /old_locus_tag="Rahaq2_4751"
     CDS             192870..193232
                     /locus_tag="RAHAQ2_RS22905"
                     /old_locus_tag="Rahaq2_4751"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341762.1"
                     /db_xref="GI:504107776"
                     /translation="MEIKTVCDAVSESACGLSIGAVWQHISVECAHIPDNDAFRVEVF
                     FTLLERLMNEGKIRLASGGEYLGGTHGQQLQQLKDAWPRGNSEDEFDDLDDTGYWFLA
                     RSPAGIVWIMPDGREIWT"
     gene            complement(193239..193883)
                     /locus_tag="RAHAQ2_RS22910"
                     /old_locus_tag="Rahaq2_4752"
     CDS             complement(193239..193883)
                     /locus_tag="RAHAQ2_RS22910"
                     /old_locus_tag="Rahaq2_4752"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341763.1"
                     /db_xref="GI:504107777"
                     /translation="MPRTTSLVSLSALIASVFLLTGCPPPPDLTQWQRPDSTIDDARV
                     AMGQCGVPLPGPEPDFTANETVLYYQCMEGKGFTYKHDFHICDVHKNTPACIEKQQGH
                     PLSQRQLEALPFVADEGFHPIKPDSGRDESQLISWRKTGASLHFSHAVENDKLALQVM
                     YDCGYPKPLGSVPFVPTILKAAKVQQCMLDKGFEPKHKLSLVCRNYPQVTGCKK"
     gene            194021..194401
                     /locus_tag="RAHAQ2_RS22915"
                     /old_locus_tag="Rahaq2_4753"
     CDS             194021..194401
                     /locus_tag="RAHAQ2_RS22915"
                     /old_locus_tag="Rahaq2_4753"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341764.1"
                     /db_xref="GI:504107778"
                     /translation="MTVVLDEIKALECSLHGVRRKDKLWLEKVLHADFREITRSGVMV
                     DRQQTVAALTAETQDLRLEAEGFQLQTLNESCVILTYKTFLNRGNENRRYTLRASCWT
                     NAGGTGWQMIFHQGTPAAETLTCG"
     gene            complement(194679..196097)
                     /locus_tag="RAHAQ2_RS22920"
                     /old_locus_tag="Rahaq2_4755"
     CDS             complement(194679..196097)
                     /locus_tag="RAHAQ2_RS22920"
                     /old_locus_tag="Rahaq2_4755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014341766.1"
                     /db_xref="GI:504107780"
                     /translation="MELFSDKPGDEGLPGRERGFAMAAVMIMATMAVFDGSMVNIALP
                     QIAQALDISAGAAVWVSNGYLLSASMTLAIFAALASHIGFRRLFAAGLTVFTLASLGC
                     ALSSSLDMLIIMRVLQGIGAAATLSIGPAILRSVFPNRLLGRILGLNALMIATSTAVA
                     PVLGGTILSAMSWQWLFAINIPLGIIAVVLTLRVVPSNPASTRQPFDTAGAILSAVAL
                     GALIMAAESFARPGNDELATAITYGLTAIIAGVAFVWRQRRAPKPLLPLGMFASARFT
                     LAAFTSLASFVSQGITFVALPFLFQSVYGYSAFVSALLFTPWPLGIILAAPHAGRLAD
                     RYPAAIISTVGLAVFAVGLLLLAQLPAHPQVWDIGLRSFICGLGFGCFQSPNNREMLS
                     NASRENSGYASGVLAIMRTFGQCLGAACVGVILTIYSARSVLQEAQAVQVSLWVAVIA
                     TVVAMLISLSRLRNPATHLQNG"
     gene            196232..197137
                     /locus_tag="RAHAQ2_RS22925"
                     /old_locus_tag="Rahaq2_4756"
     CDS             196232..197137
                     /locus_tag="RAHAQ2_RS22925"
                     /old_locus_tag="Rahaq2_4756"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014341767.1"
                     /db_xref="GI:504107781"
                     /translation="MTEPDLNLLIALDVLLAEGSVAGAARRLGLSASAMSRTLSRLRA
                     TTGDPLLVRAGRNMVLTPYAEEIRQRTRNVAFEARALLRPSSADFNLARLERTFLIRS
                     NDGFVVAFGAAMIAAAAQVAPCVCLRFMPKPEKTSNALREGRVDLEIGVLGEMGPEIR
                     LQTLFRDRFMGVVRKGHPLALKKAITAEDYVSFGHVVVSRRNNTYGPVDDALAEVGLK
                     RKIAAVVPGFSAALAIAQNSDLVALIPGSFLIAEPDRLYAFELPLKTREITISQMWHP
                     RSEVDPAHRWLRQLVLKVCRDEVPL"
     gene            complement(197141..197803)
                     /locus_tag="RAHAQ2_RS22930"
                     /old_locus_tag="Rahaq2_4757"
     CDS             complement(197141..197803)
                     /locus_tag="RAHAQ2_RS22930"
                     /old_locus_tag="Rahaq2_4757"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341768.1"
                     /note="3'-5' exonuclease activity on single or
                     double-strand DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease X"
                     /protein_id="WP_014341768.1"
                     /db_xref="GI:504107782"
                     /translation="MLRVIDTETCGLQGGVVEVASVDIEDGKIVNPMSDLVRPDRPIS
                     HQAMAIHKITEAMVADKPWIEEIIARYHGSQYYVAHNASFDQRMLPEMQGEWICTVKL
                     SRRLWPGIKYSNMALYKSLKLEVATPADLHHHRALFDCYITAALLIRIMDESGWTPEE
                     MVTITGRPALVSTMMFGKYRGRKIAEIAEDDPMYLRWMLNNIKELTPDLRMTLKHYLE
                     VP"
     gene            198191..199345
                     /locus_tag="RAHAQ2_RS22935"
                     /old_locus_tag="Rahaq2_4758"
     CDS             198191..199345
                     /locus_tag="RAHAQ2_RS22935"
                     /old_locus_tag="Rahaq2_4758"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase"
                     /protein_id="WP_014341769.1"
                     /db_xref="GI:504107783"
                     /translation="MKISSVEVSVFTYPTRRVSDSAGHSHPGEESQAKMAMLTLTTDE
                     GDCGYSFAPPEVVRPHVVNAFFRKVLIGQNPFDRERLWQDLVHWQRGSAHQLTERALS
                     FVEQALWDLIGRKLNMPVHKLLGGFREKVPAYGSTMCGDELKGGLSTPDEFGQFAEKL
                     VARGYQAIKLHTWMPPVAFAPDPKMDIKACAAVREAVGPDIELMLDGYHWYSRSQALT
                     IGKALEKLNFAWFEEPMEEESMASYAWLAENLSIDVIGPESLGGKHHSRADWVKAGAC
                     DILRAGANGVGGISPCMKVASLAEAFGMDCEVHGNGAASLAVVGAIRNCRWYERGLLH
                     PFLEYDEPAAYLNSIVDPMDEQGFVHLSDRPGLGEDINFDYIETHTVSRD"
     gene            199397..201040
                     /locus_tag="RAHAQ2_RS22940"
                     /old_locus_tag="Rahaq2_4759"
     CDS             199397..201040
                     /locus_tag="RAHAQ2_RS22940"
                     /old_locus_tag="Rahaq2_4759"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014341770.1"
                     /db_xref="GI:504107784"
                     /translation="MNSGKPWGAWLFALLLMTAGWTAQAKTPPDQLIIGMNMNNLLTL
                     DPAAMTGNDIVGIVVNLYDPLIELDPQQLTNVRPALATSWEVNDARNLITFHLREGVK
                     FHSGNPVTAEDVVWSMRRILHLNLAQASVWKSYGFSKKNVDEMVRAPDPYTVEIQLPK
                     PNDPKLVIYSLAALGSVVALDSKIVQAHEVNGDWGNRWLTTNEAGSGPFRLDNWQAKD
                     VLNMSRNPQYWRGEPKLSRVVFRHFQESQTLRLMIEKGDLDIANNMAVSDVKALSHDP
                     AMQVDQVKKGTIYYVAMSMKEPHFANPKVREAVRYLIDYQGIGKALMNGYGIAHQRPI
                     QVGMPATLPDPGYKLDIPRAKTLLAEAGYPDGFDTTLRVLADQPFLNIAIAVQSTLMQ
                     AGIRAKIVTGTGNQIYGAMRERKFDMLVGRGGSGVEPHPHSSLRALVYNPDNNDAARL
                     TNFQGWRTGFYDKQLNADIDQALLERDPEKQKQDYFAIQERYDALIPALVPLSQMVDS
                     IVVRRDVKNYLPHPSATTFLRDVWKDEPADVQPTGGKGL"
     gene            201082..202098
                     /locus_tag="RAHAQ2_RS22945"
                     /old_locus_tag="Rahaq2_4760"
     CDS             201082..202098
                     /locus_tag="RAHAQ2_RS22945"
                     /old_locus_tag="Rahaq2_4760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_049796167.1"
                     /db_xref="GI:908659717"
                     /translation="MSFPAGRIGKRLVQVAVTLFGLLLLTFFIGRVMPVDPVLAIVGP
                     DADHSTYEQVYHQLGFDKPLWTQFGIYLSGLAHGDLGNALLTGKPVTQDILRVFPATM
                     ELATLAIILGAGVGIPLGVLAAAKRNSLADYGVRIISLAGYSTPIFWVGMMGLLVFYA
                     WLGWVGGAGRVDFSLDGQVTRHSGFMLIDALIAGNGEVFRNALNHLILPASLLGFHSL
                     AYISRMTRSFMLAQLSQEFIITARVKGLSEWQVLWNHAFRNILVQLLTVVALAYGSLL
                     EGAVLIETVFSWPGFGSYLTSSLMLGDMNAVMGCVLVVGMIFVVLNLLSDLLYQVFDP
                     RTKV"
     gene            202095..203000
                     /locus_tag="RAHAQ2_RS22950"
                     /old_locus_tag="Rahaq2_4761"
     CDS             202095..203000
                     /locus_tag="RAHAQ2_RS22950"
                     /old_locus_tag="Rahaq2_4761"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C550"
                     /protein_id="WP_014341772.1"
                     /db_xref="GI:504107786"
                     /translation="MTISLDSVPLSAGDEKRQRVKRAVGRVGHFLWQMACNPLTAIGG
                     AIVLVLMIVAVFAPWIAPFHPLVQDLNNALSPPSAAHWFGTDEFGRDIFSRLVYGSRI
                     TLYIVLLVSVTVGPLGLLLGVTAGYFGGKTDMVLMRVTDIFISFPSLVLALAFVAALG
                     PGLEHVVIAITLTAWPPIARLARAETLSLRQADFISAVRLQGASPVRVLWRHIVPLCL
                     PSVIIRITMNMAGIILTAAGLGFLGLGAQPPDPEWGAMISSGRTYMMECWWVATIPGL
                     AILINSLAFNFLGDGLRDILDPRND"
     gene            202972..203838
                     /locus_tag="RAHAQ2_RS22955"
                     /old_locus_tag="Rahaq2_4762"
     CDS             202972..203838
                     /locus_tag="RAHAQ2_RS22955"
                     /old_locus_tag="Rahaq2_4762"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_014341773.1"
                     /db_xref="GI:504107787"
                     /translation="MTFSIPEMTDAPALLDVQDLHVSFVNGRQVTQAVRGVSFQLGRE
                     KLAIVGESGSGKSTVGRALLHLHPSKARITASKMQFADVDLLHASPAQMRQVRGKRIS
                     MIMQDPKYSLNPVLCVGDQIAEAWRSHHKCSYNDAKSKVLNMLDVVRIRDPERVYGLY
                     PHEISGGQGQRIMIAMMLITDPEMVIADEPTSALDVSVRLQVLALLDDLVKTRGLGLI
                     FISHDINLVRSFCDRVLVMYAGRIVESIAATDLDNAQHPYTRGLLNALPDMDNRRYPL
                     PVMQRQASWLTD"
     gene            203863..204633
                     /locus_tag="RAHAQ2_RS22960"
                     /old_locus_tag="Rahaq2_4763"
     CDS             203863..204633
                     /locus_tag="RAHAQ2_RS22960"
                     /old_locus_tag="Rahaq2_4763"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_037041085.1"
                     /db_xref="GI:739177133"
                     /translation="MIDVRNLNLTFGEGAKNTQVLTDVNIAVREGEIFGLVGESGSGK
                     TTVLKCLAGLFTHWQGELEIDGQQLEHRIGRERCRLVQMVFQDPYGSLHPRHTIGDIL
                     EEPLQIHRIDQREQRINTILEKVGLNRAFRSRYPHQLSGGQRQRVAIARALILKPRVL
                     LLDEPTSALDVSVQAEILNLLFDLQKEEGLTYLMVTHDLGVIAHLCQRVAVMKYGKIL
                     ETLDTDALLRGDIHDDYTRTLVDASRDYSREMAAKVML"
     gene            205077..205328
                     /locus_tag="RAHAQ2_RS22965"
                     /old_locus_tag="Rahaq2_4764"
     CDS             205077..205328
                     /locus_tag="RAHAQ2_RS22965"
                     /old_locus_tag="Rahaq2_4764"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341775.1"
                     /db_xref="GI:504107789"
                     /translation="MKLLNNIYEYRDWMIKDYLHLDDTFPSVFEPDEIEIDILRQAPK
                     EFPCLVQLVEDESGNYPQFFQFIYRSQVEEWARLFGIVR"
     gene            complement(205434..206525)
                     /locus_tag="RAHAQ2_RS22970"
                     /old_locus_tag="Rahaq2_4766"
     CDS             complement(205434..206525)
                     /locus_tag="RAHAQ2_RS22970"
                     /old_locus_tag="Rahaq2_4766"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341777.1"
                     /db_xref="GI:504107791"
                     /translation="MAGTPPDAGVVLMMPDDFDDDAKKKENVLKEFWRDKDGNDRAYA
                     FNFYRFCQLLEKQLSDNKPIGSTFSPKNDAVRFRPHPGMGFPVSELKAVETREECPDT
                     PPTVRATFMGLYGVDSPLPTGYIDDIAQRREGHEALEAFLDIFNHRMMTQFYRIWRKY
                     NYPATFEDGGTDKTSRSLMALTGITGSGDVPASRLLALLQPLVRTTRTAEGIVSVIRS
                     QAPNTQVTVKPHKVTRMAAGKRARFSFSEQQRLSDHLVLGSHTEDANYCIGVEMFTED
                     AAEAKGWLPGGQLREDVFTLLRVYLGCDYDASLTLTIPMKLAPLPRLGDPRLMAGYNV
                     VMGLREDNLDKMPKEVTMKLGRIRNERRC"
     gene            complement(206489..208264)
                     /locus_tag="RAHAQ2_RS22975"
                     /old_locus_tag="Rahaq2_4767"
     CDS             complement(206489..208264)
                     /locus_tag="RAHAQ2_RS22975"
                     /old_locus_tag="Rahaq2_4767"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341778.1"
                     /db_xref="GI:504107792"
                     /translation="MEDDFLKYFDGEMRYLKEAGLEFAKEFPELGRALGLDGSPVPRD
                     DSVERLFQGFSLMMAKLRQKIDDDIPELTEPLLSHLLPVINRTLPSTAIVELTPAAPA
                     LHIREEILPAESELLTRPPGNDNQRCAYRTTRDLKVHPFALDNVSLFTLQEGQQALKL
                     RFTLPALTEIRRADWQNISLYLNGDRVLQSALYLALSRQIKRVNVRFWQESTVLTPVD
                     VQFVPRWQAENDASIWPESDSPALCGEVRPWLEYFTSPERYFFMQLRGLETLTFPADT
                     TAFDIEVTLSERWPYDLAVPPDAIRMHCVPVINLFRLLAQPLSVTAAVSDYRLRPHRL
                     SDGRTEIYAVNDVAEVTEDNTEFSYVPYSQFREKGGMLQYAKNWPDRYYHTRMYRGTS
                     GLNETILMLGGRTHEAQNGLKMRLNMTCTNGAWPRMALQESVFDGETALGNLELKCAT
                     RKRPSMPYYPPAAELYQWQVLSLLHPQAIAGLMEIGTLRHALSLLDWTHDPENARRIA
                     GITHVEYAPSHYPAEGWHGVAIRVTLDEHQFCGLGDALLFCEVLEQFYTQYADIRRFI
                     QLTVTLSQSGTQWAWPERRLTRVLF"
     gene            complement(208264..208797)
                     /locus_tag="RAHAQ2_RS22980"
                     /old_locus_tag="Rahaq2_4768"
     CDS             complement(208264..208797)
                     /locus_tag="RAHAQ2_RS22980"
                     /old_locus_tag="Rahaq2_4768"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341779.1"
                     /db_xref="GI:504107793"
                     /translation="MTPDNFQRVRRGTVLFLLPLLISSCGLTQRVGNGASAVADAVLY
                     RKIDTLHLKLTSRAALNSNEGGEALPTVVRVYQLKDRKTFDTASYAALLRQDNTVLAA
                     DLLDRQVVQVMPDAEATVAVPLHADAQFVAVVALFMAPDVTNNTWRLVLERSDLDDSK
                     DQIVELNDNRLQLRKSQ"
     gene            complement(208784..212152)
                     /locus_tag="RAHAQ2_RS22985"
                     /old_locus_tag="Rahaq2_4769"
     CDS             complement(208784..212152)
                     /locus_tag="RAHAQ2_RS22985"
                     /old_locus_tag="Rahaq2_4769"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein VasK"
                     /protein_id="WP_014341780.1"
                     /db_xref="GI:504107794"
                     /translation="MTKSLHLMLVVMLALALSVLWLSVDGETLTHGVAWWATGVILLS
                     YFLLARYAFALELLDFNRPPETQDDARITAFDTLRFTLRHRYDWHWKHKQPWLLVTGE
                     AAVVEKIAPGLTQARWQESQNAVLIWCGEADALDLAAVTQLRDMRGRRAFNAVLWVTD
                     VTAEPQYLWTTQPVPNQTLPAGNSDTVYRQFIALGHTLSWRPPVFGVCLSEPQWEQDD
                     RPVQSIGCHWPAGTPVSLDDQLSQLAATLIPQGIAQLNENKHWAWLLQLSGDLKHHTG
                     ALLRQRFQPWLGENQRVLAGGIFFMPAAPESASVQQRSHACYLSPAWNGVIAQSRMQQ
                     GRRDHLSTGDRLAIGTLTLAGLWVLGMGISACANRALIADSQALLQAARTPAPMSDTL
                     TRSVALQDNIDRLLWWQQNGSPWLHRFGLDQRDAVIEALWPAYTRQSQALLITPMVNA
                     LKDRLQAFVSLPPGSAERRLAGKLAYQQLKAYLMLMHPEHADPAFMQPVLSPLWTVPD
                     GVAPGEWLARSDKLLAFYLQQLPRHPQWKLPADDTLVANVRTILRSQKGISNSENALY
                     QQVLLSVSPHYADVTLDSLLGEFAGGQLFSTDDTLPGMFTREAWEGEVSDAIDKAAAA
                     RHVTSDWVLDDKGEQQLLTKDPLQYRLTERYFADYTSAWLNFLNSIRWNTSDSLSTSL
                     DQLTRLADARQSPLLALSRTLRYQGAAGQHREAMGDSLLKSAQKLVSKTTPDAGFAGG
                     RNDPTRVLSETFAPLLAVLPPETPAAGETQTVQNTAVVSVSNYLLQVSQTRLQLMQVA
                     NASDPQAMAQNLVRSAFSNGDTTLSQGRHYAQLLAASLGGEWSSFADAAFVQPLEQAW
                     NGVMTPAQQGINSAWQVQVQNPWQAEFTGRYPFDNTKNDADFTQLAHYLTPDTGLIDQ
                     FITRQLAGVLEKQGDSWVPDPLNTQGMSINPDFLSAVNQLSQLGRRVFPQGKPGVTFE
                     LQIRPTRNVVETDLQIDDATLKYFNQLPGWQTFRWPDAASDHPQVSLTYSPVAASGKS
                     ADAFQSYFQADGGWAWLRLLDKAQVEQLDSSRYRLSWQTATRETLNVVLRTQSGGGPL
                     ELLTLRRFTLPAQIFTSPGLATDNAEDTTHHDAR"
     gene            complement(212145..213557)
                     /locus_tag="RAHAQ2_RS22990"
                     /old_locus_tag="Rahaq2_4770"
     CDS             complement(212145..213557)
                     /locus_tag="RAHAQ2_RS22990"
                     /old_locus_tag="Rahaq2_4770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341781.1"
                     /db_xref="GI:504107795"
                     /translation="MNWHLPQMARNALPKLPGWWWWLAVPAACIALAAIALFFTWPVQ
                     RGFTNLRFWFWLLLLPVLVSSAVMAFVLSAALQVRRETDWRHLFIDRKYAHWQHWGRR
                     SLRLVAFHCLTPETDIASRELGLEGQPPQAPAKPAEIIPVQPLQLGESPLKDILSQTL
                     EPLSETLRAQSSIEIWLYANTPEEQATNAVEQYWSAKLKKRLPTENIHWQSIAQDAAL
                     LDSWCDEDISVPRLVIALHLLDGKSQASASSSALLFQRSSGPVIKAPPFRPVYLFRPL
                     VTQSHDLDADFPRFLAASQTGAKRLSHLWDAGLHSRERGALLAMLDEHDVMLPAQGRH
                     DLSLLLGPASPASFWLALCLAAQGCDLGQRGQLVAAQSEESISLVQLSTQPAAPVDMP
                     VDTISRYPLAYLAGIVAVMLALILLPADRDTQSGMLPWLGGGLVVVAALLSFSVPLAL
                     RLWRKRLDVEWHLLEQQRHD"
     gene            complement(213557..213811)
                     /locus_tag="RAHAQ2_RS22995"
                     /old_locus_tag="Rahaq2_4771"
     CDS             complement(213557..213811)
                     /locus_tag="RAHAQ2_RS22995"
                     /old_locus_tag="Rahaq2_4771"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341782.1"
                     /db_xref="GI:504107796"
                     /translation="MKGVIRLGDPHTHGGNVSSASGALFEGKPVMLAGDTVSCSQHGT
                     VPVNQGHPTWKMNGKAVIVDGCVAQCGCTLKTTLPNAGAQ"
     gene            complement(213880..214626)
                     /locus_tag="RAHAQ2_RS23000"
                     /old_locus_tag="Rahaq2_4772"
     CDS             complement(213880..214626)
                     /locus_tag="RAHAQ2_RS23000"
                     /old_locus_tag="Rahaq2_4772"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341783.1"
                     /db_xref="GI:504107797"
                     /translation="MILIQRIGIGLMAGLISACQAAPQSPPTQVVYRFDDHRYLELTG
                     FNCQGGLRYIDTQRGIQHQIYDVSTGYRIFTKKFVHPSERYIAITSYEGGGFAISKDY
                     GRTWDGASFSPGGGAVRYKDDHPQREEIESLTVVHDQGFMLTKAGDIYMSSKPFDDPR
                     LEPGGSGIDYTITTKRGLVQDHHIAPGYGGGKWGENYLSWNSVQGPKPWSILAYKTNF
                     QGIPNKVPAVKNYSGWDHMRCDPNLGITSK"
     repeat_region   214325..214575
     gene            complement(214623..215369)
                     /locus_tag="RAHAQ2_RS23005"
                     /old_locus_tag="Rahaq2_4773"
     CDS             complement(214623..215369)
                     /locus_tag="RAHAQ2_RS23005"
                     /old_locus_tag="Rahaq2_4773"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341784.1"
                     /db_xref="GI:504107798"
                     /translation="MQTLKMAGVLILVINIGACQATPQSPPTQVVYRFDDHRYLELTG
                     FNCQGGLRYIDTQRGIQHQIYDVSDGYRIFTKKFVHPSERYIAITSYEGGGFAISKDY
                     GQTWDGARFSPGGGAIRYKGSNPTREEIESFTVVNDQGFMLTKAGDIYMSSKPFDDPR
                     LEPGGSGIDYSFTTKRGVLQTNHMRPGYGGGKWGTEYSSWNSFAGPNHWTTDTYRRNF
                     QGIPNKVPEVKNYTGWDHMRCDPNLGLASK"
     repeat_region   215068..215318
     gene            complement(215382..217499)
                     /locus_tag="RAHAQ2_RS23010"
                     /old_locus_tag="Rahaq2_4774"
     CDS             complement(215382..217499)
                     /locus_tag="RAHAQ2_RS23010"
                     /old_locus_tag="Rahaq2_4774"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341785.1"
                     /db_xref="GI:504107799"
                     /translation="MADSCSNIRNPKLLSEGDICRPVTSGKALIQECGVQPPLPCIVI
                     LVHGVNDVGEAYENQDVGICAGLNTRLGRTDMHHHEWKQHDFMISDADGNITTETCAV
                     QDQTCVGVVNRSPVIPFYWGYKPVDHDAFVQDQKRYKSELLKKGNDADLPYDTYREND
                     TKKLKAHNNAKIDNLNNWLDPLSAKGGGTFANATTNIPDMFGPGAAGPILAMIGKLMS
                     RTETFNLNNKDWSHPIYQNPHRIYQAYAARRLADLILDIRRNQDTQSDTINIVAHSQG
                     TIITMLANMWVEAEGYPTADCVILNHSPYALENRWLENFMPGNQQTSDARQKTFAHFC
                     KLMAKNPNAPQGTLSHDSAYIQKIMDTGCLAKKAKETIWESALYNRNNFGRVYNYFCP
                     NDQVVSMSPIQGFGWRGIPDKIKAQLGDNLYQRVFCKDVWVGDKTGFHYTMPPRQADD
                     SKDTGYSFTDVTINAPVLPEPFQFALMAQGKDNYKAKMAGNDPEIAKAAMKAEKFIPE
                     TVDVPNSPLFYGMRSNGSVLSPEQLEELNATYAPKKFVSGIVSGHRDSFQQLILQREM
                     TNDELTAAVQMDVSYSQHSSIVASDKTPSHAMVYDLAIGQCEAFENQEFWERLLLQAD
                     WRRPENPEPKIKQYYIEGILPYEDIKQFMNKPELDKGMPIGEEFGVKNDYGSRQMVKP
                     GNHRNMENTTVQLLQWDMPKPQV"
     gene            complement(217499..220009)
                     /locus_tag="RAHAQ2_RS23015"
                     /old_locus_tag="Rahaq2_4775"
     CDS             complement(217499..220009)
                     /locus_tag="RAHAQ2_RS23015"
                     /old_locus_tag="Rahaq2_4775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
                     /protein_id="WP_014341786.1"
                     /db_xref="GI:504107800"
                     /translation="MGIQEYILAGSKLPVHNHYQLRLTRLESQQPGVDISVLRFSGSE
                     AISDILRYEIEFTSAVKDIPAQHIINYSALFLMYPDGKPWKSVKPRIIPGVITRFRQC
                     GTSADETRYVATLEHRVTRLNQGSNNAIYQNDSVISMTENTFLRYNMDRLDFRFALHD
                     RYPLKKFMMQFGESEYAHIARRLADSGISYFFEYDEENNCDVMVLADHSYAWPEPVAI
                     PFRNPAGMFDGGLESVWEMSVSRKAIPKSVTVNDDYYPAAQSDMTATATTNPDYPALV
                     AEDYRWGEYYPEPGKEYSSDPGQGMWYAKRRQERYLSEQITFEGKSNCMTLRPGMVIT
                     TPGKDWPEAPDGLLIVSTNSKNVARDTAYFVTFTAVPRNTQHPYRPALLPWPTVTGTL
                     PARISSAHPDEPYAHINADGLYRAQFGFDRTEWQKGFESCWLRLAKPYSGDTCGFHMP
                     LLDSTGVAIAFENGDVDRPYIAYALHDSRHPDHVALPNYKRNIIRTPSGNKIRLEDQR
                     GKEHIKISTVHSGKSQLSLGHLVDSARKQRGEGAELRTDAYVAVRGGKGVLLSTEPKN
                     SAQGQQLDMDAAIAQLEKALALAKTLKSTADIAQASPAETTDQELLKTDLTKLAQPGV
                     VVYGDAGIAHTTPKTIQQTAGKNLVATAGQDASFSVFRRFSVAAGELFSVFANKLGIK
                     LIAAAGKVQLQAQKDQMELTSFEDMQITSTNGRIVLNAKKELLLMCGGAGIRIKDGTI
                     EELAPTRITQKSPVLEYQGGDSVKQAMPTFNQGDFGMKYKLHINGDPSHVLKNQKFRV
                     HRQDGSVSEGITDANGESSLLQMSELENVAIELIKGVK"
     gene            complement(220500..222299)
                     /locus_tag="RAHAQ2_RS23020"
                     /old_locus_tag="Rahaq2_4777"
     CDS             complement(220500..222299)
                     /locus_tag="RAHAQ2_RS23020"
                     /old_locus_tag="Rahaq2_4777"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014341787.1"
                     /db_xref="GI:504107801"
                     /translation="MSESLYCRTCAGVSRLRMSQTGGAGVPLISRLLTLAAIVVLTGL
                     LPWLSGSDPALSLLRARSGEQEATAETLNAIRLTLGLDQGPWHALTHWLGGLPGGDAG
                     VSWVSGLPVLPGMLRATGVSLTLMTASAGVAFLIAVLLCAGTLIRGLQGGTPRPAGFL
                     AALLTALPEFLLASVLLITGAVWLKFFPPYGWAGWHYAVLPALALGIPAGGYLGRLYS
                     DALSGAFNESWLTTWSVLGISRRHIALAIIRRTLPGVMPLTGLVLVSLTGGAIAVEKV
                     FAIPGLGRATLGAAAAGDLPALQTGVLILLLLASALGMLTGGIRRILLGRALSLGAMP
                     VPQPVALPEKQRAWLPLLCLSILVVMVFAGLPRDPLTSAYLRLQPPSFALPFGADAMG
                     RDLLARVAHGTLNTCLQALAVSLICLLAGMTAGAFPRAMTGPIEVTNALPPVIAGLVI
                     AAINGPTATGAVIAVTVVSWAPLAAHTAALVAEIRARPYIQMLAVMGVGTLRRHVFYV
                     FPALAGPLLRHALLRLPGIALALASLGFLGLGAPPPAPEWGRVLAEGMPYIERAPWSV
                     LAPAGALALLSVLAVTMSSLRWKNRVRQPGTLH"
     gene            complement(222299..223807)
                     /locus_tag="RAHAQ2_RS23025"
                     /old_locus_tag="Rahaq2_4778"
     CDS             complement(222299..223807)
                     /locus_tag="RAHAQ2_RS23025"
                     /old_locus_tag="Rahaq2_4778"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014341788.1"
                     /db_xref="GI:504107802"
                     /translation="MSVKHVSPLAGLLSAALLLTGCFGEADKNPGKTADQRLRLAMLQ
                     PPRSGLTPLSDDAFKLSRWSTTETLVTLDKLGEAQPALATKWQQTGDNSWRFELRHGV
                     RFHDGSLLDAATVVNALTVAAHAAPKPRILDGVQLTAVADGEQAVMVTTAQPDPLLPQ
                     RLSSPQLAILSQKAYSTSGVVDPRHAGSGPFELVQVNGTSSARLERFGGYWGEKAKAS
                     GIDVSFVPDGTARGAALRTGAADIVEAIPVSQAPLLDQTLIHEVPMPRTNTLYLNTRL
                     GVMQDPALRAAVRDAINRQQLVDNVYEKRADVAQGLLGPALPWAAPLRQPVSQPVTAR
                     KPAGETITLATFSDRAELPEVAVYVAQQLTAAGFTVKQVVREYSQIESDALAGKFDAF
                     ILSRATVLDSGDPVAYLYSDFACKGSFNIAQLCRPDIDQALQKASVIPAGAERRQAIM
                     LAENLILATDAAIPMLHERVIQGELADIRDAVRDPRERTLINAATQRVVQAD"
     gene            complement(223821..225059)
                     /locus_tag="RAHAQ2_RS23030"
                     /old_locus_tag="Rahaq2_4779"
     CDS             complement(223821..225059)
                     /locus_tag="RAHAQ2_RS23030"
                     /old_locus_tag="Rahaq2_4779"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014341789.1"
                     /db_xref="GI:504107803"
                     /translation="MLTRSIAHTSAPKPPLLLASSLVFNIGFYAVVPFLAIFLRDDLL
                     LSGWAIGLVLGLRTFSQQGMFLLGGALSDRYGARVIILLGCVVRIAGFLLLGLSDTLA
                     PVILGACLTGIGGALFSPSIEALLAQAGTHSEKAGKRSRAEWFALSAVCAELGAVLGP
                     LLGSLLSGYGFQPVALAGSGLFLIALLVLFFTLPATPKRAAELKIVPWWQTFRQPRFV
                     AFIIAYSAYLFSYNQLYLALPVELRRSGGSEQDLGPLFVLASVLVIVLQMPLARFSRR
                     LGAARILPAGFGLLSSAFIAVALFAWTVPPEGWLRLLPSVLLITLLTVGQMLIVPVGM
                     DLIPRFAGQHNLGAHYGALSSMGGIAVLTGNFLLGGLLDNALTPSPGAVIPWLALAAV
                     PFLSALAMRRICRQLPPPAI"
     gene            complement(225064..225879)
                     /locus_tag="RAHAQ2_RS23035"
                     /old_locus_tag="Rahaq2_4780"
     CDS             complement(225064..225879)
                     /locus_tag="RAHAQ2_RS23035"
                     /old_locus_tag="Rahaq2_4780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014341790.1"
                     /db_xref="GI:504107804"
                     /translation="MEPSLPRVSGPFLHLQNISRHLALPGSFWRTQRTALFEHLSLRI
                     GRHETLGLVGASGCGKSSLLRILLALEAPDSGDVYCAGVRIRPGSARSLREYRQRVQY
                     IPQDPAGSLPPVHTVYQIIAEPLKRLGFTGDIRLRVSDVMAQVCLSETLLWRVAGELS
                     GGQAQRLAIARALAIGPQFLVADEPVSGLDLPLRGQIKHLLQQVTQQNGMGLLMVTHD
                     MSMVAGLCGRLLVMHGGEIVEDRATQDVLRAPDHTHTRQLLQAIPHLPLTVDG"
     gene            complement(225879..226697)
                     /locus_tag="RAHAQ2_RS23040"
                     /old_locus_tag="Rahaq2_4781"
     CDS             complement(225879..226697)
                     /locus_tag="RAHAQ2_RS23040"
                     /old_locus_tag="Rahaq2_4781"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_014341791.1"
                     /db_xref="GI:504107805"
                     /translation="MTHNRTQNTEPVLAVQGLTVRLAGETRLSGLSFSVGAGERVCLL
                     GASGSGKSLTAKAITGTLPAGATLSGSIRVNGVGVCGRHPVSRCAASRVATVFQDSST
                     ALNPLMTLGKQLRLALPAAREDELRTMLDAVGLGDITQFYARYPAELSGGQRQRLCLA
                     LAMQSASSLLVADEPTTALDVLTQQQVLQVMRNACASPQSPRALLFITHDIAVAAQLC
                     ERALVMENGVLVESAGMAQLLSHPQHPYSQKLVHAARQAAALHQNAASLYGVAI"
     gene            complement(226955..228010)
                     /locus_tag="RAHAQ2_RS23045"
                     /old_locus_tag="Rahaq2_4782"
     CDS             complement(226955..228010)
                     /locus_tag="RAHAQ2_RS23045"
                     /old_locus_tag="Rahaq2_4782"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose operon repressor"
