GenomeNet

Database: RefSeq
Entry: NC_016935
LinkDB: NC_016935
Original site: NC_016935 
LOCUS       NC_016935            8739048 bp    DNA     circular CON 06-JUL-2013
DEFINITION  Paenibacillus mucilaginosus 3016 chromosome, complete genome.
ACCESSION   NC_016935
VERSION     NC_016935.1  GI:379718015
DBLINK      Project: 89377
            BioProject: PRJNA89377
KEYWORDS    RefSeq.
SOURCE      Paenibacillus mucilaginosus 3016
  ORGANISM  Paenibacillus mucilaginosus 3016
            Bacteria; Firmicutes; Bacilli; Bacillales; Paenibacillaceae;
            Paenibacillus.
REFERENCE   1  (bases 1 to 8739048)
  AUTHORS   Ma,M., Wang,Z., Li,L., Jiang,X., Guan,D., Cao,F., Chen,H., Wang,X.,
            Shen,D., Du,B. and Li,J.
  TITLE     Complete genome sequence of Paenibacillus mucilaginosus 3016, a
            bacterium functional as microbial fertilizer
  JOURNAL   J. Bacteriol. 194 (10), 2777-2778 (2012)
   PUBMED   22535950
REFERENCE   2  (bases 1 to 8739048)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 8739048)
  AUTHORS   Ma,M., Li,L., Jiang,X., Wang,Z., Guan,D., Cao,F., Chen,H., Wang,X.,
            Shen,D., Feng,R., Ge,Y., Bing,X., Yang,X., Du,B. and Li,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-DEC-2011) Institute of Agricultural Resources and
            Regional Planning, Chinese Academy of Agriculture Sciences, 12
            Zhongguancun South Street Haidian District, Beijing, Beijing
            100081, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003235.
            Source DNA is available from China General Microbiological Culture
            Collection Center (CGMCC, htp://www.cgmcc.net/).Bacteria available
            from CGMCC.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..8739048
                     /organism="Paenibacillus mucilaginosus 3016"
                     /mol_type="genomic DNA"
                     /strain="3016"
                     /isolation_source="rhizosphere soil"
                     /db_xref="taxon:1116391"
     gene            1..1362
                     /locus_tag="PM3016_1"
                     /db_xref="GeneID:11889114"
     CDS             1..1362
                     /locus_tag="PM3016_1"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase DnaA"
                     /protein_id="YP_005310147.1"
                     /db_xref="GI:379718016"
                     /db_xref="GeneID:11889114"
                     /translation="MESHPNDQWQQVLLILQKRVSKPSYETWLASTRAVVFNKSTVTI
                     CAPNKFAREWLEDRYTKHINEAIVDYMGHPVELKFTIEDEQTEAAGTPSEALPVKPKQ
                     PPAAEETFSHMMNPKYTFDTFVIGAGNRFAHAASLAVAEAPAKAYNPLFLYGGVGLGK
                     THLMHAIGHFVLEHNPSARVLYISSEKFTNEFINAIRDNRGESFRAKYRSIDILLIDD
                     IQFLAGKEQTQEEFFHTFNALHEERKQIIISSDRPPKEIPTLEERLRSRFEWGLITDI
                     QPPDLETRIAILRKKAKAENLDIPNEAMVYIANQIDSNIRELEGALIRVVAYSSLINE
                     DITSHLAAEALKDIIPSSRPKVITIQDIQAKVGEFYGLKIEDFKARKRTKTVAFPRQI
                     AMYLAREMTDFSLPKIGDAFGGRDHTTVIHAHEKISAALKVDQDLYKIIQNISEKVKN
                     VTM"
     misc_feature    16..1350
                     /locus_tag="PM3016_1"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    16..201
                     /locus_tag="PM3016_1"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    <160..339
                     /locus_tag="PM3016_1"
                     /note="Vesiculovirus matrix protein; Region:
                     Vesiculo_matrix; pfam06326"
                     /db_xref="CDD:253678"
     misc_feature    379..816
                     /locus_tag="PM3016_1"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    460..483
                     /locus_tag="PM3016_1"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(463..486,649..651,748..750)
                     /locus_tag="PM3016_1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    637..654
                     /locus_tag="PM3016_1"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    787..789
                     /locus_tag="PM3016_1"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1075..1344
                     /locus_tag="PM3016_1"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1144..1146,1168..1173,1192..1194,1210..1218,
                     1243..1257,1264..1266,1273..1278)
                     /locus_tag="PM3016_1"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1594..2736
                     /locus_tag="PM3016_2"
                     /db_xref="GeneID:11889116"
     CDS             1594..2736
                     /locus_tag="PM3016_2"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaN protein"
                     /protein_id="YP_005310148.1"
                     /db_xref="GI:379718017"
                     /db_xref="GeneID:11889116"
                     /translation="MKLTVLKEYLNESIQHVSKAISSKTTIPILGGIKIDADSTGMTL
                     TASDTDISIQSFIPKEKNEISVIDLKQTGSVVLPSKFFVEIIRKLPAQQVEIEVKEGF
                     HTTIRSGSSEIQLVGLDPEEYPIMPGIEENKRIQIPSDLLKTMIKQTAFAVSTNEATP
                     ILTGILWTIADGKLKFTACDRHRLASRETSIDTEEGLVLNNVSISGKTLNELSKILPD
                     QNTLIDVVFAENQVLFKMSSILFYSRILDGTYPDTSKLIPQSYQTELVINTDDLADAI
                     DRAYLLSREEKTNIVKLIMREDQTIEISSSSSELGKVTEELTASRLNGELLRISFNSK
                     YMLDALKVMDSEQIHIGFTGAMQPIIIRPDENSSLLQLILPYRTTG"
     misc_feature    1594..2727
                     /locus_tag="PM3016_2"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1594..2724
                     /locus_tag="PM3016_2"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1663..1665,1831..1833,1852..1854,2212..2214)
                     /locus_tag="PM3016_2"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1834..1836,1843..1845,1921..1923,1927..1929,
                     2434..2436,2533..2538)
                     /locus_tag="PM3016_2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2128..2130,2134..2145,2587..2589,2713..2724)
                     /locus_tag="PM3016_2"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2128..2130,2134..2139,2359..2361,2467..2469,
                     2509..2514,2596..2598,2713..2724)
                     /locus_tag="PM3016_2"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2749..2964
                     /locus_tag="PM3016_3"
                     /db_xref="GeneID:11889118"
     CDS             2749..2964
                     /locus_tag="PM3016_3"
                     /codon_start=1
                     /transl_table=11
                     /product="YaaA-like protein"
                     /protein_id="YP_005310149.1"
                     /db_xref="GI:379718018"
                     /db_xref="GeneID:11889118"
                     /translation="MKTVSIHTEYITLGQFLKLADCISTGGQAKPFLEETPITVNGEP
                     ENRRGRKLRPSDIIKVQGCGEFQVVQG"
     misc_feature    2755..2931
                     /locus_tag="PM3016_3"
                     /note="S4 domain protein YaaA; Region: YaaA_near_RecF;
                     TIGR02988"
                     /db_xref="CDD:132033"
     gene            2964..4071
                     /locus_tag="PM3016_4"
                     /note="RecF"
                     /pseudo
                     /db_xref="GeneID:11889144"
     gene            4101..4349
                     /locus_tag="PM3016_6"
                     /db_xref="GeneID:11889186"
     CDS             4101..4349
                     /locus_tag="PM3016_6"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YaaB"
                     /protein_id="YP_005310150.1"
                     /db_xref="GI:379718019"
                     /db_xref="GeneID:11889186"
                     /translation="MFIHLGGEKIIRASELVAIFDLSIEKSSKISKQFVTYASKEKRV
                     EVIGDEESKSLVVTQSKVYYSPISSMTLKKRAHQLLTN"
     gene            4440..6353
                     /locus_tag="PM3016_7"
                     /db_xref="GeneID:11889188"
     CDS             4440..6353
                     /locus_tag="PM3016_7"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GyrB"
                     /protein_id="YP_005310151.1"
                     /db_xref="GI:379718020"
                     /db_xref="GeneID:11889188"
                     /translation="MSVNPGTTYDESQIQVLEGLEAVRKRPGMYIGSTSARGLHHLVW
                     EVVDNSIDEALAGYCTRIEVIVHKDNSITVIDNGRGIPVGEHPKLKKSTLEVVLTHAG
                     GKFGGDESGYKVSGGLHGVGISVVNALSKKLVVQVKREGKVHQQEFSCGVPQYDLKII
                     GETEETGTQATFWPDEEIFKETTEYDFDTLQSRIRELAFLNKGIEIVLTDERSDVSNS
                     FMYEGGIVSFVEHLNRNREPLHEPPIFVEGEKDNITVEVALQYNDTYAENIYSFANNI
                     NTHEGGTHESGFKSALTRILNEYARKYNTIKDNDANLSGDDVREGLTAIISVKIPEPQ
                     FEGQTKTKLGNSEVRGIVESLFSDKLEEFLVENPSVAKKIVEKGVQAQRAREAARKAR
                     ELTRRKSALEVSSLPGKLADCSSKDASISEVYIVEGDSAGGSAKQGRDRHFQAILPLR
                     GKILNVEKARLDKILSNAEIRAIITALGTGIGDDFEITKARYHKVIIMTDADVDGAHI
                     RTLLLTFFFRYMRKLIEAGFVYIAQPPLYKLERNKTIRYAYNDKQREAIMAEFGEGAK
                     VNVQRYKGLGEMNPGQLWETTMDPDSRTLLQVSIQDAIDADVVFDTLMGDAVEPRRDF
                     IQLHARYVKNLDI"
     misc_feature    4449..6350
                     /locus_tag="PM3016_7"
                     /note="DNA gyrase subunit B; Validated; Region: gyrB;
                     PRK05644"
                     /db_xref="CDD:235542"
     misc_feature    4554..>4838
                     /locus_tag="PM3016_7"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(4572..4574,4584..4586,4593..4595,4659..4661,
                     4665..4667,4671..4673,4677..4682,4797..4808)
                     /locus_tag="PM3016_7"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    4584..4586
                     /locus_tag="PM3016_7"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(4671..4673,4677..4679,4797..4799,4803..4805)
                     /locus_tag="PM3016_7"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    5106..5570
                     /locus_tag="PM3016_7"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    5259..5261
                     /locus_tag="PM3016_7"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5433..5435,5442..5447,5451..5453)
                     /locus_tag="PM3016_7"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5451..5453,5457..5459)
                     /locus_tag="PM3016_7"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    5700..6041