                     /protein_id="WP_014341792.1"
                     /db_xref="GI:504107806"
                     /translation="MSFRITEYGAVKKTKRITISGIAELAGVSKSTASQVLNGHSKKF
                     RISDLTRDRVLAVAAEHHYQPSIHARSLNVTRSFTLGLVVPEMTNYGFAACSNELETL
                     CRENGMQLLIACTDENTSQETMVVNNLIQRQVDGLIVASSMLSDAEYVKISQQVPVVL
                     FDRHIQDTQLPIVVCEAIESSAELVSRIAKTQRDEFYFLGGQPRISPTRDRLAGYQLG
                     LQRAGVSLDPDWILYGNYHPSSGYEMFAQLCARLGRPPKALFVASCGLMEGVLRYMSQ
                     HQLLESDIHLCSFDDHYLYDSLSVKIDTVAQDCRELAMHCFSMISDLMNEQPIEQTQC
                     FLSPKLHWRSPPFSQIK"
     gene            complement(228011..229420)
                     /locus_tag="RAHAQ2_RS23050"
                     /old_locus_tag="Rahaq2_4783"
     CDS             complement(228011..229420)
                     /locus_tag="RAHAQ2_RS23050"
                     /old_locus_tag="Rahaq2_4783"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 32"
                     /protein_id="WP_014341793.1"
                     /db_xref="GI:504107807"
                     /translation="MTETRLLKKALRSVVAGQVRAAADPYRPGWHLAPPVGLLNDPNG
                     FIQHNGRFHLFYQWNPLACAHGAKFWGHWSSADLLHWQHEPVALVPSEEFETHGCYSG
                     SAVTDNGQLTLIYTGNVKYPDGSRTAFQCLARENAEGQFDKAGPVFNLPQGYTGHVRD
                     PKVWWHDKHWYMVLGAQDLSLKGKVLLLRSDNLLAWDLLGEIAGSGLYGLGEFGYMWE
                     CPDLFPLAGHDVLICCPQGLAAGSDRYLNTFQAGYFVGQLDYDKATFAHGDFAELDLG
                     FEFYAPQTTLTDDGRRLLIGWMGIPDGDEFYQPTIQNGWLHTLTCPRELTLVAGKIIQ
                     QPARELQQLRRNVQEWQGVADNAPSPDITKAETEIVTEHAFCADFGGDMTLSRDGECL
                     RLTRKNRRTGLPEHRVWRGRLRKLTVLSDASSLEIFINDGEAVMSSRYFPVLPAQLNL
                     RGSHQITLRHWSLAECVIE"
     gene            complement(229417..230790)
                     /locus_tag="RAHAQ2_RS23055"
                     /old_locus_tag="Rahaq2_4784"
     CDS             complement(229417..230790)
                     /locus_tag="RAHAQ2_RS23055"
                     /old_locus_tag="Rahaq2_4784"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341794.1"
                     /note="phosphoenolpyruvate-dependent sugar
                     phosphotransferase system; catalyzes the phosphorylation
                     of incoming sugar substrates concomitant with their
                     translocation across the cell membrane; IIB is
                     phosphorylated by IIA and then transfers the phosphoryl
                     group to the sugar; IIC forms the translocation channel;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter"
                     /protein_id="WP_014341794.1"
                     /db_xref="GI:504107808"
                     /translation="MNINAIATELLPLLGGKDNIASAAHCATRLRLVLADDSLINKSA
                     IEKVEGVKGCFSNAGQIQIIFGTGLVNKVYAEFIKVAGISESSKSEAADIAARKLNPF
                     QRLARVLSNIFVPIIPAIVASGLLMGLLGMVKTYGWANPESAIFIMLDMFSSAAFIIL
                     PILIGFTAAREFGGNPFLGATLGGILTHPALTNAWGVASGFHTMNFFGIEIAMIGYQG
                     TVFPVLLAVWFMSFIEKRLRKVIPDALDLILTPFLTVIISGFIAFLLIGPAGRVLGDG
                     ISFILSTLITHAGWVAGLVFGGLYSVIVITGIHHSFHAIEAGLLGNPNIGVNFLLPIW
                     SMANVAQGGACLAVYFKTRDAKIKAIAVPSAFSAMLGITEAAIFGINLRFMKPFLAAL
                     AGGALGGAWVVAMHVNMTAVGLTGIPGLAIVQSSSILSYLIGLVIAFGSAFLLSLLLK
                     YNTESEK"
     gene            complement(230866..232446)
                     /locus_tag="RAHAQ2_RS23060"
                     /old_locus_tag="Rahaq2_4785"
     CDS             complement(230866..232446)
                     /locus_tag="RAHAQ2_RS23060"
                     /old_locus_tag="Rahaq2_4785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose porin"
                     /protein_id="WP_014341795.1"
                     /db_xref="GI:504107809"
                     /translation="MMIKPRYLAVAIGLILSGTAQGTDISASAIEARFAALEKRLQVA
                     ENRAAKAERRASEAEQQVKTLEARTASNEQQTRLVAKDVEMTGQKTAEVAKRTETLAA
                     DTTKNSSDNSGFKFTGYARSGVIMNDSATSTESGPYVTPAGQTGGAVGRLGNEKDTYV
                     ELNLEHNQTMASGATSRYKVMLADGQRSYNDWTAATSDLNIRQAFVELGSLPTFSGPW
                     KDSTLWAGKRFDRDNFDIHWLDSDIIFLAGTGGGIYDVKWGENLKSNFSLYGRNFDDL
                     EDNNNDDTRIENYIVTANNYAGPFQWMLSGLRAKNNQDRENTGTSGITNAADTGFHTL
                     LAYHGDSFYGLREGTSKTALLYGHGLGAEVKALGSDGHLTDDASTLRLATYGITPISK
                     NWSIAPAVLAQQSKDRYVSGDDYKWLTFNTRLIQQITENFELAYEGSYQYMDLDPQGY
                     SDYNKVKGGFYKLTFAPTFKVGDISNMLSRPEIRFFATYMDWSKELDSYSSSDSFGTD
                     GFAAGGQWNFGIQMETWF"
     gene            232697..233629
                     /locus_tag="RAHAQ2_RS23065"
                     /old_locus_tag="Rahaq2_4786"
     CDS             232697..233629
                     /locus_tag="RAHAQ2_RS23065"
                     /old_locus_tag="Rahaq2_4786"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoimidazole riboside kinase"
                     /protein_id="WP_014341796.1"
                     /db_xref="GI:504107810"
                     /translation="MNNRVWVLGDAVVDLIAEEDGRLLKCPGGAPANVAVGIRRLGGD
                     SAFIGRVGDDPFGKFLMKTLGDEGVNIDWMYPDPDHRTSTVVVENDADGERTFTFMVR
                     PGADLFLRDTDIPAFDAGDFLHLCSIALSAEPSRSAAFLAMAKMKAAGGYICFDPNIR
                     HDLWPDEGQLRENLARALSLADVIKVSEDELEFLTGEALLSEGVLRLCDVYKPELLLV
                     TQGKQGVSVYRKYNAGLKHYPAPEVKAVDTTGAGDAFVAGLLAGLAQHWPLRSDNVWQ
                     SIIRQALACGSLATTARGAMTALPDSDTLKAFSS"
     gene            233851..236274
                     /locus_tag="RAHAQ2_RS23070"
                     /old_locus_tag="Rahaq2_4787"
     CDS             233851..236274
                     /locus_tag="RAHAQ2_RS23070"
                     /old_locus_tag="Rahaq2_4787"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341797.1"
                     /note="part of a complex with YfgL, YfiO, and NlpB
                     involved in outer membrane protein biosynthesis; involved
                     in the assembly of outer membrane proteins; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor YaeT"
                     /protein_id="WP_014341797.1"
                     /db_xref="GI:504107811"
                     /translation="MTMKKLLLASLLFSSVPVFAAGGFVVKDIHVEGLQRVTVGAALL
                     SIPVRVGDTVSDDDISQTIRALFATGNFDDVKVLEDGNTLIVQVKERPTIASITFSGN
                     KAIKDEMLQQNLEASGIRVGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPR
                     NRVDVKLVFTEGVSAKIQQINIVGNKAFTSDDLIAHFQLRDEVPWWNVIGDKKYEKQK
                     LSGDLETLRSFYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGAKYTVSGVVVTGD
                     MAGHSSEIETLATIPAGEWYNGAKVTTVESDIKNLLGRYGYAYPHVTTQSDINETDKT
                     VKLRISVDTGNRYSVRRIRFEGNDTSKDEVLRREMRQMEGAWLGNDLVQKGKDRLNRT
                     GYFESVDVDTQPVPGSQDQVDVVYKVKERNTGTFNVGVGYGTDSGISYQLGVTQDNWL
                     GSGNTVSFSGTRNSYQTYVEVSATNPYYTVDGISLGGKVFYNHYDAEDNDLAAYNLQS
                     YGTGVNLGLPVSENNTLNLGLDYVHSTLSDMEPQVAVWRYLNASGVQPGLVTTSTSSD
                     AQLSTNDFFASAGWAYNDLNRGFFPSSGTRASLVAKVTTPGSDDSYYKITFDANHYIP
                     LSDKSDWVLMGRAKAGYAAGIGSNEVPFYDNFYAGGSSSVRGFSSNTIGPKAAYYKCS
                     SADNSYSTCPVTKSTDAVGGNAMAIASAELYVPTPFISEKYASSVRTSLFVDSGTVWD
                     TKWKNTSATEAAGIPDYSDPTHIRVSSGIALQWQSPLGPLVFSYAQPLVKYEGDSAEQ
                     FQFNIGKTW"
     gene            complement(236486..236872)
                     /locus_tag="RAHAQ2_RS23075"
                     /old_locus_tag="Rahaq2_4788"
     CDS             complement(236486..236872)
                     /locus_tag="RAHAQ2_RS23075"
                     /old_locus_tag="Rahaq2_4788"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578081.1"
                     /note="this stereospecific enzymes reduces the R isomer of
                     methionine sulfoxide while MsrA reduces the S form; a
                     fusion protein of this enzyme with MsrA and thioredoxin
                     provides protection against oxidative stress in Neisseria
                     gonorrhoeae; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase B"
                     /protein_id="WP_013578081.1"
                     /db_xref="GI:503343420"
                     /translation="MNRELNDFERFVIENKGTERPNTGEYNDHFSPGRYVCKRCSAPL
                     YSSEHKFESHCGWPAFDDEIPGAVERVPDADGRRTEIVCANCKAHLGHVFEGEYLTEK
                     NLRHCVNSVSMIFESADAQGNYHKAE"
     gene            complement(237187..238221)
                     /locus_tag="RAHAQ2_RS23080"
                     /old_locus_tag="Rahaq2_4790"
     CDS             complement(237187..238221)
                     /locus_tag="RAHAQ2_RS23080"
                     /old_locus_tag="Rahaq2_4790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014341798.1"
                     /db_xref="GI:504107812"
                     /translation="MDLIRKPLALALALLLLPAVVSATTLRYTDHEPLGAMRTRFIKD
                     VLFPAIEKESHGRLKIEEHWGGELSTGYDALRTVREGNNADIGIVVPEYTAKELPLHQ
                     LFKSFPTGPSGDKQIAFFRRVYAEIPAFPAELAKNGVVDIFLSTGYPVAFFSTHPLEK
                     LQNIKGTAWRSASFWHQNFLRNAGATPVTTPWGEQTVNAFKTGKLDGILVNIDSGYDL
                     KIQKMAPEVIVSKELWLGHLYLLVMNHKVWNGLAQEDKDAITRAANTAYKVAGSMMDH
                     SVEPQLDALRKDGANVRVLQHSEVTYWQEVTGYQDIQANWVKNQEAAGVKDVASTLQK
                     VSKVMEEEMK"
     gene            complement(238370..240790)
                     /locus_tag="RAHAQ2_RS23085"
                     /old_locus_tag="Rahaq2_4791"
     CDS             complement(238370..240790)
                     /locus_tag="RAHAQ2_RS23085"
                     /old_locus_tag="Rahaq2_4791"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_014341799.1"
                     /db_xref="GI:504107813"
                     /translation="MFKSFTQQGLVKNVIFMGTILTTTFNVNAAEAVKDNTDLTANNT
                     QSSEAIKKKPAVRTAQDLAQNNEEVMTVTETMPDKKPGSKTTLTAADMQRKGGNDFGT
                     IMRYEPLITATGANGGSGNGKSGFDRSGYTGYNIRGLESNRVGIDVDGIPQPSATGRS
                     YVSRAGLNTFGIGRDYIDPYIYGQVDIESGATSADRANTSIGGAVSFLPKSADDYLHP
                     GKETYFGYQSDYDSSDRSWHNGITAAAGDDTLRGLIAISRRDGQETRNNSGTLDAYPA
                     NWHSDAVMTSVIWQPNDAHKITGTLDYYEKVNHTHYDTWNNAGSAILGTAQQQSNTRR
                     WGASLKDEWTPFNDYVDAIVTKVYYQYTQAHDNTYLPNESQQMMNVYSNYDVNTYGAE
                     TSWLKTLGRHELSAGINGRVSNTERPFRESPDQSAFTTIMQPEANSRTYILGGFLQDT
                     IRFDLDGHNFSVVPAVRVAYQNTKARNLSDLSNSIVSEDQVSTLYGKANSDTQALPSL
                     AFTYDITPKLMTYLQYQRGAQFPDASQLYGSWNLGSNYAGRGQYALIGNTDLKTETSN
                     NFEWGMKGEATEGVTFKTSVFYNTYKNFIANTRYTRAGSPGMFTNVPSNIYTIYQAEN
                     RDEAFIYGGDLSTKINYGTWFSNVDGLSTTFALGYAKGQSKSSYDGDKYVDLDSVPPM
                     KFVAGVAWDDPSGIYGTALTATFVKGKKAEATSRQSYTNAGTPITGSTTEYMNVPGYG
                     MVDATAYWKVAKNVKLSGGVYNITDRKYWDYLSSRTLTETTNQDEYNKALAVMPGRSF
                     QLGVNVDF"
     gene            241157..241969
                     /locus_tag="RAHAQ2_RS23090"
                     /old_locus_tag="Rahaq2_4792"
     CDS             241157..241969
                     /locus_tag="RAHAQ2_RS23090"
                     /old_locus_tag="Rahaq2_4792"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_014341800.1"
                     /db_xref="GI:504107814"
                     /translation="MAQHRTESPAANLPVRVKNELVFRHITVKSSETISGCFKRIVLN
                     GDELTGFTSRGFDDHIKLFFPAVPGDVITPPVATEEGIVWGEGPRPLNREYTPLHYDA
                     QTNELTLDFYIHDGGVASEWAAGAKPGDKLIIGGPRGSLIIPTTYKWQLYVCDETGLP
                     AVKRRLRELKQAGSDARVTVLVKVKEVSCVSYLDEEKDFNIEWIVSDEHNGYQEDDAA
                     VKKLKSLPLPESDYYIWATGEGKFAKGLNDYFVETRGLEPNLVRCVAYWHNK"
     gene            241978..242457
                     /locus_tag="RAHAQ2_RS23095"
                     /old_locus_tag="Rahaq2_4793"
     CDS             241978..242457
                     /locus_tag="RAHAQ2_RS23095"
                     /old_locus_tag="Rahaq2_4793"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014341801.1"
                     /db_xref="GI:504107815"
                     /translation="MNHKHRRERMFETGDIRLLMLHFLQQRSAHGYELIKAIEQLSKG
                     EYTPSASIIYPNLTFLEEQGLIMASQEEGGKKQYSITPEGSQSLAEQGDLLGSVTEKL
                     HSLAILSNNRSIPEMQRAINNIRMALNLRLAKGPIEQETLYKITDALDRATKEIERS"
     gene            242642..>244711
                     /locus_tag="RAHAQ2_RS23100"
                     /pseudo
     CDS             242642..>244711
                     /locus_tag="RAHAQ2_RS23100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341802.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
     gene            complement(245673..246473)
                     /locus_tag="RAHAQ2_RS23105"
                     /old_locus_tag="Rahaq2_4795"
     CDS             complement(245673..246473)
                     /locus_tag="RAHAQ2_RS23105"
                     /old_locus_tag="Rahaq2_4795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="WP_014341803.1"
                     /db_xref="GI:504107817"
                     /translation="MNNGSDSRYFINNNRMIKTPEGIDKARIAGKLAARVLHMITPYV
                     VPGVTTNELDRLCHDFIVNELQAIPANIGYHGYQKTTCTSVNHVICHGIPSDKALKKG
                     DIVNIDVALIKDGWYGDTSRMYYAGEPGILARRLVDTTFEAMMAGIAVVRPGATLGDV
                     GYAIAAVARREGFTIVEEYCGHGIGMGYHEDPQVLHYGERGRGLVLQEGMLFTIEPML
                     NAGKKQNKVLPDGWTVVTKDHSLSAQWEHMIAVTKDGYEILTPWPEDN"
     gene            complement(246466..246720)
                     /locus_tag="RAHAQ2_RS23110"
                     /old_locus_tag="Rahaq2_4796"
     CDS             complement(246466..246720)
                     /locus_tag="RAHAQ2_RS23110"
                     /old_locus_tag="Rahaq2_4796"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341804.1"
                     /db_xref="GI:504107818"
                     /translation="MGIIKISELMHENLRIASLAYTRSMNAQAEHWMKIGMLMETHPD
                     MTHSEISQLLVRCSVESDENSDSIRTLLNVGGTHRKASNE"
     gene            246880..247269
                     /locus_tag="RAHAQ2_RS23115"
                     /old_locus_tag="Rahaq2_4797"
     CDS             246880..247269
                     /locus_tag="RAHAQ2_RS23115"
                     /old_locus_tag="Rahaq2_4797"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341805.1"
                     /db_xref="GI:504107819"
                     /translation="MKSISKLLIGLVCVMALSGCARTEPVSTPHTTLVTHNSDSQIRT
                     AIIDAGQKRGWIMTDGAPGVINGHLNNREHKADIRITYNTSGYTINYVGSTNLLAEKG
                     EIHRSYNHWVNNLDNDIQIRLASSATK"
     gene            complement(247382..247633)
                     /locus_tag="RAHAQ2_RS23120"
                     /old_locus_tag="Rahaq2_4798"
     CDS             complement(247382..247633)
                     /locus_tag="RAHAQ2_RS23120"
                     /old_locus_tag="Rahaq2_4798"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341806.1"
                     /db_xref="GI:504107820"
                     /translation="MKKLTVMMMSACLMMGAVSTTYAADAMAKKDTMGHMSKDCMKKD
                     SMSKDNMAKDSMGKDCMSKDHMKKDNMSKDAMKKDAMSQ"
     gene            complement(247684..248487)
                     /locus_tag="RAHAQ2_RS23125"
                     /old_locus_tag="Rahaq2_4799"
     CDS             complement(247684..248487)
                     /locus_tag="RAHAQ2_RS23125"
                     /old_locus_tag="Rahaq2_4799"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite oxidase-like oxidoreductase"
                     /protein_id="WP_014341807.1"
                     /db_xref="GI:504107821"
                     /translation="MKKLIKKTISQIFSTADSEAIVQEAQKQIIRELDAPSRRLFLQR
                     GLTLGGVAMLTGCDISDNASVENALGKISGFNDRVQGWLFGSTRLAPVYAESMITRPF
                     PFNAFYAEEDAPQVDGNDYRLKIAGLALDKREWSLPALYNMAQVSQVTRHICVEGWSA
                     IGKWGGVPFGDFLRLIGADLTAEYVSFKCADEYYTSIDMATALHPQTLLALTYDGQIL
                     PRKYGFPMKLRMPTKLGYKNPKHIEVIEITNKFTGGYWEDQGYNWFGGS"
     gene            complement(248497..249123)
                     /locus_tag="RAHAQ2_RS23130"
                     /old_locus_tag="Rahaq2_4800"
     CDS             complement(248497..249123)
                     /locus_tag="RAHAQ2_RS23130"
                     /old_locus_tag="Rahaq2_4800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_014341808.1"
                     /db_xref="GI:504107822"
                     /translation="MTIHTDLPHQAKSKPATVHPLWLRLTHWLNALAVLIMVTSGWQI
                     YNASPLFNFDFPSTLTLGGWLGGAIQWHFAGMWLFGFNGLFYLLMNIFTGRMKQKFWP
                     LTPRGIFNDFCAALRGKLKHDDLRHYNMVQRAAYVFVMFDGIVLVISGLVVWKSVQFP
                     LLRALMGGFDTARYVHFLAMASLVGFVVLHIVMVALVPKTLIAMLRGR"
     gene            249277..249999
                     /locus_tag="RAHAQ2_RS23135"
                     /old_locus_tag="Rahaq2_4801"
     CDS             249277..249999
                     /locus_tag="RAHAQ2_RS23135"
                     /old_locus_tag="Rahaq2_4801"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoB family transcriptional regulator"
                     /protein_id="WP_014341809.1"
                     /db_xref="GI:504107823"
                     /translation="MDKTKKILIVEDDGDIAELLSLHLRDEGYEITHAADGNLGVAHL
                     EKGGWDALILDLMLPGVDGLEICRRARNMTRYTPIIIISARSSEVHRVLGLELGADDY
                     LAKPFSMLELVARVKALFRRQEAMSRNMKMDAGTLSFSGLVIDPIARDVMLNHQPVEL
                     TPREFDLLYFFAKNPGKVFSRLSLLNQVWGYEHEGYEHTVNTHINRLRIKIEANPAEP
                     ERILTVWGKGYKFVSSSEESQG"
     gene            250003..251469
                     /locus_tag="RAHAQ2_RS23140"
                     /old_locus_tag="Rahaq2_4802"
     CDS             250003..251469
                     /locus_tag="RAHAQ2_RS23140"
                     /old_locus_tag="Rahaq2_4802"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_014341810.1"
                     /db_xref="GI:504107824"
                     /translation="MKNLTLAQRLTLVFTGLLIACCAFSGYMQVRSSNQYSQSVIQRL
                     SANLATQIAANNPLLSQGNWDPKAVHTLFDQLMAVNPSVEVYLLDKDGNIVGNAAPPG
                     RLQQQKIDLAPVNALLNGAKMPVYGENPRDPQTRQVFSAAPLRVDGIIKGYVYIILLG
                     DQYTALTSDAQYQSAISLALRSMGLVALFGLLAGALAFRWVTRPVRKLTSQIARLDTG
                     GMEAIQALAKTNTPAGAARDEVTQLQQAFVALAKRIDQQWQSLMVQDQQRREFIANIS
                     HDLRTPLTSLHGYLETLSVKADHLSDEDRQRYLNIALTQSKKVGRLAQELFELARLEY
                     GVVKPQKEPFSLSELVQDVFQKFELATETRGQKLLADITPGIPLVNADLGMIERVLTN
                     LLDNAIRFTPEGGVIEIKLWKQAGQVMVQLKDSGPGIAPELKDSLFVRPSILSTNKHR
                     AGGLGLMIVRRILQLHGSDIKLIEQPKHGACFQFSVPL"
     gene            251598..251918
                     /locus_tag="RAHAQ2_RS23145"
                     /old_locus_tag="Rahaq2_4803"
     CDS             251598..251918
                     /locus_tag="RAHAQ2_RS23145"
                     /old_locus_tag="Rahaq2_4803"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341811.1"
                     /note="member of the SMR family of proton-dependent drug
                     efflux transporters; quaternary ammonium compound efflux
                     pump; confers resistance to cetylpyridinium,
                     cetyldimethylethyl ammonium and cetrimide cations; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014341811.1"
                     /db_xref="GI:504107825"
                     /translation="MAWVYLFFAGIFEVVWSTAMKESHGFTRLIPSILTVFFMILSVV
                     LLAISMKTLPLGTSYTVWVGIGAIGAFILGVVMFGESLSPLRVIAVLLIFSGVILLKV
                     ATKG"
     gene            complement(251978..252451)
                     /locus_tag="RAHAQ2_RS23150"
                     /old_locus_tag="Rahaq2_4804"
     CDS             complement(251978..252451)
                     /locus_tag="RAHAQ2_RS23150"
                     /old_locus_tag="Rahaq2_4804"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014341812.1"
                     /db_xref="GI:504107826"
                     /translation="MKEPLIAADSAKSTIAKIRAKKNDANHSRRDAGQMLAQEKTSST
                     VKKQTRRRVSSLTKPVSTNDRNEARLNIMRALLLGEITQGQALKALRITVLGLKQDTF
                     AKLVSVSRKSLSEVENDKGNYTPDIINRLFKPFGLKVGLVPVSQQIFRTLFESSE"
     gene            complement(252402..252848)
                     /locus_tag="RAHAQ2_RS23155"
     CDS             complement(252402..252848)
                     /locus_tag="RAHAQ2_RS23155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041056.1"
                     /db_xref="GI:739177104"
                     /translation="MNTLLIFGAGSGVDAELVKLTAQEWPVRTRKSCQRCAAYDFAPM
                     KADPEGIARTTKWKAPLEIGGEYDYPGIAQSLDDLVPAETLLAALQSTANQLTGLKER
                     LAARGIPQQILNMPAISFSFIPEKLRRWGCYERTSDCGRFSEKHHR"
     gene            253354..253572
                     /locus_tag="RAHAQ2_RS23160"
                     /old_locus_tag="Rahaq2_4807"
     CDS             253354..253572
                     /locus_tag="RAHAQ2_RS23160"
                     /old_locus_tag="Rahaq2_4807"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341813.1"
                     /db_xref="GI:504107827"
                     /translation="MKKLLSGVAVMGIMFAVSACSSDYIISTNDGHMITTHGKPVKDK
                     DTGLISYKDTDGSIHQVHQGDVKEIVEK"
     gene            253800..254318
                     /locus_tag="RAHAQ2_RS23165"
                     /old_locus_tag="Rahaq2_4808"
     CDS             253800..254318
                     /locus_tag="RAHAQ2_RS23165"
                     /old_locus_tag="Rahaq2_4808"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341814.1"
                     /note="Member of the extracytoplasmic function sigma
                     factors which are active under specific conditions; binds
                     with the catalytic core of RNA polymerase to produce the
                     holoenzyme and directs bacterial core RNA polymerase to
                     specific promoter elements to initiate transcription; this
                     sigma factor regulates the genes for iron dicitrate
                     transport; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_014341814.1"
                     /db_xref="GI:504107828"
                     /translation="MSTNAAVSPARAFEALYSSHHRWLKNWLQFKLGSANDADDLAQD
                     TFMRVLTGDSAQEIREPKSFLCTIARRVMVDFFRRNALERAYLDMLALMPEEHMPSPE
                     QRQCLLETLQQIDTMLDGLGEKVRQAFLLSQLEGLTYPVIAERLNVSVSSVKKYMAKA
                     TEHCLLFSLEHG"
     gene            254324..255295
                     /locus_tag="RAHAQ2_RS23170"
                     /old_locus_tag="Rahaq2_4809"
     CDS             254324..255295
                     /locus_tag="RAHAQ2_RS23170"
                     /old_locus_tag="Rahaq2_4809"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341815.1"
                     /note="with FecA forms the FecAR signal transduction
                     system; ferric citrate binds FecA and transmits a signal
                     across the outer membrane to FecR. FecR transmits a signal
                     across the cytoplasmic membrane and activates the sigma 70
                     protein FecI that directs the RNA polymerase to express
                     the fecABCDE operon; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+-dicitrate sensor membrane protein"
                     /protein_id="WP_014341815.1"
                     /db_xref="GI:504107829"
                     /translation="MNSSVSDHQRLALKMAARWFATLCSGEVTPQQNQKWQVWLAQHE
                     DHRWAWQRVESLQGQMHSMPGKFSYQTLSHAHRQSDITRRRVLKGLLVLLGLGGTWKA
                     WQTPAGQGLLADTRTSTGEIKTLRLDDGSQLSLNTASAADIRFTPQQRLIRLHQGEIR
                     ITTARDPQPVARPFLVQTQQGMLRALGTEFIVRQYDDATRLTVLKHAVEITLPGHPVP
                     RLQVSEGHSVRFTGTAFGEVTAIESGAGSWNKGVLSVSDRRLAEVVDELARYRHGHLS
                     CDPAVADLRISGTFPLNDTDSVLNILSRTLPVKIQTMTRYWVNVVPA"
     gene            255431..257791
                     /locus_tag="RAHAQ2_RS23175"
                     /old_locus_tag="Rahaq2_4810"
     CDS             255431..257791
                     /locus_tag="RAHAQ2_RS23175"
                     /old_locus_tag="Rahaq2_4810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014341816.1"
                     /db_xref="GI:504107830"
                     /translation="MSISRSRVVRSFGKTTPLAIAIHCAIIPAALMSALPAAAAVQSA
                     SYQIAAGDLDTALNQFAAKAGITLSVDSSLTRGKHSNGLQGNYTPDDGLTALLADSGL
                     EAKSLGNSAFTLAAIPVPVQTPESLTVVGDWLADARENDVFEHGGARDVIRREDFVKT
                     GATTVREVMNRIPGVNAPENNGTGSHDMAMNFGIRGLNPRLASRTTVLMDGIPVPFAP
                     YGQPQLSLAPVSPGNMDAVDVVRGGGAVRYGPQSVGGVVNFVTRAIPKDFGIEAGTEG
                     TYSPTSSQNHPKGTGNLMIGGTADNGLGGALLYSGTRGSDWREHSATKIDDVMLKTRY
                     APNEIHTFNSLLQYYEGRAEMPGGLSRADYNASRFQSTRPYDEFWGRRQLASFGYQYQ
                     PDQQHKFNIQSFYTYTLRSGYLDQGKNLTLSPRQYWVRGIEPRYSQSFNLGQTAHEVG
                     VGYRYVSESTHELRYYSPAKSGVLPTGNSPYDRDTQSGTQANAFYIDDRIDVGDWTLT
                     PGMRYEHIQSYQNNYIKGTKQEISYNAPLPALNVVYHLNDAWNIYGNTEGSFGTVQYS
                     QIGKAVDSGNIGPEKARTWELGTRFDNNIVKAEVGLFLINFNNQYDSSQTTDSVTARG
                     KTRHTGLESQIRYDLSDLSPKLENVSAYASYAYVNAVIREEGDTHGNQVPFSPKNKGT
                     LGLDYTPGNWFFNVNSEYQSGQFADNANTVEESADGSTGRIPGFMLWGARAGYQFGAD
                     MANLNLAFGVKNIFDHEYFTRAYDDNNKGIYAGQPRTLYMQGSLKF"
     gene            257843..258748
                     /gene="fecB"
                     /locus_tag="RAHAQ2_RS23180"
                     /old_locus_tag="Rahaq2_4811"
     CDS             257843..258748
                     /gene="fecB"
                     /locus_tag="RAHAQ2_RS23180"
                     /old_locus_tag="Rahaq2_4811"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341817.1"
                     /note="part of the ABC transporter involved in the uptake
                     of citrate-dependent Fe(3+); Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron siderophore-binding protein"
                     /protein_id="WP_014341817.1"
                     /db_xref="GI:504107831"
                     /translation="MSFFSRFALFASLCFLLPAAQAVTVTDQQGSFTIDSTPKRVVVL
                     ELSFVDALAVVDVSPVGVADDNDADRILPQVRQRISAWQSVGTRSQPSLEAIAALKPD
                     LIIADSSRHSGIYAALKGIAPTLLLKSRNETYSEDLASAAIIGKVLGKDVLMQQRLKE
                     HHQRMQAFAAQLPKGTQVVFGTSREQQFNLHTRDSYTGSVLTSLGLIVPEPVNQQALA
                     NISFEQLLAINPDWLIVAHYRQESIVRQWQQDPLWQMMKAAQQKQEASVDSNVWARMR
                     GVFAAEQIARDTVQILHHQALKTAP"
     gene            258745..259749
                     /gene="fecC"
                     /locus_tag="RAHAQ2_RS23185"
                     /old_locus_tag="Rahaq2_4812"
     CDS             258745..259749
                     /gene="fecC"
                     /locus_tag="RAHAQ2_RS23185"
                     /old_locus_tag="Rahaq2_4812"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341818.1"
                     /note="part of the FecBCDE citrate-dependent iron (III)
                     transport system; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter"
                     /protein_id="WP_014341818.1"
                     /db_xref="GI:504107832"
                     /translation="MMAVKYLFAGWRWTLPLFILGVSFWLTLFCRSAVPIGAVESLRA
                     LLPGPPVSLAQALVLNLRLPRSLVAMLLGASLALAGSLLQTLTRNPLASPSLFGINAG
                     ASLAMVLVSALSPQLFSGFSIALVAALGGGVSWGTVMLTGGGWRQAGDRSRLILAGVA
                     VSALCAALAKATLILSEDHAYGILSWLAGGVAHARWPEFWHLFPFTAIIAPWVLLLAG
                     RLNLLQVSDDSAQTLGVNLPRLRLTINLMVLLLVGACVSVAGPLAFIGLLVPHISRYW
                     IGYDLRRMLPLSMIFGATLMLLADLLARFLAWPGELPAGVVLALIGAPFFVWLVRTRT
                     "
     gene            259746..260708
                     /gene="fecD"
                     /locus_tag="RAHAQ2_RS23190"
                     /old_locus_tag="Rahaq2_4813"
     CDS             259746..260708
                     /gene="fecD"
                     /locus_tag="RAHAQ2_RS23190"
                     /old_locus_tag="Rahaq2_4813"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341819.1"
                     /note="Ferric citrate binds FecA and is transported across
                     the outer membrane while transmits a signal across the
                     cytoplasmic membrane protein FecR. FecR transmits a signal
                     across the membrane and activates the cytoplasmic FecI
                     that directs the RNA polymerase to express the fecABCDE
                     operon (which encodes the ferric citrate outer membrane
                     receptor and the ferric citrate ABC transporter), as well
                     as fecIR. FecD is one of two (along with FecC) integral
                     membrane protein components of the iron dicitrate ABC
                     transporter; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe3+ dicitrate ABC transporter permease"
                     /protein_id="WP_014341819.1"
                     /db_xref="GI:504107833"
                     /translation="MTRQFTLFLTLSALLLLTFVISLRYGTHTLTFEQMRLAVSPADS
                     NHFPLFEYRLPRTLLAMLVGAALALSGVLVQGIIRNPLASPDILGVNHAAGLASAGAL
                     MLLPALPVLWLPPLAFTGGIAAFVLLRLMAGRSAPLRLALTGVALTAFYASLTDYLML
                     SHPMEINNALLWLTGSLWGRGWNFVEIVAPWLLILLPLSLWFCRDLDVLALGDDSAST
                     LGIRVSRVQRLVLLLAVALAAISVAACGPVGFIGLVAPHLTRKLVGGRHRVLIPASLL
                     VGALILLLADVLARTLHPPLELPAGVLTAVIGAPYFFWLLMRTR"
     gene            260711..261478
                     /locus_tag="RAHAQ2_RS23195"
                     /old_locus_tag="Rahaq2_4814"
     CDS             260711..261478
                     /locus_tag="RAHAQ2_RS23195"
                     /old_locus_tag="Rahaq2_4814"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter"
                     /protein_id="WP_014341820.1"
                     /db_xref="GI:504107834"
                     /translation="MQLSAENLTAGYGNKNILNGLSLTLPAGKITALIGPNGCGKSTL
                     LKCFSRLLTPACGTLRLGDDDLSTLHGRPLARKLALLPQQHIAPEGISVRELVGYGRS
                     PWLNLWGRLGQQDKTIVERAMQETNITELAEKRVSELSGGQRQRVFLAMVLAQDTPLV
                     LLDEPTTYLDISHQVELMSLLRSQNQQGKTLVAVLHDLNQASRYCDYLVMMAAGKIIA
                     QGTPEEVMTPELLAQVFDIDAQIYPEPVTGKPMCIVR"
     gene            complement(261503..261988)
                     /locus_tag="RAHAQ2_RS23200"
                     /old_locus_tag="Rahaq2_4815"
     CDS             complement(261503..261988)
                     /locus_tag="RAHAQ2_RS23200"
                     /old_locus_tag="Rahaq2_4815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="WP_014341821.1"
                     /db_xref="GI:504107835"
                     /translation="MPIPAYMWLYDDGGSAIKGSVDVAGREGSIEIIGFSHGLNIPVD
                     SRSGSITGTRSHSPMMFEKEFDSSSPYLYKAVSKGQTLKSAEIRWYRINDAGREEAYF
                     IMTIEGVKITGVNPGMPNVKMSGNSQINHMESVSMMYNKITWHCVDGNIKYTDEWNDR
                     S"
     gene            262179..262706
                     /locus_tag="RAHAQ2_RS23205"
                     /old_locus_tag="Rahaq2_4816"
     CDS             262179..262706
                     /locus_tag="RAHAQ2_RS23205"
                     /old_locus_tag="Rahaq2_4816"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341822.1"
                     /db_xref="GI:504107836"
                     /translation="MALQGKFVINDADYCPLLMYGVGTYMAYSGKDAYRNRASCSGIL
                     NLGPIPHGRYHIIKRATGGVKGIVRADLRDSYSWFTPTPVIKAEWFALYRDDGSIDDK
                     TWIEGVERGNFRLHPPGPLGISLGCITLQHRSDFMAIRQALMSTRQTELPNGLMSYGM
                     IEVILNGQASCGNGM"
     gene            263144..264307
                     /gene="lldD"
                     /locus_tag="RAHAQ2_RS23210"
                     /old_locus_tag="Rahaq2_4818"
     CDS             263144..264307
                     /gene="lldD"
                     /locus_tag="RAHAQ2_RS23210"
                     /old_locus_tag="Rahaq2_4818"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341824.1"
                     /note="flavin mononucleotide-dependent dehydrogenase;
                     functions in aerobic respiration and also has a role in
                     anaerobic nitrate respiration; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate dehydrogenase"
                     /protein_id="WP_014341824.1"
                     /db_xref="GI:504107838"
                     /translation="MIISASTDYRAAAKSKLPPFLFHYIDGGAYNEHTLRRNTADLAD
                     IALRQRILKNMSDLSLETQLFGEKLAMPVVLAPVGLTGMYARRGEVQAARAAAKKGIP
                     FTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAQAAGVRTLVFTVDMPT
                     PGARYRDAHSGMSGPNAAVRRMFQAVMHPQWAWDVGLNGKPHDLGNVSAYRGKPTTLE
                     DYIGWLAANFDPSISWKDLEWIREFWKGPMIIKGILDPEDAKDAVKFGADGIVVSNHG
                     GRQLDGVLSTAHALPAIADAVKGDITILADSGIRTGLDVVRMIALGADSVLLGRAFVY
                     ALAAAGEAGVINLLNLIEKEMRVAMILTGAKSIADISADSLVYGRDQVHRATL"
     gene            complement(264350..265480)
                     /locus_tag="RAHAQ2_RS23215"
                     /old_locus_tag="Rahaq2_4819"
     CDS             complement(264350..265480)
                     /locus_tag="RAHAQ2_RS23215"
                     /old_locus_tag="Rahaq2_4819"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014341825.1"
                     /db_xref="GI:504107839"
                     /translation="MQKTTHTLQNTAFDTLLDHYKKASLRTSGIWLLLANLSFVLFLF
                     GRHQFRVLLDPNADVAVSGPVLDKLALIFLVFFIILLPVLRFIRSRMPAMILAFLVGL
                     YWAVVFHFMLASDAQQQLVFPLFCMLIFTALIALYPTMPVLYSFTLPLWFSLFFHLVL
                     LKPAIPILEIAAMIVVSALFETARMMLSRWFVLSVRRECDNQLLVSKLDNLAHYDPLT
                     GIANRRQLDNQLEQMIAQTERQGGTFSLIMIDVDFFKKYNDHYGHQAGDTCLVGIAEC
                     FKQVVRQPADLVARYGGEEFVVLLHNADAKDAEVVAERIRQSVTQAAIPHALSQVSDT
                     VTVSQGIMQWSPGMTSLELLKRADGALYDAKHAGRNGYCVGQ"
     gene            complement(<265561..267699)
                     /locus_tag="RAHAQ2_RS23220"
                     /old_locus_tag="Rahaq2_4820"
                     /pseudo
     CDS             complement(<265561..267699)
                     /locus_tag="RAHAQ2_RS23220"
                     /old_locus_tag="Rahaq2_4820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341826.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqF"
     gene            complement(267707..268864)
                     /locus_tag="RAHAQ2_RS23225"
                     /old_locus_tag="Rahaq2_4821"
     CDS             complement(267707..268864)
                     /locus_tag="RAHAQ2_RS23225"
                     /old_locus_tag="Rahaq2_4821"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqE"
                     /protein_id="WP_049796161.1"
                     /db_xref="GI:908659711"
                     /translation="MHKSGLPSVNLLKPAVKPPLWLLAELTYRCPLQCPYCSNPLDFA
                     KQEKELTTAQWIKVFEEAREMGAVQIGFSGGEPLVRKDLPELIRAARDLGFYTNLITS
                     GIGLTEKKIDAFAEAGLDHIQISFQASDETLNAALAGNAKAFRQKLEMAKAVKAHGYP
                     MVLNFVLHRHNIDQIDKIIDLSIELEADDVELATCQFYGWAQLNREGLLPTREQIARA
                     EQVVHQYREKMAGTGNLANLLFVTPDYYEERPKGCMGGWGAIFLSVTPEGMALPCHSA
                     RQLPVEFPSVLENTLQEIWYDSFGFNKYRGFDWMPEPCRSCSEKEKDFGGCRCQAFML
                     TGNADNADPVCSKSEHHGKILAAREQANCTNIQINQLQFRNRANSQLIFKG"
     STS             268373..270062
                     /standard_name="Myln"
                     /db_xref="UniSTS:143966"
     gene            complement(268827..269084)
                     /locus_tag="RAHAQ2_RS23230"
                     /old_locus_tag="Rahaq2_4822"
     CDS             complement(268827..269084)
                     /locus_tag="RAHAQ2_RS23230"
                     /old_locus_tag="Rahaq2_4822"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O33505.2"
                     /note="with PqqC converts a biosynthetic intermediate to
                     pyrroloquinoline quinone; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqD"
                     /protein_id="WP_037041038.1"
                     /db_xref="GI:739177083"
                     /translation="MFRRGYRMQFEKTQDCHVILYPEGMAKLNDSATFILQLVDGGRT
                     IANIIDELNTRFPEAGGVNDDVKDFFAQAHAQKWITFREPA"
     gene            complement(269111..269878)
                     /locus_tag="RAHAQ2_RS23235"
                     /old_locus_tag="Rahaq2_4823"
     CDS             complement(269111..269878)
                     /locus_tag="RAHAQ2_RS23235"
                     /old_locus_tag="Rahaq2_4823"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341829.1"
                     /note="Required in the synthesis of PPQ, but its exact
                     function is unknown; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqC"
                     /protein_id="WP_014341829.1"
                     /db_xref="GI:504107843"
                     /translation="MSISTTQTSPMTPQEFEQALRAKGAFYHIHHPYHIAMHNGQATR
                     GQIQGWVANRFYYQTSIPLKDAAIMANCPDAQTRRKWVQRILDHDGHGGSEGGIEAWL
                     RLGEAVGLDRDVLLSEERVLPGVRFAVDAYVNFARRAVWQEAACSSLTELFAPQIHQA
                     RLDTWPQHYTWIEEEGYGYFRSRLSQANRDVEHGLQLALEYCDTVEKQQRMLEILQFK
                     LDILWSMLDSMSMAYELNRPPYHSVTQQAVWHKGRLL"
     gene            complement(269891..270802)
                     /locus_tag="RAHAQ2_RS23240"
                     /old_locus_tag="Rahaq2_4824"
     CDS             complement(269891..270802)
                     /locus_tag="RAHAQ2_RS23240"
                     /old_locus_tag="Rahaq2_4824"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578119.1"
                     /note="possibly involved in transport of pyrroloquinoline
                     quinone transport; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqB"
                     /protein_id="WP_014341830.1"
                     /db_xref="GI:504107844"
                     /translation="MQIIVLGSAAGGGFPQWNCNCSNCQGVRNGTMKTSPRTQSSIAV
                     SDNGTDWVLCNASPDICHQIAATPELIKQDVLRGTSIGSIILTDSQIDHCTGLLNLRE
                     GCPHQVWCTPEVHEDLTTGFPIFTMLSHWNGGLQHHAIRPENRFSVAVCPNLTFTAIP
                     LLSNAPPYSKYRGKPLPGHNIALFIEDTKTGTSLLYAPGLGEPDDELLKWLHKADCLL
                     IDGTLWQDNELATTGVGRNTGKDMGHLALAEEQGLIALLSSLPAKRKILIHINNTNPI
                     LNESSAERQALTQQNIEVSRDGMRIEL"
     gene            complement(271102..272142)
                     /locus_tag="RAHAQ2_RS23245"
                     /old_locus_tag="Rahaq2_4826"
     CDS             complement(271102..272142)
                     /locus_tag="RAHAQ2_RS23245"
                     /old_locus_tag="Rahaq2_4826"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_037041023.1"
                     /db_xref="GI:739177068"
                     /translation="MMNTIPHPPVFDGHNDLLLRLWLHDAADPAALFLDGSLEGHLDF
                     RRCRLGGFAGGLFAIFVPPASYMPQLKPDSPAEPHDAFAITQAQISLLERLETQSAGR
                     AKICRTVGEIEACITQNVLAMVMHIEGAEALGDDFSRLERWYEKGLRSIGPLWNLPNQ
                     FGTGVKGDFPGSPDTGDGLTPAGLGLLHECNRKRILFDVSHMNEKAFWQTAKFSDAPL
                     VATHSNVHALCPQPRNLTDKQLAAIAESNGFVGVNFGTAFLRADGKRNGDTPITEIVK
                     HLDNLVGKLGEENVGFGSDFDGINVPDTLGDVAGLPLLLQAMSDAGYGDALIEKIAYR
                     NWLKVLKQTWGE"
     gene            272138..272380
                     /locus_tag="RAHAQ2_RS23250"
     CDS             272138..272380
                     /locus_tag="RAHAQ2_RS23250"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037041020.1"
                     /db_xref="GI:739177065"
                     /translation="MMLMVLYKSMLKHGELCKFWFFCTDRCKGGDFKINVQVKVKTVG
                     VGPHRLGGRPIAATPQDPPGSFTARCRRHDGHVLVQ"
     repeat_region   272383..272553
     gene            complement(272863..275004)
                     /locus_tag="RAHAQ2_RS23255"
                     /old_locus_tag="Rahaq2_4827"
     CDS             complement(272863..275004)
                     /locus_tag="RAHAQ2_RS23255"
                     /old_locus_tag="Rahaq2_4827"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferric-rhodotorulic acid transporter"
                     /protein_id="WP_037041017.1"
                     /db_xref="GI:739177062"
                     /translation="MIALLMSSSLHSAYAAETTAKKTAGDTVVVTGGNNSTSATDTAA
                     TDYSVPVTTAGTKMTLTARDIPQSVSIISKQRMQDQQLQSLGDVLRNTTGIQESVSDL
                     DRRTYYARGFLIDNYMVDNIPTTFDPRWDLGDSQSDTAIYDRIEVVRGATGLMTGPGN
                     PSASVNQVRKHADSKEFTGNVSATYGSWNKQRYVADLSTPLNASGSVRGRLVTGYQDK
                     NSYVERYGATKKFVYATVDADLTDSTLLSAGYEFQQTNTDSPTWGGMPRWYLDGSKTD
                     YRRGFNSAPDWAYSDKETTKLFTTLKQSFDNGWQATLNGTHTESHIDSKMMYIDGTFD
                     KTTGVGESAYAGYPVVAGTGYNTGKRKVDGVDAFASGPYELFGRQHELMTGVSYSKQQ
                     NTYYSSFANISTEELGNFNDFNGQFPETDWAPRTLAEENVIRQKSAYVATRLSLADPL
                     HLIVGARYTNWNSHTLTDQIEKNNITPYAGLVFDINDTWSTYASYTSVFQPQTYRDIN
                     GGYLSPVIGKNYEAGVKSDWFNSRLTASVSIFRAELDNVAQSTGRVIPGTTDTAYEGK
                     NGTVSRGVEFEVNGALTDNWQMTFGGTRYIAEDENGDAVNPQLPRTQLKLFSSYRLPM
                     LQDLTVGGGVNWQTHVWDTVPGPSGNGTRYAEQGSYALVNLFSRYQVTRQLAVQANVN
                     NLFDKEYDTSVNQYVVYGEPRNVSVTASYSF"
     repeat_region   275432..275682
     gene            275983..276885
                     /locus_tag="RAHAQ2_RS23260"
                     /old_locus_tag="Rahaq2_4828"
     CDS             275983..276885
                     /locus_tag="RAHAQ2_RS23260"
                     /old_locus_tag="Rahaq2_4828"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homocysteine S-methyltransferase"
                     /protein_id="WP_014341833.1"
                     /db_xref="GI:504107847"
                     /translation="MISNIKILDGGMGRELARMGAPFRQPEWSALALMQAPEFVRAAH
                     DAFIAAGSQVITTNSYAVVPFHVGEEIFAEQGAALIALSGKLAREAAEAAPAAVQVAG
                     SLPPVLGSYRPDLFEPVAAKKLLQVLVDNLTDSVDVWLAETQSSVAEVEAVRDVLGDD
                     PRPLWLSFTLQDNPDDQGNALLRSGESVGDAVSAALRVSAAAVLFNCSRPEVMATAVK
                     TARAALTTQGSQLDIGVYANAFEPSDNKRGANEGLSKMRQDTDPAGYLDFAKDWVAQG
                     ATLVGGCCGIGPEHIAALKQAFAK"
     gene            276969..278513
                     /locus_tag="RAHAQ2_RS23265"
                     /old_locus_tag="Rahaq2_4829"
     CDS             276969..278513
                     /locus_tag="RAHAQ2_RS23265"
                     /old_locus_tag="Rahaq2_4829"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014341834.1"
                     /db_xref="GI:504107848"
                     /translation="MIDRRSFIKSAGALSVAAATHSLWLGNAFAAEAEKPKKGGHLVV
                     GVDNASSTDRLDPAFWFETYMYFVGSQMFNNLVEIDENARLAPSLAEAWASTDGSKTW
                     VLKIRQGVQFHDGRSLGAKDVVYSLNHHRGEKSTSPVKGYLDTVSSIEATGDHEVTIK
                     LTAPDVEFVWLLSAVHFAITAENENFDKGIGTGAFILEKFQPGVSTLTKHNPNYWNSE
                     RGHVDSVETLAMNDSTARVAALVSGSAQLINRVNPRIVSRIERMPNLKLVRAKDSMIY
                     TFPGLSNLAPFDNVDGRLALKYAIDRQKIIDTVLGGYASVANDNPIFPSNRYFAKDIP
                     QRPYDPEKAQFHWKKSGFSGPLTLNVADAGFPGAVDAGQLYQQSAAKAGINLNVVRVP
                     DDAFWNDIWQKKAFVSSNWANRPTADALLSLVFTSQSSWNESAWHVPAFDAMVKAARG
                     EADEARRKQIYHDIQVMLVDQGSEIIPLYADALDGCSAKIKGFTSVPGMPLSGNRAAE
                     KVWIEG"
     gene            278527..279546
                     /locus_tag="RAHAQ2_RS23270"
                     /old_locus_tag="Rahaq2_4830"
     CDS             278527..279546
                     /locus_tag="RAHAQ2_RS23270"
                     /old_locus_tag="Rahaq2_4830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_049796168.1"
                     /db_xref="GI:908659718"
                     /translation="MSDLSAQQKVTQRPAGRFSPHRSGLLSMVLVRLFYGVLVVLAVS
                     MLIFAGVQLLPGNAATAILGQSATPDAIRELNLQLGLDKPAVSRYLSWLFGVLHGDFG
                     TSFSTREAISGPLFTRLGNTLFLAGCTAAIAVPLALLIGFISVRYHGSVIDTLLNAIT
                     RATVALPEFFSGYLLILIFAITLAWAPSNSSITADMPLTAKLSAISLPCATLVLAILG
                     HMSNMTRVALIAAQSSAYVDTALLKGLSPSRILWRHVLPNAVGPIINVVAINLAYLMV
                     GVVIVENVFVYPGLGQYMVDSISKRDIPVMQDCALLLAGIYILLNLLADVMALVANPR
                     LRHNR"
     gene            279565..280383
                     /locus_tag="RAHAQ2_RS23275"
                     /old_locus_tag="Rahaq2_4831"
     CDS             279565..280383
                     /locus_tag="RAHAQ2_RS23275"
                     /old_locus_tag="Rahaq2_4831"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014341836.1"
                     /db_xref="GI:504107850"
                     /translation="MPALKPASILGLLVLSLFILIAIFAPWLAPHAPDQTLGMSWDLP
                     GPDSVLGTDNLGRDLLSRLIWGTRVSLGVTTLAALVAFIVGCTFGFIAGLRGGWLDQV
                     ISRCNDIVMAIPTLILALIVLAVLPKTILVLTLVLGLLESTRVLRVARSLAVDIGVME
                     FVDVARLRGESLGWILGHVILPNALQTLIAEFGLRFIFILLFLSALSFLGLGIQPPTA
                     DWGGLARDNKDGILFGVWAALVPGGAIAVLALAVNAVADWLMSGERRVWGKKHE"
     gene            280376..281962
                     /locus_tag="RAHAQ2_RS23280"
                     /old_locus_tag="Rahaq2_4832"
     CDS             280376..281962
                     /locus_tag="RAHAQ2_RS23280"
                     /old_locus_tag="Rahaq2_4832"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014341837.1"
                     /db_xref="GI:504107851"
                     /translation="MNEHVLNVENLCVVSQGKNPRTLVDCVSFTVKRGEVLGLIGESG
                     AGKSTIGLAILGHCRQGMRIHSGKIAFSGRELTSLSERQLRQVRGRQIAYVAQSAGAA
                     FNPAITLGEQVIEAALKHNVYPRQQAQAKAIALFEQLGLPDPQAFYQRYPHQVSGGQL
                     QRAMIAMALCAGPELLIFDEPTTALDVTTQLGVLKAISDVIRLSGVAAIYISHDLAVV
                     AQISDHIMVLQHGKTVEQAETAQLLSQPQQDYTRRLLHAQGGNKTPQTGPAPVALDIS
                     NISARYHAQPVLQNISLSLPRGRTLAVIGESGSGKSTLGKVICGLLTQESGEISLNQQ
                     VLPASLRQRSRVQLRDVQLIHQIPDTALDPKERIGGQISRVLACFTTLNRSQREARVS
                     ELLAQVGLHAELAARFPAALSGGQKQRVCIARALAAEPKIIVCDEPTSALDPLVARDV
                     LALLRQIQQETGISYLFITHDLQVVREIADEVAVLKQGVIVRQGPVASALAEPLDDYT
                     RELLRSVPEMRVGWLEEMFA"
     gene            282205..283869
                     /locus_tag="RAHAQ2_RS23285"
                     /old_locus_tag="Rahaq2_4833"
     CDS             282205..283869
                     /locus_tag="RAHAQ2_RS23285"
                     /old_locus_tag="Rahaq2_4833"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_014341838.1"
                     /db_xref="GI:504107852"
                     /translation="MYKLINNMRVGARLGAAFGLIILLLFIVSGIAITKISSINSSIE
                     QIVNDRYVKVRLAFDVRDGVNDQIKYLRGIVIDTKNPEQNKKRYLQLDDTVKKTNVAM
                     DKIAAIQSTVTGKQKIKALQEAGETFEAAKEQLIALARAGDMDGATEYVLRKLTTSQN
                     AYLDLATAFATSQDQQLQAEGKTAVADGATAIQLTLIFSTLAILMAAALGYFLSRSIT
                     RPLHTAVKVAENVAAGDLTTQILVTSQDETGQLMQGLKNMNENLLKIVTEVRAGTHAI
                     TSASSEIAAGNLDLSSRTEQQASSLEETASAMEQMTATVKQNADNARQANQLAAQASR
                     VAVQGGEVVGEVVNTMEGINTSSRKIVDIIAVIDGIAFQTNILALNAAVEAARAGEQG
                     RGFAVVASEVRNLAQRSASAAKEIKVLIDDSVAKVDNGTQLVAKAGATMAEVVSSVRN
                     VTDIVGEIAIASNEQSTGIEEINKAITQMDEVTQQNAALVQEASSAAYSLNEQAERLS
                     QAISIFKVSAGSATAAVRKAGQTKSPALLSNRQPVPAADQGNWETF"
     gene            283994..284881
                     /locus_tag="RAHAQ2_RS23290"
                     /old_locus_tag="Rahaq2_4834"
     CDS             283994..284881
                     /locus_tag="RAHAQ2_RS23290"
                     /old_locus_tag="Rahaq2_4834"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class A beta-lactamase"
                     /protein_id="WP_014341839.1"
                     /db_xref="GI:504107853"
                     /translation="MMKNTLRKTVLMAAAVVPMLAFSAASWAQTATKMTSVQQQLAAL
                     EKDSGGRLGVMLINTEDNSQIAYRADERFAMCSTSKFMAASAILKQSETQTELLNRHV
                     SLKKSDLVNYNPITEKHLNTGMTVGELAAAALQYSDNTAMNKLIGQLGGPQKVTEYAR
                     TLGDKTFRLDRTEPTLNTAIPGDDRDTTSPRAMALSLQHVALGSALAEPQRAQLVEWM
                     KGNTTGAMSIRAGLPATWVVGDKTGSGDYGTTNDIAVIWPDNKAPLILITYFTQPEKD
                     AKSRRDVLASAAKIVTQGY"
     gene            285035..285385
                     /locus_tag="RAHAQ2_RS23295"
                     /old_locus_tag="Rahaq2_4835"
     CDS             285035..285385
                     /locus_tag="RAHAQ2_RS23295"
                     /old_locus_tag="Rahaq2_4835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000038571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341840.1"
                     /db_xref="GI:504107854"
                     /translation="MSGSLSRWARITCTSALLLSFTAIADQQGRQQLQEHFADQNRQQ
                     EEQMRQIERQQSQYAADYARESQERVDRQIKEQEETTTRIQNEAIATHEKRDAEAREA
                     ARQKREQAGDPERN"
     gene            286153..287538
                     /locus_tag="RAHAQ2_RS23300"
                     /old_locus_tag="Rahaq2_4836"
     CDS             286153..287538
                     /locus_tag="RAHAQ2_RS23300"
                     /old_locus_tag="Rahaq2_4836"
                     /EC_number="2.6.1.76"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341841.1"
                     /note="catalyzes the reversible formation of
                     diaminobutyrate and 2-oxoglutarate from glutamate and
                     L-aspartic beta-semialdehyde; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminobutyrate--2-oxoglutarate
                     aminotransferase"
                     /protein_id="WP_037041013.1"
                     /db_xref="GI:739177058"
                     /translation="MMTDKVRIDSLGANSLNGNNETYLARQAEFESNVRSYPRKLPLA
                     IAKANGVWITDVENKQYLDCLAGAGTLALGHNHPEVLQSIQNVITSGLPLHTLDLTTP
                     LKDQFSEYLLSLLPQQGKEYCLQFTGPSGADAVEAAMKLAKKVTGRSGIISFSGGYHG
                     MTHATLAVTGNLSPKEAVNGMMPEVQFMPYPHQYRCPLGIGGDAGVKALTYYFENLIN
                     DVESGVRKPAAVILEAVQGEGGVNPAPAEWLQRIRKVTQEHGIMLILDEVQAGFCRTG
                     KQFAFEHAGIEPDIIVMSKAVGGGLPLAVLGIRKEFDAWAPGHHTGTFRGNQLAMATG
                     LTTLKILKEEKIAEKVAAQGEWLKGKLADMQKRYPVMGHVRGLGLMIGIEIVKPNEAQ
                     DHMGCYPADGELSALLQKKCFEAGLILERGGRNGCVLRLLPSLLITNDELGIFLDKFE
                     QALLAAGIKPA"
     gene            287557..289029
                     /locus_tag="RAHAQ2_RS23305"
                     /old_locus_tag="Rahaq2_4837"
     CDS             287557..289029
                     /locus_tag="RAHAQ2_RS23305"
                     /old_locus_tag="Rahaq2_4837"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-diaminobutyrate decarboxylase"
                     /protein_id="WP_014341842.1"
                     /db_xref="GI:504107856"
                     /translation="MSELNPILAGSAQSTEAYQQAIAQSSEAVVQWLQQPEMYQGKTV
                     AELRERITLDFNPNGLGNQAAIERAIEYFLKDSLSVHHPQCVAHLHCPSLVVSQAAEV
                     LINATNQSMDSWDQSPSATIIEMKLIEWLRTQVGYQAGDAGVFTSGGTQSNLMGLMLA
                     RDAFFARQGHSIQQDGLVGNLRKIKVLCSENAHFSVQKNMALLGLGYQCVTLVKTDEF
                     ARMDLNDLREKVAQAQANGDQILAIVATAGTTDAGAIDPLRAIAELAAEHQIWVHVDA
                     AWGGALLLSEKYRHYLDGIELVDSITLDFHKQFFQTISCGAFLLKEERHYELMRYQAA
                     YLNSEFDEAAGVPNLVSKSLQTTRRFDALKLWMGLEALGQKQYAAIIDHGVTLAQDVA
                     QYVGSEAALELVMKPQLASVLFRYRPAQLAGSSDAAIALLNQKIGDALLESGRANVGV
                     TEHNGITCLKLTLLNPTVTLEDVKVLLALVEKTAQQLLNA"
     gene            289379..290491
                     /locus_tag="RAHAQ2_RS23310"
                     /old_locus_tag="Rahaq2_4838"
     CDS             289379..290491
                     /locus_tag="RAHAQ2_RS23310"
                     /old_locus_tag="Rahaq2_4838"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="WP_014341843.1"
                     /db_xref="GI:504107857"
                     /translation="MNFLSHFDVIALMMTPVFWMGVATMCVVTLVTYWLLSWLVSFLR
                     KGVKRWGEVNEASHRIRFILGEILDRTSNLLIFIAAFLFSLRFVNLPDNLYNTISHAW
                     FLVLAFQMALWLDQAVVSWLRHIMRQPGMNKNPVTLVITGLIFRAVVWSVMLLSILAN
                     VGVNITALVASLGVGGIAIALAIQTILSDVFASLSIGFDKPFEIGDFVVFNDVAGTVE
                     HIGLKTTRIRSLSGEQIVCGNAILLQQTLHNYKRMQTRRIVFNFGIAINTPPEKLRII
                     GDMVKEIIIDVGETKFDRAHLLGFGTDRLNIEVVHIVNTADYNKYMDIQQEINIRIIE
                     KLIEQGIEMALPNMIIKTQAEREEGAGESTREKGQA"
     gene            complement(290602..291048)
                     /locus_tag="RAHAQ2_RS23315"
                     /old_locus_tag="Rahaq2_4839"
     CDS             complement(290602..291048)
                     /locus_tag="RAHAQ2_RS23315"
                     /old_locus_tag="Rahaq2_4839"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014341844.1"
                     /db_xref="GI:504107858"
                     /translation="MENVLRAAIMYVFLFIIFKISGRKTLLEMNIFDFILVLIISEAT
                     QQALLGEDFSLMGAMITIGTLIFIDKSLGFLENKSPTFNLWLNGSPIILIENGKILDQ
                     RLRKCSLTEDEIMVVARQQEAIVSMDEIKFAILEKNGKISIIPYKK"
     gene            complement(291061..291579)
                     /locus_tag="RAHAQ2_RS23320"
                     /old_locus_tag="Rahaq2_4840"
     CDS             complement(291061..291579)
                     /locus_tag="RAHAQ2_RS23320"
                     /old_locus_tag="Rahaq2_4840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007781253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341845.1"
                     /db_xref="GI:504107859"
                     /translation="MDKDNQSQFEPRTTPVEENIGWIKTAWRLERIGFFLLGLFILYA
                     LLGGFSQGWLSDSRYQNEEKSTQITYEKYLRSDTESPLIIAYPLKEAQSDHITLSGKF
                     VNEYDIINVSPESAVIHRSPGTMIIYPNNTGVTNAGNVQLTLKPRKFGIYTLSVAANN
                     DSPFIFKQIVFP"
     gene            291745..292938
                     /locus_tag="RAHAQ2_RS23325"
                     /old_locus_tag="Rahaq2_4841"
     CDS             291745..292938
                     /locus_tag="RAHAQ2_RS23325"
                     /old_locus_tag="Rahaq2_4841"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_014341846.1"
                     /db_xref="GI:504107860"
                     /translation="MRALTYHGPYRVSVDNMPDPTLQASDDIILKVTATAICGSDLHL
                     YRGKIPGTHHGDIFGHEFMGEVVEAGSDVTAVAKGDRVVIPFVIACGECFFCKLNQYA
                     ACETTNSGKGAALNPKKITPPAALFGYSDLYGGIPGGQAEYVRVPKANTGPFKVPDGL
                     ADEKVLFLSDILPTAWQAVKNAGLMPGSSVAIFGAGPVGLLSAACARLAGAEQIFMID
                     HHPYRLAFAQERYGVIPINFDENDDAAAWIIEHTAGHRGVDAVIDAVGFEAKGSVTET