                     /locus_tag="PM3016_7"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(5718..5723,5730..5732,5937..5939,5943..5945,
                     5949..5951)
                     /locus_tag="PM3016_7"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(5718..5720,5937..5939)
                     /locus_tag="PM3016_7"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    6126..6317
                     /locus_tag="PM3016_7"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            6555..9062
                     /locus_tag="PM3016_8"
                     /db_xref="GeneID:11889190"
     CDS             6555..9062
                     /locus_tag="PM3016_8"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GyrA"
                     /protein_id="YP_005310152.1"
                     /db_xref="GI:379718021"
                     /db_xref="GeneID:11889190"
                     /translation="MSEEPRSQVKEIDIGSEMRTSFMDYAMSIIVSRALPDVRDGLKP
                     VHRRILFAMSELGMSPDKPYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSLRYM
                     LVDGHGNFGSIDGDMAAAMRYTEARLSKIAMELLRDINKETIDFVPNYDGEEQEPAVL
                     PSRFPNLLVNGLSGIAVGMATNIPPHNLTEVINGVQQLIQNPEVTPLELMQSIKGPDF
                     PTGGYIMGREGIKQAYATGRGSVIMRAKTLIEENGNKARIIVYELPYQVNKARLIEKI
                     AELVREKKIDGITDLRDESDRNGMRIVIELRRDVNPNVVLNNLYKQTAMQSNFGIIML
                     ALVNGEPKVLNLRDVLFHYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDHLDEV
                     IALIRASRTTEEAREGLMTRFGLSFDQAQAILDMRLQRLTGLERQKIEEEYAELLKKI
                     AEYKAILADEQLVLAIISEELNEIKEKFGDERRSEITIGEESIEDEDLIPQSDVVITI
                     THTGYIKRLPVTTYRSQRRGGKGIMGMDTKDKDFVEHLFVTNTHHYLLFFTNKGKVYR
                     LKAYEIPDLSRTARGTPIINLIQIEQGETINAVIPVESFDSDKYLFFASKKGLVKKTS
                     LDDYSNIRKGGLIAITLREDDDLIGVRLTDGNQSIIMGTAQGMSIHFPENEVRPMGRS
                     ATGVKGIQLDEEDHVIDMDVVHEDNSVLIVTSKGFGKRTPVSEYRLQSRGGKGIKTLN
                     VTSKNGPVVGLKVVQEEEDLMIITAFGTVIRTSMSGISLMGRNTQGVRLINIREEDEV
                     STLARVEKSDDPADDAEGEESEEIQGTSEGFDETSEE"
     misc_feature    6567..8978
                     /locus_tag="PM3016_8"
                     /note="DNA gyrase subunit A; Validated; Region: PRK05560"
                     /db_xref="CDD:235502"
     misc_feature    6645..7976
                     /locus_tag="PM3016_8"
                     /note="DNA Topoisomerase, subtype IIA; domain A';
                     bacterial DNA topoisomerase IV (C subunit, ParC),
                     bacterial DNA gyrases (A subunit, GyrA),mammalian DNA
                     toposiomerases II. DNA topoisomerases are essential
                     enzymes that regulate the conformational changes...;
                     Region: TOP4c; cd00187"
                     /db_xref="CDD:238111"
     misc_feature    order(6645..6728,6741..6890,6894..6950,6954..7025,
                     7032..7034)
                     /locus_tag="PM3016_8"
                     /note="CAP-like domain; other site"
                     /db_xref="CDD:238111"
     misc_feature    6921..6923
                     /locus_tag="PM3016_8"
                     /note="active site"
                     /db_xref="CDD:238111"
     misc_feature    order(7713..7721,7728..7739,7770..7775,7815..7865)
                     /locus_tag="PM3016_8"
                     /note="primary dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238111"
     misc_feature    8061..8204
                     /locus_tag="PM3016_8"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    8211..8363
                     /locus_tag="PM3016_8"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    8379..8516
                     /locus_tag="PM3016_8"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    8523..8666
                     /locus_tag="PM3016_8"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    8673..8816
                     /locus_tag="PM3016_8"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    8826..8969
                     /locus_tag="PM3016_8"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     gene            9206..10276
                     /locus_tag="PM3016_9"
                     /db_xref="GeneID:11889385"
     CDS             9206..10276
                     /locus_tag="PM3016_9"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="YP_005310153.1"
                     /db_xref="GI:379718022"
                     /db_xref="GeneID:11889385"
                     /translation="MASVPVSQLKYGDRISDNVVTKRNQVLFPKGRVISGRDVEILQA
                     FLISSVEIESKNGSRETAAESPVPSDVPEPVKSTFQEQYDKMLRLLKQVFDAVGPGGQ
                     ALPILEIRTALEGLIRHIDQYNVLTFSPKVFQLTDYMYHNSIMVGLTSFQLARWHGCA
                     PKDLIPIALAGLLHDIGNAKLDTSILFKQDALTSAEFEGMKKHTILGYNILKGVAAIN
                     EGVKLCALQHHEREDGTGYPLGISGDKIHSYAKIVAVTDMFHAMTSDRFHKKAKSRYL
                     VLEELLQESFGKLDPAIVQTFIQKVTSFHNGTLVKLSDGRTGEIVFSDRSNPTRPWVN
                     VNGAIINLTVERSLYILDVLPQ"
     misc_feature    9326..10207
                     /locus_tag="PM3016_9"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    9623..10051
                     /locus_tag="PM3016_9"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(9626..9628,9725..9730,9974..9976)
                     /locus_tag="PM3016_9"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    9728..9730
                     /locus_tag="PM3016_9"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            10602..12126
                     /locus_tag="PM3016_r1"
                     /db_xref="GeneID:11889041"
     rRNA            10602..12126
                     /locus_tag="PM3016_r1"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:11889041"
     gene            12414..15341
                     /locus_tag="PM3016_r2"
                     /db_xref="GeneID:11881973"
     rRNA            12414..15341
                     /locus_tag="PM3016_r2"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:11881973"
     gene            15441..15556
                     /locus_tag="PM3016_r3"
                     /db_xref="GeneID:11881974"
     rRNA            15441..15556
                     /locus_tag="PM3016_r3"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11881974"
     gene            15734..17190
                     /locus_tag="PM3016_11"
                     /note="GuaB"
                     /pseudo
                     /db_xref="GeneID:11881975"
     gene            17323..18627
                     /locus_tag="PM3016_13"
                     /db_xref="GeneID:11881976"
     CDS             17323..18627
                     /locus_tag="PM3016_13"
                     /codon_start=1
                     /transl_table=11
                     /product="serine-type D-Ala-D-Ala carboxypeptidase"
                     /protein_id="YP_005310154.1"
                     /db_xref="GI:379718023"
                     /db_xref="GeneID:11881976"
                     /translation="MFVRAKRICSTLAVTLLLHTTLAAVQPAAVRAEEAPPAQSTELQ
                     LNAKSAVLMDAATGQILYQYNADVAYPPASMAKMMTEYLVMEAVDQGKLKLDEMVTTS
                     QYAADVIGSGQLLAANEQATVDNLFAAMSIYSSNDASVALAERIAGTEEKFAQMMNDK
                     AKEFGLSPQAHFNNATGLSIADLGKYAPKENKQETMLTAKDAAIIAYHMIKDHKKVLE
                     YTKTSSRKFREKDAAPMVNWNWMLEANKDNANFKRYAYTGLDGLKTGHTDEAGYCFTG
                     TAERNGMRLISVVMGTPTEPKRFEETRKVLDYGFNNFESKQIAAAGAPISSMQTVNIK
                     KGVETEVPVVTEQEMKLVVKKGTPDDQIQVTGQAVADEAKLTAPIQKGQVVGTAKVTY
                     NGSEHTVNLVAAQDVEKGSWIRLFFRAIKNFFVDTINGAKKG"
     misc_feature    17365..18594
                     /locus_tag="PM3016_13"
                     /note="D-alanyl-D-alanine carboxypeptidase [Cell envelope
                     biogenesis, outer membrane]; Region: DacC; COG1686"
                     /db_xref="CDD:224600"
     misc_feature    17440..18204
                     /locus_tag="PM3016_13"
                     /note="Beta-lactamase enzyme family; Region:
                     Beta-lactamase2; cl19191"
                     /db_xref="CDD:267544"
     misc_feature    18259..18549
                     /locus_tag="PM3016_13"
                     /note="Penicillin-binding protein 5, C-terminal domain;
                     Region: PBP5_C; smart00936"
                     /db_xref="CDD:198004"
     gene            18746..19627
                     /locus_tag="PM3016_14"
                     /db_xref="GeneID:11881977"
     CDS             18746..19627
                     /locus_tag="PM3016_14"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PdxS"
                     /protein_id="YP_005310155.1"
                     /db_xref="GI:379718024"
                     /db_xref="GeneID:11881977"
                     /translation="METGTSRVKKGMAEMQKGGVIMDVMNAEQARIAEAAGASAVMAL
                     ERVPSDIRAAGGVARMADPTVVEEVMKVVSIPVMAKARIGHFVEAKVLESMGVDYIDE
                     SEVLTPADEVFHINKKEFTVPFVCGARDLGEALRRIGEGASMLRTKGEPGTGNIVEAV
                     RHMRLINGQIRKIQSLSKDELMAEAKNLGAPYELLLQVHETGRLPVVNFAAGGVATPA
                     DAALMMHLGSDGVFVGSGIFKSDSPEKFAKAIVEATTHYNDYELIAKVSKNLGTPMKG
                     IEISKLHASERMQERGW"
     misc_feature    18773..19621
                     /locus_tag="PM3016_14"
                     /note="PdxS is a subunit of the pyridoxal 5'-phosphate
                     (PLP) synthase, an important enzyme in deoxyxylulose
                     5-phosphate (DXP)-independent pathway for de novo
                     biosynthesis of PLP,  present in some eubacteria, in
                     archaea, fungi, plants, plasmodia, and some...; Region:
                     pdxS; cd04727"
                     /db_xref="CDD:240078"
     misc_feature    order(18812..18814,18869..18871,18983..18985,19199..19207,
                     19382..19384,19439..19441)
                     /locus_tag="PM3016_14"
                     /note="active site"
                     /db_xref="CDD:240078"
     misc_feature    order(18914..18916,18920..18922,18944..18946,18989..18991,
                     18998..19006,19013..19015,19064..19078,19202..19210,
                     19214..19216,19223..19228,19235..19237,19388..19390,
                     19397..19402,19523..19525)
                     /locus_tag="PM3016_14"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240078"
     gene            19668..20240
                     /locus_tag="PM3016_15"
                     /db_xref="GeneID:11881978"
     CDS             19668..20240
                     /locus_tag="PM3016_15"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PdxT"
                     /protein_id="YP_005310156.1"
                     /db_xref="GI:379718025"
                     /db_xref="GeneID:11881978"
                     /translation="MKIGVLALQGAVAEHVKMIEKAGAEGVPVKRTEQLGEIDGIIIP
                     GGESTTIGKLMRTYGFLDALREFSRQGKPLFGTCAGLIVLAKEIEGQDEAHLGLMDMN
                     VARNAFGRQRESFETDLDIKGIDKDVRAVFIRAPLINSVGEGVDVLSEYNGQIVAARQ
                     GHLLAASFHPELTDDERMHAYFLDMVRETR"
     misc_feature    19674..20216
                     /locus_tag="PM3016_15"
                     /note="Glutamine Amidotransferase (GATase_I) involved in
                     pyridoxine biosynthesis; Region: GATase1_PB; cd01749"
                     /db_xref="CDD:153220"
     misc_feature    order(19800..19808,19899..19901,19980..19982,20064..20069,
                     20172..20174,20178..20180)
                     /locus_tag="PM3016_15"
                     /note="predicted active site [active]"
                     /db_xref="CDD:153220"
     misc_feature    order(19899..19901,20172..20174,20178..20180)
                     /locus_tag="PM3016_15"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153220"
     gene            20252..21532
                     /locus_tag="PM3016_16"
                     /db_xref="GeneID:11881979"
     CDS             20252..21532
                     /locus_tag="PM3016_16"
                     /codon_start=1
                     /transl_table=11
                     /product="SerS protein"
                     /protein_id="YP_005310157.1"
                     /db_xref="GI:379718026"
                     /db_xref="GeneID:11881979"
                     /translation="MLDVKLLRGDLDRVKQGLSNRGANLDDLDRFTSLDTNRRQLLQE
                     VEQLKNRRNVVSQEVAQLKKAKENADHLIEEMKVVGDRIKALDEEIRVLEADLDSILM
                     SLPNMPQDSVPVGSSEEENVEIRRVGDVPAFGFEPKPHWEVAQALDILDFENAGKVTG
                     SRFVFYKGLGARLERALINFMMDLHADQHGYEEMLPPQIVNRDSLTGTGQLPKFAEDV
                     FKLEGTDYFLIPTAEVPVTNYHRDDILSAEDLPKYFVAFSACFRSEAGSAGRDTRGLI
                     RQHQFNKIELVKLTLPEQSNDELEKLTADAEKVLQLLKLPYRVLSLCTGDIGFSSSKT
                     YDLEVWLPNSNTYREISSCSNFEDFQARRANIRFRRDAKAKPEFVHTLNGSGLALGRT
                     VAAILENYQQEDGSVLIPEVLRPYMGGVTKISKK"
     misc_feature    20252..21529
                     /locus_tag="PM3016_16"
                     /note="seryl-tRNA synthetase; Provisional; Region:
                     PRK05431"
                     /db_xref="CDD:235461"
     misc_feature    20252..20575
                     /locus_tag="PM3016_16"
                     /note="Seryl-tRNA synthetase N-terminal domain; Region:
                     Seryl_tRNA_N; pfam02403"
                     /db_xref="CDD:251274"
     misc_feature    20609..21502
                     /locus_tag="PM3016_16"
                     /note="Seryl-tRNA synthetase (SerRS) class II core
                     catalytic domain. SerRS is responsible for the attachment
                     of serine to the 3' OH group of ribose of the appropriate
                     tRNA. This domain It is primarily responsible for
                     ATP-dependent formation of the enzyme...; Region:
                     SerRS_core; cd00770"
                     /db_xref="CDD:238393"
     misc_feature    order(20711..20728,20735..20755,20765..20767,20771..20773,
                     20777..20779,20786..20788,20825..20836,20840..20848,
                     20852..20854,20906..20911,20915..20917,20927..20929,
                     20954..20956,20966..20968,20978..20980,21026..21028,
                     21089..21091,21497..21502)
                     /locus_tag="PM3016_16"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238393"
     misc_feature    order(20732..20734,20942..20944,20948..20950,21035..21037,
                     21041..21043,21059..21061,21068..21070,21077..21079,
                     21083..21085,21092..21094,21098..21100,21104..21106,
                     21296..21307,21398..21400,21404..21406,21422..21424)
                     /locus_tag="PM3016_16"
                     /note="active site"
                     /db_xref="CDD:238393"
     misc_feature    20825..20848
                     /locus_tag="PM3016_16"
                     /note="motif 1; other site"
                     /db_xref="CDD:238393"
     misc_feature    21032..21043
                     /locus_tag="PM3016_16"
                     /note="motif 2; other site"
                     /db_xref="CDD:238393"
     misc_feature    order(21407..21415,21422..21424)
                     /locus_tag="PM3016_16"
                     /note="motif 3; other site"
                     /db_xref="CDD:238393"
     gene            21580..21666
                     /locus_tag="PM3016_t1"
                     /db_xref="GeneID:11881980"
     tRNA            21580..21666
                     /locus_tag="PM3016_t1"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:11881980"
     gene            21807..22157
                     /locus_tag="PM3016_17"
                     /db_xref="GeneID:11881981"
     CDS             21807..22157
                     /locus_tag="PM3016_17"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310158.1"
                     /db_xref="GI:379718027"
                     /db_xref="GeneID:11881981"
                     /translation="MMSNNDKLQIDSKRLAEAWQNTLPRVLEESDRAEVKADEAEPNA
                     LRVRISTAGRTMYNFDFKCTYVDSREVKVELVDVERGGGSVDERTTVIQNLVDDYVRH
                     LHECAQQLHSVTHS"
     gene            22175..22357
                     /locus_tag="PM3016_18"
                     /db_xref="GeneID:11881982"
     CDS             22175..22357
                     /locus_tag="PM3016_18"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310159.1"
                     /db_xref="GI:379718028"
                     /db_xref="GeneID:11881982"
                     /translation="MTKNKSGVDKNLQNVVEDLEVRPVNSHQAQQIQQQTNDHRHQDS
                     LNHDKEPHAFTLTDKD"
     gene            22381..22524
                     /locus_tag="PM3016_19"
                     /db_xref="GeneID:11881983"
     CDS             22381..22524
                     /locus_tag="PM3016_19"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310160.1"
                     /db_xref="GI:379718029"
                     /db_xref="GeneID:11881983"
                     /translation="MPKDIPQPVNPPTGQENQHEQRQRTGPKPGSKRIKNENHSRHNN
                     GEG"
     gene            complement(22611..22796)
                     /locus_tag="PM3016_20"
                     /db_xref="GeneID:11881984"
     CDS             complement(22611..22796)
                     /locus_tag="PM3016_20"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310161.1"
                     /db_xref="GI:379718030"
                     /db_xref="GeneID:11881984"
                     /translation="MPAESCYYIIYDDFSISICTMLDEVCDAVAGGALLYGYTDNEDM
                     AQWMLNECFHVVEKGNL"
     misc_feature    complement(<22653..>22775)
                     /locus_tag="PM3016_20"
                     /note="dihydropyrimidinase; Provisional; Region: PRK13404"
                     /db_xref="CDD:184033"
     gene            complement(22935..25265)
                     /locus_tag="PM3016_21"
                     /db_xref="GeneID:11881985"
     CDS             complement(22935..25265)
                     /locus_tag="PM3016_21"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase replicase"
                     /protein_id="YP_005310162.1"
                     /db_xref="GI:379718031"
                     /db_xref="GeneID:11881985"
                     /translation="MTQDPVWQEEKKRLGHVLERIQEEIKRTEALSEERLTTVAEARK
                     DFWSDISVNLSNRDDIMETYAAITQQSMMLGGQERSLQHAEDNRYRLLRMYNSPYFGR
                     IDFTEDGTDDTQQIYIGIGSVLDEETQTYWVYDWRAPVSSLFYDYPPGPASYKTPAGT
                     IDGQLELKRQYMIRGGELKALFDTGVTIGDEVLQEILGGHADDRMKSIVATIQSEQNR
                     IIRDDTHPVLIVQGAAGSGKTSVALQRVAYLMYKHRQTLHADNMVLFSPNALFNSYVA
                     SVLPELGEANMQQTTYQEYLRLRLSRQFEVEDAYDQIETLLGLSPEDSDYELRTASIR
                     FKSSRAYIEVIERYAKRLEKEGMLFQDLIFRGRVLISRERMAEEFYRLDPGLKLSNKL
                     HLLKEWLLKELKELAKLERRKSWVKKEIELLDKEDYQRAYNALQKQAGEREVAFDDAQ
                     QEALLLAKFVVHERFKSLRSRIKALRFVSGALLYKQMLSDESWTADDATLSLPGEWDA
                     VRLWTLERMEAGQLPYEDATPLLYLTGLMEGFHSYNAVRHVLIDEAQDYSAFQLAFLR
                     RLFPRARMTLLGDFNQAIYAHTHGGGDTADTGYGVVYDLFGKDQVELIRLVRSYRSTR
                     NIVDFTLKILPAGEPVEAFNRSGEDPRILQVKDTDELHRVIAQEVARLREKGQQSIAV
                     ICKTASEARSANDALSSLLQTELITKDTRIFPEGVLVLPAYLAKGLEFDAVIVYNASG
                     KRYGNDNERKLLYTACTRAMHQLTVCAVGSVSPLLD"
     misc_feature    complement(22971..25259)
                     /locus_tag="PM3016_21"
                     /note="Superfamily I DNA and RNA helicases [General
                     function prediction only]; Region: COG3973"
                     /db_xref="CDD:226482"
     misc_feature    complement(24405..24593)
                     /locus_tag="PM3016_21"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    complement(22968..23264)
                     /locus_tag="PM3016_21"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            25422..26165
                     /locus_tag="PM3016_22"
                     /db_xref="GeneID:11881986"
     CDS             25422..26165
                     /locus_tag="PM3016_22"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310163.1"
                     /db_xref="GI:379718032"
                     /db_xref="GeneID:11881986"
                     /translation="MIILKTPEEIAKMREAGQILAACHREIAKIVRPGITTMEINDFA
                     EAFIVKHGASQVTKGFKGFPAATCASVNDVIAHGFPSKEPLVNGDIVKIDIVCCYNGW
                     MADTCETYAVGTISPEAEKLVRVTKECLNLGISKALIGNRIGDVVSAIQKHAEGNGFS
                     VVRDLVAHGIGRNMHEEPSFPHAGKPGRGFRLEEGMVFTIEPMVNAGKHEMFIDFDGW
                     TARTMDGSLSAQFEHTVAITKDGPLVLTQ"
     misc_feature    25449..26162
                     /locus_tag="PM3016_22"
                     /note="Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also
                     known as methionyl aminopeptidase and Peptidase M.