                     ILSNLKIEGSSGKALRQCIAAVRRGGIVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQT
                     HVHAYLPDLLMLIESGQLKPEEIVTHHMPLEDAAKGYSLFEKRQEDCRKIILLPGTPS
                     RVSAA"
     gene            complement(292972..295482)
                     /locus_tag="RAHAQ2_RS23330"
                     /old_locus_tag="Rahaq2_4842"
     CDS             complement(292972..295482)
                     /locus_tag="RAHAQ2_RS23330"
                     /old_locus_tag="Rahaq2_4842"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malto-oligosyltrehalose synthase"
                     /protein_id="WP_014341847.1"
                     /db_xref="GI:504107861"
                     /translation="MKIPTATYRIQFRNGLDFDTATGLIPYLKQLGISHLYASPVFTA
                     TSGSTHGYDITDANEIDPSIGGREGFDRMAQALKTAGIGLILDIVPNHMAASLENPWW
                     RDVIEHGEKSRYARHFDIDWSRRLTLPFLGDSFEEALEKGDITLKSDPKTGQPTFAYF
                     DTYYPVAPGTLTAVRTGGLSKTELTELHERQPYRLMCWRDAPRELSYRRFFEITGLAG
                     VRVEDDGVFDDTHRLILELVRSGVADGLRVDHVDGLADPKAYLERLREKAGADCYITV
                     EKILGKDERLPPDWPVSGTTGYEFIASLSDVLVNDENMAVLSELYDNVVGKPVDIRNE
                     LRAAKLMMVEKNFAGEFTTLWKLATGIAATEGTGYDENDVRTALCELLIAFPVYRTYG
                     TEQGMPAEDSTLLHKIQRKISTSPLAVQPEILAFLVRILCGETSAVSSSQAGLFRTRF
                     QQLTGPLMAKSVEDTLFFRQNMELALNEVGAEPLIRTFSLSRFHTGMIKRREEQPEAL
                     SATSTHDTKRGEDARARLFTLTEAPQEWAACVKRWHRMNESHVMMLADGPAPRPALTW
                     MLYQALAGAWPATLTPEDAQGLQELDERFQSFVEKALREAKLRTNWDDNNEDYEKAVL
                     DYAHHLLSPENRLFLQDFHASIQPFIHAGLVNSLTQTVIKLMAPGVPDIYQGSEALNF
                     SLVDPDNRRLPDFTGLERLLMQDKKPAGDKPESWLNGQLKQYLVSALAGLRQQKPALF
                     QQGDYVPLSASGDHGENVIAFARVNNDDAVIVVARRLVLGLQAQTFPQTEIVLPPQLA
                     YRHYRELFSNKEMTSAGRLDMAAWPGFSPVILIASSPS"
     gene            complement(295479..297266)
                     /locus_tag="RAHAQ2_RS23335"
                     /old_locus_tag="Rahaq2_4843"
     CDS             complement(295479..297266)
                     /locus_tag="RAHAQ2_RS23335"
                     /old_locus_tag="Rahaq2_4843"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malto-oligosyltrehalose trehalohydrolase"
                     /protein_id="WP_014341848.1"
                     /db_xref="GI:504107862"
                     /translation="MQRDAFMTSWGASFISAGTVRFRVRAPGQDKMTLRLSGENREML
                     PTENGWFEFVATGVSPGEEYQFILADGLPVPDPASRAQLADVNGPSLVTSSSGYAWRN
                     HDWKGRPWEETVIYEMHIGTFTPEGTFSAAQAKLAYLAETGITMIEVLPLSQFGGQRG
                     WGYDGVLLYAPHSAYGSPDDFKAFVDAAHGVGISVVLDIVLNHFGPEGNYLPLLAPDF
                     FDSQRMTAWGAGIDYQNDAARCYIVEAPLYWLKEYRLDGLRFDAIDQMQDTSSPHILI
                     EIAERIREEITDRPVHLTTEDSRNVTFLHPRNADGTVPLFTAEWNDDFHNAIHVLSTG
                     ETHAYYQDFAQNPEKLAARALAEGFAYQGEKSPQTGQPRGAVSRRQPPVAFVDFIQNH
                     DQIGNRAHGDRLLTLAGAERTHILLAALLLSPHIPLLFMGEEYGETHPFLFFTDFEGE
                     LAQAVREGRAREFEGHSGYGSQAVPDPNALSTFENSKLDWQKLTYPESQNTLALTRRL
                     LALRRKHIVPLLTPAKGEVGQIVETSAGFLAVKWVFPRGTLSLVLNIGKDTHPLPELP
                     GETLFAWPQDAAISAPCSLIVRLAPGVIP"
     gene            complement(297412..297603)
                     /locus_tag="RAHAQ2_RS23340"
                     /old_locus_tag="Rahaq2_4844"
     CDS             complement(297412..297603)
                     /locus_tag="RAHAQ2_RS23340"
                     /old_locus_tag="Rahaq2_4844"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341849.1"
                     /db_xref="GI:504107863"
                     /translation="MAPVASISGGIIFIIVGIVMLWLLVKAHKGNTSKKFFTPHKCML
                     LIGTLVSFVISIVFFTSSS"
     gene            297910..299016
                     /locus_tag="RAHAQ2_RS23345"
                     /old_locus_tag="Rahaq2_4845"
     CDS             297910..299016
                     /locus_tag="RAHAQ2_RS23345"
                     /old_locus_tag="Rahaq2_4845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_014341850.1"
                     /db_xref="GI:504107864"
                     /translation="MKLLHGLLFMLSVVITGQSGAATTTLTDVLGNKITLETPVKRAV
                     LGFYFEDYMAVGGEQAFDHIVGISREAWHGKVPANWDMYIKYRPSIASIPDIGEIDLH
                     NVSLEKVISLKPDVVILASWQYAALKYEVTQLQSLNIPVVVLDYNDQTVENHVKSTEI
                     IGILTGQTDRAHELAQLYKNNITLIEDRIRQANLPKPKVYIEFGNKGPAEYSFTYGEN
                     MWGVMLRLAGGENIAAPFVKQWGEINPEQLLVAKPDVIFISGRENNKVDTALEMGIGV
                     NEATARAKLNGFAQRDGWRSLPAIKNDKLFGVYQGASRTLVDFTMVQFIAKSLYPDLF
                     RDIDPVKNYHDYYKKYLPVMPVGTFALSASGEPH"
     gene            299414..301102
                     /locus_tag="RAHAQ2_RS23350"
                     /old_locus_tag="Rahaq2_4846"
     CDS             299414..301102
                     /locus_tag="RAHAQ2_RS23350"
                     /old_locus_tag="Rahaq2_4846"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_014341851.1"
                     /db_xref="GI:504107865"
                     /translation="MYEFNLILLLLQQMCVFLVIAWLMSKTRLFIPLVQVTVRLPHKL
                     LCYITFSIFCIMGTYFGLHIEDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGIHRYSM
                     GGMTALSCMISTIAEGLLGGLVHSVLIKRGRIDKLFNPLVAAGVTFVAEILQMLIILL
                     IARPFHDALNLVSSIAAPMMVTNTLGAAMFMRILLDKRAMFEKYTSAFSATALKVAAS
                     TEGILRRGFNEENSMKVAQVLLKELDIGAVAITDRDKLLAFTGIGDDHHLVGKPIASQ
                     YTWRAIENDEVVYADGNEMPYRCSLHPSCKLGSTLVIPLRGENQRVIGTIKLYEVRNR
                     LFSSINRTLGEGIAQLLSAQILAGKFEQQKALLAQSEIKLLHAQVNPHFLFNALNTLM
                     AVIRHDSDKAGQLVQYLSTFFRKNLKRSSESVTLADELEHVNAYLQIELARFPTQLKV
                     DLQVPEAFSDQSLPAFTLQPLVENAIKHGTSQLLSNGNIIIRAYSEGEMVIVEVEDNA
                     GLYQPEESGDGLGMSLVDKRLRARFGDDYGITVSCKPDDFTRVTLRLPVEGATC"
     gene            301096..301815
                     /locus_tag="RAHAQ2_RS23355"
                     /old_locus_tag="Rahaq2_4847"
     CDS             301096..301815
                     /locus_tag="RAHAQ2_RS23355"
                     /old_locus_tag="Rahaq2_4847"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341852.1"
                     /note="unknown function; when overproduced it confers
                     drug-resistance; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014341852.1"
                     /db_xref="GI:504107866"
                     /translation="MLRVLIVDDEPLALENLRLQLQDESDIDIVGECTNAIEAIGVIH
                     KIRPDIVFLDIQMPRISGLEMVGMLDQQHRPHIVFLTAFEEYAVQAFEQCAFDYLLKP
                     IQAARLQKTLARLRLGYQTQDVSQLPQYQQPLKFIPCISSNRIWLLQMEDVAYVSSRV
                     GGVYVTGQDGKETFTELTLRTLEVRTPLLRCHRQYLVNMDYLKEIRLEDKNQAELLLR
                     DGQIVPVSRRYLKSLKETVGL"
     gene            complement(301837..302808)
                     /locus_tag="RAHAQ2_RS23360"
                     /old_locus_tag="Rahaq2_4848"
     CDS             complement(301837..302808)
                     /locus_tag="RAHAQ2_RS23360"
                     /old_locus_tag="Rahaq2_4848"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_037041032.1"
                     /db_xref="GI:739177077"
                     /translation="MTPIAVTVLTGFLGAGKTTLLRQILHTQQQIKIAVIENEFGEMP
                     IDNQLIGDRATRITTLSNGCICCTRSGELEAALLDLLDSVDKGEVRFDRLMIECTGMA
                     DPGPILQAFFAHEIICERYVLDGVITLVDAVHAMSQLDQFPLAQSQIGYADRILLTKT
                     DVAGECPELAERLQRINARAPVYKMVQGDIDPALLFDTRGFMLEENVVAARPRFHRIA
                     PQQNAVSSIVVELDYPVALKAISAVMEELLASFADNLMRYKGMLWIADQPCRLLFQGV
                     QRLYSADWDREWQADETPHSALVFIGMQLPETEIREAFARLRPACLI"
     gene            complement(302856..303059)
                     /locus_tag="RAHAQ2_RS23365"
                     /old_locus_tag="Rahaq2_4849"
     CDS             complement(302856..303059)
                     /locus_tag="RAHAQ2_RS23365"
                     /old_locus_tag="Rahaq2_4849"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008460696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341854.1"
                     /db_xref="GI:504107868"
                     /translation="MFDNLGAAKKYLGQAARMLVGIPDYDTYVLHMQTNHPDTTPMTY
                     EEFFRERQQARYGGDGKGGMRCC"
     gene            complement(303119..305272)
                     /locus_tag="RAHAQ2_RS23370"
                     /old_locus_tag="Rahaq2_4850"
     CDS             complement(303119..305272)
                     /locus_tag="RAHAQ2_RS23370"
                     /old_locus_tag="Rahaq2_4850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon starvation protein A"
                     /protein_id="WP_037041008.1"
                     /db_xref="GI:739177053"
                     /translation="MNKKALFKHIPWMIVALLGACCLGVVALRRGEHISALWIVVASV
                     SVYLVAYRYYSLYIAQKVMKLDPSRSTPAVINNDGLNYVPTNRNVLFGHHFAAIAGAG
                     PLVGPVLAAQMGYLPGVLWLLAGVVLAGAVQDFMVLFISSRRNGASLGEMIKEEMGPV
                     PGTIALFGCFLIMIIILAVLALIVVKALAESPWGVFTVCSTVPIALFMGIYMRFIRPG
                     RVGEISVIGVVLLVAAIWFGGVIASDPYWGPALTFKDTTITFTLIGYAFVSALLPVWL
                     ILAPRDYLATFLKIGVIVGLAIGIVILNPELKMPALTQYIDGTGPLWKGALFPFLFIT
                     IACGAVSGFHALIASGTTPKLLACETDARFIGYGAMLMESFVAVMALVAASIIEPGLY
                     FAMNTPPAGLGITMPNLHELGGDNAPMILAQLKDVTAHAAATVSSWGFVISPEQIMQT
                     AKDIGEPSVLNRAGGAPTLAVGIAHVFHKIMPLADMGFWYHFGILFEALFILTALDAG
                     TRSGRFMLQDLLGNFIPFLKKTDSLVAGIIGTAGCVGLWGYLLYQGVVDPLGGVKSLW
                     PLFGISNQMLAAVALILATVVLVKMKRTKYIWVTMLPAIWLLICTTWALGMKLFSTNV
                     QMEGFFYMAGQYKARISAGGANLTPEQISNMHHIVINNYTNAGLSILFLIVVYSIIFY
                     GIRACLQARKTDKRTDKETPYVPVPAEGIKISAGH"
     gene            complement(305805..306284)
                     /locus_tag="RAHAQ2_RS23375"
                     /old_locus_tag="Rahaq2_4852"
     CDS             complement(305805..306284)
                     /locus_tag="RAHAQ2_RS23375"
                     /old_locus_tag="Rahaq2_4852"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="WP_014341856.1"
                     /db_xref="GI:504107870"
                     /translation="MSNPAYIWLVDENGSPIVGDSLVSGRLGAIELKSVNHNVSIPTD
                     QHTGRLTGTRVHSPISLQKEFDKATPILYRALCQGVTLQSATIKMYQITETGTEAEYF
                     NIILDNVKIVAITPNLYPGGQTGTHFENILLHYETITWKYCDGNIIYKDTWNNRAVA"
     gene            complement(306522..307172)
                     /locus_tag="RAHAQ2_RS23380"
                     /old_locus_tag="Rahaq2_4853"
     CDS             complement(306522..307172)
                     /locus_tag="RAHAQ2_RS23380"
                     /old_locus_tag="Rahaq2_4853"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341857.1"
                     /db_xref="GI:504107871"
                     /translation="MNSYDEISTRIAEIIISPDSAIGFIHGILSVPVDLGYLAYGYLN
                     TESRYSNQTETIRIIQAIDNGILNYDRIIEAIQIVFKRFDKYVSESEKNKIYSRTIFS
                     VLGRTTANSFLSGKIATAICGQASVFITLRGGLIGNILLAGGMTERCIRTSEKLSVDE
                     PDVYELLRAKNYDLLYFMFEPALKPFVDALTVRRNQGIYAFKTILDLVESKVNGYV"
     gene            307598..308017
                     /locus_tag="RAHAQ2_RS23385"
                     /old_locus_tag="Rahaq2_4854"
     CDS             307598..308017
                     /locus_tag="RAHAQ2_RS23385"
                     /old_locus_tag="Rahaq2_4854"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341858.1"
                     /note="binds with UmuC protein to form functional DNA pol
                     V (UmuD'2UmuC); involved in translesion polymerization;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V subunit UmuD"
                     /protein_id="WP_037041002.1"
                     /db_xref="GI:739177047"
                     /translation="MQFLTANEPRQFVTFPLFSDLVPCGFPSPAQDYVERRIDLNELM
                     IQHPSATYFVRVTGDSMIDAGIGEGDLLVVDSSRKAEHGHIVIAAVDGEFTVKRLQLH
                     PVVMLKPENSVYAPIMIGGEENLEVFGVVTYIVKTAS"
     gene            308020..309285
                     /locus_tag="RAHAQ2_RS23390"
                     /old_locus_tag="Rahaq2_4855"
     CDS             308020..309285
                     /locus_tag="RAHAQ2_RS23390"
                     /old_locus_tag="Rahaq2_4855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341859.1"
                     /note="binds processed UmuD protein to form functional DNA
                     pol V (UmuD'2UmuC); involved in translesion
                     polymerization; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V subunit UmuC"
                     /protein_id="WP_014341859.1"
                     /db_xref="GI:504107873"
                     /translation="MFALCDVNSFYASCETVFRPDLKGRPVVVLSNNDGCVIARSAEA
                     NAFAKMGEPYFKQKELFRRHGVVCFSSNYELYADMSNRVMTTIEEMSPRCEVYSIDEI
                     FCDLTGVRHCRDLTEFGREIRATVLQRTHLTVGVGIAQTKTLAKLANYAAKKWQRETG
                     GVVDLSNVEHQRKLMAALPVGEVWGVGRRIAKKLDSMGIKTVLQLADTDIRFIRKHFN
                     VVLERTVRELRGESCLELEEFAPVKQEIVCSRSFGDRITEYEEMRQAICSYAIRAAEK
                     LRHEHQHCRFISAFIKTSPFGVNESYYGPSSSVNLLTPTQDSRDIIAAATRCLEAIWK
                     EGYRYQKAGVMLGDFYSQGVAQLNLFDENPPRHNSQKLMGVLDYLNAKKGRGTLYFAG
                     QGIRQQWQMKREMLSPRYTTRYQDLLVIK"
     gene            309651..311267
                     /locus_tag="RAHAQ2_RS23395"
                     /old_locus_tag="Rahaq2_4856"
     CDS             309651..311267
                     /locus_tag="RAHAQ2_RS23395"
                     /old_locus_tag="Rahaq2_4856"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="WP_049796169.1"
                     /db_xref="GI:908659719"
                     /translation="MRKGRLYGFLVWLSFFTSFLLQAAEPRQMPSDQEKARTVYIFHQ
                     PVVMLQAKFGLSTPEERVLRIRNTLRSLSGEDIRHPVQILPVQRYGQQGRLLVINGKP
                     LMLLAESDLDEGDDLTLDQAAQRVLARFNAQRISLTEQYSSTYLTIATLKVVAGTAVL
                     ILLYYAAFTSWAKVKAYFTARILLKKGWIPYRWRSLLGAVEVHLYAILMILLSIVAFY
                     LWLSWLFRLYPWTRVWGESLGDWSVNVMQKIALAIVSAFPGLMIVAIIFLITAFILKL
                     LKIMLKRVETRKLNVPGLHPETVGATRKLISVMIWLFALSAAYPFLPGANSLAFKGVS
                     VFFGLMLTLGSAGVMNHAMSGLVLIYSRALRKGDVIRIGDNEGLVSEIGMLATKIITR
                     ESYVVTVPNAVVVSGKITNLSAQNPGGGVNLTTSITIGYDTPWRQVHAMLELAASRTR
                     GIDLQHKPLVRQLSLMDWYIAYELQVHLRAGESLAAVRSELHSHIQDVFNEFNVQIMS
                     PNFVNQPETAVRVAQDNWFAAPASPPDKPT"
     gene            complement(311310..311753)
                     /locus_tag="RAHAQ2_RS23400"
                     /old_locus_tag="Rahaq2_4857"
     CDS             complement(311310..311753)
                     /locus_tag="RAHAQ2_RS23400"
                     /old_locus_tag="Rahaq2_4857"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ester cyclase"
                     /protein_id="WP_014341861.1"
                     /db_xref="GI:504107875"
                     /translation="MSDNNEIANRLIAERKAVEKIYQAFSLHNPDLLDEAVTQDWNDI
                     PLAPGQASGPEGLKPIIRGFIEAFPDVKITVHDLLQTPGKIAVRAEITGTHNGNFMGI
                     EPTGKFVSIRLHEFHELNGERVTTTWHLEDWFGAFMQLGQFPPQG"
     gene            311872..312786
                     /locus_tag="RAHAQ2_RS23405"
                     /old_locus_tag="Rahaq2_4858"
     CDS             311872..312786
                     /locus_tag="RAHAQ2_RS23405"
                     /old_locus_tag="Rahaq2_4858"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014341862.1"
                     /db_xref="GI:504107876"
                     /translation="MDFKGLDLNLLVAFDALMEERNVTRAASKAAVSQPAMSAALSRL
                     RTHFADPLFIRSTSGLLPTARAKEIGLHVSKALNELSHLLAPDDNFAPENRKISFTLG
                     TSEYPLMVLLPGIMRAISEQAPGVTLHVRTFIDRDASVSMLDAGEVDLVIGIPPTRPE
                     NRILSLPLFSDEFVTLIRRDSDAARNGMTLEAYLAMSHILVSPEGNHYGLVDEQLRKM
                     GLTRELRLTLPTMAGVAGVVQQTGYVATVLKRSVIVSEKHQNILMTPPPVALPEIPFY
                     LLWHRRSDDSNGQKWLRKLICAQARELL"
     gene            complement(312875..313735)
                     /locus_tag="RAHAQ2_RS23410"
                     /old_locus_tag="Rahaq2_4859"
     CDS             complement(312875..313735)
                     /locus_tag="RAHAQ2_RS23410"
                     /old_locus_tag="Rahaq2_4859"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014341863.1"
                     /db_xref="GI:504107877"
                     /translation="MSQPSMTYRLGDREVARLGYGAMQLAGPGVFGPVRDEARAIQVL
                     RDAVASGVNHIDTSDFYGPHETNKLIKKALYPYPDNLCIVTKVGALRDEKGGWLPAFS
                     PQELTQAVEDNLRNLGLNTMDVVNLRSMFDVRQPKEGSLEPQLEALLMLKERGLIRHI
                     GLSNVTAKQVADAQKLTTIACVQNMYNLANRHDDALVDSLAEQEIAYVPFFPLGGFSR
                     LQSTQLDEVAAQLQATPMQVALAWLLKRSPNILLIPGTSSPQHLQENLASSKVILSDE
                     VMEKLNGMAG"
     gene            313831..314766
                     /locus_tag="RAHAQ2_RS23415"
                     /old_locus_tag="Rahaq2_4860"
     CDS             313831..314766
                     /locus_tag="RAHAQ2_RS23415"
                     /old_locus_tag="Rahaq2_4860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014341864.1"
                     /db_xref="GI:504107878"
                     /translation="MPMDIALLHAVVEVAKAGGFREAARVTGSNASRLSDAVRRAEQQ
                     LGIRLFHRTTRAVVLTEAGRALLEKLIPAMNEVDAALDVLNHYRNTPGGTLRLNVPVS
                     ATRLVLPALVPEFLRRYPDIQLEIIAESNVQDVFRDGCDAGIRYDERLEQDMVAIPIG
                     PHRQRYAAAASPDYLNAHGRPAHPRDLIQHRCLRGRYASGIMPDWEFEREGESLSVQV
                     SGPLVVSVGGAVDLAVETAVAGAGIIYLFEEWLRPAISSGKLEAILQPWWLSFSGPYL
                     YYNDRRLIPAPLQAFIDFVREDNLKRNCSVESIKP"
     gene            complement(315069..315644)
                     /locus_tag="RAHAQ2_RS23420"
                     /old_locus_tag="Rahaq2_4862"
     CDS             complement(315069..315644)
                     /locus_tag="RAHAQ2_RS23420"
                     /old_locus_tag="Rahaq2_4862"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341865.1"
                     /note="membrane protein YebN; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014341865.1"
                     /db_xref="GI:504107879"
                     /translation="MQLYTILILAFGMSMDAFAAAIGKGASLHRPPLKEALRTGLIFG
                     VIEAITPVIGWGIGLAASQFIMSWDHWVAFTLLLILGIRMIVEAFRKGHAEEDAQAPR
                     RHGFWVLVTTAVATSLDAMAVGVGLAFLQVNILVMALAIGAATTIMATSGMLLGRFLG
                     AAMGKWAEILGGVVLIGIGTSILVEHLGLLG"
     gene            316147..316626
                     /locus_tag="RAHAQ2_RS23425"
                     /old_locus_tag="Rahaq2_4863"
     CDS             316147..316626
                     /locus_tag="RAHAQ2_RS23425"
                     /old_locus_tag="Rahaq2_4863"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341866.1"
                     /db_xref="GI:504107880"
                     /translation="MSNTQYKLSKARPPRVQITYDVEVGGAESKKELPLVMGVIGNFS
                     KDDMPLRDRRFTHIDKDNFNNVMEGMKPAVEMLVESTLPEKEGQMAIALEFNSMDDFS
                     PENVAMQVEPLRKLLELREQLSDLRNRTASNDRLKEQLVELLEGMTKNAEPAKGDAE"
     gene            316623..318104
                     /locus_tag="RAHAQ2_RS23430"
                     /old_locus_tag="Rahaq2_4864"
     CDS             316623..318104
                     /locus_tag="RAHAQ2_RS23430"
                     /old_locus_tag="Rahaq2_4864"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EvpB family type VI secretion protein"
                     /protein_id="WP_014341867.1"
                     /db_xref="GI:504107881"
                     /translation="MSDIQVMNAPAQAEQAGDYLDQIIDNTQAIRRESDRNKVKSQLD
                     NFLSEVASGAVIVSNDLVGSIEARIAAIDELLSSQVSKIIQAPEFQRMESSWRGLHKL
                     VQSSVTENTKVRVFNCTKKELLRDFKSASDFDQSSLFKSIYESEYGTFGGDPYSAFVG
                     DFEFDCMPEDVQLLEQISHVAAAAHAPFLSAANPGMFAMGSFSEMPRPRDLGKLFETS
                     DYARWKSFRQSDDSRYVGLTLPRVIGRLPYGAKTVSVDAFNFEEKIDENNDGSNYLWV
                     NAAYDLAGRMVEAFEEYSWCAAIRGVEGGGLVKSLPTYNYISQTGEKIMQCPTEVAIS
                     DRREKELAELGFIPLIYCKGTDYAAFFAVQSTNKPRKYDSELANANAKLSSQLQYIMT
                     TSRFAHYLKSIVRDKVGSFMSKSECQNFLQNWINQYVVGSDNVGPAIKASHPLREAVV
                     EVVDVPGSPGSYRAVAYLKPHFQLEGLSMSLRLVAELPASTDA"
     gene            318129..318623
                     /locus_tag="RAHAQ2_RS23435"
                     /old_locus_tag="Rahaq2_4865"
     CDS             318129..318623
                     /locus_tag="RAHAQ2_RS23435"
                     /old_locus_tag="Rahaq2_4865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin-coregulated protein"
                     /protein_id="WP_014341868.1"
                     /db_xref="GI:504107882"
                     /translation="MSDADNLFMQIEGITGCVSDKKYNGWIAVDYTSNSVFSSAAINN
                     GTGQMNSDGVRFEQVSFSKEMDATSTDLMNMVAEGTNIKKIIVAMNVKTDNKDNEMVR
                     WTYQNCILTSHQIGASKAGGIPHETLSFVFGRIEFETQMVEPGGTTKKYGPVGWNIIE
                     NTKL"
     gene            318677..319093
                     /locus_tag="RAHAQ2_RS23440"
                     /old_locus_tag="Rahaq2_4866"
     CDS             318677..319093
                     /locus_tag="RAHAQ2_RS23440"
                     /old_locus_tag="Rahaq2_4866"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341869.1"
                     /db_xref="GI:504107883"
                     /translation="MKSLLQQLSDNNPKDQNDISEEEDKSSTLIDEILLLLSSRPRSY
                     RIDDIPLINESILNYGVSDVFSSDTPRLERNTIMQSRIQMALQRFEPRLKNVCVTPGE
                     ELGSLCSFIINAETLNGEVRYRLMWDDVISQFSLRD"
     gene            319106..320908
                     /locus_tag="RAHAQ2_RS23445"
                     /old_locus_tag="Rahaq2_4867"
     CDS             319106..320908
                     /locus_tag="RAHAQ2_RS23445"
                     /old_locus_tag="Rahaq2_4867"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341870.1"
                     /db_xref="GI:504107884"
                     /translation="MLAKKLISYYQNELAYLKTQGKAFARHFPKVARRLGMSEGTSED
                     PHIERIIESFALVTAQIQQRLDEDMPEVTDALLTVLAPQFLRPFPSVCIVQMQPDSKV
                     SALTASNRIDAGTALYSRPVNGQVCRFRTIYPVTLQPVSLYKASLHLDADDMSWSLKI
                     QLSVWPGATLAADSLRLHLSGASRIVNIFYTLLCSEVESLTVFQQGQSYTLSAQAIRA
                     VGFGENESLLAGDSRVSPTHSLLQDYFFFPQKFHFIDIPLPAGMVAGSQSELSLVVKF
                     NRCMIARQLEKIAGAVNENLFLLNCTPAVNLFAHRAEPISPDHETAEYPIIPDIRHQD
                     AMEVWSVDSVSAMRKLGNETQSRPIYPLFGLDHSASDGESGLFWQCMRRETIQNNGVA
                     TSLFIAFSDRGESPLAPGCDIVSMNLTCTNRDIPGAMRNGDPDGDFESELPIAGMKII
                     ALTRPTLPVRPPVKQATRWRLISQLSLNHMLISGPEGARVLRESLALYNFVDNPGITR
                     LINLILRVDSSPVVTRLAPLDPRSMARGIEIRITFASEAAEEVEYFLLCRFIDCFLAL
                     YAPVNSFTRVITCIDSSGETARTWPVRAGRLSWI"
     gene            320899..321846
                     /locus_tag="RAHAQ2_RS23450"
                     /old_locus_tag="Rahaq2_4868"
     CDS             320899..321846
                     /locus_tag="RAHAQ2_RS23450"
                     /old_locus_tag="Rahaq2_4868"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341871.1"
                     /db_xref="GI:504107885"
                     /translation="MDLSNILSPHNFFQQVRLMLRRLTRTQGKNSQQALETQLYFISP
                     LSLDAPKGDITSITPLDQQRWQVEVAAHGLTGALGALPTVYTEWMIDRYYRHGDKTAK
                     AFLDIFNHRLHSLRYLAWQKYHYYAMAEFSATRPLSQAIHALSGVANSTPSQQQEQFA
                     DLFAHSVRSMLNVETWLKHRFSVAAKVTPFTGGWQVMDQAQCCRLGEPSQTLAAAPML
                     GSVYWDRQSHFTVTLGPVPMKNAGLFLPKGKHYQNLWSHLREYVGQGLDFDIDLLIDN
                     TANVVTPLGSGQLGLDICLGPSGGAGQHKIRLPVCREGK"
     gene            321850..323763
                     /locus_tag="RAHAQ2_RS23455"
                     /old_locus_tag="Rahaq2_4869"
     CDS             321850..323763
                     /locus_tag="RAHAQ2_RS23455"
                     /old_locus_tag="Rahaq2_4869"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
                     /protein_id="WP_014341872.1"
                     /db_xref="GI:504107886"
                     /translation="MSNVVGQDNRFIRFVGSAADSLTLMHIEGDEQFSDTFSYQIRFR
                     TSLITPQMGRFLGHEMACEIGRGNQKRYVHGVLTHIEEDNSVNGISTFTGTLEPRMAL
                     LRLGRNLAVFQNITVPDLVCKLLRQQNISHIDLRLRATYQPREYCIQYRESDFDFISR
                     LLEQEGIYYFFQHDAGQHTLVLADHPSSHQSGKTAELPFMPLQGRGDGVGILNWVACS
                     SLAASSVMLKGFNMVQAASVEGESKAVDADYSVPGVSYVDAHGHEKRELLQSEARLKM
                     EQLEADNQLFYAEASVWGLGCGDKFLLSGHPSCQGNYRIKSVHMHASSNIDDGQPDFG
                     CALTVLKDSLSWRPPCLTRQPEIAGILTAIVVGPKSEEVHTDEYGRIKIQFPWDRENK
                     HDDGSSCWVRVSQSWAGGRFGAMFLPRVNSEVTVSFVHGNPDYPLVTGSVYNGQNKPP
                     LSLPEEKNHAGFVSRSSLNGNVEEGHELRFDDKKGEERLLITSQKDLLLTVKNDVTTR
                     ITKNVNETIGENRTTELTKGNENLTLKQGDYVLDIKGNLQESLTSGNHQLNISGGGST
                     VKADKACVIESTQSIELKVGSSKITLSPSGITLSGTTIKIEGKGTAELKGAMVTVQGS
                     GMTQIKGGVTMIG"
     gene            323777..324292
                     /locus_tag="RAHAQ2_RS23460"
                     /old_locus_tag="Rahaq2_4870"
     CDS             323777..324292
                     /locus_tag="RAHAQ2_RS23460"
                     /old_locus_tag="Rahaq2_4870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341873.1"
                     /db_xref="GI:504107887"
                     /translation="MKEKLLTPEALAVYNPLQNGAENAAQLMIAERWEDALASVVADS
                     VQEKLLAWTLQQALGRPESHEPAVQQCASEIHQWLAEPDDDRRFRIFQQAERLGFDTP
                     VGALGLSLFWMQGSMTPAEFDAVYPEPHLSRLMLHCALKLLSVAIATEDAPLKGAQTL
                     LSQWHAARGGD"
     gene            324292..324591
                     /locus_tag="RAHAQ2_RS23465"
                     /old_locus_tag="Rahaq2_4871"
     CDS             324292..324591
                     /locus_tag="RAHAQ2_RS23465"
                     /old_locus_tag="Rahaq2_4871"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341874.1"
                     /db_xref="GI:504107888"
                     /translation="MGQPAARVGDMHVCPMVTPGLPPIPHVGGPVTTPGTPTVLIGGM
                     PAATMGSMAVCVGPPDTVVMGSAKVLIGGKPAARMGDSTAHGGTIVAGCPTVLIS"
     gene            324603..325667
                     /locus_tag="RAHAQ2_RS23470"
                     /old_locus_tag="Rahaq2_4872"
     CDS             324603..325667
                     /locus_tag="RAHAQ2_RS23470"
                     /old_locus_tag="Rahaq2_4872"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341875.1"
                     /db_xref="GI:504107889"
                     /translation="MIMNFEPLFAPVSAEQPAGRNMEYEQVYNEIREARESDPDYLPQ
                     GEWATELRKADWSKVVRLSSQVLQKESKDLQVACWLIEGLSHQHGISGLLGGIGFLIP
                     FIQNYWQNGWPEMDEDGAVIRHGMINRLDRQLAQMMHCHPLFGQPESTLDHWRKVLAY
                     EHRVTMKPDSAAERGSDDDFSMDTFNRWAATLDPQKVIAQNEALTQLETTLDTLEALY
                     GQLNPQADSLAMGQMRSATAEMQEFVKRLFDRAAPAYDDVMTLNVLTPDEDEQGTDVS
                     SLMNNTKKQTMSRDLAISQMLTIAHFFRQTEPSSPVPFLMERAARWAAMTLTEWLEEM
                     LQDDSSMRDINKVLKGHGRE"
     gene            325664..326239
                     /locus_tag="RAHAQ2_RS23475"
                     /old_locus_tag="Rahaq2_4873"