                     Catalyzes release of N-terminal amino acids,
                     preferentially methionine, from peptides and arylamides;
                     Region: MetAP1; cd01086"
                     /db_xref="CDD:238519"
     misc_feature    order(25650..25652,25701..25703,25734..25736,25923..25925,
                     26022..26024,26115..26117)
                     /locus_tag="PM3016_22"
                     /note="active site"
                     /db_xref="CDD:238519"
     gene            complement(26388..26460)
                     /locus_tag="PM3016_t2"
                     /db_xref="GeneID:11881987"
     tRNA            complement(26388..26460)
                     /locus_tag="PM3016_t2"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:11881987"
     gene            26680..27168
                     /locus_tag="PM3016_24"
                     /db_xref="GeneID:11881988"
     CDS             26680..27168
                     /locus_tag="PM3016_24"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-24 subunit"
                     /protein_id="YP_005310164.1"
                     /db_xref="GI:379718033"
                     /db_xref="GeneID:11881988"
                     /translation="MERYGTDLYKAVYSVLHSAGDAEDVTQEVLLKIYSSLPQYRHGG
                     LKTWLTRIAVHKAIDYKRSKDRKREQLTEEWEAIGAAARSPGSPVEEKVLRRDRRERV
                     RENLERLPGAYRDVVVAFYLEDKSYQQIADEQQVAVKTVESKLYRAKQYMRKAWREED
                     LE"
     misc_feature    26680..27162
                     /locus_tag="PM3016_24"
                     /note="RNA polymerase sigma factor SigW; Reviewed; Region:
                     PRK09642"
                     /db_xref="CDD:170031"
     misc_feature    26683..26877
                     /locus_tag="PM3016_24"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    26995..27135
                     /locus_tag="PM3016_24"
                     /note="Sigma-70, region 4; Region: Sigma70_r4_2;
                     pfam08281"
                     /db_xref="CDD:203898"
     misc_feature    order(27007..27009,27037..27039,27055..27060,27088..27090,
                     27094..27099,27103..27111,27115..27120,27124..27126)
                     /locus_tag="PM3016_24"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            27165..27671
                     /locus_tag="PM3016_25"
                     /db_xref="GeneID:11881989"
     CDS             27165..27671
                     /locus_tag="PM3016_25"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310165.1"
                     /db_xref="GI:379718034"
                     /db_xref="GeneID:11881989"
                     /translation="MNHMPRETWLDYIRGTLAPEERDVCDAHLAEDCASCFELYLEAL
                     EELAEELPEPDAASLQASVMEQWDLEHRSAAPAIVGQTGSRRHRLLWLQHPLFHYGAA
                     AAITMLLMSSGAFQFLLGSVSAAVEQAPPDSTRPASETEPYSVRWMEKTVGLLDRIEP
                     KRERGDNR"
     gene            27668..28831
                     /locus_tag="PM3016_26"
                     /db_xref="GeneID:11881990"
     CDS             27668..28831
                     /locus_tag="PM3016_26"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310166.1"
                     /db_xref="GI:379718035"
                     /db_xref="GeneID:11881990"
                     /translation="MNTTKHPMAALLLSFIPGLGHLYRGRIIKGMIYGILFFGLALLS
                     FLSAVIFRETELGILLCLGGIAVGLINLADMIVSLLTSSHPTRPPSSYPGRVYSEEGP
                     QSFQSPHANEGRTHASQDYPPAAANDRYFTVFLSLIPGLGHFHLGLMQRGLAFMAVFF
                     GFIVMTLFLAALTGQDDFFVFLGVLPIVWLYCMFDCVQLLKRREAGEPLLDRTFFDDF
                     QEWRGPGRKNRTLAAILSVFPGAGHMYLGLQKRGFQLMAGFLLAVYILDVLRLSLFMF
                     LIPLLWFFSFFDALQHISRWEKEELRDIPVVEWILHHQRGIGIGLLGLGIYYLFDQVL
                     LQVLDLWVTPETQQRIVYWFERYFQTFVVSVLLIGGGIRLLLGSRGNGQGRRM"
     gene            28991..29596
                     /locus_tag="PM3016_27"
                     /db_xref="GeneID:11881991"
     CDS             28991..29596
                     /locus_tag="PM3016_27"
                     /codon_start=1
                     /transl_table=11
                     /product="dedA protein"
                     /protein_id="YP_005310167.1"
                     /db_xref="GI:379718036"
                     /db_xref="GeneID:11881991"
                     /translation="METITIDTLLSYIHQFGYLALFFALWLGIVGMPIPDEVVVMTGG
                     MVGALHLLSPLPAFVITYVGVVSGLTLGYVLGRVMGPPVLERLRKKKSMEPYIEKSYA
                     MLDKYGSGTLVFSYFLPVVRHLVPYLVGINGMSYRTYALYSYLTGLLWTMVYFVLGYF
                     FGDSIEVISRAVTRYGWYVLALLAAGGLAVMWLRPLRQKAR"
     misc_feature    28991..29593
                     /locus_tag="PM3016_27"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     gene            complement(29660..30139)
                     /locus_tag="PM3016_28"
                     /db_xref="GeneID:11881992"
     CDS             complement(29660..30139)
                     /locus_tag="PM3016_28"
                     /codon_start=1
                     /transl_table=11
                     /product="TadA protein"
                     /protein_id="YP_005310168.1"
                     /db_xref="GI:379718037"
                     /db_xref="GeneID:11881992"
                     /translation="MEEEHVRFMRAAIEEARKAEAIREVPIGAVIVREGEIIGRGYNR
                     RETDKDPLAHAELIAIREASEHLDAWRLLNCRLYVTLEPCPMCAGAIVQSRIVQVVYG
                     THDPKAGCAGTLMNLLQEERFNHRVDVVSGILQEECGSMLTDFFRRLRGKNKPGGHQ"
     misc_feature    complement(29792..30115)
                     /locus_tag="PM3016_28"
                     /note="Nucleoside deaminases include adenosine, guanine
                     and cytosine deaminases. These enzymes are Zn dependent
                     and catalyze the deamination of nucleosides. The zinc ion
                     in the active site plays a central role in the proposed
                     catalytic mechanism, activating a...; Region:
                     nucleoside_deaminase; cd01285"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(29879..29881,29888..29890,29972..29980,
                     30011..30013,30059..30061))
                     /locus_tag="PM3016_28"
                     /note="nucleoside/Zn binding site; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(29858..29863,29870..29875,29882..29887,
                     29957..29959,29969..29971,29984..29986))
                     /locus_tag="PM3016_28"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(29879..29881,29888..29893,29972..29980))
                     /locus_tag="PM3016_28"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238612"
     gene            30680..31390
                     /locus_tag="PM3016_29"
                     /db_xref="GeneID:11881993"
     CDS             30680..31390
                     /locus_tag="PM3016_29"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310169.1"
                     /db_xref="GI:379718038"
                     /db_xref="GeneID:11881993"
                     /translation="MMKMAAARSAYSLTDEKYRSPSGILLHSRTVVEKANFVSTGILS
                     FAEGDILEIEMSEYKVFDLGDTVKLTVYSPGGIYMFESTVVAKDHGALIIINPPQNRN
                     LFAEKRENPRITVKEEGRVLSVQMADGTDRLLEDKIELSVHNISISGIGFTIREDLGI
                     GKGAVVHLHLQLGFEMPCRAEIARTEKTENGEFYYGAQFIDLAKDKANSLRAYVLKKQ
                     VETHFRTKREESAKRIFK"
     misc_feature    30995..31327
                     /locus_tag="PM3016_29"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     gene            31519..32244
                     /locus_tag="PM3016_30"
                     /db_xref="GeneID:11881994"
     CDS             31519..32244
                     /locus_tag="PM3016_30"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase CwlA"
                     /protein_id="YP_005310170.1"
                     /db_xref="GI:379718039"
                     /db_xref="GeneID:11881994"
                     /translation="MAFLMKYEIIPRYLTGPSQRRPKLPLARCRFMVAHDTGNPSSTA
                     AANVAYYERTRNDMASSAHLFVDDQQIIECIPLLTGAAEKAYHVIYNVTSDNARYGTD
                     ANDTAGAVELCYGGSINLTESYKRYVWVFAYACYRYGLNPLTDITGHYILDPARRSDP
                     QTPLRLLGKSFANFVQDVADELKACTIVTPPKPQVLISPEDANKLISFLSAIYYAAED
                     EESRTEVNRLANELRRISGQPEE"
     misc_feature    31606..31998
                     /locus_tag="PM3016_30"
                     /note="Peptidoglycan recognition proteins (PGRPs) are
                     pattern recognition receptors that bind, and in certain
                     cases, hydrolyze peptidoglycans (PGNs) of bacterial cell
                     walls. PGRPs have been divided into three classes: short
                     PGRPs (PGRP-S), that are small (20...; Region: PGRP;
                     cd06583"
                     /db_xref="CDD:133475"
     misc_feature    order(31621..31623,31702..31704,31963..31965,31987..31989,
                     31993..31995)
                     /locus_tag="PM3016_30"
                     /note="amidase catalytic site [active]"
                     /db_xref="CDD:133475"
     misc_feature    order(31621..31623,31963..31965,31993..31995)
                     /locus_tag="PM3016_30"
                     /note="Zn binding residues [ion binding]; other site"
                     /db_xref="CDD:133475"
     misc_feature    order(31624..31629,31696..31698,31702..31704,31741..31743,
                     31774..31779,31828..31830,31963..31965,31975..31977,
                     31987..31995)
                     /locus_tag="PM3016_30"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133475"
     gene            32425..33525
                     /locus_tag="PM3016_31"
                     /db_xref="GeneID:11881995"
     CDS             32425..33525
                     /locus_tag="PM3016_31"
                     /codon_start=1
                     /transl_table=11
                     /product="protein EngD"
                     /protein_id="YP_005310171.1"
                     /db_xref="GI:379718040"
                     /db_xref="GeneID:11881995"
                     /translation="MALKAGIVGLPNVGKSTLFNAITQAGAESANYPFCTIDPNVGVV
                     EVPDERLEGLAKIVTPNRIVPTAFEFIDIAGIVKGASKGEGLGNKFLSHIREVDAIVH
                     VVRCFQDENITHVSGKVDPISDIETINLELILADVDSVDRKIERSRKNLKGGDKKVAQ
                     EVETLEKVKEALYNDKPARSLDLTDEEKLLIRDLHLLTMKPVLYAANVSEAEVANSDD
                     NPYVQKVREYAAAENAEVVPISAKVEAEIAELEGEDKAMFLEELGLQESGLGRLIKAA
                     YKLLGLYTYFTAGVQEVRAWTIRKGMKAPQAAGVIHTDFERGFIRAEVVGYEDLTNSG
                     SMNAAKEKGLLRLEGKEYVVQDGDVMHFRFNV"
     misc_feature    32425..33522
                     /locus_tag="PM3016_31"
                     /note="GTP-binding protein YchF; Reviewed; Region:
                     PRK09601"
                     /db_xref="CDD:236583"
     misc_feature    32437..33264
                     /locus_tag="PM3016_31"
                     /note="YchF GTPase; Region: YchF; cd01900"
                     /db_xref="CDD:206687"
     misc_feature    32449..32472
                     /locus_tag="PM3016_31"
                     /note="G1 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    order(32458..32460,32464..32475,33043..33048,33052..33054,
                     33142..33150)
                     /locus_tag="PM3016_31"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206687"
     misc_feature    32518..32541
                     /locus_tag="PM3016_31"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206687"
     misc_feature    32530..32532
                     /locus_tag="PM3016_31"
                     /note="G2 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    order(32635..32664,32683..32712)
                     /locus_tag="PM3016_31"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206687"
     misc_feature    32638..32649
                     /locus_tag="PM3016_31"
                     /note="G3 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    33043..33054
                     /locus_tag="PM3016_31"
                     /note="G4 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    33142..33150
                     /locus_tag="PM3016_31"
                     /note="G5 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    33268..33516
                     /locus_tag="PM3016_31"
                     /note="TGS_YchF_C: This subfamily represents TGS
                     domain-containing YchF GTP-binding protein, a universally
                     conserved GTPase whose function is unknown. The N-terminal
                     domain of the YchF protein belongs to the Obg-like family
                     of GTPases, and some members of the...; Region:
                     TGS_YchF_C; cd04867"
                     /db_xref="CDD:133440"
     gene            33675..34754
                     /locus_tag="PM3016_32"
                     /db_xref="GeneID:11881996"
     CDS             33675..34754
                     /locus_tag="PM3016_32"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PrfA"
                     /protein_id="YP_005310172.1"
                     /db_xref="GI:379718041"
                     /db_xref="GeneID:11881996"
                     /translation="MLDRLQALADRYEKLSELLCDPDVAGDSKKLREFSKEQSDLQET
                     YDAYMEYKSVSEQYESARAMQNEKLDDEMKELVKMELEELTERKTELEERIKVLMMPK
                     DPNDDKNVIVEIRGAAGGDEAALFAADLYRMYSKYADTQGWKIDVMDVSMNDLGGFKE
                     IIFMVNGKGAYSKLKFESGAHRVQRIPATESGGRIHTSTSTVSVMPEMEEFDIEIHDN
                     DIRVDTFCSSGAGGQSVNTTKSAVRVTHIPTGIVATCQDGKSQNSNKEKALQVLRARI
                     FDKAQQEEMEKYGAERKSKVGTGDRSERIRTYNFPQSRVTDHRIGLTLHRLDAIMNGD
                     MEEIVSALTIAAQTEQMEKGEYAGA"
     misc_feature    33675..34730
                     /locus_tag="PM3016_32"
                     /note="peptide chain release factor 1; Validated; Region:
                     prfA; PRK00591"
                     /db_xref="CDD:234801"
     misc_feature    33864..34205
                     /locus_tag="PM3016_32"
                     /note="This domain is found in peptide chain release
                     factors; Region: PCRF; smart00937"
                     /db_xref="CDD:214923"
     misc_feature    34290..34631
                     /locus_tag="PM3016_32"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            34747..35655
                     /locus_tag="PM3016_33"
                     /db_xref="GeneID:11881997"
     CDS             34747..35655
                     /locus_tag="PM3016_33"
                     /codon_start=1
                     /transl_table=11
                     /product="HemK family modification methylase"
                     /protein_id="YP_005310173.1"
                     /db_xref="GI:379718042"
                     /db_xref="GeneID:11881997"
                     /translation="MPDERRRTIREAYTEASSFLAAQGVREPESNSELLLAYVLGESR
                     SGLLLRWPEPFPPEREALWQRVLERKAAGEPAQYIIGEQEFYGLPYTVTPAVLIPRPE
                     TELLVEAVIRLGRQLWMGPGEGGEGPLAADVGTGSGAIAVTLASQCPSWRLMASDISR
                     AALDVAQANAVRHGAEERITFVEGDLLLPWIEQGIALDLVVSNPPYIPDSDEAGLQPE
                     VRLYEPRTALYGGPDGLEPYRRLTQQLLELPAVPRLVGFEVGQGQAPEVRRLLEAAAD
                     WDGVLIVPDLAGIERHVVAYRSGRGS"
     misc_feature    34768..35637
                     /locus_tag="PM3016_33"
                     /note="N5-glutamine S-adenosyl-L-methionine-dependent
                     methyltransferase; Provisional; Region: PRK09328"
                     /db_xref="CDD:236467"
     misc_feature    35140..>35370
                     /locus_tag="PM3016_33"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(35143..35163,35215..35220,35296..35304,35353..35355)
                     /locus_tag="PM3016_33"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            35820..36569
                     /locus_tag="PM3016_34"
                     /db_xref="GeneID:11881998"
     CDS             35820..36569
                     /locus_tag="PM3016_34"
                     /codon_start=1
                     /transl_table=11
                     /product="stage II sporulation protein R"
                     /protein_id="YP_005310174.1"
                     /db_xref="GI:379718043"
                     /db_xref="GeneID:11881998"
                     /translation="MVKRVSWKRYGYLLFAFMVMMMCWESNRSNVMLVTAAAAETGGE
                     ANGQSIPQESIRLRILANSDAPADQWIKREVRDAIVAEMEGWVEQPKGIEEAREAVRA
                     HLPELSEVVGSTLRKNGFDYAYNVELGTVPFPTKMYGNEVYPAGEYEALRVSIGEAEG
                     QNWWCVLFPPLCFIDSEMVVKPENTAQAAGAEEAPENNADEASAESRKGAKPAEAEKK
                     AEGERTAATAAKPEVRFFLWDLLQKIGTWFA"
     misc_feature    35967..36344
                     /locus_tag="PM3016_34"
                     /note="Stage II sporulation protein R (spore_II_R);
                     Region: Spore_II_R; pfam09551"
                     /db_xref="CDD:150280"
     gene            36662..37732
                     /locus_tag="PM3016_35"
                     /db_xref="GeneID:11881999"
     CDS             36662..37732
                     /locus_tag="PM3016_35"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310175.1"
                     /db_xref="GI:379718044"
                     /db_xref="GeneID:11881999"
                     /translation="MTTKQWKVTAEEAAPETLAEPASLLKKGGTVAFPTETVYGLGAD
                     ARSTEAVAAVFAAKGRPSDNPLIVHIADRSQLEELTAPPEEAVSRLLDAFWPGPLTVV
                     LPARPGVLSPLVTAGLSTVGVRMPDHPVALALIAAAGCPVAAPSANRSGRPSPTRASH
                     VLEDLGGRIGGVVDGGEAGVGLESTVAEYAGGALHILRPGGVTQAQLQAVLPDVPVVG
                     ASAGLEAESLPEPEAPRAPGMKYAHYAPQGAMLLVQGEDPAAVQERIRAELDAAKQRG
                     ERTGVFTYAEHAHLFAADHVAVCGRLDDPASVARELYAALRSFDEAGVSFIAAEACPA
                     AGIGQAVMNRLRKASGGNIRTV"
     misc_feature    36668..37303
                     /locus_tag="PM3016_35"
                     /note="Putative translation factor (SUA5) [Translation,
                     ribosomal structure and biogenesis]; Region: SUA5;
                     COG0009"
                     /db_xref="CDD:223088"
     misc_feature    37265..37711
                     /locus_tag="PM3016_35"
                     /note="Putative GTP-binding controlling metal-binding;
                     Region: SUA5; pfam03481"
                     /db_xref="CDD:251991"
     gene            37834..38397
                     /locus_tag="PM3016_36"
                     /db_xref="GeneID:11882000"
     CDS             37834..38397
                     /locus_tag="PM3016_36"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310176.1"
                     /db_xref="GI:379718045"
                     /db_xref="GeneID:11882000"
                     /translation="MAWSSPLMWAQFVSIGLMALALGLDALSLGLGLGMKGIRKLDIL
                     KVSAVTALFHVLMPLAGMWMGGYISVLLGKVATMCGGLLLLLLGGHMIYSSLHPGEER
                     SYDHRSFVGLLLFSLSVSIDAFSVGVSLGMFAGDVLLTVGMFGAAGGLMSVIGLLLGR
                     HVGEWIGEYGEMLGGVILMAFGLKFLL"
     misc_feature    37867..38394
                     /locus_tag="PM3016_36"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG1971"
                     /db_xref="CDD:224882"
     misc_feature    37897..38061
                     /locus_tag="PM3016_36"
                     /note="Domain of unknown function DUF; Region: DUF204;
                     pfam02659"
                     /db_xref="CDD:251451"
     misc_feature    38188..38379
                     /locus_tag="PM3016_36"
                     /note="Domain of unknown function DUF; Region: DUF204;
                     pfam02659"
                     /db_xref="CDD:251451"
     gene            38531..39114
                     /locus_tag="PM3016_37"
                     /note="protein-tyrosine-phosphatase"
                     /pseudo
                     /db_xref="GeneID:11882001"
     gene            39401..39859
                     /locus_tag="PM3016_39"
                     /db_xref="GeneID:11882002"
     CDS             39401..39859
                     /locus_tag="PM3016_39"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310177.1"
                     /db_xref="GI:379718046"
                     /db_xref="GeneID:11882002"
                     /translation="MKIAMGADHAGYRLKDELKPFLESLGHEVEDFGCSCGDSVDYPD
                     YAIEVCEKVVSGEADKGILICGTGIGMTIAANKVPGIRCALVHDLFTAKATREHNDTN
                     VLTLGERVVGPGVAQEIVKIWLETDFSQGERHQKRLDKVRAIEEKYALHP"
     misc_feature    39404..39823
                     /locus_tag="PM3016_39"
                     /note="Ribose/Galactose Isomerase; Region: LacAB_rpiB;
                     pfam02502"
                     /db_xref="CDD:251337"
     gene            39901..40518
                     /locus_tag="PM3016_40"
                     /db_xref="GeneID:11882003"
     CDS             39901..40518
                     /locus_tag="PM3016_40"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310178.1"
                     /db_xref="GI:379718047"
                     /db_xref="GeneID:11882003"
                     /translation="MTVEHSAVQEDGGASLLTGLRPQVEQILRELVQAGGVKPGQLLV
                     IGTSTSEVLGHRIGTAGSGEVAQRIFEAVEAVREEAGFYPVYQCCEHLNRALVLEREA
                     AERYGLEEVSVVPAPRAGGSMAAHAFRQLPQAVVVETVQAHAGIDIGDTMIGMHLKRV
                     AVPVRPTIRQLGDAHVTMAFTRPKLIGGARAIYTAEAPQVNDNCS"
     misc_feature    39949..40494
                     /locus_tag="PM3016_40"
                     /note="hypothetical protein; Provisional; Region:
                     PRK13690"
                     /db_xref="CDD:237472"
     gene            40625..41872
                     /locus_tag="PM3016_41"
                     /db_xref="GeneID:11882004"
     CDS             40625..41872
                     /locus_tag="PM3016_41"
                     /codon_start=1
                     /transl_table=11
                     /product="GlyA protein"
                     /protein_id="YP_005310179.1"
                     /db_xref="GI:379718048"
                     /db_xref="GeneID:11882004"
                     /translation="MEQLRKQDPKIVEAMNLELGRQRDKIELIASENFVSEAVLQAMG
                     TVLTNKYAEGYPHKRYYGGCEYVDIVEDIARDRAKELFGAEHANVQPHSGAQANMAVY
                     LAAVKPGETILGMNLAHGGHLTHGSPVNASGILYNFVAYGVSEKDSRIDYDDVRKAAF
                     KHKPRLIVAGASAYPRTIDFEALASIANDVGALFMVDMAHIAGLVAAGLHPNPVPYAH
                     FVTTTTHKTLRGPRGGMILCRKPWAAAIDKAVFPGSQGGPLMHVIAAKAVAFGEALQP
                     EFKTYAQNVVDNAKALAEALTAEGINLVSGGTDNHLMLIDLRNLNISGKDAEHLLDEV
                     GVTVNKNAIPFDPTSPFVTSGIRVGTPAATSRGMDQEAMKTIAKIISLTLKNPSDEAV
                     HEKVRGMVKDLTAQFPLYAGLGY"
     misc_feature    40640..41833
                     /locus_tag="PM3016_41"
                     /note="Serine-glycine hydroxymethyltransferase (SHMT).