     CDS             325664..326239
                     /locus_tag="RAHAQ2_RS23475"
                     /old_locus_tag="Rahaq2_4873"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_049796162.1"
                     /db_xref="GI:908659712"
                     /translation="MRWKTGLTTLMLGVMLLTGCASDNDQGRQKAISEVAAPFANGAI
                     TLKLRAEPGLNSLNEMPNSCTVLLLQARDKPTLDKILGNPATLKSLFAGAGSEGDVLQ
                     VDRYVMMPGQTNTVHIDRARDTRNVALVAGYYPFPMKKHMVSAGVPVESESTGWWEPV
                     WQAHLAPVTLSVTLGSESIVSSDVPVAGEKK"
     gene            326239..327633
                     /locus_tag="RAHAQ2_RS23480"
                     /old_locus_tag="Rahaq2_4874"
     CDS             326239..327633
                     /locus_tag="RAHAQ2_RS23480"
                     /old_locus_tag="Rahaq2_4874"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_014341877.1"
                     /db_xref="GI:504107891"
                     /translation="MYPEQQQIYWHSGLYLQPQHFQSLDLHYEWNLAEHLRLAQPYNY
                     GLIEVSINEAALNDYVISVEQIRCILPGGTLLSQPGNSRVEQRNFRDFWKQRDQPMTL
                     WLAVRRFDPLHSNVTTLEKEHDRAVTRWINTSEERVMKDVYDHAPDAAVARLCYNVRL
                     LTDIEKDDAVDCECIPLTRLRYENERVILDPTFSPPSVTLFGSFSLGKLIDTIYFELS
                     ARARKLEEYKRSERLVSDAERGDQVTQLLAMRSLNRVLPQLKNFCQARQVHPWQVYNM
                     LCQLVGDLSSFNDSCSFLGEWHDGENPLQTYNHNDLLSCFESARKTLITLLNSLVLED
                     NTYITLENDLQGVFTGNFDSMQSKNAETVLLLLRSASMPMENRQIKNPGGIKLASPKM
                     IEPLIQHALPGIPVIRCPQPPRGVPNRSDSHYFLVEQDSELWNKARQHNSISFYWPDM
                     PEDLQVQIIFVVPS"
     gene            327630..328253
                     /locus_tag="RAHAQ2_RS23485"
                     /old_locus_tag="Rahaq2_4875"
     CDS             327630..328253
                     /locus_tag="RAHAQ2_RS23485"
                     /old_locus_tag="Rahaq2_4875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341878.1"
                     /db_xref="GI:504107892"
                     /translation="MMSLLNCYLPLFRYVTAFFIHPQEYPDYNAFREKSITLLQQALL
                     ESERHHETTECEDAYFAVVLWVDERVLRSRADWVKEWRGDLLQKYYFDISVGGEAFFD
                     RLDETDKNNIQLRMVYLFCLLMGFHGKYTSQDAQLLQQRIEDERQCLPQAWRQWPNDA
                     LLVEQDTGGEKNKTVVKRLRQRKGLLLALPVIIYLVILSTGLGIFFR"
     gene            328257..331694
                     /locus_tag="RAHAQ2_RS23490"
                     /old_locus_tag="Rahaq2_4876"
     CDS             328257..331694
                     /locus_tag="RAHAQ2_RS23490"
                     /old_locus_tag="Rahaq2_4876"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341879.1"
                     /db_xref="GI:504107893"
                     /translation="MFKKLLSFVAWTLFLCLLLIICVVMSVALEQTLLHAFILWLILI
                     VVVLFSRFVWGSVSGIAQAKYISSLKAKFKLTRLEYVLFEHWKTGAAVIKRIRRRKQP
                     IPWFVLTGGRSGKTTLMAGAGLPLFSNEPESSLVVPTRTLRWWFFRSAGFLDLSSHFL
                     SKTPAFERGWLRLVNWCARLPAPAGIVVCVSVSELLEQDDAELHLHARHIRTQIEPLV
                     SKVRRRLPVYLFITCCDRMPGFSHWANKLSAVQRQQPLGYYWRDSPVVDGKDPALLDP
                     LFACVKDGLDKVRVSMLSGGEPDGETLALMDFPEQLPQLQPAMQRYLAALCEPDAYFQ
                     PAALGGIWFTATEPVSKNSASRQAFFIHDLMTRLLPALSRQRDIEPVGFGRRYLHKWG
                     AMTCSALAIMYLLVSGYFTRHLTDGTPTQMDIMAQVQQLENIEGWNAHPLKYLPFVPV
                     INHRHAQLEASILAASPRDKVNLHEIADNYQQQFNDAVPQQKRALILDLASTLITKQA
                     MWEKQPVSALVKRAPVPAALSMTGATVPLPPQQDVVLQRALLQLPEGGEQLAVLRELL
                     GRLVNSDPQMAWLVAPSDDLTPVNLTDFLPWSEDKTQISGLWTLQGTAQIQNWLEEIR
                     RAGSQQVPMPELAAFEQRWPALRQTQWMTMMLAMDQQSAPALTHEQWQTALIALDQGN
                     SPSMKFARYINEQLEDISAHDAARWLRELRRLNQLQAMSVPGALVPRISKFQQSVQKK
                     IATWLKIDSKTLKPVVSDLNIKNWNAWQTSLHAAVADVFATPKSSDRLTRGLFQTGAA
                     GDSNPLQLLDSRFNVMRKSLSAEHDDFAINAVWALYQNDARWLVAHAMQRSACWLEQQ
                     WQSRVLWPMENNASRLEYDDQQDLAWQYLSDFIRGPAKSVLVVEDNGPKAGEFNGQTP
                     GLTPEFLRMVNHVLRPDDVLAMPERESTRNDDALSALKDEQSELEAQMAELEAKPLEL
                     TLKSLPATIPGGARLMPVGTRLTLFCDEQQWKLNSMNFSEQATFHWRPGHCSRATLMI
                     NFPGFDLTYEYFGDAAWPDFLHDISDGQHRFKAEDFPDEAAQLAALGIKEVMVRYQSA
                     AQNLIQDSWHQWQALSQALNDNAQAQQEAGSRNAEKKRPTALKSAFSQLPVRITECH"
     gene            331740..334310
                     /locus_tag="RAHAQ2_RS23495"
                     /old_locus_tag="Rahaq2_4877"
     CDS             331740..334310
                     /locus_tag="RAHAQ2_RS23495"
                     /old_locus_tag="Rahaq2_4877"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_014341880.1"
                     /db_xref="GI:504107894"
                     /translation="MGNYLKQIVEKMNVEARECLDAAISLAVSRTHHEVDVEHLLLAL
                     MTRNPALIEQLCLSAGLRGDTLIDALKISLNHLRSGNTRSPVLSELLVEHLEKSWLHA
                     SACWQQTQLPVQAFLGSLIASEKDNQIHLSSALQQALLCQTDRADRLLHDACAPAQAT
                     NHPAATRHNTDSAVMKFTRNLTEQARNASLDPALGREQEIRQLIDVLLRRRQNNPVLT
                     GEPGVGKTALVEGLAQRIADGTVPQALKTMEILSLDMGLLQAGASVKGEFENRLQTLL
                     REVKEYPSPVILFIDEAHTLIGAGGQAGQNDAANLLKPALARGEMRVVAATTWAEYKK
                     YFEKDAALARRFQVIKVAEPDEESATAMLRSLKPALSKHHGVQILESALVAAVRLSSR
                     YISGRQLPDKSISLLDTACARVAISQCHEPKEIEDLNAMIANIHTERESLLKEGDNLS
                     RVKWLDQRESELMQSLEALLPLWRQQQQIVAQINRTEDVAQIAALRLQLAEMHKEQAM
                     VYDCVDATCVADVVAGWTGIPLGRMMEKEQQQLGDLVARLESRVIGQSHALADIAQQI
                     RIGRANLADPVKPTGVFMLAGPSGVGKTETALALSELLFGGEQSLITINMSEYQEAHS
                     VSGLKGSPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEKAHPDVMEIFYQVFDKGVME
                     DAEGQLINFRNTLIILTSNLASDRVMTACASGNTDQKSLTALLRPEFDQFFRPALMGR
                     LQLIPYLPVVGETLAKIIRLKIDKVCKRFSGAGEGHSSLSYSEKVVEFIASRCEVEQS
                     GAREIDAVLNRELLPLLTDRLLALENKTAIRLQLGVSKGQLTLIKQPAAKNSVAKQSV
                     "
     gene            334331..335668
                     /locus_tag="RAHAQ2_RS23500"
                     /old_locus_tag="Rahaq2_4878"
     CDS             334331..335668
                     /locus_tag="RAHAQ2_RS23500"
                     /old_locus_tag="Rahaq2_4878"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341881.1"
                     /db_xref="GI:504107895"
                     /translation="MKNRVNLRALKINGHDPRLSKSFLLLSSELSHLSGSLPARLDWN
                     ALEERCFQLFHEYGYDLQSGMWFCLINLRLKSWKGLALALDLLSTAFTHNSQRCWPPV
                     AAVQQRQQLIDWFNANVATHIYTLEYGPENSGEMRQVERSIGILCGQSKNLQSRSHDS
                     LNNLHYFLQVRCRSVPYPVQLKVTKPLPVAVENTSQPANDKKASEAVTDDIMPHVQAP
                     EIQLAEAPRLRPLLWGLGGMAAGIAVCAVAAAFWFSSQTRSLSEKLSAPLLALQRSER
                     QLNDAWNNVQESELSAQKEAVLADAAPVLTWISEQPADILLRHGEILSDHLEKAYPGN
                     EYSLQWRRTLDEKAGDIPALDGFILANKHLDELEIRLLNAEKKHSQYMTVSELKTAVY
                     QIRQDLQRNGTTAETLLWMMQQDKENHREVNPALLKQFTQRTVALNAYRFANE"
     gene            335739..336494
                     /locus_tag="RAHAQ2_RS23505"
                     /old_locus_tag="Rahaq2_4879"
     CDS             335739..336494
                     /locus_tag="RAHAQ2_RS23505"
                     /old_locus_tag="Rahaq2_4879"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000170816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341882.1"
                     /db_xref="GI:504107896"
                     /translation="MHPAEERLKRLLPFIITTAKQQVNVALEALERRKLSDDTRKILK
                     ELLNEDDSATVKKLTHSLNKIRRRMTSLAPEHFDLAEELYEAGGDTIGYVKATDAKDF
                     KKGTNKKYIALSYIHTGRMHVDDIAATVIHELSHLILNTEDHAYSICMSKQASGLFTP
                     WSVKELHSYARGKNSNPLNNAETLSRIVLLIYFSVSKLAAYKKAYALYWESGDNKILA
                     FHRMEPGQNPRISSPVLARKSNKLRIVNGHVVI"
     gene            336657..338531
                     /gene="trkD"
                     /locus_tag="RAHAQ2_RS23510"
                     /old_locus_tag="Rahaq2_4880"
     CDS             336657..338531
                     /gene="trkD"
                     /locus_tag="RAHAQ2_RS23510"
                     /old_locus_tag="Rahaq2_4880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341883.1"
                     /note="Responsible for the low-affinity transport of
                     potassium into the cell; involved in potassium ion uptake
                     under hyper-osmotic stress at a low pH; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter Kup"
                     /protein_id="WP_014341883.1"
                     /db_xref="GI:504107897"
                     /translation="MKQTKNKSSLLTVTVACIGVVYGDIGTSPLYTLRECLTGQAGIA
                     VTQSALFGFLSLIFWLLMLVVSVKYISFVMRADNDGEGGILTLMALAIRNLNPRWIPC
                     IMFIGLVGGSFFYGDGVITPAISVLSAIEGLEIIAPSLDRFIIPFSIAVLTLLFFIQK
                     NGTGGVGKIFAPVMVVWFITIGALGIGGILRNPDVLQALNPYWAMHFFVEFKTVSFFA
                     LGMVVLSVTGGEALYADMGHFGKKPIRIAWFVLIGPSLVMNYFGQGALLLSQPAAIKN
                     PFFLLAPDWALVPLLVLATLATVIASQAVISGVFSLTRQAVRMGYLPPMRIIYTSDVE
                     SGQIYIPVVNWLLYSAVLIAIVSFKHSSNLASAYGIVVTGTMVITSVLIGIVMIKNWG
                     WKSWAGGLVITAMLLIDVPLFAANLSKIFSGGWLPVAIGLTILVIMLTWKTERSRLLR
                     RLRQDPEALEALITSLEKSPPQRVPGTAVVMSRGQYEVPLVLLHNLKHNKILHERVVL
                     LTIVTEDVPYVHNVQRVIIEPLSPTFWRVIARYGWREKPNVTDILYRCGLEGLQSNMN
                     ETSFFMSRDTFILGEPRPWYLKARGKLFQVLQRNSLRAPEHYHIPPNRVIELGAVVKY
                     "
     gene            complement(338577..339374)
                     /locus_tag="RAHAQ2_RS23515"
                     /old_locus_tag="Rahaq2_4881"
     CDS             complement(338577..339374)
                     /locus_tag="RAHAQ2_RS23515"
                     /old_locus_tag="Rahaq2_4881"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341884.1"
                     /db_xref="GI:504107898"
                     /translation="MSYRFTLAAVAAVLTLTGCAKSKTAEQAPAFDFGSTRVTVTHIP
                     TKTDDGTKLYVTIDGKDAGTLGIGESMEVQLPEGKHKVGGYARSLIGRVTISPVEVAT
                     SRDVISHVTYSVANLKPTFLVRASTPVPKPKSESIPAEPVPSMPKQIEAPAAAEQAQA
                     ATPAAPVTAPQTQAATPAAPVTAPQTQAATPAAPVTAPQTQAATPAAPVTAPQTQAAT
                     PAAPVTPQETQTPKVTELTPTTQSQTSQATQGSATPVITDLTSAPQT"
     repeat_region   338704..338900
     gene            339763..340650
                     /locus_tag="RAHAQ2_RS23520"
                     /old_locus_tag="Rahaq2_4883"
     CDS             339763..340650
                     /locus_tag="RAHAQ2_RS23520"
                     /old_locus_tag="Rahaq2_4883"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydrolase"
                     /protein_id="WP_014341886.1"
                     /db_xref="GI:504107900"
                     /translation="MHKFHSYCISASGEERGDGDFDARFPYWSFTKTTTAICALKLSE
                     NGFVDLDCCIDGAAYTLRQLLNHTAGLPDYGALKAYHDAVAAGEQPWSREKLLSAALA
                     KGMLFAPGEGWSYSNVGYMLAREHIEAASGLDFAQLVADIITTPLGLTSVSQVTTREQ
                     FAELHCEAAGKYHPGWVYHGCLAGNVRDAARLLHGLFTGKLLSPASLAEMRVAYPLGG
                     ALEGRPWTACGYALGLMSGAMGKAGAAAGHSGGGPSCVNAVYHFPDLSEPVTGACFTD
                     GYYEGEAETELGRLVQNFA"
     gene            340835..341833
                     /locus_tag="RAHAQ2_RS23525"
                     /old_locus_tag="Rahaq2_4884"
     CDS             340835..341833
                     /locus_tag="RAHAQ2_RS23525"
                     /old_locus_tag="Rahaq2_4884"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014341887.1"
                     /db_xref="GI:504107901"
                     /translation="MFTPLNRTTREMKINNVVLVTDALKSLGSATKADLAVATGLSIA
                     TCGAVLNELSLRHEVLALEMEVSRGGRPAQRYAYNADFFSVLSLYAQGSDAAAQIIWS
                     VNSATGESLAQGEVRFLPLTLATFYQQIASLLADYPNIKALGVGLPGVVVKGTVATCD
                     ITAFAGIAIEQQLRDRFGLYVQVDNDMNYTAWGFYRSSCAGVTAPVAYVFKPDVPCLG
                     CGMVINGQVLQGASQFAGEVSNLPFEHLNKLPVAEEMAKVIVSLTAIINPVTIALSGP
                     KISEALIPQLTALCQQYIPAQHMPELTYRPSMRKDYLQGITELTLHNYNLHVAFGE"
     gene            341922..343094
                     /locus_tag="RAHAQ2_RS23530"
                     /old_locus_tag="Rahaq2_4885"
     CDS             341922..343094
                     /locus_tag="RAHAQ2_RS23530"
                     /old_locus_tag="Rahaq2_4885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_014341888.1"
                     /db_xref="GI:504107902"
                     /translation="MSLSSEMESVDAHAGSPARRVATRAIFFVTGMAMGLWAALVPYA
                     QLRTHSEAGDLGLLLLCLGAGSLLSMLGSGRIIGRFGCRAVIVAAVVLYCLMLPLLAV
                     FSAIWLLALSLFIFGMGIGLADVAVNVQGTLVEQAADKPLMSGFHCLWSVGGIAGAGG
                     GALLLSAGITPLGSTFFAVALVALVTAWSFRGMLPFGAHEEEGAEGKPKARPNFRLVL
                     MAVMAMICFMAEGAVLDWGGVFLTRERGLALEHAGWGFAVFAVTMSLMRLTGDAIVSA
                     LGRKRILVVGGVLGIAGYLMVVLLPGWILPLCGFALVGIGAANIVPVLITLAGQEKVM
                     PVNMSVAMVATLGYLGVLGGPAVIGFIAHLSSLYVAFSVVAAAFLIITLGAYKLKY"
     gene            343124..343951
                     /locus_tag="RAHAQ2_RS23535"
                     /old_locus_tag="Rahaq2_4886"
     CDS             343124..343951
                     /locus_tag="RAHAQ2_RS23535"
                     /old_locus_tag="Rahaq2_4886"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphatase SupH"
                     /protein_id="WP_014341889.1"
                     /db_xref="GI:504107903"
                     /translation="MAVKLIAVDMDGTFLNPQHEYNKTRFREQYQQLLAREIKFVVAS
                     GNQYYQLKSFFDDIDEQIAYVAEGGGYVVDKKEEIYCGKLEPEQVADVLHWISRTPGI
                     NTIVCGRNGAYVLNGTDDVFIRRMRRYYHRLSKVSDYAEINDTIFKFALSYREDDVYP
                     LMGEITRHLGNIVAPVTSGHGSVDLIISGNHKACGLQKIQKIYGIRDEEVLAFGDSGN
                     DLEMLSYCGFGFAMENASAPAKAAAKYTAPSNSNEGVLKVIDDVLNDRAPFVCTTHN"
     gene            complement(344016..344555)
                     /locus_tag="RAHAQ2_RS23540"
                     /old_locus_tag="Rahaq2_4887"
     CDS             complement(344016..344555)
                     /locus_tag="RAHAQ2_RS23540"
                     /old_locus_tag="Rahaq2_4887"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341890.1"
                     /db_xref="GI:504107904"
                     /translation="MKRFTPLAVVALAAALSGCVSPPTRPDVMVLPGTGKDYQQFRMD
                     EMTCRNDAYSRVNGGAQTANNNAVNTAAAGTVVGAAAGALLGAASHQAGAGALVGAGS
                     GLLIGSAMGSNGAGASSGNLQDQYDTVYTQCMYAKGNKVPVDASYGYRSPPQAQSEVP
                     PDYYPPPSGNNDVPPDYVP"
     gene            complement(344570..344920)
                     /locus_tag="RAHAQ2_RS23545"
                     /old_locus_tag="Rahaq2_4888"
     CDS             complement(344570..344920)
                     /locus_tag="RAHAQ2_RS23545"
                     /old_locus_tag="Rahaq2_4888"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341891.1"
                     /db_xref="GI:504107905"
                     /translation="MKRLLLLMLTAGVLMSASFASSAYGYYGHGYYGHGYYHGGYGGP
                     RIIVGIPWGPPPPPVYYGPPPVVYVTPAQPQTYVEKTPDYAYYCQNPAGYYPHVQRCP
                     RGWMKVVVGDSAPR"
     gene            complement(345179..345646)
                     /locus_tag="RAHAQ2_RS23550"
                     /old_locus_tag="Rahaq2_4889"
     CDS             complement(345179..345646)
                     /locus_tag="RAHAQ2_RS23550"
                     /old_locus_tag="Rahaq2_4889"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="manganese transporter"
                     /protein_id="WP_049796163.1"
                     /db_xref="GI:908659713"
                     /translation="MSKKEAGVVKEKKINPLLDVEEHAQGFLQVREAHRRELMDDYVE
                     LISDLIHEFGEARQVDLAARLGVSQPTVAKTLKRLANAGLVHQLPYRGTFLTPEGERL
                     AAENRERHNVVEAFFIALGISPETARLDAEGVEHHVSDETLEAFRRFTAEKKS"
     gene            345810..346751
                     /locus_tag="RAHAQ2_RS23555"
                     /old_locus_tag="Rahaq2_4890"
     CDS             345810..346751
                     /locus_tag="RAHAQ2_RS23555"
                     /old_locus_tag="Rahaq2_4890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-binding protein"
                     /protein_id="WP_014341892.1"
                     /db_xref="GI:504107906"
                     /translation="MGKGQNILKLFSYSPFRLRLMLVGMIVALITGNAQAAEKDKKKF
                     KIVTTFTVIQNIAQNVAGDAATVESITKPGAEIHDYQPTPRDIVKTQSADLILWNGFN
                     LERWFGRFFANIKNVPSVTVTDGIAPLPIQEGPYVGNPNPHAWMSAKNALVYVENIRA
                     ALVKYDPENAAVYDRNAKSYAEKISQLDAPLRERLAKIPAGQRWLVTSEGAFSYLAKD
                     YGLKEAYLWPINAEEQGTPQQVKKIIDLVRQQNIPVVFSESTISDKPAKQVSKETGAK
                     YGGLLYVDSLSAADGPVPTYIDLLKVTVGTIAEGFGQ"
     gene            346748..347527
                     /locus_tag="RAHAQ2_RS23560"
                     /old_locus_tag="Rahaq2_4891"
     CDS             346748..347527
                     /locus_tag="RAHAQ2_RS23560"
                     /old_locus_tag="Rahaq2_4891"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="manganese transporter"
                     /protein_id="WP_014341893.1"
                     /db_xref="GI:504107907"
                     /translation="MNDTALDLNVDDISVTYNNGHTAIENASFTLRGGSICALLGVNG
                     SGKSTLFKTIMGMIRPTHGRVTLDGLNVAKALKQNLIAYVPQSEEVDWNFPVLVRDVV
                     MMGRYGKMSFLRIPSQEDKKQVASALARVGLTELAHRQIGELSGGQKKRVFLARALAQ
                     QGRVMLLDEPFTGVDIKTENAIIELLRQLREEGHLILVSTHNIASVPDFCDRVVLINR
                     TVIASGPLETTFTHQNLESTFGGALRNIGYLMPQEPVRRVV"
     gene            347524..348378
                     /locus_tag="RAHAQ2_RS23565"
                     /old_locus_tag="Rahaq2_4892"
     CDS             347524..348378
                     /locus_tag="RAHAQ2_RS23565"
                     /old_locus_tag="Rahaq2_4892"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014341894.1"
                     /db_xref="GI:504107908"
                     /translation="MTELLLEPFQYNYMVKAIWVSAGVGAVCAFLSAYLMLKGWSLMG
                     DALSHSVVPGVAGAYALGFPYAIGAFGTGILAALSMTLLRHFTKLREDAIIGFVFSTF
                     FALGLLLVSLNPTSVNVQSILFGNILGIDDADILQVQIIVGVSLLVLCVIWRDLLAVF
                     FDEAHAVSVGLSPLWLKVIFFTIFSACSVAALQTVGAILVIAMVITPGATAYLLSDRF
                     SHLLIISVIIGAVTSAAGAWLSYFLDGATGGVIVCLQTTVFLLAFLFAPKHGWLVNHL
                     RIKNRSRA"
     gene            348375..349229
                     /locus_tag="RAHAQ2_RS23570"
                     /old_locus_tag="Rahaq2_4893"
     CDS             348375..349229
                     /locus_tag="RAHAQ2_RS23570"
                     /old_locus_tag="Rahaq2_4893"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_014341895.1"
                     /db_xref="GI:504107909"
                     /translation="MMSWFDVLMEPLSFDFMQRALLTAAATSIVCAIFSCFLVLKGWS
                     LMGDAISHAVLPGVVLAYLAGIPLVIGAFGSGLFCAVATGFIKEHCRVKEDSVMGIVF
                     SGMFAAGLVLFSRVNTEQHLSHILFGNVLGVTDSEMLQTLIIAAVVTLAIILKFKDLM
                     LFCFDPVQAKVIGLPVRFYHYALLCMLALTIVAALQAVGVVLVVAMLITPGITAFLLC
                     KTLPKMLMVSVTTSLFAAVSGTFISFYIDAATGPTIVLVQAAIFLLALTANLLRKTIK
                     PHQAAPNV"
     gene            349369..349548
                     /locus_tag="RAHAQ2_RS23575"
                     /old_locus_tag="Rahaq2_4894"
     CDS             349369..349548
                     /locus_tag="RAHAQ2_RS23575"
                     /old_locus_tag="Rahaq2_4894"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341896.1"
                     /db_xref="GI:504107910"
                     /translation="MSEVASSISVGDSFTVKNGTTHEVTGFVKKGERIYPTVKTDHGD
                     SNFTFIKEIVSVNKA"
     gene            complement(349728..350972)
                     /locus_tag="RAHAQ2_RS23580"
                     /old_locus_tag="Rahaq2_4895"
     CDS             complement(349728..350972)
                     /locus_tag="RAHAQ2_RS23580"
                     /old_locus_tag="Rahaq2_4895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578205.1"
                     /note="tryptophan transporter of high affinity; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan permease"
                     /protein_id="WP_014341897.1"
                     /db_xref="GI:504107911"
                     /translation="MATLSVTAPQHSVLGGAMIISGTIIGAGMFSLPVVMSGAWFFWS
                     VAALIFTWFCMLHSGLMILEANLNYPVGSSFNTVTGDLLGKNWNRLNGITIAFVLYIL
                     TYAYISASGSVIQHTLREMSVSFSPRLGGLLTALVVAFIVWLSTRAVSRMTAIVLGAK
                     IIAFFLTFGSLLWHIKPVNLLNSVELNPSYAPYVLATLPFCLASFGYHGNVPSLMKYY
                     GKNPHVIKKCLLLGTLMALGLYVIWMLGTMGNIPRPEFIGIAERGGNIDVLVQSLSQI
                     LNSAGLDLLLTIFSNFAVACSFLGVTLGLFDYLADLFKFDDNRTGRFKTALVTFVPPI
                     VGGVIYPDGFIYAIGFAGLAATVWAVIVPALMALASRQRFGSPLYRVWGGNKMIVLVL
                     LFGVLNAVVHILSSVSLLPVYR"
     gene            complement(351934..352668)
                     /locus_tag="RAHAQ2_RS23585"
                     /old_locus_tag="Rahaq2_4897"
     CDS             complement(351934..352668)
                     /locus_tag="RAHAQ2_RS23585"
                     /old_locus_tag="Rahaq2_4897"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="WP_014341899.1"
                     /db_xref="GI:504107913"
                     /translation="MFNVLRAEPKTTFEYGPFRIRRMRPGKIVPDSSDDAFGPLSVID
                     HANLELGTLVKMHEHNNDEIFSYLWRGSMVHEDSAGHRASLSPKKLMMMNAGESFWHE
                     ESTPLVPAEMLQIFIRPRKADLKGRVQFMERPDGVKQNEWTLLAAPEGIESPLEIRQA
                     VYVYDIRMDEKSTTEIPAHPGFAQWLYVMDGEISIADVSLSKGDAISDEESALPAASA
                     KRETTLVCFLVCLGAEAILEGTISGK"
     gene            complement(352739..354472)
                     /locus_tag="RAHAQ2_RS23590"
                     /old_locus_tag="Rahaq2_4898"
     CDS             complement(352739..354472)
                     /locus_tag="RAHAQ2_RS23590"
                     /old_locus_tag="Rahaq2_4898"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014341900.1"
                     /db_xref="GI:504107914"
                     /translation="MTTLLSAQSLSFDNAFGPLLAEISFGLKKGDRIGLIGHNGCGKS
                     TLLKILSGELAASSGTVTLANQCLMARVEQHLPVELNDCTLLESVLGYLPGSLHQPEP
                     WQAQVLLSSLGFDENAWELTAGTLSGGQHTRLLLARALIRQPDLLLLDEPSNHLDLPT
                     LLWLERFLKDWAGSFVLVSHDRSLLDSVTNATWILRDKTLQFIRLPCTQARQALKEKD
                     IADALRRKAEQKEIDRVTLSAKRLAVWGSVYDNEGLARKAKQMEKQVVRMKEDQTDVT
                     AGNQWKLRLNGEALAADRVLALSDLQVRPAADAPVLFTLDEMRVKSGDRIALVGRNGC
                     GKSSLLHSLWQAFICPETATCGVVFHPRLRMGYYDQNQHQLQDNDSLSDALAHFAPLT
                     EEQRKMALIGAGFPYIRHQQKVGTLSGGERSRLLFIGLTLANYSLLLLDEPTNHLDLE
                     GKEELAETLKTFSGAVLMVSHDRTLIEQSCNRFWLIDQQRLEEWHSPAPVYAILAGAV
                     PVTSTPVSDVMAHSTAIQDTEEERLLATLMELENKLEEDLARKPKHQKPALQRQWQQK
                     IAELNALLDLL"
     gene            complement(354761..355999)
                     /locus_tag="RAHAQ2_RS23595"
                     /old_locus_tag="Rahaq2_4899"
     CDS             complement(354761..355999)
                     /locus_tag="RAHAQ2_RS23595"
                     /old_locus_tag="Rahaq2_4899"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014341901.1"
                     /db_xref="GI:504107915"
                     /translation="MSASAGHSDSLLQHRSFVAFWIARAASSFGFQMLSIVVSWQIYS
                     ITGRAFDLGLIGLVQFVPSVALALVAGHVADQFDRRRVVLLGQIAEWVATGALAYLTL
                     THHVNEVIVLGLIFVISTAKAMEAPSLQSMLPALVPPNLLARAMAATSVSGQAASMVG
                     PALGGFLYVAGAGVAYAVCACLYLLSIVMVSRLRYEQVPPRRVPATFKTLFAGIGFIR
                     ARPDVLGVISLDLFAVLLGGATALLPIFAHDILHTGPWGLGLLRGAPAVGGLIVGFWL
                     SHRALNRNVGKIMFAAVAGFGAATLVFAFSTSLWLSMFALFALGGFDMISMVIRGALV
                     QLDTPDDMRGRVSAVNSIFINTSNQLGEFESGLLAAWVGAVPAAAIGGVGTLIVVGLW
                     MTWFPGLRKRQKLENETVEA"
     gene            complement(356137..357060)
                     /locus_tag="RAHAQ2_RS23600"
                     /old_locus_tag="Rahaq2_4900"
     CDS             complement(356137..357060)
                     /locus_tag="RAHAQ2_RS23600"
                     /old_locus_tag="Rahaq2_4900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_014341902.1"
                     /db_xref="GI:504107916"
                     /translation="MTDITPSAVVSAAPFAVADLTLSGFTHRYATVDGVRLHYVSGGN
                     PQGKVLLLLAGFPQTWYAWRNVMKALAEDFWLVAPDLPGQGDSDRPQTGYDTQSLAQK
                     IHGLMQLLGHKRYSLAAHDVGAWVAYPYAAMYGGEVQRLALLDAGIPGITLPDALPVT
                     PDKSWKTWHFAFHTLPDLPEALIAGNERVYLDWFLRRKTAAPDAFTDDDISEYLRVFL
                     KSGGLRAGLAYYRSVTESAEQNRELNRRGKLKMPVLAVSADQGSIPDMAIPLHAFAEN
                     VTGIIIPHSGHFIPDEQPEALARELHNFFTM"
     gene            complement(357135..357737)
                     /locus_tag="RAHAQ2_RS23605"
                     /old_locus_tag="Rahaq2_4901"
     CDS             complement(357135..357737)
                     /locus_tag="RAHAQ2_RS23605"
                     /old_locus_tag="Rahaq2_4901"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014341903.1"
                     /db_xref="GI:504107917"
                     /translation="MASSSPKDRGRPREFDTELALDNAMTVFREKGFHAASISDLSQA
                     MNLTAGSIYKAFSDKRTLFLNVFERYTSLRNIQLRQQIERAATGRERIAEVLRFYLRS
                     SHEIEGRRGCLVVGSTVGLLTLDDELAALVRQAIMRNKSFLASLIEQGQQDGSVAADI
                     DAQAASSLLLWIVLGMRVAGKVENNQASETTLKLALKILD"
     gene            complement(357825..358502)
                     /locus_tag="RAHAQ2_RS23610"
                     /old_locus_tag="Rahaq2_4902"
     CDS             complement(357825..358502)
                     /locus_tag="RAHAQ2_RS23610"
                     /old_locus_tag="Rahaq2_4902"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014341904.1"
                     /db_xref="GI:504107918"
                     /translation="MTDSKKALIIGASRGIGLGVVDVLAKRGWQVTATTRDAVPAKTP
                     AAVEWVKLDINKSEAREAVKDALSESHFDLIFVNAGVFGPDHQDLHQASDEEIIQLFL
                     TNAISPVRCAGELLPFLNHRTGVLALMTSELSSLNENDVATYPLYSASKAALNMLTRG
                     LLEQIEKQELTLLSVHPGWVQTDMGGENATLTVTESATGIVDQFEAWRGKGGHHFVEY
                     SGRELRW"
     gene            358838..359611
                     /locus_tag="RAHAQ2_RS23615"
                     /old_locus_tag="Rahaq2_4903"
     CDS             358838..359611
                     /locus_tag="RAHAQ2_RS23615"
                     /old_locus_tag="Rahaq2_4903"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341905.1"
                     /db_xref="GI:504107919"
                     /translation="MIAIKWVSLGFVLVLLLSFGYSYARATQTRTEPAGQSWSTARRT
                     SAGIAPDPVRLKSIAIIQIYAAPTYGWRGLVAVHPWIIYKREGETAFTRYDVISWGST
                     NVVRRDYAIPDGYWFGSQPRILVDHRGAQAQIMIPKIEAAIKSYPYPHTYHAWPGPNS
                     NTFIAHIGREVPDLALDLPSNAIGKDYRGITNPIGLPPSGRGVQVSLLGLLGVTLGVE
                     EGVEVNVLGLNLGIDVKNPALRLPFVGRVGFDNPGKAEL"
     gene            complement(359775..361421)
                     /locus_tag="RAHAQ2_RS23620"
                     /old_locus_tag="Rahaq2_4904"
     CDS             complement(359775..361421)
                     /locus_tag="RAHAQ2_RS23620"
                     /old_locus_tag="Rahaq2_4904"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013508758.1"