                     This family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). SHMT
                     carries out interconversion of serine and glycine; it
                     catalyzes the transfer of hydroxymethyl...; Region: SHMT;
                     cd00378"
                     /db_xref="CDD:99733"
     misc_feature    order(40646..40648,40652..40654,40673..40678,40703..40705,
                     40718..40720,40772..40774,40826..40831,40853..40855,
                     40898..40900,40919..40921,41024..41029,41399..41401,
                     41453..41455)
                     /locus_tag="PM3016_41"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    order(40715..40717,40775..40777,40805..40807,40904..40909,
                     40988..40990,41138..41140,41213..41215,41222..41224,
                     41297..41302,41318..41320,41693..41695)
                     /locus_tag="PM3016_41"
                     /note="glycine-pyridoxal phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    order(40715..40717,40988..40990,41300..41302,41693..41695)
                     /locus_tag="PM3016_41"
                     /note="active site"
                     /db_xref="CDD:99733"
     misc_feature    order(40781..40783,40802..40804,40973..40975,40985..40987,
                     40991..40993,41375..41377,41645..41647)
                     /locus_tag="PM3016_41"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:99733"
     gene            42080..42709
                     /locus_tag="PM3016_42"
                     /db_xref="GeneID:11882005"
     CDS             42080..42709
                     /locus_tag="PM3016_42"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310180.1"
                     /db_xref="GI:379718049"
                     /db_xref="GeneID:11882005"
                     /translation="MGKVYICDHPLIQHKLTYIRDENTTTKDFRELVDEVATLMAYEI
                     TRDIPLEKVQVKTPVTMAECRVISGRMLGLIPILRAGLGMVDGILKLVPAAKVGHIGL
                     YRDPETLEPVEYYAKLPTDVLERELIVIDPMLATGGSANAAITALKKRGCTQMKLMCL
                     IAAPEGVQAVQEAHPDVDLYVAAIDDHLNDHGYIVPGLGDAGDRLFGTK"
     misc_feature    42299..42631
                     /locus_tag="PM3016_42"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(42311..42313,42317..42319,42470..42478,42482..42496,
                     42566..42568)
                     /locus_tag="PM3016_42"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            42745..43887
                     /locus_tag="PM3016_43"
                     /db_xref="GeneID:11882006"
     CDS             42745..43887
                     /locus_tag="PM3016_43"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MnaA"
                     /protein_id="YP_005310181.1"
                     /db_xref="GI:379718050"
                     /db_xref="GeneID:11882006"
                     /translation="MKKTKVITIFGTRPEAIKMAPLVKELEKHPDHIESLVCVTAQHR
                     QMLDQVLEIFKIKPDYDLDVMKDRQTLNEITIRVLQGLDPVFQKEKPDLILVHGDTLT
                     TFLASYAAFLQQIQVGHVEAGLRTWNKMSPYPEEMNRQLTGVLADLHFAPTNWSAGNL
                     RKENKPEERIFVTGNTVTDVFQYTVQDEFQHEVLDWAKGKRLVMMTAHRRESQGEPHR
                     QIFRAVRRLADAFDDIAIVYAVHPSPAVKEPAYEMLSGHERIKLIEPLDVFEFHNFYR
                     HAHLILTDSGGLQEEAPSFGVPVLVLRETTERPEGIEAGTLELVGTDEEKVFSRASAL
                     LSDQVLYERMSRSANPYGDGKASERIADAILYHFGHKPERPLPFQP"
     misc_feature    42745..43869
                     /locus_tag="PM3016_43"
                     /note="UDP-N-acetylglucosamine 2-epimerase [Cell envelope
                     biogenesis, outer membrane]; Region: WecB; COG0381"
                     /db_xref="CDD:223458"
     misc_feature    42757..43839
                     /locus_tag="PM3016_43"
                     /note="Bacterial members of the UDP-N-Acetylglucosamine
                     (GlcNAc) 2-Epimerase  family are known to catalyze the
                     reversible interconversion of UDP-GlcNAc and
                     UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to
                     produce an activated form of ManNAc residues; Region:
                     GT1_UDP-GlcNAc_2-Epimerase; cd03786"
                     /db_xref="CDD:99962"
     misc_feature    order(42781..42783,43540..43542,43546..43548,43555..43557,
                     43603..43605,43615..43617)
                     /locus_tag="PM3016_43"
                     /note="active site"
                     /db_xref="CDD:99962"
     misc_feature    order(42961..42963,42967..42972,42991..42993,43075..43080,
                     43084..43086,43090..43092,43141..43143,43153..43155,
                     43228..43230)
                     /locus_tag="PM3016_43"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99962"
     gene            44062..44298
                     /locus_tag="PM3016_44"
                     /db_xref="GeneID:11882007"
     CDS             44062..44298
                     /locus_tag="PM3016_44"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310182.1"
                     /db_xref="GI:379718051"
                     /db_xref="GeneID:11882007"
                     /translation="MKRQNSNDSPWRALALLGGIGVDLGVCMAAGYWVGDLISEWQGG
                     EPLWIVGGMMTGFILGIASIYLIIRNYMRGGPNG"
     misc_feature    44104..44268
                     /locus_tag="PM3016_44"
                     /note="Putative F0F1-ATPase subunit (ATPase_gene1);
                     Region: ATPase_gene1; pfam09527"
                     /db_xref="CDD:255412"
     gene            44695..45462
                     /locus_tag="PM3016_45"
                     /db_xref="GeneID:11882008"
     CDS             44695..45462
                     /locus_tag="PM3016_45"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase F0 subunit A"
                     /protein_id="YP_005310183.1"
                     /db_xref="GI:379718052"
                     /db_xref="GeneID:11882008"
                     /translation="MHELPIVNWLGLNWDLSTIITVTVTCLIVLILAIAGTRNLSVHN
                     PGKMQNFLEWLVEFVQNIIAGSMDMKKGKPFLMLGITLIMFIFVGNMLGLPLYIATEV
                     TGPLPQFGITAAEYEAAHAANKHLSISWWKSPTADLSVTMGLALMVIVMVHFLGLTKN
                     TKHYLHHYVEPFAVMFPLNIVKEVSKLLTLGMRLFGNIYAGEVLIAVILMAGIGGIVP
                     LIIWQGFSVFVGAIQAFVFTTLTMVYISQAIVHEEKH"
     misc_feature    44695..45453
                     /locus_tag="PM3016_45"
                     /note="F0F1 ATP synthase subunit A; Validated; Region:
                     PRK05815"
                     /db_xref="CDD:235617"
     gene            45562..45792
                     /locus_tag="PM3016_46"
                     /db_xref="GeneID:11882009"
     CDS             45562..45792
                     /locus_tag="PM3016_46"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit C"
                     /protein_id="YP_005310184.1"
                     /db_xref="GI:379718053"
                     /db_xref="GeneID:11882009"
                     /translation="MEGMSFLAAAIAIGLGALGAGIGNGLIVSKTVDGIARQPELKGT
                     LQTVMFIGVGLVEAIPIIAVVFALLFTFVFAG"
     misc_feature    <45631..45780
                     /locus_tag="PM3016_46"
                     /note="F0F1 ATP synthase subunit C; Validated; Region:
                     PRK06876"
                     /db_xref="CDD:180739"
     gene            45905..46390
                     /locus_tag="PM3016_47"
                     /db_xref="GeneID:11882010"
     CDS             45905..46390
                     /locus_tag="PM3016_47"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310185.1"
                     /db_xref="GI:379718054"
                     /db_xref="GeneID:11882010"
                     /translation="MHFELTSFIFAIVSFAILMWLISKYAFGPLMGIMEQRRQLVLDQ
                     MNSAEQNRKQADSLLAEQKAALEQVRSEAKQIMEQARVTSGKQAEDIIAQAKAEAGRL
                     KEEALRDIENEKNLAVAALRSQVSAMSVLIASKIIEKQIDEKSQEQLVEHYLKEVGGN
                     Q"
     misc_feature    45914..46378
                     /locus_tag="PM3016_47"
                     /note="F0F1 ATP synthase subunit B; Provisional; Region:
                     PRK14471; cl17192"
                     /db_xref="CDD:266543"
     misc_feature    45926..46375
                     /locus_tag="PM3016_47"
                     /note="F0F1 ATP synthase subunit B; Validated; Region:
                     PRK05759"
                     /db_xref="CDD:180240"
     gene            46387..46938
                     /locus_tag="PM3016_48"
                     /db_xref="GeneID:11882011"
     CDS             46387..46938
                     /locus_tag="PM3016_48"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit delta"
                     /protein_id="YP_005310186.1"
                     /db_xref="GI:379718055"
                     /db_xref="GeneID:11882011"
                     /translation="MSQDLIAAKRYAKALFEVAKDAGRIAEVEQELETVVAVFKENPD
                     LSKLIKHPGIDAGVKIGLIKQIFGAGVSESVLNTLQLLIERRREEALEAFVRAYSKIA
                     GESLGQANATVYSPVELSAEELSNIASTFAKMTGKQIRVSTVLDKSLLGGIQVRIGDR
                     LYDGSLSGKLQRLERALNQSQAL"
     misc_feature    46405..46917
                     /locus_tag="PM3016_48"
                     /note="ATP synthase delta (OSCP) subunit; Region: OSCP;
                     pfam00213"
                     /db_xref="CDD:249684"
     gene            46955..48469
                     /locus_tag="PM3016_49"
                     /db_xref="GeneID:11882012"
     CDS             46955..48469
                     /locus_tag="PM3016_49"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AtpA"
                     /protein_id="YP_005310187.1"
                     /db_xref="GI:379718056"
                     /db_xref="GeneID:11882012"
                     /translation="MSIKPEEISTLIRQQIENYKSEIQVVDVGTVIQVGDGIARAHGL
                     ENVMAGELLEFSNGVLGYAFNLEESNVGIVILGPYTDIREGDPVKRTGRIMEVPVGEA
                     LLGRVVNALGQPIDGKGPINTTHSRPVESPAPGVMARKSVHEPMQTGIKAIDAMIPVG
                     RGQRELIIGDRQTGKTSIAVDTIINQKGSGVKCIYVAVGQKQSTVVALVETLRRAGAL
                     DYTIVVSASASEPSPMLWLAPYAGCAMGEYFMYKGEHVLIVYDDLSKQAAAYRELSLL
                     LRRPPGREAYPGDVFYLHSRLLERSAKLSDELGAGSMTALPFIETQAGDVSAYIPTNV
                     ISITDGQIFLESDLFYSGQRPAVNVGISVSRVGGSAQTKAMKKVAGTLRLDLAQYREL
                     AAFAQFGSDLDRATQTRLNRGVRTLELLKQGVNQPLPVEKQVAAIYVVTRGHIDDLPV
                     QDVRRFEAEFLAYLDSNRPEILASIRDTKDLTSDNEKALVDAIGQFKKGFAPSA"
     misc_feature    46955..48460
                     /locus_tag="PM3016_49"
                     /note="F0F1 ATP synthase subunit alpha; Validated; Region:
                     PRK09281"
                     /db_xref="CDD:236448"
     misc_feature    47036..47230
                     /locus_tag="PM3016_49"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    47234..48055
                     /locus_tag="PM3016_49"
                     /note="F1 ATP synthase alpha, central domain. The F-ATPase
                     is found in bacterial plasma membranes, mitochondrial
                     inner membranes and in chloroplast thylakoid membranes. It
                     has also been found in the archaea Methanosarcina barkeri.
                     It uses a proton gradient to...; Region: F1_ATPase_alpha;
                     cd01132"
                     /db_xref="CDD:238552"
     misc_feature    order(47297..47302,47348..47353,47357..47362,47369..47371,
                     47375..47377,47465..47470,47555..47566,47570..47575,
                     47582..47584,47765..47770,47786..47794,47798..47803,
                     47816..47818,47828..47830,47837..47839,47849..47851,
                     47960..47962,47969..47971,48002..48007,48014..48016,
                     48047..48049)
                     /locus_tag="PM3016_49"
                     /note="beta subunit interaction interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238552"
     misc_feature    47459..47482
                     /locus_tag="PM3016_49"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238552"
     misc_feature    order(47465..47467,47477..47485,47537..47539,47552..47554,
                     47735..47740,47747..47749,47912..47914,47960..47962,
                     47999..48001,48014..48019,48047..48049)
                     /locus_tag="PM3016_49"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238552"
     misc_feature    47723..47737
                     /locus_tag="PM3016_49"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238552"
     misc_feature    48080..48349
                     /locus_tag="PM3016_49"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:249758"
     gene            48566..49423
                     /locus_tag="PM3016_50"
                     /db_xref="GeneID:11882013"
     CDS             48566..49423
                     /locus_tag="PM3016_50"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AtpG"
                     /protein_id="YP_005310188.1"
                     /db_xref="GI:379718057"
                     /db_xref="GeneID:11882013"
                     /translation="MAKGMREIKRSIKSKQNTKQITKAMEMVAASKLRRAQEAAEASR
                     PYSEKMKEVIASIAAGTKGVKHPMLQTRPIKKTGYLVITSDRGLAGGYNANVLRKVMN
                     VIREKHNSTNEYAIFVIGRKGRDFFSKRNIPIVEEVTGLADSPTFADVKQVAASAVAN
                     FEKGTYDELYLVYNEFKNAITQIPTVKRLLPLEEVSGASVSNYEYEPSPEGVLEVLLP
                     KYAETLIYSAVLDGKASEFGARMTAMNSATKNATKMISTLTLQYNRARQASITQEISE
                     IVAGANAQS"
     misc_feature    48578..49408
                     /locus_tag="PM3016_50"
                     /note="mitochondrial ATP synthase gamma subunit; Region:
                     F1-ATPase_gamma; cd12151"
                     /db_xref="CDD:213394"
     misc_feature    order(48581..48583,48596..48598,48614..48616,48626..48628,
                     48635..48640,48644..48649,48656..48661,48821..48823,
                     48827..48838,48926..48931,48938..48943,48950..48952,
                     49304..49306,49313..49318,49325..49327,49343..49345,
                     49352..49357,49361..49366,49373..49378,49385..49387,
                     49391..49408)
                     /locus_tag="PM3016_50"
                     /note="core domain interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213394"
     misc_feature    order(48689..48694,48698..48703,48710..48712,48719..48724,
                     49199..49201,49208..49213,49220..49222)
                     /locus_tag="PM3016_50"
                     /note="delta subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213394"
     misc_feature    order(48935..48937,48968..48985,49208..49210,49217..49222)
                     /locus_tag="PM3016_50"
                     /note="epsilon subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213394"
     gene            49580..50986
                     /locus_tag="PM3016_51"
                     /db_xref="GeneID:11882014"
     CDS             49580..50986
                     /locus_tag="PM3016_51"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AtpD"
                     /protein_id="YP_005310189.1"
                     /db_xref="GI:379718058"
                     /db_xref="GeneID:11882014"
                     /translation="MSKGRVVNITGPVVDIEFERGQLPEILNAIKIQRKAQSAGEQDI
                     NLTVETAVHLGDNMVRCIAMSSTDGLVRGVEAVDTGAPISVPVGAATLGRVFNVLGEP
                     IDGNETVDRTLTSPIHKEAPSFENLSTQAEILETGIKVIDLMAPYAKGGKIGLFGGAG
                     VGKTVTMQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVISKTAMVFGQMN
                     EPPGARLRVALSGLTMAEYFRDEEGKDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGY
                     QPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERGI
                     ASKGIFPAVDPLASSSRILTPEILGEEHYQVAQGVKRILQRYKELLDIIAILGMDELS
                     DEDKLVVHRARRLELFLSQPLHVAEAFNGIPGVYVPVKETVRSFKEVLEGKHDNLPEP
                     AFHNVGTIEDAIEKAKTL"
     misc_feature    49580..50983
                     /locus_tag="PM3016_51"
                     /note="F0F1 ATP synthase subunit beta; Validated; Region:
                     PRK09280"
                     /db_xref="CDD:236447"
     misc_feature    49595..49819
                     /locus_tag="PM3016_51"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    49823..50644
                     /locus_tag="PM3016_51"
                     /note="F1 ATP synthase beta subunit, nucleotide-binding
                     domain. The F-ATPase is found in bacterial plasma
                     membranes, mitochondrial inner membranes and in
                     chloroplast thylakoid membranes. It has also been found in
                     the archaea Methanosarcina barkeri. It uses a...; Region:
                     F1-ATPase_beta; cd01133"
                     /db_xref="CDD:238553"
     misc_feature    order(49892..49894,49943..49945,49949..49954,49958..49960,
                     49964..49966,50147..50155,50162..50164,50228..50236,
                     50249..50251,50342..50344,50351..50353,50363..50365,
                     50381..50389,50393..50398,50411..50413,50423..50425,
                     50444..50446,50495..50497,50504..50509,50519..50521,
                     50540..50542,50546..50554,50585..50590,50615..50620,
                     50624..50626,50630..50632)
                     /locus_tag="PM3016_51"
                     /note="alpha subunit interaction interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238553"
     misc_feature    50051..50071
                     /locus_tag="PM3016_51"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238553"
     misc_feature    order(50057..50059,50066..50074,50144..50149,50156..50158,
                     50330..50332,50342..50344,50594..50599)
                     /locus_tag="PM3016_51"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238553"
     misc_feature    50318..50332
                     /locus_tag="PM3016_51"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238553"
     misc_feature    order(50588..50590,50594..50596,50612..50617)
                     /locus_tag="PM3016_51"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238553"
     misc_feature    50666..50983
                     /locus_tag="PM3016_51"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:249758"
     gene            51107..51511
                     /locus_tag="PM3016_52"
                     /db_xref="GeneID:11882015"
     CDS             51107..51511
                     /locus_tag="PM3016_52"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AtpC"
                     /protein_id="YP_005310190.1"
                     /db_xref="GI:379718059"
                     /db_xref="GeneID:11882015"
                     /translation="MSTFLLEIVTPERKVYAEPANMIVVKGVEGELGILPNHIPMVTP
                     LRIAAVTVKKQGAKDEQIAVHGGFMEVRRDKVVILAESAELPGQINLERAQAAKGRAE
                     QRLAAKKDQIDFKRAELALQRAMTRINVGGGQ"
     misc_feature    51107..51505
                     /locus_tag="PM3016_52"
                     /note="F0F1 ATP synthase subunit epsilon; Validated;
                     Region: atpC; PRK00571"
                     /db_xref="CDD:234796"
     misc_feature    51116..51481
                     /locus_tag="PM3016_52"
                     /note="mitochondrial ATP synthase delta subunit; Region:
                     F1-ATPase_delta; cd12152"
                     /db_xref="CDD:213395"
     misc_feature    order(51125..51127,51134..51142,51146..51148,51155..51157,
                     51221..51235,51302..51319,51335..51337,51341..51349)
                     /locus_tag="PM3016_52"
                     /note="gamma subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    order(51140..51142,51188..51190,51236..51241,51245..51247,
                     51293..51295,51299..51307,51347..51352,51356..51358,
                     51365..51370,51374..51376,51395..51397,51449..51454,
                     51458..51463,51470..51472,51476..51478)
                     /locus_tag="PM3016_52"
                     /note="epsilon subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    order(51170..51172,51176..51178,51194..51199,51203..51205,
                     51209..51211,51215..51223,51263..51265)
                     /locus_tag="PM3016_52"
                     /note="LBP interface [polypeptide binding]; other site"
                     /db_xref="CDD:213395"
     gene            51908..52273
                     /locus_tag="PM3016_53"
                     /db_xref="GeneID:11882016"
     CDS             51908..52273
                     /locus_tag="PM3016_53"
                     /codon_start=1
                     /transl_table=11
                     /product="protein NuoA"
                     /protein_id="YP_005310191.1"
                     /db_xref="GI:379718060"
                     /db_xref="GeneID:11882016"
                     /translation="MYFNNYVVVTIFLFLGVILPVVALTFGRLLRPHKPVEEKYTTYE
                     SGNEPVGEGQVRFNIRYYLFALMFVIFDVETVFLYPWAVAYKQLGLFALVEMCIFVGL
                     LIIGLLYAWKKKVLQWTSI"
     misc_feature    51908..52261
                     /locus_tag="PM3016_53"
                     /note="NADH-ubiquinone/plastoquinone oxidoreductase, chain
                     3; Region: Oxidored_q4; cl00535"
                     /db_xref="CDD:260484"
     gene            52258..52776
                     /locus_tag="PM3016_54"
                     /db_xref="GeneID:11882017"
     CDS             52258..52776
                     /locus_tag="PM3016_54"
                     /codon_start=1
                     /transl_table=11
                     /product="protein NuoB"
                     /protein_id="YP_005310192.1"
                     /db_xref="GI:379718061"
                     /db_xref="GeneID:11882017"
                     /translation="MDFNLENITPEEREELDRNVFMTTLEQIKAWARSNSLWPLTFGL