                     /note="catalyzes the formation of malate from fumerate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="WP_014341906.1"
                     /db_xref="GI:504107920"
                     /translation="MSNKPFYYQNPFPVSKDDTEYYLLTKEHVSVSTFDGEDVLKVEP
                     QALTLLAQQAFHDASFMLRPAHQQQVASILHDPESSENDKYVALQFLRNSEIAAKGIL
                     PTCQDTGTAIIMGKKGQRVWTGGGDEASLSQGVYNTFIEDNLRYSQNAALDMYKEVNT
                     GTNLPAQIDLYSVDGDEYKFLCIAKGGGSANKTYLYQETKALITPAKLKDYLVDKMRT
                     LGTAACPPYHIAFVIGGTSAEATLKTVKLASTHYYDGLPTEGNEHGQAFRDVNLEQEL
                     LAEANNLGLGAQFGGKYFAHDIRVVRLPRHGASCPVGMGVSCSADRNIKAKINRDGIW
                     IEKLEDNPGQYIPEALREQGEAGVVKVDLNRPMPEILAQLSEYPVSTRLSLSGTIIVG
                     RDIAHAKLKERLDNGEGLPQYIKDHPIYYAGPAKTPEGYASGSLGPTTAGRMDSYVDL
                     LQSNGGSMIMLAKGNRSQQVTDACHKHGGFYLGSIGGPAAVLAQQSIKSLECVEYPEL
                     GMEAIWKIEVENFPAFILVDDKGNDFFQQIHANTCAKCVK"
     gene            complement(361612..363123)
                     /locus_tag="RAHAQ2_RS23625"
                     /old_locus_tag="Rahaq2_4905"
     CDS             complement(361612..363123)
                     /locus_tag="RAHAQ2_RS23625"
                     /old_locus_tag="Rahaq2_4905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578286.1"
                     /note="involved in the transport of citrate into the cell
                     along with the export of succinate out of the cell;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate:succinate antiporter"
                     /protein_id="WP_037040907.1"
                     /db_xref="GI:739176948"
                     /translation="MSEISKTAVKEPAKKAESGKKNRWIFMALPVLVSVLLLLVPVPA
                     GLEPHAWHFFAIFVGVIIGLIFEPLPGAVIGLTGVVVIALFSQWLLFSPAELADPKFK
                     TAAQSFKWAVSGFGNSTVWLIFGAFMFAAGYDKTQFGRRLALILVKYLGRRSLTLGYA
                     ITFADLLLAPFTPSNTARSGGTIYPIIANLPPLYGSKPNDPSARKIGSYLMWVAITAA
                     CITSSMFLSALAPNLLALGIVNSVTGINISWGTWFIAFLPVGLLLLLTMPLLAYWFYP
                     PEVKINDEVPRWATAELAKLGRMSRHEILLLVFVCCALAMWIFAASFIEPAMAALLVV
                     VLMLWTGVLNWNDITSNKPAWNTFAWFATLVALADGLSRTGFIAWLGKEGAALMGGIS
                     PGAATIALLLAFYLLHYLFASTTAHTTALLPAMLTIGAAIPGINMQVFCLLMVTSLGV
                     MGIITPYGTGPSPIYYGSGYLPTKDYWRLGTIFGAIFLIALLVIGYPWMVMMF"
     gene            363862..366639
                     /locus_tag="RAHAQ2_RS23630"
                     /old_locus_tag="Rahaq2_4906"
     CDS             363862..366639
                     /locus_tag="RAHAQ2_RS23630"
                     /old_locus_tag="Rahaq2_4906"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase"
                     /protein_id="WP_014341908.1"
                     /db_xref="GI:504107922"
                     /translation="MSTNDLLLSPFTLPNGTELKNRILMAPMTTCTGFYDGTVTRELV
                     EYYRARAGSIGTVIVECCFVDDRGLAFPGAIGIDNDAKIDGLAKIAAAVKSQGSKAVL
                     QIYHGGRMSEPKLIGGQQPVAPSALAAPRDGAATPVALTAGEVEDMITKFGEGVRRAI
                     EAGFDGVEIHGANTYLIQQFFSPNSNQRDDKWGGSRENRARFPLAVLDITHEMAKKYA
                     DSSFIIGYRFSPEELEEPGIRFADTLYLLEQLAARGLDYLHFSLGYSLRPSIVDTTDP
                     TPLIDKYVAMRSDTLAKIPVMGVGGIVNKSDAELALEHGYDMVAIGKACIAYPDWTDR
                     IAADHKLELFIDSTQREALTIPEPLWRFSLVDAMIRDMSMSSKKFKAGVFREKVQDPA
                     HELAVNVSLDTDRIADIALDAGADLDVEFTTSFDIIRSRILDANSPHFDAVTGATEQS
                     EAVKKAVSKAIAKSCKAQLLEEGGSLNAPQSYDVVVVGSGGAGLAAAIQACDEGAKVL
                     IVEKMSTIGGNTIKASVGMNAAETRYQRLKGIEDSKDLFYQETLKGGQFKNNTVLLKE
                     FIEHAPRAVEWLADHHIELSDITITGGMSVDRTHRPADRSAVGGFLISGLVKNLNKRN
                     IDVMLDTSVTEIRYSNGAVQGVQLLNDDNDVLTINAKSVIVATGGFSANREMVVKYRP
                     ELDGFVTTNHKGATGSGIAILQNIGAGTVDMGEIQIHPTVEQTTSYLISEAIRGGGAI
                     LVSQAGKRFFNEMETRDKVSANIIALPEKFAYVVFDEQVRLNNKAADEYIAKGFVISG
                     SSPRDLAAKLEMNSDTFLATLESYNVAVDKQDDAEFGRKTALRHPINQGPFYAIRIAP
                     GVHHTMGGVTINTDTCVLDAQQQVLGGAFAAGEVVGGIHGGNRIGGNAVADIIIFGIL
                     AGQNAAKFAMR"
     gene            366664..367626
                     /locus_tag="RAHAQ2_RS23635"
                     /old_locus_tag="Rahaq2_4907"
     CDS             366664..367626
                     /locus_tag="RAHAQ2_RS23635"
                     /old_locus_tag="Rahaq2_4907"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis lipoprotein ApbE"
                     /protein_id="WP_014341909.1"
                     /db_xref="GI:504107923"
                     /translation="MTPDDRVYAYSAVLMGSPILLKLFEHNESLASGVFRLIKQQENI
                     FTVNRPHSDIMAINHAAGRDPVTVSAPVFALIRRAKAISCLPDSSFNFTIGPLVKRWK
                     IGFSGHSIPAAHDLRTLLALTDPQDVILDEQTRSVFLQQAGMEIDLGAMAKGYIADVV
                     RDYLREQQVESALINLGGNVQTLGSGAEGAWAIGLKKPFSDPEALIGVINVIGKSVVT
                     SGVYERYFELDGHCYHHILDPKTGYPLDNELLSVTIISEDSIDGDIWTTLLYGMGVKK
                     SLACLAKTPHIEAIFVTRDGQVILSSQRQFTFTPLDDSYRIVAY"
     gene            complement(367637..368356)
                     /locus_tag="RAHAQ2_RS23640"
                     /old_locus_tag="Rahaq2_4908"
     CDS             complement(367637..368356)
                     /locus_tag="RAHAQ2_RS23640"
                     /old_locus_tag="Rahaq2_4908"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416701.1"
                     /note="response regulator in two-component regulatory
                     system with DcuS; phosphorylated DcuR activates
                     transcription of genes involved in anaerobic fumarate
                     respiration; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014341910.1"
                     /db_xref="GI:504107924"
                     /translation="MINVLIVDDDAMVAELNRCYVGQIDGFACCGTASTLQQAKDLVL
                     NSELSIDLILLDVYMQQDNGLDLLPELRNARRPVDVIVISSAADAETIKKSLNYGVVD
                     YLIKPFQFSRFEEALTGWQQKKTLMDNQQYYEQSDVDRLIHGSNPAAADNKKLPKGLT
                     LQTLRTLCQWIDAHPTIEFSTDELATSVNISRVSCRKYLIWLAQMNILFTSIHYGVTG
                     RPVYRYRLQADHYSLLKQYCQ"
     gene            complement(368353..369972)
                     /locus_tag="RAHAQ2_RS23645"
                     /old_locus_tag="Rahaq2_4909"
     CDS             complement(368353..369972)
                     /locus_tag="RAHAQ2_RS23645"
                     /old_locus_tag="Rahaq2_4909"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341911.1"
                     /note="C4-dicarboxylate-sensing histidine kinase; part of
                     two-component regulatory system with DcuR; regulates
                     anaerobic fumarate respiration; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_014341911.1"
                     /db_xref="GI:504107925"
                     /translation="MSDSQQRHSVRKHPMKLSTSVSLMISAVIASVLLVVHMLYFVQV
                     SDTTRDGVKDKALAVARTMADLPETKRALLLPPDSNIIQPIASAVQKRNDLLFIVVTN
                     MDGIRYSHPNPDVISHHFIGDDINPALLGNENVSINKGTLDKALRVFTPVYDEHHKQI
                     GVVAIGISLVKVTEQINKSRWSILWTVLFGLMVGALGTYCLVKLLKRILFGLEPYEIS
                     TLFEQRQAMLQSIKEGVIAVDAQAHVTLINQTARQTFRETAIDVMPDADSLPLIANLR
                     DVLNTGVPRRDEEINFKGRLLLSNTVPVRNNGVIIGAICTFRDKTEVSQLMQRLSGMV
                     NYADSLRERSHEFMNKLHVILGLLHMKSYAQLEDYILKTANNYQAEIGSLLLKIKSPV
                     IAGFLLSKINRASDTRHRLTLSDDSLLPDNNNEDQVAALITVLGNLIENALDALGDQP
                     DGEVSVLLHYQNGSLACIVSDDGPGIQPENIDAIFEKGVSSKGDQRGMGLFLAKQQVE
                     SLGGTITVESEPDVYTQFFVQLPWDAERTSS"
     gene            complement(370213..370530)
                     /locus_tag="RAHAQ2_RS23650"
                     /old_locus_tag="Rahaq2_4910"
     CDS             complement(370213..370530)
                     /locus_tag="RAHAQ2_RS23650"
                     /old_locus_tag="Rahaq2_4910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013578291.1"
                     /db_xref="GI:503343630"
                     /translation="MRHSKIVMLSALVVSSLLPLANTAFAASNSHEIKSFYDDSKLYS
                     IGDQVPALYRTKPYEIVGWQERHLPAPDAGSHWTYIGGSYALITDTDGKILKAENGDI
                     YFQ"
     gene            370897..373305
                     /locus_tag="RAHAQ2_RS23655"
                     /old_locus_tag="Rahaq2_4911"
     CDS             370897..373305
                     /locus_tag="RAHAQ2_RS23655"
                     /old_locus_tag="Rahaq2_4911"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose dehydrogenase"
                     /protein_id="WP_014341912.1"
                     /db_xref="GI:504107926"
                     /translation="MRNERFFSWSFMTGLVTGVIGLAYLVLGVWLAALGGSPWYMLFG
                     SGYLLSGIFIARRHASGIWLYLLTFLLCCVWSVWEVGLDGWQLMPRLFVMALLGVWCS
                     LPLITRQVMATRGNHRTGTFAGLVYVVAIVGIFYSGWQVTGSRFVHRQPVPAQSGDVQ
                     ATSPESNDWRYYGRTEAGQRYSPLTQITPANVSQLKPAWEFHTGDVMRKGEDKDGREF
                     NFEVTPVKVGNSLFICTPHREVIALNATTGAQRWKFDPKSDTSANEYLACRGVAYSQS
                     AGDKVCPEKIIATTSEARMVALNAQTGEPCSSFGQNGFVSLTDHMGDVPPGFHFITSQ
                     PMVMDGRIVLGGWIYDNQSTGEPSGVVRAFDVNTGQLAWAWDMGRDPQNAPLKPGEVY
                     TRGTPNGWGTYTGDPKLGLVYIPLGNATPDYYGAGRRPFDEKYSSSLVALDIHTGEER
                     WHFQTVHHDVWDFDLPIGPTLVDLPSPEGITVPALVQTTKMGQLFLLDRRTGKPLAQV
                     NEKPVNTSPSLPGEHLSPTQPDSVGMPSLSPPDLKETDAWGATPIDQLYCRIQFKSAR
                     YQGQFTPPAEGKSIAYPAFDGVMDWYGASVDPIRHVLIANTSYIPFTMELKKSADAIK
                     EGLMHKWAGWGSNQPYPKPKEFSVGPQYGTPWAAIVKPWLSFLQAPCNAPPWGKLVAV
                     DLTARKIAWERPAGTTRDMNIFGTHTNVPLPTGIFMMGGNIITQSGLIFTGATADNYF
                     RAFDETTGNELWRARLPAGGQATPMTYTGDDGRQFVVIAAGGHGGLGTTSGDALVAYA
                     LPAR"
     gene            373411..374316
                     /locus_tag="RAHAQ2_RS23660"
                     /old_locus_tag="Rahaq2_4912"
     CDS             373411..374316
                     /locus_tag="RAHAQ2_RS23660"
                     /old_locus_tag="Rahaq2_4912"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_014341913.1"
                     /db_xref="GI:504107927"
                     /translation="MNNKTIPTSLNEPHVDAYPTPPFEHQKQPFPGLASKMNPVPDHG
                     EKTYKGSARLEGRKALITGGDSGIGRAVAIAFAREGAQVAINYLPDEEADAKEVIDLL
                     WAEGRKVIAIPGDIRDEKFCQQLVKEAEEKLGGLDLLVNNAGRQQFCDSIKDLTTEAF
                     DATFKTNVYAMFWITKAALEFIPRGGAIINTTSVQAFSPSDNLLDYSSTKASIMAFTK
                     GLAKQLAGDGIRVNGVAPGPYWTPLQISGGQPQEKIESFGQQAPLKRPGQPAEIAPLY
                     VTLASNENSYASGQVWCSDGGTGTV"
     gene            374531..374956
                     /locus_tag="RAHAQ2_RS23665"
                     /old_locus_tag="Rahaq2_4913"
     CDS             374531..374956
                     /locus_tag="RAHAQ2_RS23665"
                     /old_locus_tag="Rahaq2_4913"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341914.1"
                     /db_xref="GI:504107928"
                     /translation="MQTHPISPRRGVAVALYELLNPVPLGFFVAAWIFDILYMKTFIT
                     MWTDAASWLIVFGLIIAIIPRLINLAQVWTGGKTPAGSPVKTHFWLNLLAVLLAIFNA
                     FIHSRDAYAVVPMGVMLSTLVVVLLLLGNVQLALRARTV"
     gene            374969..376273
                     /locus_tag="RAHAQ2_RS23670"
                     /old_locus_tag="Rahaq2_4914"
     CDS             374969..376273
                     /locus_tag="RAHAQ2_RS23670"
                     /old_locus_tag="Rahaq2_4914"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sorbosone dehydrogenase"
                     /protein_id="WP_014341915.1"
                     /db_xref="GI:504107929"
                     /translation="MKNYQRALLALTLAALLSSCDDSSQIDPNKQTGADPELPKAQNF
                     LMPPMKVPEGIPWKTGEMPKVADGLKIEKIADGLKHPRQVYVLPNNDVLVAESNGPAK
                     KPIFRPKQLIMGLVQKSSGKGGEGGNSITLLRYTGGKWEKHLFITGVNAPFGIQLTGN
                     RLWVASADSLIKYPYQEGETQITAPGEVVTELPGGPINHHWTKSLLASPDGSKLYVGV
                     GSNSNITENGIGAEDRRAAILEVDAATGASRIFASGLRNPTGLQWEPESGKLWAVVNE
                     RDEIGSDLVPDYMTSVQEHGFYGWPYSYFGQHVDERVKPPRPDLVEKAIKPDYAISSH
                     VAPLGLLFYTGDNMAQYRGGAFVSEHGSWNRKPLNGYQVMWVKFENGKPVGLPQPVVT
                     GFLTDDQKQVRGLPVGLAMDKQGGVLIADDAGNSIWRVSKAE"
     gene            376541..376762
                     /locus_tag="RAHAQ2_RS23675"
                     /old_locus_tag="Rahaq2_4915"
     CDS             376541..376762
                     /locus_tag="RAHAQ2_RS23675"
                     /old_locus_tag="Rahaq2_4915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341916.1"
                     /db_xref="GI:504107930"
                     /translation="MPDITIVCGQCGSDRFVAAVNTPLAEIVHSLVCAECQHPVPVNE
                     VVIFREGMYISGSYDTFPAGPGKLYNFDI"
     gene            complement(376834..377745)
                     /locus_tag="RAHAQ2_RS23680"
                     /old_locus_tag="Rahaq2_4916"
     CDS             complement(376834..377745)
                     /locus_tag="RAHAQ2_RS23680"
                     /old_locus_tag="Rahaq2_4916"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_014341917.1"
                     /db_xref="GI:504107931"
                     /translation="MATTPVKKRIDVFGERYRARASTLSPGLQAVASYIQNNRESVLE
                     ATAMDIAAATDVSDATVVRAVQALGFAGLRDMKQTLEAWFGTAVNSEEKMITTVSELA
                     SDINSGISFVLDGHKRACDALAEPANRQAISEAIALLINARQVAVFGLNASGILADYS
                     TRLFTRIGIPAVSLNRSGIALAEQLINLQRGDVLIMMAQKSAHREGRTAIQEAKRLSI
                     PLILLTNASDSFFAKQADIVINVPRGGENGRMPLHGTVLVCLEMLILSVASATASRTM
                     KTMKRIQDLNQSLKSANKIRKLQDGVA"
     gene            378087..380216
                     /locus_tag="RAHAQ2_RS23685"
                     /old_locus_tag="Rahaq2_4917"
     CDS             378087..380216
                     /locus_tag="RAHAQ2_RS23685"
                     /old_locus_tag="Rahaq2_4917"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel"
                     /protein_id="WP_037040930.1"
                     /db_xref="GI:739176971"
                     /translation="MNNNKLFDFKRKSHPAILAAIYGVAMLTPVSGHSAGENDTLTIT
                     GQGADDGGYSAGTSSVASKIPTPRLNEAQSVSVVTRQQLDDYQATSLSDAMRFVSGVS
                     EGNTLAGTEDGFVRRGFGSNSDGSIYRDGVRSSQGLNFDATTERVEVLKGSASLLYGI
                     QNPGGVINLVSKKPQYDWHTKVSGRYASEGGGAGTVDVTGPLGNGFALRMIAEKQDQD
                     YWRNFGSDKHTLISPSLQWYGEKASFLISYSDYRYDIPYDRGTAFINGKAIDIGYKNR
                     LDDKSNRAWGHNKTLNAHYDWQFSDDWSTRLTVGWNQRRYNNDEVRVTAVNTTTGAVT
                     RRADANRGFNHKTKYVSWDLLGSQDILGMNHDLVLGTDYEMNQTYRAHQYQGKANSSF
                     NYFDPQYDILSPVANSTTENTANGNNLNRIHSRSVYAKDSISLTSDWIAVLGGRYQHY
                     EQRASKGFDPVVQTLDSEGNKFLPQAGLIYKVTPDVSLYSSVSKSFTPSTDVDDDGNV
                     GKPEQGTTWEVGSKWQMTPRMFASVALYRIDERDMSLSINGETRAIDKARSSGAEFEL
                     NGEILPDWEVSASYSYDKAEIVDDGENAANNGNRLQNAPRHSGALYLSHNLVINGLPG
                     DFRIGGGARYVGTRAGDPENSFTLPDYTVADSFVAWNNRLFGEKTQLKLNLNNLFNKH
                     YYTSSGGNLRVREGETRNLMVQASVEF"
     gene            380263..381360
                     /locus_tag="RAHAQ2_RS23690"
                     /old_locus_tag="Rahaq2_4918"
     CDS             380263..381360
                     /locus_tag="RAHAQ2_RS23690"
                     /old_locus_tag="Rahaq2_4918"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic-binding protein"
                     /protein_id="WP_037040932.1"
                     /db_xref="GI:739176973"
                     /translation="MTMLFMLLLTLTGFGVQARTVTDIDGNHVDIPDNPQRIVLGESR
                     MLYTLALLETGDPVKRIVGWPLDLKKYDSQTWNIFAQRFPQMLAIPSLGLGGTNDMNP
                     EKVLALKPDLVILPSLARYDDADLRLNAMLKAAHIPVVKVDLRVHLLKNTTRSVNILG
                     EVLNQTARAQAFNHFYDAHMQVIHDRLAAYSGHKPTVLLQLHLGRRNECCVTAVKGSL
                     GELLNFAGGDNIASKTVQGVFGRLNEETVIMAQPEVYFATGAGSAEDQNDLKLGPAIT
                     LEMAQHSLQELTARQNGLRELKALHNGRTGMIWQNFYLSPWHVAATEFMAKTLYPDVF
                     ADIEPEQTLKQIFHDYLPIPYSGTYFAHGSP"
     gene            381625..383178
                     /locus_tag="RAHAQ2_RS23695"
                     /old_locus_tag="Rahaq2_4919"
     CDS             381625..383178
                     /locus_tag="RAHAQ2_RS23695"
                     /old_locus_tag="Rahaq2_4919"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="WP_014341920.1"
                     /db_xref="GI:504107934"
                     /translation="MHSSVNKNESRTFFGHPYPLGSLFFTEMWERFSFYGIRPLLILF
                     MAATVYDGGMGLARENASAIVGIFAGCMYLAALPGGWLADNWLGQQRAVWYGSILIAL
                     GHLSIALSAFMGDSLFFIGLMFIVLGSGLFKTCISVMVGTLYKKGDARRDGGFSLFYM
                     GINMGSFIAPLISGWLIKTHGWHWGFGIGGIGMLVALIIFRLYAVPAMKRYDSEVGLD
                     STWNSPVAKKNGVGVWLLALAAGVAVIVALISQGVIVINPVAVASVLVYVIAASVALY
                     FIYLFLFAGLNRKERARLLVCFILLVSAAFFWSAFEQKPTSFNLFANDYTNRMIGDFE
                     IPAVWFQSINALFIILLAPVFSWAWPLLARKNVRPSSITKFIIGILCAAAGFGIMMMA
                     AQNVLNSGGAGVSPLWLVGSILMLTLGELCLSPIGLATMTLLAPERMRGQMMGLWFCA
                     SALGNLAAGLIGGHVKADQLDMLPDLFARCSIALLICAAVLFVLIIPVRRMLENAQSK
                     TEQKPVTHA"
     gene            complement(383248..383679)
                     /locus_tag="RAHAQ2_RS23700"
                     /old_locus_tag="Rahaq2_4920"
     CDS             complement(383248..383679)
                     /locus_tag="RAHAQ2_RS23700"
                     /old_locus_tag="Rahaq2_4920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="WP_014341921.1"
                     /db_xref="GI:504107935"
                     /translation="MSNITIYHNPACGTSRNTLELIRNSGAEPAIILYLETPPAREEL
                     VTLIADMGITVRALLRKNVGPYEQLKLADNHFSDDQLIDFMLQYPILINRPVVVTPLG
                     TRLCRPSEEVLAILPDEQRGAFTKEDGEAVIDESGKRITKI"
     gene            complement(383731..385020)
                     /locus_tag="RAHAQ2_RS23705"
                     /old_locus_tag="Rahaq2_4921"
     CDS             complement(383731..385020)
                     /locus_tag="RAHAQ2_RS23705"
                     /old_locus_tag="Rahaq2_4921"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_014341922.1"
                     /db_xref="GI:504107936"
                     /translation="MWLAGTIFLLTLILVIWQPRGLGIGWGAMLGAGLALLTGVVHPS
                     DIPVVWQIVWNATATFIAVIIISLLLDESGFFEWAALHVARWGNGRGRLLFTWIILLG
                     AMVAALFANDGAALILTPIVMAMLLALGFSRGATLAFVMAAGFIADVASLPLIVSNLV
                     NIVSADFFNLGFTEYAAVMGPVNLAAIATTLVMLHLFFRQDIPPVYDISLLKRPEEAI
                     RDAGTFKAGWLVLILLLAGFFGLEPLGVPVSLVAAIGALILYVIARKGHAINTGKVLR
                     GAPWQIVIFSLGMYLVVYGLRNAGLTHTLSALLNQLAEQGLWASTLGTGFLTAFLSSI
                     MNNMPTVLIGALSIEGSSATGVIREAMIYANVIGSDLGPKITPIGSLATLLWLHVLSQ
                     KNMTITWGYYFRVGIVMTLPVLFVTLAALALRLSVVL"
     gene            complement(385065..385385)
                     /locus_tag="RAHAQ2_RS23710"
                     /old_locus_tag="Rahaq2_4922"
     CDS             complement(385065..385385)
                     /locus_tag="RAHAQ2_RS23710"
                     /old_locus_tag="Rahaq2_4922"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013578301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite transporter"
                     /protein_id="WP_014341923.1"
                     /db_xref="GI:504107937"
                     /translation="MLQPVQLFKLLADETRATIVMLLRESGELCVCDICAATAESQPK
                     ISRHLALLREAGLVTDRREGKWVHYRLSPQMPAWSATIIDSAWNCDRENIRHKLNNKS
                     PVSC"
     gene            385737..387041
                     /locus_tag="RAHAQ2_RS23715"
                     /old_locus_tag="Rahaq2_4924"
     CDS             385737..387041
                     /locus_tag="RAHAQ2_RS23715"
                     /old_locus_tag="Rahaq2_4924"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_037040935.1"
                     /db_xref="GI:739176976"
                     /translation="MTAVKYPAAIVAFALLLASCSSTPPKSLVTPLPPVTKHPLPGQP
                     VLSHEPVRGVWLATVSRLDWPPVNSVNTGSTSLRISQQQQALTAKLDKLKSLGINTVF
                     FQVKPDGTAFWPSKILPWSDMLTGKIGQDPGYDPLQFMLDEAHKRGMKVHAWFNPYRV
                     SVNTKSSTVAELNQTLPLHPASVFVLHRDWIRTSGDRFVVDPGIPEARDWITSIVAEV
                     VARYPVDGVQFDDYFYSESPGSALDDSLTFRKYGQGYASKADWRRHNTQQLIEQVSRT
                     IKQLKPGVEFGVSPAGVWRNVSHDPAGSQTSGAAAYDEAYADTRLWVQQGLLDYIAPQ
                     LYWPFSRKAARYDVLANWWANVVKPTHTRLYIGVALYKVGEPSKNEPDWTVSGGVPEL
                     KKQLDMNESVSQINGTILFRENYLNQPQTQDAVRYLKSRWGS"
     gene            complement(387109..387696)
                     /locus_tag="RAHAQ2_RS23720"
                     /old_locus_tag="Rahaq2_4925"
     CDS             complement(387109..387696)
                     /locus_tag="RAHAQ2_RS23720"
                     /old_locus_tag="Rahaq2_4925"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341926.1"
                     /db_xref="GI:504107940"
                     /translation="MRFIEKNPQGRKPLTLSLDEEKETPPEYERHAMNFSLFTDNHEN
                     VAAGRCSVQSESGSSDYLYISAIYVEGNTNTPTKSNPNRFIGLGQILLFSAIRYGLEL
                     NIENASLLPVDDSQGFYLKMGFHPNIAGSVNRMDTTGVSLSSGSGKLNAQWVNRFAHA
                     SFLNRHFRGSNWTGNIRNIHLNLRQKVMNNWTIIA"
     gene            387950..388285
                     /locus_tag="RAHAQ2_RS23725"
                     /old_locus_tag="Rahaq2_4926"
     CDS             387950..388285
                     /locus_tag="RAHAQ2_RS23725"
                     /old_locus_tag="Rahaq2_4926"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010671501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341927.1"
                     /db_xref="GI:504107941"
                     /translation="MRRIALLLTLMIAGPAVAEDTTAQHTPATYINILCSSALNKPDG
                     TAAYFREQIKDVSTQSQSPSSINKTEFDEDEADKVIQTWTSLSKADREKVKTQQQCQD
                     TLHKRYQEG"
     gene            388531..389163
                     /locus_tag="RAHAQ2_RS23730"
                     /old_locus_tag="Rahaq2_4927"
     CDS             388531..389163
                     /locus_tag="RAHAQ2_RS23730"
                     /old_locus_tag="Rahaq2_4927"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cAMP-binding protein"
                     /protein_id="WP_014341928.1"
                     /db_xref="GI:504107942"
                     /translation="MVTESDKGKDLSRATAELLAELIPYLQFRTVPAGSRFYLYENGE
                     FHCYFIRKGWFKTFHNDEPVLIGVISVPGIIGIGGAVPADAKMFIQAQDEGEIARATV
                     AEMHALIERLDLWEALTKHLLRMTNKLYVKSTLLTAPTSYEILRHQLMELMNEPPEIR
                     ENIPAAHYIQLKTHLSRSTIMKVLSQLKLGGYLRLDNGILKEVIRLPLKY"
     gene            complement(389220..389606)
                     /locus_tag="RAHAQ2_RS23735"
                     /old_locus_tag="Rahaq2_4928"
     CDS             complement(389220..389606)
                     /locus_tag="RAHAQ2_RS23735"
                     /old_locus_tag="Rahaq2_4928"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341929.1"
                     /db_xref="GI:504107943"
                     /translation="MAVETKFVVVRKGEEKMTFANKKEADAYDKMLDMADAFTEWLLQ
                     SNIDMDETLAENIALHLAEQKDTVQHILRTSKLPEAESAPQPAAETSTQAADVAENVV
                     IEETVAEEIVAEKPAAAKKVRTVKAA"
     gene            complement(389695..389895)
                     /locus_tag="RAHAQ2_RS23740"
     CDS             complement(389695..389895)
                     /locus_tag="RAHAQ2_RS23740"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040911.1"
                     /db_xref="GI:739176952"
                     /translation="MPSVSPKRNYPFFIPGNSSEKRAVIASVHDPDIPSEYDINLACD
                     LPSSVCPYFHPRYIGQGIMPGL"
     gene            389930..390619
                     /locus_tag="RAHAQ2_RS23745"
                     /old_locus_tag="Rahaq2_4930"
     CDS             389930..390619
                     /locus_tag="RAHAQ2_RS23745"
                     /old_locus_tag="Rahaq2_4930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341930.1"
                     /db_xref="GI:504107944"
                     /translation="MIVVNPSLDPTLARIAPGFRVLSISAQAAPIINPALAQETLQNA
                     CRFVLENDFSWTDEHLSAWGEVFKAFGAKPKRTPCSADALRKRVLKDGTMPAIDPVVD
                     LYNAVSIQYAIPVGGENISAYIGHPLLTFATGSEPFDTLKAGEPVMESPDAGEVIWRD
                     DAGVTCRRWNWRQGIRTRLDSDAQNMWFILESLPAMPLQALHDAGDMLIHGLEQMMPG
                     VQTDVKLITLP"
     gene            complement(390632..391030)
                     /locus_tag="RAHAQ2_RS23750"
                     /old_locus_tag="Rahaq2_4931"
     CDS             complement(390632..391030)
                     /locus_tag="RAHAQ2_RS23750"
                     /old_locus_tag="Rahaq2_4931"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341931.1"
                     /db_xref="GI:504107945"
                     /translation="MSTHPIRQVIEACDKAISVRDFDALMAHYAEDAALVIKPGMIAR
                     GKTDIRKAFVAISDYFQDQLVVEQGEMQVIEGADDALVIMETVLHFPDGQGGKVTTTR
                     RATYVFRHEPDGRWLCTIDNSYGTSLLDKE"
     gene            complement(391034..391762)
                     /locus_tag="RAHAQ2_RS23755"
                     /old_locus_tag="Rahaq2_4932"
     CDS             complement(391034..391762)
                     /locus_tag="RAHAQ2_RS23755"
                     /old_locus_tag="Rahaq2_4932"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_037040914.1"
                     /db_xref="GI:739176955"
                     /translation="MMYVVIGLTGILAGVISGIVGTGSSIMLLPALTYTFGPKTAIPV
                     MAISAIVGNISRVILWRKDINIRAFLLYAVPGIPAAILGANTLWEMPARLSNICIGTF
                     FFLLIPLRHYARCRAFTLSSMQLALAGALTGFLTGVVFSTGPLTIPVFAGFGLVKGAL
                     LSTEAAASFAIYFAKASTFSAIGAMPWPVLFSGLLVGSTLAAGMLIGKKFVIKMSETY
                     FNRLIDILLFLAGISLFWNSAKGD"
     gene            391867..392757
                     /locus_tag="RAHAQ2_RS23760"
                     /old_locus_tag="Rahaq2_4933"
     CDS             391867..392757
                     /locus_tag="RAHAQ2_RS23760"
                     /old_locus_tag="Rahaq2_4933"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014341933.1"
                     /db_xref="GI:504107947"
                     /translation="MHALPPITALRAFLVACHAGSFTAAAQELCITHGAVSRHIQVVE
                     KWFGVNLFSKEGQRRVPTPYALKLARELGSAFDTLSDIALRYGNGGRNNVFNVSVPTT
                     MSLKWLLPRLDDFYTQFPEANLQISTANTEQLHIVGHYDLLIRRETGATEYSAIPFLA
                     DTHCLMASPALLGRFQLKTPEDVLKCPRIETLTRPGHWNMWLAAAGLEKTPVSGLRRY
                     DHFHVSLHAMLEGIGVGLGPVRTLSAEIRRGNLVLLFPQITVAPCHYHALTPAGVQKT
                     LLHQAFERWLVAQGECGDQS"
     gene            complement(392748..394418)
                     /gene="treF"
                     /locus_tag="RAHAQ2_RS23765"
                     /old_locus_tag="Rahaq2_4934"
     CDS             complement(392748..394418)
                     /gene="treF"
                     /locus_tag="RAHAQ2_RS23765"
                     /old_locus_tag="Rahaq2_4934"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577718.1"
                     /note="cytoplasmic; catalyzes the hydrolysis of trehalose
                     to glucose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trehalase"
                     /protein_id="WP_014341934.1"
                     /db_xref="GI:504107948"
                     /translation="MQNAKYQTNQNAMFDSENADSEETRLTELEPIELILDRMMDAEP
                     EPEMIEGLPPSDALTPADRYLELFTSVQSSGLFEDSKTFPDCPPKMDPLDILLRYRRI
                     KKHPGFDLKRFVDAHFWLPEHRDDEYVSDPGDSLKEHIDKLWPVLTRQPEDHVPWSSL
                     MPLPQAYVVPGGRFSETYYWDSYFSMLGLAESGRNDLLRTMADNFAWIIEMYGHIPNG
                     NRTYYLSRSQPPVFALMVELFEEDGVRGARRYLDHLKMEYEFWMDGAESLAPNQAYRH
                     AVCLPDGTLLNRYWDDRDTPRDESWREDVETARQSGRPANEVYRDLRAGAESGWDYSS
                     RWLRDGHRLASIRTTQFIPVDLNAFLHKLESAIANISGLKGDKITETLFRRKAETRRE
                     AINRYLWDDNEGCFRDYDWHRQQMALFSAASVVPLYVGLASHYQAERLSEVVRARLLT
                     PGGIMATEYETGEQWDKPNGWAPLQWMAIQGFKQYGNDVLGDEIARNWLKTVNQYYQQ
                     HHKLIEKYHISGGTPREGGGGEYPLQDGFGWTNGVVRRLIGLYGENYD"
     gene            complement(394447..395853)
                     /locus_tag="RAHAQ2_RS23770"
                     /old_locus_tag="Rahaq2_4935"
     CDS             complement(394447..395853)
                     /locus_tag="RAHAQ2_RS23770"
                     /old_locus_tag="Rahaq2_4935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose-6-phosphate synthase"
                     /protein_id="WP_014341935.1"
                     /db_xref="GI:504107949"
                     /translation="MSRLVVVSNRIAIPDGSKSAGGLAVGILDALKNTSGLWFGWNGE
                     ISEISGEEEDDLNLTEDDGITYASVPLNQNDYDLYYCQFSNAVLWPALHYRIDLVDFQ
                     REAWDGYCRVNDMLAKRLQPLIKADDILWIHDYHLLPFAAALRKLGVKNRIGFFLHIP
                     FPTPEIFNAVPTHDELLEMMCEYDLLGFQTEGDRLAFLDNLKALTDIKDCDAHQHQAF
                     GKTFATGVYPISIAPESIREMAEGPLPPKMAAMEREIRESKNIISCERLDYTKGLPER
                     FLAFEALLEKFPQHRGKVRYSQIAPTSRGDVQAYQELRHQLETEVGRINGKYGGINQT
                     PLFYLNQHFQRSLLMKLFRLTDVGLVTPLRDGMNLVAKEYVAAQDPQDPGVLVLSQFA
                     GAANELTSALIVNPYDRDDVAAALDKALTMPLEERLERYNDMMAVLRKNDIANWGETY
                     LRDLYAVSPHGEKHRAVV"
     gene            complement(395850..396644)
                     /locus_tag="RAHAQ2_RS23775"
                     /old_locus_tag="Rahaq2_4936"
     CDS             complement(395850..396644)
                     /locus_tag="RAHAQ2_RS23775"
                     /old_locus_tag="Rahaq2_4936"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341936.1"
                     /note="biosynthetic; catalyzes the formation of trehalose
                     and phosphate from trehalose-6-phosphate; expression is
                     increased under osmotic stress and induced during the
                     transition to stationary phase and by decreased
                     temperature; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose-phosphatase"
                     /protein_id="WP_014341936.1"
                     /db_xref="GI:504107950"
                     /translation="MTAEIQENTTETPLLPVLDSRQYAFFFDVDGTLAEIRSEPDAVT
                     IPAEVRDHLQTLFAASSGALALVSGRPVEQLDQLVSPLELPAAGVHGAEMRDGSGTLH
                     RVTLPANVAQEVQQTLEAGMAALPGTLLETKGMAFALHYRQAMLHQQQVLALAESVVA
                     KFPELVLQPGKCVLEIKPRGKDKGAAIYTFMQQTPFSGRIPVFVGDDLTDEKGFEVVN
                     AMQGISVKVGEGSSLAQYRVKTVRDVYRWIEALQRHTLTFKKESEL"
     gene            complement(396857..397537)
                     /locus_tag="RAHAQ2_RS23780"
                     /old_locus_tag="Rahaq2_4937"
     CDS             complement(396857..397537)
                     /locus_tag="RAHAQ2_RS23780"
                     /old_locus_tag="Rahaq2_4937"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_014341937.1"
                     /db_xref="GI:504107951"
                     /translation="MKNSRLMICGLLLASASSQAVTIDLRHEWLDDSKQHKDRALVSH
                     RFANGFGFSLEAKWKSGGDNENKPFNNLVDNGTESTISYQVKVTPEVFVQPGFTLESS
                     SDSSIYKPFLTAGYTFDSGIYFNARYRYEYTRYTKENTEDRKTNRGEIWLGYKMADWR
                     FEYNYIYKHSDQILYDNDKWDYEQNLKVAYNINKQWTPYAEIGDVSVRKTTDERQTRL
                     RLGIQYNF"
     gene            complement(397606..399774)
                     /locus_tag="RAHAQ2_RS23785"
                     /old_locus_tag="Rahaq2_4938"
     CDS             complement(397606..399774)
                     /locus_tag="RAHAQ2_RS23785"
                     /old_locus_tag="Rahaq2_4938"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pectate disaccharide-lyase"
                     /protein_id="WP_014341938.1"
                     /db_xref="GI:504107952"
                     /translation="MWASKFVITALTLGISAQCLAVTLPDSGKLVWHSMTFGQSTDVN
                     FATNVLPEKIGMNETLLAGGKAVPATGTVLSTPFTLESRGGKIGNSHDGLTFFYTRLP
                     ADVNFQLEAEITLNQFGPENGAKPAGQEGAGLLVRDILGNPREPVTKPGIEELPAASN
                     MVMNSIMAIGDKPPVLALIARQGVQQPWGNTGIGIVRESYHPLSTPARFSLRLTRTDT
                     GFTVAYAPQGSDQWVSKSVQHADSVTQLDKTGYYVGFFASRNAKMTVEHARLTLSEAH
                     VQPSAPYVTPSLNARIEVMSSPVIARRDSVFQLRTNGDGKVQIDQNGKPLLSQITVRG
                     GEVVAVPFHAEQPVTALKITYTPADGKPVMQEFQVNMALVSNPDHLYVSPAGAAGNDG
                     SAEHPLDFDSAVNLLAPGGTLWLAEGDYPASLIPATASGTGKNRKTLRAQGDNVVFNG
                     LTLNASYWNIQGITVTQKSFHVAGSYNHIDRVKAHHADDTGIWVASPDGIGRALWASH
                     NLISNSESWGNQDPGRKNADGFAVKMRVGEGNRLVNCYSHDNIDDGFDLFNKIEDGPN
                     GSVTLENSLSVNNGSNGFKLGGEGLPVGHVVRHNVAVGNGMDGFTDNFNPGALVIEDN
                     RAVDNKRFNFLFRPSPYTTADKQGTFRDNISLRTTAGKYDDAVTGNVDNSNYFYTDHK
                     TVNNRHQEIKPGDYISLRLPDPITRLSDGGFNYADFLKNK"
     gene            complement(399861..401426)
                     /locus_tag="RAHAQ2_RS23790"
                     /old_locus_tag="Rahaq2_4939"
     CDS             complement(399861..401426)
                     /locus_tag="RAHAQ2_RS23790"
                     /old_locus_tag="Rahaq2_4939"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014341939.1"
                     /db_xref="GI:504107953"
                     /translation="MNAEKPILFKHQLAYGGGNLLGSGALAIAGIWLLYFYTTFCGLT
                     LLQASAIFSVASIIDAISNPLMGYLSDNFGKTRLGKRFGRRRFFILLGVPLMMFYPLL
                     WVEGFGFWYYLSTYVMFELIYTSVMVPYETLATEMTTDFSARSKLTGYKAIFGKVANF
                     LAAFIPGQFILIYGKDSAQPFFFTALTYGVILFIAIGMLYLSSWERPVEETTPVDEKK
                     MTLGKTMLTLVRDMKSTFHLRVFRKHLGMYLCGFGAEWLFASVFTYFIIFVLQYDPTM
                     VAGLSSLNSLLQLFSTAIFIGICVKHGFSKPYILALGIVIFSVICYSLLHVLHLPQQY
                     ATAAMLTITVIFGIGTGGVYYIPWTVYTFLADIDEAFTGRRREGIYAGAMTFSGKLMR
                     SVIVFVMGAILSFYGFQSKSHTQPESAVMAIALVFCIGVIALALMAIVFSNQMKLNRK
                     THLVVLGEVARIKAGGQISEVQPEVRAVMEELIGYPYEQCWGNSVVCRKIFDTPAVVV
                     TEPKPMVSTTQQP"
     gene            complement(401815..402795)
                     /locus_tag="RAHAQ2_RS23795"
                     /old_locus_tag="Rahaq2_4940"
     CDS             complement(401815..402795)
                     /locus_tag="RAHAQ2_RS23795"
                     /old_locus_tag="Rahaq2_4940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341940.1"
                     /db_xref="GI:504107954"
                     /translation="MEHIPLNETESLSEAYPVEQTTKKTSGFSLFVDLLSGACVPDNL
                     WRDRMFRVKYAVRTLLHPLDTLKVLNKMAAETLWQEAFQVQTKLPSKIHKPYLYLGLH
                     SAGRADALVDHYAFVKSLENARLRNTFLSATGNTITRFTGKDGEAFRVELGSIGKSER
                     EGEANMFLYMEDTLLAALTFSIVQRPEGRTLIIGGFQGAHRSTAHEVIKQATKSCYGL
                     FPKRLLLESLQRVAAGTGVQRILAVSDTGHVFRSLRYRHRKKNVFVASYNEFWDSISA
                     TPASSALYHVPLELPRKPMEEIASKKRSEYRKRYTLLDELHESTASLLNA"
     gene            403091..403828
                     /locus_tag="RAHAQ2_RS23800"
                     /old_locus_tag="Rahaq2_4941"
     CDS             403091..403828
                     /locus_tag="RAHAQ2_RS23800"
                     /old_locus_tag="Rahaq2_4941"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase"
                     /protein_id="WP_014341941.1"
                     /db_xref="GI:504107955"
                     /translation="MKIITTFCLASLFSVNAFALTGNDATTKPDLYYLKNDQAINSLA
                     LLPPPPAVGSIAFLNDQAMYEQGRLLRSTERGKLAAEDANLSAGGVANAFSGAFGSPI
                     TAKDSPELHKLLTNMIEDAGDLATRSAKEKYMRIRPFAFYGVPTCNTTEQDKLSKNGS
                     YPSGHTSIGWATALVLTEINPQRQDQILQRGFDLGQSRVICGYHWQSDVDAARIVGSA
                     VVATLHTNPAFQQQLQKAKEEFAKQHP"
     gene            403997..404488
                     /locus_tag="RAHAQ2_RS23805"
                     /old_locus_tag="Rahaq2_4942"
     CDS             403997..404488
                     /locus_tag="RAHAQ2_RS23805"
                     /old_locus_tag="Rahaq2_4942"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="WP_014341942.1"
                     /db_xref="GI:504107956"
                     /translation="MASPAYLWLYDANGALLYGGSEVLSREGAIEIQSFTHGLSVPFD
                     GNTGRLTSTRVHQTMGLVKEFDKSTPYLYRAVATSEKLQKAVIKWYRINAAGMEEEFL
                     NMTMEGVRILNINPHMHNFKHADGQASMPTESIGLGYQKITWLYLDGHISFTDQWNSS
                     IYA"
     gene            404501..405025
                     /locus_tag="RAHAQ2_RS23810"
                     /old_locus_tag="Rahaq2_4943"
     CDS             404501..405025
                     /locus_tag="RAHAQ2_RS23810"
                     /old_locus_tag="Rahaq2_4943"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341943.1"
                     /db_xref="GI:504107957"
                     /translation="MISCRVDFNRLYEGGKIAKLYCAGVGIFPVFSGLGSLLNRQGCS
                     DLKNGAIPPGKYWIVDRPAGGLNSWIVQMRKEWKTGNDYDSWFALYRQDSLIDDWTNI
                     GARERGNFRLHPLRSDGTGVSDGCITFYNHADFKVLRDRLLRAHTMIIPVLGKKAYGE
                     VEVFGDINAPCIHF"
     gene            405003..405305
                     /locus_tag="RAHAQ2_RS23815"
                     /old_locus_tag="Rahaq2_4944"
     CDS             405003..405305
                     /locus_tag="RAHAQ2_RS23815"
                     /old_locus_tag="Rahaq2_4944"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341944.1"
                     /db_xref="GI:504107958"
                     /translation="MRHVYIFSTLKIVWRLILFVAITLFLTPLNESFTHYLYLITDPV
                     VEFYHSTLGVDSGDRWDMEELTFLIFAVTATSIIAVCSIAVIEALFKKLMRVLRGI"
     gene            complement(405482..406564)
                     /locus_tag="RAHAQ2_RS23820"
                     /old_locus_tag="Rahaq2_4945"
     CDS             complement(405482..406564)
                     /locus_tag="RAHAQ2_RS23820"
                     /old_locus_tag="Rahaq2_4945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341945.1"
                     /note="member of the iron-containing alcohol dehydrogenase
                     family; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014341945.1"
                     /db_xref="GI:504107959"
                     /translation="MSDTDIRVVTGPANYFSFPGAIDRLTQFYSPEQLDKALWIYGER
                     ALTAAQDFLPEAFTASQAKRVLFAAHCSETEVQRIADIGGPDRQVVIGIGGGAVLDTA
                     KVVARRLGLPVVAIPTIAATCAAWTPLSVWYNDEGQALRYEIFNDANHLVLVEPRIIL
                     HAPKEYLLAGIGDTLAKWYEAVVLSPQPEKLPLTVQLGLNTALTLRDVLLNESEAALQ
                     AQDDNRLTQPFLNVLDAIIAGGGLVGGLGDRYTRIAAAHSVHNGLTALPQTDAFLHGT
                     KVAYGILVQSALLNQPEVVQQLTALYKVLDLPVSLAQLQVDIHDEKQLSRLIERTLQP
                     GESIHLLPGNPNAEQLRLAFEFVENK"
     gene            406786..407853
                     /locus_tag="RAHAQ2_RS23825"
                     /old_locus_tag="Rahaq2_4946"
     CDS             406786..407853
                     /locus_tag="RAHAQ2_RS23825"
                     /old_locus_tag="Rahaq2_4946"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_014341946.1"
                     /db_xref="GI:504107960"
                     /translation="MKLFSASLLALSLFSVLPSFAAGTAPVPKAIADHQGPVRIAVIR
                     NLGSDDNTTQFLSGVIQEGRKLGFQVSTFLSNGDDAKFQDFVNQAISQKYDGIILSQG
                     RDPYSTDLLKRITASGIAVSVFDTAVNGNIPGVTVTQQDDASLTDLSVGQLVKDFNGK
                     ANIVKLWVAGFPPMERRQDAYKKVLAAHPGIHELESVGAVSSDVQGDTANKIGALLAK
                     YPKGKIDAIWGTWDAFSQGAYKALQENGRTEIKLYSIDISNQDIGLMRAANSPWKLSV
                     AVDPKLIGAINLRLVASKIAGEKTPATYEFKAAAIPQALLTSNPDAVNVASLAKVIPG
                     WGKSDDFIAPWFATLEAQHKK"
     gene            407863..409110
                     /locus_tag="RAHAQ2_RS23830"
                     /old_locus_tag="Rahaq2_4947"
     CDS             407863..409110
                     /locus_tag="RAHAQ2_RS23830"
                     /old_locus_tag="Rahaq2_4947"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040919.1"
                     /db_xref="GI:739176960"
                     /translation="MTMQTLPTPEYSRNMRLIGHSDQGGKPDGVQVMVHRGYAYIGHM
                     VSQGFSIVDVRDPKNPRPAGFIPAPPGTWNVHLQAHDDLLLVINARDLFADVRFADEK
                     VYYTRSVSETVQGTQQRGWSAGVRIFDISVPDQPKEISFLGLEGIGVHRIWYVGGRWA
                     YVSALIDGYSDYIFLTIDLADPRHPQVAGRWWLPGMHTAGGEKPDWPEGKRYALHHAI
                     ISGDTAYASWRDGGLTLLDIKDRSAPQLISHRNWSPPFGGGTHTALPLPDRDLLVVLD
                     EAVLDNQEDGEKLIWLFDVREPSNPVSISTFPQPGERDYISKGAHFGPHNLHENRPGS
                     FISSTLIFATYQNAGVRAYDISNPYQPKETGALVPAAPATMMDKRPGRPQVIQSCDVF
                     VDTQGIIYSTDYNGGLSIIEYLG"
     gene            complement(409131..410054)
                     /locus_tag="RAHAQ2_RS23835"
                     /old_locus_tag="Rahaq2_4948"
     CDS             complement(409131..410054)
                     /locus_tag="RAHAQ2_RS23835"
                     /old_locus_tag="Rahaq2_4948"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT transporter permease"
                     /protein_id="WP_014341948.1"
                     /db_xref="GI:504107962"
                     /translation="MKSGDYCRLLLLAAIWGGSFLFMRVAAPAFGAINTAFLRVLFGF
                     VGLVVILAVMRTPRDYQHKFGRSLLLGVINSGLPFLMYCLAARWLPAGYSAILNATTP
                     LMGVVLGGLFFHETVTLKKALGVLTGLFGITLLTTTGSAESVPQLLAGVIACLVATGC
                     YAVAGFLTRRWITERGGLDPKLVATGSQLGATLFLLPFFLYTSATEAPVSWAQPLVWL
                     CVLAVGFICTAWAYILYFRLIADIGPLRSMTVTFLIPPFGILWGYLLLNEKLSEGFFA
                     GGILICVAVWLVLSPGKSVTGKTKTPAPETR"
     gene            410194..410916
                     /locus_tag="RAHAQ2_RS23840"
                     /old_locus_tag="Rahaq2_4949"
     CDS             410194..410916
                     /locus_tag="RAHAQ2_RS23840"
                     /old_locus_tag="Rahaq2_4949"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341949.1"
                     /db_xref="GI:504107963"
                     /translation="MTDFSQADFDVRLEWGAQAVDHLAAEVDCIVIIDVMSFSTCVSV
                     ANERGGVIFPYPWKDASAQQYAVERNAQCAQFDRRFQGPGFTLSPCSLQEMATGTRLV
                     LPSPNGSALTFKAKIHNAAIFTACLRNLTATACACKKYQRILVIPAGEKWPDNSLRPA
                     LEDLVAAGGLISRLQNRQLSAEARAAKAVYQNLTLEKLADCGSARELTRRGFSADVTL
                     CLQEDVSDFACQLQGEFFTAVS"
     gene            411047..412492
                     /locus_tag="RAHAQ2_RS23845"
                     /old_locus_tag="Rahaq2_4950"
     CDS             411047..412492
                     /locus_tag="RAHAQ2_RS23845"
                     /old_locus_tag="Rahaq2_4950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_014341950.1"
                     /db_xref="GI:504107964"
                     /translation="MSHSKPDASEHPQEESAVNSGISVIALLVAAAFFMEFIDGTVIA
                     TALPQMAISFGVSAVDLNAGMSAYMLTLAVLIPASGWAAERFGARNVFTFALAVFTLA
                     SLFCAMASGVREFIILRIIQGIGGALMVPVGRLTVLKTTPKPQLIKAIATLTWPALVA
                     PILGPPLGGFITHYASWHWIFYINVPLGIIAMMLAWRLFPQAPSAEPKHFDKPGFVLT
                     GLAMLSLVTGLELISQDHILWTVAILLLAAGAALSVLAIRHLYRAPAPMVHLGTIVIP
                     TFRICMGGGSLFRVTISAVPFLLPLMLQVGFGMDPFHAGLLVLAVFAGNLAMKPATTP
                     LIRRFGFRPVLIVNGLLSVFSLLFCAFLTPGTPDWLVMLLLFLGGLSRSMQFTGISTL
                     AFSDVPAKQMADANTLFSTVLQLSVGLGITVGALGTRLGEQLTDLLHWSDIPGMSFKI
                     SFVVIAVLTLIGWLDMLRLQPDAGASVSGKK"
     gene            412543..413433
                     /locus_tag="RAHAQ2_RS23850"
                     /old_locus_tag="Rahaq2_4951"
     CDS             412543..413433
                     /locus_tag="RAHAQ2_RS23850"
                     /old_locus_tag="Rahaq2_4951"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="WP_014341951.1"
                     /db_xref="GI:504107965"
                     /translation="MFTGLSAFPLTPLTEKGIDEKSFVRLMERLVAAGVDSIGALGST
                     GSYAYLKHSERDRVARLAVEHAGGIPVMVSIGSVRTSDVLHLAEDAQRAGVSAVLLAP
                     VSYQKLTSDEVFTLYETVTRHLSVPLCVYDNPGTTNFDFTDELYVRIAQLPHVASIKI
                     PGLSADPVTTRNRLDELRLLVPSHVTLGAAGDLAAATVLTQGGDVWYSVIAGLFPEIP
                     LAITRAAQNGDAQTALALSARLEPLWALFRQHGSLRVVAAAAEILGIVSAPCLPLPLQ
                     SLSGDARQHLISVLETLFQN"
     gene            413675..414082
                     /locus_tag="RAHAQ2_RS23855"
                     /old_locus_tag="Rahaq2_4952"
     CDS             413675..414082
                     /locus_tag="RAHAQ2_RS23855"
                     /old_locus_tag="Rahaq2_4952"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341952.1"
                     /db_xref="GI:504107966"
                     /translation="MPYGDNGQGLFRRGQLEQQIIRTTKFSIYAQAVYCVNRMLREAN
                     VGISEQAYQSISRNITAVTNGRLYETSASLSEARVFARDTVGAIKAGDFTSAAITASG
                     VAINAIGGPLFFGHYDRNKLIAIERHLYDNFHL"
     gene            complement(414207..415343)
                     /locus_tag="RAHAQ2_RS23860"
                     /old_locus_tag="Rahaq2_4953"
     CDS             complement(414207..415343)
                     /locus_tag="RAHAQ2_RS23860"
                     /old_locus_tag="Rahaq2_4953"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013576820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341953.1"
                     /db_xref="GI:504107967"
                     /translation="MNRVITALFLWSVAFILHAAIRPPAPSTVSIERTFDRMSPPSGN
                     ISIWSNESGGYDSDDPGKWGKNGWICGSSSDPKYGECQDSQLWGHSGETTIPLLFIEK
                     RSGMRITLNLSGYRVVKYHIDGGSCYDEGKLEIYSGVDSTCQGYGGAKSSEATLTVYI
                     PAAELSKLPVGGLWQADLHLKLMQWQNQFLADFNAHINLNVTDPSHIDIYFPAFSSAT
                     PLVELDLRPHGAPDESPFAQDSTTLDMCLYDGYNANSTRYEVRLKDEGDLPPGRAASD
                     FSIFRDGGERGPERDRIDYHVLLRDPETRGMRKVNNNETIVWTQINQNLIRPVRLPSI
                     TYPVLCVPTPLVFSVDKFYIKDKNAGHYRGVLTVIFTPTTPTVD"
     gene            complement(415343..418030)
                     /locus_tag="RAHAQ2_RS23865"
                     /old_locus_tag="Rahaq2_4954"
     CDS             complement(415343..418030)
                     /locus_tag="RAHAQ2_RS23865"
                     /old_locus_tag="Rahaq2_4954"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341954.1"
                     /db_xref="GI:504107968"
                     /translation="MKKNLIILFAFFTFPVDASTLKIPAGFEILSQGMQERVDVIVAG
                     KHIGSYDAIVSLDGIKFINPESVLTALQLSVKPDDKDYKVIRQLLNNTFPRNDILACT
                     NAQQSKGCGFIASKSIDVIYDSSEGSVTLFIRKEWLADAERNDLYIKPTTNNVVNAFI
                     HQQDMNVIVQDDYSNFFIQGAGALGISDNSYIGGDWSFSAAQNEDESNNEADLNDLYY
                     RYDISQRYYSQLGRMDNRMLFNSQGGSFNFSFLPLGAIDGVRIGTTLSYLNREVASQG
                     TPLNVLLTRNSRVDAYRNDQLLGTFYLSPGNQSIDTSLFPSGSYSVQLRIYESNQLVR
                     TENSPFSKTGSLDDGSIHWFAQGGKITDSDTNENTAFQAGLRVPFTPALSFTVGSAAV
                     QSNTYAETGFDYSPDLGLAGTPNFNGRVFRSSDGNKGDSEQLSWSVGDWPSLSVYRYS
                     SSGDDCSDSGQNDNNDYTSQSCYESINTTLTSNVLSWNLMFGYIQTQNHASDDMSWQR
                     DKSFEDNILEQTTEESTSRTLQFSASRAFTQADWVYNGTFGLFRRDDDGYDGIDNGVY
                     LSLTLSQAPRQDNLGKSQSTRLSTDYRDSQDQSSQLSYNVSHSWYRDQNQHKELTLEA
                     GGINTDTLDTGLSGRMEGQYGNVSAVLSDSYDNEYNKHTSAFSGSWSSSFAASTKGVH
                     WGSAGISEPASAVLVNIDDLSDEDDGIAIDAQVSGNRTAHISRGGSALFPTTGFEPTT
                     VAVSDSSAPLNTDSSTNILNGAGERNIMLLPGKMRLRSVVVEHRYGYIGQLILPQSAS
                     NNIIIGLNSKMLMLSDDGGFTAEMATKAPALYLLSGDVIYQCPLQIKKQRGTVRYVGE
                     SSCQLIKRDSLPAEVNEQLLVKLKSRRDIETASNKEGDE"
     gene            complement(418216..418746)
                     /locus_tag="RAHAQ2_RS23870"
                     /old_locus_tag="Rahaq2_4955"
     CDS             complement(418216..418746)
                     /locus_tag="RAHAQ2_RS23870"
                     /old_locus_tag="Rahaq2_4955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_014341955.1"
                     /db_xref="GI:504107969"
                     /translation="MKKSMVKPLVIAALLVSFTGTTSAVQKDITVTANVDASIDMTLS
                     DGSALPKSVEMQYIPGNGLSPVSMMTKIWSNATTSDAGDVHLQLITDPQLINNTGPEA
                     NPIPLNVSWGGDALSVATPIDLTTAVLFPNGADAANTGSVAKELQISQATKGTVETGM
                     YKGVVSIYLFQDATTI"
     gene            complement(418827..419549)
                     /locus_tag="RAHAQ2_RS23875"
                     /old_locus_tag="Rahaq2_4956"
     CDS             complement(418827..419549)
                     /locus_tag="RAHAQ2_RS23875"
                     /old_locus_tag="Rahaq2_4956"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_014341956.1"
                     /db_xref="GI:504107970"
                     /translation="MYLLRINKWFFMLAFFSFMTSANMTIYPMAVGLDTQGEGSVRLL
                     SKTNDVQFVKTKTLKITNPGTPEEKEVDVNSYSGNELVVMPPKFAIPGGSSKLVRFVA
                     MNVPEKEEIYRVMFQAVPSLDDDHVSENGKAIDTEVSVNLVWGILVSIPPLHPRIDVA
                     LSPDHHFLHNNGTQRIKIINIGLCKHGGKDKECVWKEDNHNLFPDKEYNLPDTAGYEK
                     LVIKYKDWIRKTNNERLEFSLK"
     gene            420074..421426
                     /locus_tag="RAHAQ2_RS23880"
                     /old_locus_tag="Rahaq2_4957"
     CDS             420074..421426
                     /locus_tag="RAHAQ2_RS23880"
                     /old_locus_tag="Rahaq2_4957"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341957.1"
                     /db_xref="GI:504107971"
                     /translation="MAKSFLRSGSLNDILALGENGQPVYASALQLRETLRLRKQPAIA
                     DCLAIPQLNEAGDRLDWYSPREGKVVSWAAATDTARASALRQLENCLDTVSQISKAAK
                     SSEKPATQFFGSLLEKAFRFPDQNHVYLVGGQPVLTFWGFLSLDSVSQPDPFAALRNT
                     LTAGEPLPALSLAAEKIKAPEPVVEQPEPVRVIKTIEARAAEQEIAVPEPVVAPRRKK
                     SPLIWALPVAALVVAGSAAGWLYSRVPAPKVETAKTEAPKPAPAAEPVVIAPPAVAEQ
                     VKAPEVKAPEPAPLPVAPAAVVVPSAQPVAEVEKTPIVTEPAAAPVSKNALVMPPDAV
                     KIGSTKFLNGNWQVVLDIKDPVTGKPPVLRYQFKQGQGTVKITYGAGVTCRAAANAGL
                     MQSGNLVINSRYRAKCSDGSRYQMPEISCTQGATGAAVCQGRYTGDTVYPMTIKREGK
                     "
     gene            421431..424403
                     /locus_tag="RAHAQ2_RS23885"
                     /old_locus_tag="Rahaq2_4958"
     CDS             421431..424403
                     /locus_tag="RAHAQ2_RS23885"
                     /old_locus_tag="Rahaq2_4958"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor SrfB"
                     /protein_id="WP_014341958.1"
                     /db_xref="GI:504107972"
                     /translation="MLATLTDFKQKITLIRDSGIQFLDFALKPVWDDGLPAKFVRKSA
                     NGPLLRLDYNPQNGRHFLPGLEGGAPEVVRPEFSFPLEQSLKLLDQIWLPLPFLRFNP
                     PRTFMAGPDNWARVQIRQLDTPEADGSTHRVVIAFDTRVVEGDGEQTQLAPTQDDVKN
                     GISFALAWHNEELPDFLDQTWVDGWLREVFTEQSAIREEREARNIKVALREFEYQAHY
                     LNLLEMLGSQLGIPELKINGATLQEPAINVDLILDVGNSHTCGILVEDHVGETDGLKQ
                     TSELQLRDLSQPHFLYNELFESRVEFAQARFGKPNFSVESGRDDAFIWPSILRAGREA
                     SRLALLREGTEGSTGISSPRRYLWDEDSYTPGWRFSQGGHGAVTEPVAAAMPLTFLIN
                     DDGQPLSDLPAEDRLPVFSAHYSRSSVMTLMLSELLAQALMQINSPAQRTRMLRSFAP
                     RQLRNIILTLPSAMPKPEREIFRRRMQEAIGLVWKSMGWHPSDDAFKNQADKAKSSVP
                     VPDVQMEWDEATCGQMVYLYNETQVNFGGHTGEFFASMARPDRELADDEPVGKTLRIA
                     SIDIGGGTTDLAITQYWLDDGMGNNVKITPRLLFREGFKVAGDDILLDVIQLYVLPAL
                     QAALKKAGLANPDSLMTRLFGSEGRMDGHATLRQQSTLQIFIPLARSVLEVYERFDPL
                     DTHAEIDAPFGELLEQTPTQKVLDYLHTEIQRVLPAGSAVFDILQVPLVLKLSKLHSE
                     FLSNRMSITQNLRSLCEVVSLHDCDVLLLTGRPSRFPGIQALFRHLQPLPINRMLSLD
                     GYHTSGWYPFNKLGRIDNPKSTAAVGAMLCLLALDLRLPGFYFKAGDFQPYSTVRYLG
                     MLDGNQVLSEDNVCYGDIDLDAHDYKLDSAASFRIRGAICLGFRQLENDRWPASPLYT
                     LSIAEPELARKVAGDSVLRVKLAVKKGEDHPTPEFFDIASAVLDNGTKVPAHHLRLRL
                     NTLGESHYWIDSGSVFVS"
     gene            424400..426775
                     /locus_tag="RAHAQ2_RS23890"
                     /old_locus_tag="Rahaq2_4959"
     CDS             424400..426775
                     /locus_tag="RAHAQ2_RS23890"
                     /old_locus_tag="Rahaq2_4959"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor"
                     /protein_id="WP_014341959.1"
                     /db_xref="GI:504107973"
                     /translation="MTTSTTETNAGLTTNVLQRQFTAVSDTIGGALDWVETTRADAPR
                     LDLEADRLNLQLIRCREKAQRLALACELPPALGFYGHSQAGKSYLICSLASGNYGRLE
                     TRLGGVTLDYLTQINPGNRVARFATRFTRQADVRDRAFPVRVLLLNEADLARIVIRAF
                     QPDSHSPVADTQHITEHLSKLMMHRQPEPVDGFTCEQMMGLWDSMIRLDPRRFRHLNA
                     HYWPVAVKLAPYLNIDDRARLFSLLWGNEPALTAAYRHYAHTLQHLSGAESLLAPLSI
                     LVDEAMQPADGIFSQSPGWDMQIPVCPQFGDESAPPVTLSLTELTMLASEVQIPLLSP
                     PREVLFEQIDLLDLPGYGALPDESGDDENSALFRAKISYLPERYTDRHEMNMLMVCTA
                     ADVRDDVVAVGRTLEYWVKEMHGENTQVRGRRKPGLVWVLTPFDRRVNGSAHFDEAVQ
                     RHVGNPGDAWGALLAMDDRGLQRMADYLVAEIRPEIRLNRLNELRDELRRELADNLLG
                     RWYQAGDAADPAQKQRTVQTVIKALQTRTGVHGELLEKLLPGRDELHRIYHEHAGLPA
                     ETGEQDEGGAESFGIGIDIDLFAEQQDVPVWQEKPDDGTAFARQVQRYWINHLRSLPE
                     NEPLIALLGVAKPTVELLMEELITISFRLKMGDALVRSLGGALSAGAREHEHHADRQV
                     SRALTVLGDFVAWLGFEKQAEAERPESRINKGNKIFAKPKQSVASWKSSRRLTKLSAT
                     PTNSTAFYIYDWLVGLQESIMRNAGYAAGGEIPAQQRESLASLLRMLKAEN"
     gene            426963..428012
                     /locus_tag="RAHAQ2_RS23895"
                     /old_locus_tag="Rahaq2_4960"
     CDS             426963..428012
                     /locus_tag="RAHAQ2_RS23895"
                     /old_locus_tag="Rahaq2_4960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004093099.1"
                     /note="catalyzes the formation of glycerone phosphate and
                     D-glyceraldehyde 3-phosphate from D-fructose
                     1,6-bisphosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="WP_014341960.1"
                     /db_xref="GI:504107974"
                     /translation="MTDITKLLGKEADSLLQHQCSTITSDQLCLPGADFVDRVMIDNN
                     RSPRVLAAMQNLYNTGRLAGTGYLSILPVDQGVEHSAGASFAANPLYFDPKNIVELAI
                     EAGCNCVASTYGVLASVSRRYAHKIPFLVKLNHNETLSYPTQYDQTLYASVEQAFNLG
                     AQAVGATIYFGSEESRRQIEEISAAFERAHELGMVTVLWAYLRNPAFVKDGKDYHSSA
                     DLTGQANHLAATIGADIVKQKMAENNGGYKAVKFGYTDERVYSTLTTDHPIDLVRYQL
                     ANCYMGRAGLINSGGAAGENDIQESVRTAVINKRAGGMGLILGRKAFKKSMKEGVGLI
                     NAVQDVYLDQKVTIA"
     gene            428335..430020
                     /locus_tag="RAHAQ2_RS23900"
                     /old_locus_tag="Rahaq2_4962"
     CDS             428335..430020
                     /locus_tag="RAHAQ2_RS23900"
                     /old_locus_tag="Rahaq2_4962"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_014341961.1"
                     /db_xref="GI:504107975"
                     /translation="MLIGIDLGTSNCAVAIWQDGQSVLVPNVYGKNLTPSVIGLDDNG
                     HILVGAPAQARLFTHPDLTLSSFKRFMGTEHQFRLGHQHFRAEELSALLLRSLKADVE
                     QHCGREVTRAIITVPAYFNDIQRKAVKAAGELAGLQVERLLNEPTAASLAYGLVNQQE
                     QKFLVFDLGGGTFDVSIIDMFEGVIEVRASSGDVFLGGDDFTRSLAVWMLAQYPQLDK
                     DDSALFGQLITLAEKAKHQLTTQDSTTLRYTWKDSSLNWTLTTEILAQCCESTLERMK
                     KPVIQALRDARFSADEVDHVVLVGGATRMPLVRQAVARLFGRFPRSELQPDEAVALGA
                     GIQAGLVLQDQALDDIVLTDVMPFTLGIGISRPKGDGYEDGHFLPLIERNSFVPVSRV
                     EKIVTISDQQKYLNLSIYQGEARRVADNILLGSLTVDVPPRPAGEMAADVRFTYTLDG
                     ILEVECKITSTGLVEKLVIEKAPGSLTPAQITASLLKLENIKQHPREQLVNRQLVAEA
                     NAYYEQSLGDQRQFIADQLYRFEHVLDTQDARQITTARREFESLLMHLRSEWE"
     gene            430025..430597
                     /locus_tag="RAHAQ2_RS23905"
                     /old_locus_tag="Rahaq2_4963"
     CDS             430025..430597
                     /locus_tag="RAHAQ2_RS23905"
                     /old_locus_tag="Rahaq2_4963"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_014341962.1"
                     /db_xref="GI:504107976"
                     /translation="MGIWSVLGIEPTQDITAIKRAYARQLKSTRPDQDPEAYQHLREA
                     FESARRGDHFWNISDAVTYSFPLPSLTDDAVIRQTQVHFLVSDTVSLLLENEQAGLDL
                     LKVCLSEELLQNLQLREIFSQQLAWDLAEREGLTASVLAKVAVLMEWEIDHYQPAGIS
                     IYQLDALHQQIENTAGGRYRDDSGAPWGEG"
     gene            430638..431969
                     /locus_tag="RAHAQ2_RS23910"
                     /old_locus_tag="Rahaq2_4964"
     CDS             430638..431969
                     /locus_tag="RAHAQ2_RS23910"
                     /old_locus_tag="Rahaq2_4964"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341963.1"
                     /db_xref="GI:504107977"
                     /translation="MSSQGIWSVLGIEPTQDLSVIKRAYARQLKNTRPDQDPEGYQRL
                     REAFDAAKHQGNNTVLSDVVTDEMPPAEVPAPPFLPRPAPFEPVNEISQETYRDTALR
                     RKVISQAAKITDEMMENETAGLEHLDAFIKSNVLQNIELHELFSQELAEQLSDRDGLY
                     SALLINVSGIMGWDIDHYQPEGISAYRLAALQRQVEMTDAKRYWSVMVREYQDCALNR
                     LRLRLLTVEGATVPWWAKLVPDFMTSLSNKLREIRMYHPALLPYLNSVLLKTLSETRV
                     ALSWGAVFLNGFWLLLIMLTTREHSEPWRSRILLIAIIGLYIHGYSYLERKLRYRPRM
                     LCVTECVLSVLSTAIMVKIMLGFFTMFKPDAGNLVMAATHYGVLSASSFCVLWMMSPK
                     HWKWYGVPLNAMIVLAMLPWQLMRKSAGMVSVVAFIALLGVYSLLIAFGFR"
     gene            complement(432002..433483)
                     /locus_tag="RAHAQ2_RS23915"
                     /old_locus_tag="Rahaq2_4965"
     CDS             complement(432002..433483)
                     /locus_tag="RAHAQ2_RS23915"
                     /old_locus_tag="Rahaq2_4965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341964.1"
                     /note="converts 1,4-alpha-D-glucans to maltodextrin;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /protein_id="WP_014341964.1"
                     /db_xref="GI:504107978"
                     /translation="MQNPTLFQFFHWYYPDGGKLWPEVAEKAAWLAEIGITAAWLPPA
                     CKGESGGYSVGYDTYDLFDLGEFEQKGSRATKYGDKEGLLAAIGALKQHNLGVILDVV
                     LNHKMGADEKERVQVNRVNMDNREEISDDIIEAEAWTRFIFAARNGKYSKFIWDFHCF
                     SGVDHIENPDEQGIFKIVNDYTGGGWNDQVDDEFGNYDYLMGANVDFRNNAVSEELKY
                     WGRWIMEQTHCTGFRLDAVKHIPAWFYKEWIDHIQAEAEQPMYVVAEYWSFDVQTLQN
                     YIHQVEGKTMLFDAPLQLNFHHASKQGADFDLTTIFDNTLVAADASHAVTLVANHDTQ
                     PLQSLEAPVEPWFKPLAYALILLREQGVPIVFYPDLFGASYEDQGEDGNTYTINLPAV
                     THLETLIKARQNYAWGAQTDYFDHPNCIAFSRSGTAEHPGCVVVMSNGEAGEKTIELG
                     DNFAGKKWRDILENRGDVIETDENGSAQFYCEAGSVSVWIMTE"
     gene            complement(433607..435109)
                     /locus_tag="RAHAQ2_RS23920"
                     /old_locus_tag="Rahaq2_4966"
     CDS             complement(433607..435109)
                     /locus_tag="RAHAQ2_RS23920"
                     /old_locus_tag="Rahaq2_4966"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter"
                     /protein_id="WP_014341965.1"
                     /db_xref="GI:504107979"
                     /translation="MRLRKKRVKPMQINDITIIDDTKLKKAITAAALGNAMEWFDFGV
                     YGFVAFALGQVFFPGADPGIQMIAALATFSVPFLVRPLGGLFFGALGDKFGRQKVLSV
                     TIIIMSVSTFCIGLIPGYASIGIWAPILLLLAKLAQGFSVGGEYTGAAIFVAEYSPDR
                     KRGFLGSWLDFGSIAGFILGAGVVVLISSIVGEANFLEWGWRIPFFIAAPLGLIGIYL
                     RHALEETPTFQQHVDKIDSDARKDIAEPPRVSFREILTKQWRPLIICVGMVIATNVTY
                     YMLLTYMPSYLSHSLHYSEDHGVLIIIAIMVGMLFVQPFMGMLSDRFGRKPFVIIGSI
                     GLFILAIPCFILINSDVIGLIFLGLLILAVLLNCFIGVMASTLPAMFPTHIRYSALAI
                     AFNVSVLIAGLTPTIAAWLVETTNNLYMPAYYLMVVAMIGLVTGIFMKETANRPLKGA
                     TPAASDRAEAREILQEHHDNIEQKIEDIDAQIIELEAKRKNLIAQHPDIN"
     gene            435402..436583
                     /locus_tag="RAHAQ2_RS23925"
                     /old_locus_tag="Rahaq2_4967"
     CDS             435402..436583
                     /locus_tag="RAHAQ2_RS23925"
                     /old_locus_tag="Rahaq2_4967"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014416494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligogalacturonate lyase"
                     /protein_id="WP_014341966.1"
                     /db_xref="GI:504107980"
                     /translation="MAKGSQIQFSFHTVQDPQTGVRVTRLTPPDVLCHRNYFYQKCFT
                     RDGNKLLFAGEFDGNRNYYLLDLGTQKAVQLTEGKGDNTFGGFLSPDDQFLYYVKNER
                     SLQRVTLADFSEHTVYQVPEEWVGYGTWVANSECTSLVGIEISREDWTPLSDWKIFQE
                     FYHSNPHCRLLRVDLLSGKSRVIHEKNEWLGHPIYRPFDDSTVAFCHEGPHDLVDARM
                     WLVNEDGSDVRKVKEHAPGESCTHEFWVPDGSALMYVSYLKGQHDRHIRRFDPQTGED
                     ICLMTMPACSHLMSNENGTLLVGDGSGTPVDVKDTASHTIENDPWLYIFDARTRRHAP
                     LAAHNSSWQVLDGDRQVTHPHPSFSPDDRHVLFTTDYEGLPALYLAEIPDALLSSLRK
                     D"
     gene            436587..436907
                     /locus_tag="RAHAQ2_RS23930"
                     /old_locus_tag="Rahaq2_4968"
     CDS             436587..436907
                     /locus_tag="RAHAQ2_RS23930"
                     /old_locus_tag="Rahaq2_4968"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_014341967.1"
                     /db_xref="GI:504107981"
                     /translation="MFTFKKDIPLQDLGDGVSRRVLAHDGTMMAVEVYFEEGAVGPMH
                     NHVHEQLTYVLSGRFKFTIGEETHEVSAGDTLYKKPYIMHGCVCLEKGVLLDTFTPQR
                     QDFL"
     gene            complement(436977..437615)
                     /locus_tag="RAHAQ2_RS23935"
                     /old_locus_tag="Rahaq2_4969"
     CDS             complement(436977..437615)
                     /locus_tag="RAHAQ2_RS23935"
                     /old_locus_tag="Rahaq2_4969"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004706483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013577754.1"
                     /db_xref="GI:503343093"
                     /translation="MKIALMMENSQAAKNAIILKELNAVASEKEYPVYNVGMSDEQDH
                     HLTYIHLGIMASILLNSKAVDFVVAGCGTGQGALMSLNIHPGVNCGYCIDPADAFLFA
                     QINNGNALSLPFAKGFGWGAELNVRFIFEKAFTGVKGEGYPADRKEPQVRNAGILNQV
                     KAAVVKENYLDTLRAIDPELVKTAVTGERFQKCFFENCQNKEIETFVREILA"
     gene            complement(437684..438445)
                     /locus_tag="RAHAQ2_RS23940"
                     /old_locus_tag="Rahaq2_4970"
     CDS             complement(437684..438445)
                     /locus_tag="RAHAQ2_RS23940"
                     /old_locus_tag="Rahaq2_4970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004090015.1"
                     /note="catalyzes the formation of
                     3-dehydro-2-deoxy-D-gluconate from 2-deoxy-D-gluconate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-deoxy-D-gluconate 3-dehydrogenase"
                     /protein_id="WP_013577755.1"
                     /db_xref="GI:503343094"
                     /translation="MILDNFSLQGKVAVVTGCDTGLGQGMAIGLAEAGCDIVGINIVE
                     PTETIERVGATGRRFLSLTADLSDTKVIPALLERAVAEMGHLDILVNNAGIIRREDAI
                     EFSEKNWDDVMNLNIKSVFFMSQAVAKQFIAQGTGGKIINIASMLSYQGGIRVPSYTA
                     SKSAVMGVTRLLANEWAKHNINVNAIAPGYMATNNTQQLRADEARSEEILGRIPAGRW
                     GLPSDLMGPVVFLSSPASDYINGYTIAVDGGWLAR"
     gene            complement(438839..439195)
                     /locus_tag="RAHAQ2_RS23945"
                     /old_locus_tag="Rahaq2_4971"
     CDS             complement(438839..439195)
                     /locus_tag="RAHAQ2_RS23945"
                     /old_locus_tag="Rahaq2_4971"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013577757.1"
                     /db_xref="GI:503343096"
                     /translation="MRTEDFIHDLIEWIDHNLEERLDIKTVAKRAGYSRWYLQRMFKE
                     HTGLPMGEYIREKKLKKSADMLASSGEPIVSVAISLGFDSQQSFTRSFKRQFGQTPGD
                     WRRGLNLATECQGCLH"
     gene            439553..440776
                     /locus_tag="RAHAQ2_RS23950"
                     /old_locus_tag="Rahaq2_4972"
     CDS             439553..440776
                     /locus_tag="RAHAQ2_RS23950"
                     /old_locus_tag="Rahaq2_4972"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter, MFP subunit"
                     /protein_id="WP_014341968.1"
                     /db_xref="GI:504107982"
                     /translation="MMNLQKSQVVVRGRSGGTPLTLRLSGVALMVALLAGCDNSVAQN
                     AAPPAPQVSAADVLIKPISQWDAFNGRVEAVQSVQLRPRVSGYIDKVNYQEGQEVKKG
                     QVLFTIDDRTYRAAQEQAKAELVRARNQASLARSESARTEALIGTLAVSKEVAEQRRS
                     AASQAQSDVLAAQAQLDMAQLNLDFTRVISPIDGRASRAMITTGNLVTAGDSASVLTT
                     VVSLDTVYVYFDVDEGTFLRYQALAREGKLNDSPQSRLPVHVGLVGENGYPHQGVVDF
                     TDNQLNAGTGTIRMRALLDNRDRTFTPGLFARVQMPGSAQFNALLVDDKAILTDQDRK
                     FVYVVDKEGKAQRRDVEIGRMFGGLRIVQKGLEAGDRVIIDGVQKVFMPGMPVNAKTV
                     SMAANTVTPAAPAVQ"
     gene            440793..443945
                     /locus_tag="RAHAQ2_RS23955"
                     /old_locus_tag="Rahaq2_4973"
     CDS             440793..443945
                     /locus_tag="RAHAQ2_RS23955"
                     /old_locus_tag="Rahaq2_4973"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="WP_014341969.1"
                     /db_xref="GI:504107983"
                     /translation="MDFSRFFIDRPIFAAVLSILILVTGAIAIPLLPVSEYPNVVPPS
                     VQVRAEYPGANPKVIAETVATPLEEAINGVENMVYMKSVAGSDGVLVTTVTFRPGTDP
                     DQAQVQVQNRVAQAEARLPEDVRRQGVTTQKQSPTLTLVVHLVSPSGKYDSLYLSNYA
                     TLKVKDELARLPGVGQIQIFGAGEYAMRVWLDPNKVAARGLTASDIVKAMQEQNVQVS
                     AGQLGAEPMPKDSDYLLSINAQGRLKDEDEFGKIILKSGDNGEIVRLRDVARIEMGSG
                     SYALRAQLNNKDAVGIGIFQSPGANAIDLSDAVRAKMDELATRFPEGMTWRAPYDPTV
                     FVRDSISAVVHTLLEAVVLVVLVVILFLQTWRASIIPLLAVPISVIGTFSILYLLGFS
                     LNTLSLFGLVLAIGIVVDDAIVVVENVERNIEEGLAPRDAAHQAMREVSGPIVAIALV
                     LCAVFVPMAFLSGVTGQFYKQFAVTIAISTVISAINSLTLSPALAALLLKSHGAPKDM
                     PSRLIDRLFGWIFRPFNRFFNASSHRYQNAVSKTLGRRGAVFAVYILLLCAAAFMFKA
                     VPGGFIPTQDKLYLIAGVKMPEGASLSRTDAVIRKISAMGLSTDGVIDAVAFPGLNAL
                     QFTNTPNTGTVFFALKPLSERTRTAAEINAEINAKISQIQEGFAFSIMPPPILGLGQG
                     SGYSLYVQDRAGLGYGALQTAINTMSGAIMQTPGMGYPISSYQANVPQLDAHIDRDKA
                     KAQGVSLDELFSTLQVYLGSAYINDFNRFGRTWKVMAQADGQFRDTVEDIANLRTRND
                     KGEMVPIGSMLNITTTYGPDPVIRYNGYPAADLIGDADPRVLSSTQAMTELIAMSKNL
                     LPNGMNIEWTDLSYQQSTQGNAALIVFPMSVLLAFLVLAALYESWTLPLAVILIVPMT
                     MLSALFGVWLTGGDNNVFVQVGLVVLMGLACKNAILIVEFARELELQGKGIIESALEA
                     CRLRLRPIVMTSIAFIAGTIPLILGHGAGAEVRGVTGITVFSGMLGVTLFGLFLTPVF
                     YVALRKLVTRKKAVLETQTA"
     gene            complement(444035..444520)
                     /locus_tag="RAHAQ2_RS23960"
                     /old_locus_tag="Rahaq2_4974"
     CDS             complement(444035..444520)
                     /locus_tag="RAHAQ2_RS23960"
                     /old_locus_tag="Rahaq2_4974"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014341970.1"
                     /db_xref="GI:504107984"
                     /translation="MLDYRFPTAMQMVFCIAQSQKAGQRCTSAILATGLEANSSFIRK
                     LMVPLTQHGIIVSTLGRTGSITLGRPAEEITLRDIYCAVIEDKRLWAARPDVPARCVV
                     SANACTYFKNIVSEAEEASFQVLARHTVADALAEFERGGKYKCTKDLAAQNAEDSLCS
                     K"
     gene            complement(444733..445890)
                     /locus_tag="RAHAQ2_RS23965"
                     /old_locus_tag="Rahaq2_4975"
     CDS             complement(444733..445890)
                     /locus_tag="RAHAQ2_RS23965"
                     /old_locus_tag="Rahaq2_4975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341971.1"
                     /note="allows for ions and hydrophilic solutes to cross
                     the outer membrane; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_014341971.1"
                     /db_xref="GI:504107985"
                     /translation="MKLKALALIIPALLVAGAAHSAEVYNKEGNKLDLYGKVDARHQF
                     SDDAGQDGDETYVRVGFKGETQITDQLTGFGQWEYNVQANNSESSGTAGNATRLGFAG
                     LKFGDFGSFDYGRNYGVVYDIEAWTDMLPVFGGDTYTTTDNFMVGRTNGVATYRNTDF
                     FGEVKGWNFALQYQGANDGDNNSEDVNYNAAGEGTNNGRDVRHQNGDGYALSTTYDFG
                     MGITAGAAYASSDRTNDQTASAGENFAGGDKADVWTVGAKYDANNVYLATMYSETRNM
                     TMFGDSGVANKTQNFEVTAQYQFDFGLRPEVSYLQSKGKDLTADGSNTSDNNDKDLVK
                     YVSVGANYYFNKNMSTYVDYKINLLDSDDEFYTNQGISTDDVVGVGLQYQF"
     gene            complement(446502..446690)
                     /locus_tag="RAHAQ2_RS23970"
                     /old_locus_tag="Rahaq2_4976"
     CDS             complement(446502..446690)
                     /locus_tag="RAHAQ2_RS23970"
                     /old_locus_tag="Rahaq2_4976"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341972.1"
                     /db_xref="GI:504107986"
                     /translation="MSTTVHIAERRSLWQRITHPKFNNPQAERAQDTSRLLESFLATG
                     CLYGIDVGNSDPAWFRRS"
     gene            complement(446851..447261)
                     /locus_tag="RAHAQ2_RS23975"
     CDS             complement(446851..447261)
                     /locus_tag="RAHAQ2_RS23975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009636130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_037040952.1"
                     /db_xref="GI:739176995"
                     /translation="MTGNDIDLFRERLTVLVRSLQIAPDVAENQVLDRVALSFRKLLN
                     FLAENTELTQQIFLLPPLAKETQRLLASLMSENLTHNQQCKLFRSDIPAFALAQCFTG
                     MLVQLAQDPADPEVRHQNSQACAKLFCEGVWLRE"
     gene            447492..448271
                     /locus_tag="RAHAQ2_RS23980"
                     /old_locus_tag="Rahaq2_4978"
     CDS             447492..448271
                     /locus_tag="RAHAQ2_RS23980"
                     /old_locus_tag="Rahaq2_4978"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin reductase"
                     /protein_id="WP_014341973.1"
                     /db_xref="GI:504107987"
                     /translation="MSKNGKVALVTGGGQGIGRAIALRLAKDGFAVAVVDFNAETAKK
                     VAEEINHAGGKAIAQLADVSDREQVFAAVEAATKQLGGFDVIVNNAGIAPTTLIEDIT
                     PEIVDKVYNINVKGVIWGIQAAVKAFKSQGHGGKIINASSQAGHVGNPELAIYSSSKF
                     AVRGLTQTAARDLALLGITVNAYCPGIVKTPMWEEIDRQVSEAAGKPVGYGTQEFAKN
                     ITLKRLSEPEDVAACVSYLAGPDSDYMTGQALLIDGGMVFN"
     gene            complement(448337..449203)
                     /locus_tag="RAHAQ2_RS23985"
                     /old_locus_tag="Rahaq2_4979"
     CDS             complement(448337..449203)
                     /locus_tag="RAHAQ2_RS23985"
                     /old_locus_tag="Rahaq2_4979"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014341974.1"
                     /db_xref="GI:504107988"
                     /translation="MQSEQKPDFHDDLIKELLYWIEVNLSDRLTMEKASKKTGYSPWY
                     LQRLFKSKTGYALGKYIRDRRLTMAAIALRLTNMPILDISLYYSYDSQQTFTRSFKKN
                     FAETPGTYRRNASWTMNGITAPLTVDEFPQPEYEIVELPEMAFEGNTVSHSYPIEALF
                     NSKNHVHRAELLRYLETPASLQAPVWGLSDCRPDTNDEVANALQMDYTVAHQVQTSDS
                     HNILVPASRYLKINYPYDLSRLNDFILYLYSVFLPTLGLEFIMQPDLEKYSRESALKG
                     VTCEYYIPLARQ"
     gene            complement(449293..449961)
                     /locus_tag="RAHAQ2_RS23990"
                     /old_locus_tag="Rahaq2_4980"
     CDS             complement(449293..449961)
                     /locus_tag="RAHAQ2_RS23990"
                     /old_locus_tag="Rahaq2_4980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004711315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049796164.1"
                     /db_xref="GI:908659714"
                     /translation="MALSSAVYFASVIPVAYLCKEARRTTILEAAARVARREGLAATT
                     VRRVALEAGAATGQVHHHFSSAAELRAQAYTQVMKVLKDQLLEQCQTLTARERLNLFL
                     IDSKDEHSLMAIPLWHEAMLLTEQEPLMKAAFALSVTDWHEMVSDAITLGRQKGEFVE
                     GESPAHISWRLIGLSSSMDAMARLESLGLTADCAEYHLHRAIENELYNREPDLKEASV
                     FKIR"
     gene            complement(450089..451795)
                     /locus_tag="RAHAQ2_RS23995"
                     /old_locus_tag="Rahaq2_4981"
     CDS             complement(450089..451795)
                     /locus_tag="RAHAQ2_RS23995"
                     /old_locus_tag="Rahaq2_4981"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tannase"
                     /protein_id="WP_014341976.1"
                     /db_xref="GI:504107990"
                     /translation="MHIRRVFLNAQPPKDFFHWPFNDKLPLLSRRNERCLMKASLYLC
                     PLVLFTATVVAAPEKGLTEAQCVALKNTHINAAAIGLPTRGARVITVAMAGHPGNQHC
                     KIEGQIKPVALNAPDINFELYLPLNWNGKALQLGGSGFDGAIKDADTARLAPAATPGA
                     IKQGYATFGSDSGHQGGVSDASFTLNEEAWDNFAGAQIKKTHDVAIALIQQAYGRKPA
                     HMYFQGNSQGGHEALAAIQRFPLDYDGAIAIHPVYNVVELHIAGISIGKAIYNTPGAW
                     ISPAKAALIANAVTGACDKLDGLADGVVANPDACSTTFKLSHLRCPEGKDAGAHCLSD
                     TQIALVQMLNKPVPLGVSLLTGDHFAPWPILRGADASALVSVFGSGADRPKPEASNII
                     ISFPYMMGDQAVRYEVMRDANYDSLRFNPAAHEARLKVLAEQVDNNNADIRTFVQHGG
                     KLLLMHGTADMAVPPGNTVAYYEKLKAEFGDQELHQFARFYLAPGFTHSSGTYRASWD
                     SLGALDKWVVHGIDPGQQVMIDTNKVTAGREMPLCDYPLFPRYNGQGNPKVASSFTCA
                     AK"
     gene            complement(452484..454625)
                     /locus_tag="RAHAQ2_RS24005"
                     /old_locus_tag="Rahaq2_4984"
     CDS             complement(452484..454625)
                     /locus_tag="RAHAQ2_RS24005"
                     /old_locus_tag="Rahaq2_4984"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014341978.1"
                     /db_xref="GI:504107992"
                     /translation="MLSKQNKAIGLPEPTQTILLSTGTAEEKRQEIRDYFIQTWELYE
                     SLFDCLADERAYYNKAISLRHPLIFYFGHTATFYINKLIAAGLIPQRIDSHIEAMLAI
                     GVDEMSWDDLDDQNYNWPSVVNLRQYRDKVREEVLGIIDTMTLSLPIGWDSPAWVILM
                     GIEHERIHLETSSVLIRQLPVEWVKPQSHWPACEIARHDRNSVPENSVLAVKGDIVTL
                     GKHDDTYGWDNEYGTSVQKIQAFSASKMLVSNAEFYTFVQAGGYHETRWWDEEGAGWR
                     DFARAEMPTFWVGSPGEPERLKLRLMTEEVPMPWDWPAEVNQLEAAAFCRWKAAQTGE
                     SVQLPTEAEWMILRDQVPGDQPDWKTAPGNINLAWWASSCPVDHFAQGDFYDVVGNVW
                     QWASTPISGFDGFRVHPLYDDFSTPTFDGKHSMIKGGSWISTGNEALKSSRYAFRRHF
                     FQHAGFRYVISSHQELVTVNPYETDGLVAQYLDFQYGPRHFDVMNYAAQLADIAVENT
                     IHRGRALDIGCATGRASFELARHFDSVVGMDYSARFIDVALALARGEACRYVIPEEGE
                     LVDYCQASLADVNISAEQTARVTFVQGDACNLKPQAELYDLVLAANLLDRLREPARFL
                     ADITPMIRSGGLLMLSSPYTWLEEFTPKEHWLGGFRENGEAVTTHQALKRLLASEFEE
                     VRKPTDVPFVIRETARKFQHTVAELTLWRKR"
     gene            complement(455123..456670)
                     /locus_tag="RAHAQ2_RS24010"
                     /old_locus_tag="Rahaq2_4986"
     CDS             complement(455123..456670)
                     /locus_tag="RAHAQ2_RS24010"
                     /old_locus_tag="Rahaq2_4986"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_014341980.1"
                     /db_xref="GI:504107994"
                     /translation="MSLKKSSLLVLVILFALFFTSMLSNVWLLTRSNHSLDDVNKEIR
                     VVLSIIDPINHSRTSRVRVMEYMKEIENGDGQQSKPALDGVIEVVGKADAAFQAYLDA
                     PKLPGESGLAGEYRNTYQKYRQNGIQPLIEAAKAGDQIAFKTQIPEVVKLDRQYEIVL
                     DKVLALHEQYAKNLNSDAQSHFKFGIGLTVGFGLLFLIIIISVLMLMKRFVLTPLLSS
                     RDHCRQIAEGYLDTPVPVKAQSRSEIEELMQSIEHMRQSLTRIIGQVRDTSHTVAHAS
                     QEISAGNIDLASRTEQQAAALTQTAASMEELGATVKQNTENVSRASSLTREAVQNARA
                     GEKVAQDVIGTMGRINSSSKKIEDITGVINSIAFQTNILALNAAVEAARAGEQGRGFA
                     VVASEVRSLAQRSAVAAKEIESLISESVANIREGSDQVSRTGDSISAIISSVSQINVL
                     MEHISIASDEQSRGISQIEQAVTEIDGVTQQNAALVQESAAAAASLEEQVLHLTRSVS
                     AFRLATV"
     gene            457520..458014
                     /locus_tag="RAHAQ2_RS24015"
                     /old_locus_tag="Rahaq2_4987"
     CDS             457520..458014
                     /locus_tag="RAHAQ2_RS24015"
                     /old_locus_tag="Rahaq2_4987"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341981.1"
                     /db_xref="GI:504107995"
                     /translation="MSNSFQNEIPKARVNIKLDLHTGGAQKKVELPLKLMVMGDYSNG
                     KENRPLSEREKVNINKNNFNSVLAEFSPSLNLTVENTLAGDRSEENISLNFNEMKDFE
                     PEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKELETILKDPALSNELRSELNAL
                     APKA"
     gene            458046..459593
                     /locus_tag="RAHAQ2_RS24020"
                     /old_locus_tag="Rahaq2_4988"
     CDS             458046..459593
                     /locus_tag="RAHAQ2_RS24020"
                     /old_locus_tag="Rahaq2_4988"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017372890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein EvpB"
                     /protein_id="WP_037040958.1"
                     /db_xref="GI:739177001"
                     /translation="MLMSVNTENSSSSQTTVLDRPEAGTVYASLFDKINLTPVSSLGD
                     LNDFQDTSALADVTADQRVTAAVQVFLERLKLSGQTVERLDKTLLDHHIAELDSQISR
                     QLDVVMHHPEFQRIESGWRGLKFLVDRTDFRQNVKIELLDVSKDDLRQDFEDCPEIIQ
                     SGLYRHTYIQEYDTPGGEPIGSVISNYEFDASAQDVALLRNISKVSAAAHMPFVGAVG
                     PKFFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDSDDSRYIGLTMPRVLARLPYGPD
                     TVPVRSFNYVEEVKGPDHEKYLWTNAAFAFAANMVKSFIKNGWCVQIRGPQAGGAVTD
                     LPIHLYDLGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKP
                     ALYDTTDATANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELELNTWIRT
                     LVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYAVPHFQVEGMDVNLSLVS
                     QMPKAKA"
     gene            459609..460958
                     /locus_tag="RAHAQ2_RS24025"
                     /old_locus_tag="Rahaq2_4989"
     CDS             459609..460958
                     /locus_tag="RAHAQ2_RS24025"
                     /old_locus_tag="Rahaq2_4989"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014341983.1"
                     /db_xref="GI:504107997"
                     /translation="MKIYRPLWSEGALLSPQQFQQQALWEAHNNQCVAHLSVVNPWGV
                     ATAEFDEGLLSVRRLQALQLTVRLPDGSLIDTGSSDLLPPARDLSQDIPAQVNELTVM
                     LAMPLLQANSSNVQLTDNAGDRPLRYRQEWVNVQDAFGQEEESMAVARYALSLRFDTE
                     QNEEYLICPVLRLVRDGQGGWRNDSTFIPPLLAMSAHHGLVLDMEQILTQLQAKRRRL
                     MGMRRESNQRMADFAVADVSLFWLLNALNTHVSALSELVKNPARHPEQVWFELSKLAG
                     SLLTFSLEHDIEAIPAYDHASPETVFPPLLDLIGELLEASLPSRVISLEMHKINGQQW
                     KAPLNDSRLREDADFYLSVRSTLPAYQLISQFPALCKVGAPDDVNNIVNIALNGIPLI
                     ALSHVPAAIPLRLENQYFTMDLKHPSAQAMLDAGTCMFYVPELLGELQLELYAVLRS"
     gene            460955..461629
                     /locus_tag="RAHAQ2_RS24030"
                     /old_locus_tag="Rahaq2_4990"
     CDS             460955..461629
                     /locus_tag="RAHAQ2_RS24030"
                     /old_locus_tag="Rahaq2_4990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014341984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014341984.1"
                     /db_xref="GI:504107998"
                     /translation="MRNEIDIDELLADTWLSVVQLRNGVVAEEGEALYERCRAQVERV
                     KDQLQLAGYDSESIEHITYAQCALLDETALGRQAEDKAPDNGHITWQRAPLQARFFGS
                     LQAGEALYERIRSVLRQPAPDITVLTCFHRVLLLGFQGQYSAQTINPQQREQTLTALA
                     GRVTPFNVVLPGALLSKTGRVRGGALLRSLWFWVLVAIVIVSGVWWGGHVWLQHLINQ
                     QLPGQF"
     gene            461631..463307
                     /locus_tag="RAHAQ2_RS24035"
                     /old_locus_tag="Rahaq2_4991"
     CDS             461631..463307
                     /locus_tag="RAHAQ2_RS24035"
                     /old_locus_tag="Rahaq2_4991"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotB"
                     /protein_id="WP_014341985.1"
                     /db_xref="GI:504107999"
                     /translation="MRIGSRLSVYCLTGMTGCLALLLCWGFSPFAVSTKSVITLITLV
                     LMAGFMLWGRRNHVFMDATTRLESLPEISFSQPVVLVCGDKLDALFGETTVRVTPLAC
                     YVKTDSVKPLSIFVDAVLSQRPGWIRQMAVLYSVSPEAHADEAVFRATIKSWRQQFYR
                     LQKRIGCRIPVLVSCWLNGSVSPWFVGAADGKMIVRDDDEGATLLSDWLPSSDINMQP
                     ARQSQAICLEAACSWLRDVVLDEMQHPETLSTPVCPVAVGVRFDAVSGVPDNLWSAAL
                     TRRTTLNALMPLQSESVATLPFPDPLLPLLSGTTRHIRAGLAPVIAVILMMCFAVTAI
                     AFVVNNNHRLITRIGMDLKRYLVIPMSNYVPKAQAVAVLKLDAQLLERYHRQGEPLRL
                     GLGLYQGERLWLALQQEIDRYIPPPPPPPPAEKHTPKTVRLDALSLFDTGQYELKPGS
                     LKMLVNALVDIKAKPGWLIVVAGHTDITGDAKANQILSLKRAESLRDWMLSTSDVSPT
                     CFAVQGYGATRPIATNDTPEGRAANRRVEISLVPQADACKASATPSSSND"
     gene            463340..463831
                     /locus_tag="RAHAQ2_RS24040"
                     /old_locus_tag="Rahaq2_4992"
     CDS             463340..463831
                     /locus_tag="RAHAQ2_RS24040"
                     /old_locus_tag="Rahaq2_4992"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system effector"
                     /protein_id="WP_013577830.1"
                     /db_xref="GI:503343169"
                     /translation="MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQDHNLYIPTD
                     NNTGKLTGTRIHTPFLFTKEIDSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYF
                     NTKLENVKLVKVAPKMHDIKDPAKEKHNHLEAIELRYEKITWTYKDGNIIHSDSWNER
                     TTA"
CONTIG      join(CP003245.1:1..463906)
//
DBGET integrated database retrieval system