                     ACCAIEMMGTGASHYDLDRFGVIFRTSPRQSDVMIVAGTVTKKMAPLLRRLYEQMPEP
                     KWVIAMGSCATAGGPYVKSYAVVKGVDQVVPVDVYIPGCPPNPAALIYGINKLQEKIR
                     YEAKTGKQVTSR"
     misc_feature    52258..52764
                     /locus_tag="PM3016_54"
                     /note="NADH dehydrogenase subunit B; Validated; Region:
                     PRK06411"
                     /db_xref="CDD:235797"
     gene            52773..53930
                     /locus_tag="PM3016_55"
                     /db_xref="GeneID:11882018"
     CDS             52773..53930
                     /locus_tag="PM3016_55"
                     /codon_start=1
                     /transl_table=11
                     /product="protein NuoC"
                     /protein_id="YP_005310193.1"
                     /db_xref="GI:379718062"
                     /db_xref="GeneID:11882018"
                     /translation="MSDEEKKAKDGDTPERKDDRGLGFTSEGGGFITAEDTAGNTKVG
                     DSAGGGEGEAQNSGKPGTVDPHSEARTFGEPEEGEERQGNTTPGVKAPLMSGEPRIAE
                     GAALAKAGGAGEPPGGYADVPKAEGKEPEGGAAEAPKSAADAPNSAADTEREAKVKAA
                     AEARAARLAAKAAQTAEAGDAPAAERAAPTDAEKEAKAKAAAETRAARASARAAKPEG
                     AEPEAPKEPSPKQPLLDRLTAILKEFREGIVEDAVVNEKGGHIPTVYIKAEAWPETAD
                     MLRTHPELGLHYLRNVSGVDMETHMEVVYHFISLEHKQDYCFKVKTDRENPSIPSITP
                     IFPTADWNEREIYDLFGIDFPGHPDLRRIMMADDWVGHPLRKDYEPIDPEV"
     misc_feature    53556..53909
                     /locus_tag="PM3016_55"
                     /note="NADH (or F420H2) dehydrogenase, subunit C; Region:
                     NuoC_fam; TIGR01961"
                     /db_xref="CDD:233657"
     gene            53937..55040
                     /locus_tag="PM3016_56"
                     /db_xref="GeneID:11882019"
     CDS             53937..55040
                     /locus_tag="PM3016_56"
                     /codon_start=1
                     /transl_table=11
                     /product="protein NuoD"
                     /protein_id="YP_005310194.1"
                     /db_xref="GI:379718063"
                     /db_xref="GeneID:11882019"
                     /translation="MAIRTEELLLNVGPQHPSTHGVFRIVVKLDGEIITEAIPVMGYL
                     HRGTEKLAENLTYTQIIPYTDRMDYVSAMTNNYVLVHAVEKLMGLEIPERAEFMRLIV
                     MELQRIASHMVWWGTYLLDIGAMSPFLYAFRDREIIIDLFNELCGARLTYNYMRVGGV
                     KWDAPEGWIQKVRDFIPYMRGKLDEYNELVSGNEIFLARIKGIGKYDAETAIAYGLSG
                     ANLRCTGVDWDIRKAQPYSLYSRFEFDVPTSTVGDCYARYLLRLEEIRQSLRILEQAL
                     EQFPEEGEIMGKVPRVLRPAEGEVYAAIESPRGEIGVHLISKGKDKPYRLKFRRPSFV
                     NLQILPKLLVGETMTNLITILGGIDIVVGEVDC"
     misc_feature    53943..55037
                     /locus_tag="PM3016_56"
                     /note="NADH dehydrogenase subunit D; Provisional; Region:
                     PRK12322"
                     /db_xref="CDD:183437"
     misc_feature    53964..55034
                     /locus_tag="PM3016_56"
                     /note="Ni,Fe-hydrogenase III large subunit [Energy
                     production and conversion]; Region: HycE; COG3261"
                     /db_xref="CDD:225800"
     gene            55040..56047
                     /locus_tag="PM3016_57"
                     /db_xref="GeneID:11882020"
     CDS             55040..56047
                     /locus_tag="PM3016_57"
                     /codon_start=1
                     /transl_table=11
                     /product="protein NuoH"
                     /protein_id="YP_005310195.1"
                     /db_xref="GI:379718064"
                     /db_xref="GeneID:11882020"
                     /translation="MPELLQESLTFTNFMIFLAWGVVMLLVVLGFVTYAIYFERKVIG
                     WMQLRIGPNRVGPLGLLQSVADVTKLLIKEDTIPRKAERELFILAPVITFIPAFTVVA
                     TIPFTERLISSSLNVGVLFYVALSGISTIGIVLGGWASNNKYALLGGMRSAAQMISYE
                     IPLVISIVGIIMMTGSMNLNTIVEGQAGGFWHWNFLPQIIGFGVFAIAAVSELNRTPF
                     DLPEAESELVAGYHVEYSGFRFAFFMLAEYVYVFAIAGLTTTLFLGGWHAPLPFLEFI
                     PGIVWFLLKFSFIVFFLFWLRATLPRVRVDQLMGLGWKVLLPLALINIFVTALYMAIA
                     M"
     misc_feature    55055..56023
                     /locus_tag="PM3016_57"
                     /note="NADH:ubiquinone oxidoreductase subunit H;
                     Provisional; Region: PRK06076"
                     /db_xref="CDD:235692"
     gene            56097..56540
                     /locus_tag="PM3016_58"
                     /db_xref="GeneID:11882021"
     CDS             56097..56540
                     /locus_tag="PM3016_58"
                     /codon_start=1
                     /transl_table=11
                     /product="protein NuoI"
                     /protein_id="YP_005310196.1"
                     /db_xref="GI:379718065"
                     /db_xref="GeneID:11882021"
                     /translation="MKGIVKGLGVTLKSMTQKKVTYAYPDVPLNMPDRFRGIQHFDPE
                     KCIVCNQCARICPTECINLIGKPNPDPEKKGKVIDTYDINFEICILCDLCTEVCPTEA
                     IVMTNNFELSTYSRDDLFKNLQWLNENNTNVRKENNSALPKGGAK"
     misc_feature    56115..56474
                     /locus_tag="PM3016_58"
                     /note="NADH-quinone oxidoreductase, chain I; Region: NuoI;
                     TIGR01971"
                     /db_xref="CDD:233661"
     misc_feature    56229..56393
                     /locus_tag="PM3016_58"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            56541..57068
                     /locus_tag="PM3016_59"
                     /db_xref="GeneID:11882022"
     CDS             56541..57068
                     /locus_tag="PM3016_59"
                     /codon_start=1
                     /transl_table=11
                     /product="protein NuoJ"
                     /protein_id="YP_005310197.1"
                     /db_xref="GI:379718066"
                     /db_xref="GeneID:11882022"
                     /translation="MFENMTEFLSSGENIAFFFCALLAIGGAIFMISFTKVVHMVLAL
                     ALTFISMAGLYIVLEAEFVAVVQILIYAGAISILMIFGIMMTKHTKEEEEEPKRPWHQ
                     VLLFIGAAGLFGVIFYAIQQSEIPSGQFPQVADNTLEIGKLLFSAHVIPFELMSVLLT
                     VAFIGAIVVAKREED"
     misc_feature    56568..57059
                     /locus_tag="PM3016_59"
                     /note="NADH:ubiquinone oxidoreductase subunit J;
                     Provisional; Region: PRK06638"
                     /db_xref="CDD:235844"
     gene            57074..57391
                     /locus_tag="PM3016_60"
                     /db_xref="GeneID:11882023"
     CDS             57074..57391
                     /locus_tag="PM3016_60"
                     /codon_start=1
                     /transl_table=11
                     /product="protein NuoK"
                     /protein_id="YP_005310198.1"
                     /db_xref="GI:379718067"
                     /db_xref="GeneID:11882023"
                     /translation="MGATGLATPYLTLAAILFCIGLYGALSKKNAVIVLLSIELMLNS
                     VNLNLVAFSKYGVKPGLTGQMFSLFNITVAAAEAAVGIAILIALYRNKGTTDVNEMDS
                     MKR"
     misc_feature    57101..57385
                     /locus_tag="PM3016_60"
                     /note="NADH:ubiquinone oxidoreductase subunit K;
                     Validated; Region: PRK05715"
                     /db_xref="CDD:180218"
     gene            57450..59342
                     /locus_tag="PM3016_61"
                     /db_xref="GeneID:11882024"
     CDS             57450..59342
                     /locus_tag="PM3016_61"
                     /codon_start=1
                     /transl_table=11
                     /product="proton-translocating NADH-quinone oxidoreductase
                     subunit L"
                     /protein_id="YP_005310199.1"
                     /db_xref="GI:379718068"
                     /db_xref="GeneID:11882024"
                     /translation="MVSAYSQYAWLIPLFPLLSFLILTAAGRTLRGAGPYISIVAAFA
                     SFVLAVLIFWERVSGGVEDFTWNKLQWLRLGDTSLTMGFEVTNLNALMLVVVTLVSLL
                     VNIYSTGYMHDDERIHVFFAYIALFTFSMLGLVISENLVQLFIFWELVGVCSFLLVGF
                     WYFKPEARAAAKKAFIVTRVGDVGLFLGMLLLFWVMPEHSLSFSAITNAFNQGQIPEA
                     TATWIAILIFIGAMGKSGQFPLHTWLPDAMEGPTPISALIHAATMVAAGVYLVARTYP
                     IFMEAPTALTVVAAVGAFTAIFAATIGTAQNDIKRILAYSTVSQLGYMMMALGIGTSV
                     ALTAGIFHLFTHAFFKALLFLGAGSVIHAVHTQDIHEMGGVGRHMKVTAWTFAVGALA
                     LSGIFPLSGFWSKDAILTEALVQGHPVLFAVGLIAAFFTAFYMSRLFFLVFTGTSRSP
                     QGGHAHESPVSMTFPLMVLAVLAVAAGFVFTPFNPWLGGWLTGEAHEEHANYLVMVLS
                     TLAGLLGIGLGYLMYYKQSVRSDLVSGPAPGLYTLLSRKYYIDELYQLVIVRPLQGIG
                     SLLHLFDVYVVDGVVRLCSYAVTGAGRLGSRMQNGQVQTYGLATLLGLLILMLALAGR
                     RFIDAG"
     misc_feature    57462..59270
                     /locus_tag="PM3016_61"
                     /note="NADH:ubiquinone oxidoreductase subunit L; Reviewed;
                     Region: PRK06590"
                     /db_xref="CDD:235836"
     misc_feature    57858..58676
                     /locus_tag="PM3016_61"
                     /note="NADH-Ubiquinone/plastoquinone (complex I), various
                     chains; Region: Oxidored_q1; pfam00361"
                     /db_xref="CDD:201180"
     misc_feature    58749..>58904
                     /locus_tag="PM3016_61"
                     /note="NADH dehydrogenase subunit 5 C-terminus; Region:
                     NADH5_C; pfam06455"
                     /db_xref="CDD:203454"
     gene            59332..60957
                     /locus_tag="PM3016_62"
                     /db_xref="GeneID:11882025"
     CDS             59332..60957
                     /locus_tag="PM3016_62"
                     /codon_start=1
                     /transl_table=11
                     /product="proton-translocating NADH-quinone oxidoreductase
                     subunit M"
                     /protein_id="YP_005310200.1"
                     /db_xref="GI:379718069"
                     /db_xref="GeneID:11882025"
                     /translation="MPDNLPVLSLITFSPLIGVLLLLFIPKTQGQWIKTVAVLTTVVP
                     LLLSGWLYYDFNANLEGMQFKEEVPWILVPLNKETLSGLTSFFYQFNYVMAVDGLSLP
                     LVFLTALVALMAALASVYIKKRWKTYFILFLLLETGMFGVFMAQDLFLFFVFFEVTLI
                     PMFFLIGIWGYMDRERAANKFLIYNGLGSAIMLIAFLILVTTAGFIQTAAGGGTSIHY
                     SGDINVITENLFQNAQSYVNQNDPSGNNPFFLSETMKWALFVLLLVAFGIKLPIFPFH
                     TWMLKVHTEAPPSIVMIHSGILLKMGAYGLIRFGILLFPQQAVAWAGVLAVLGVINIL
                     YGAVLAFVQKEFKLVLAYSSISHMGIVLLGIAAFNTVGLEGAIFQLVSHGLISALMFL
                     LVGSIHERTGTTELGSLGGLAKSIPFISGILLVAGMASLGLPGLSGFVSEFLAFLGLF
                     ESHPVITAVGALGIILAAVYVLRGVLSITYGPLQEGLPEMRDARLIEAVPMITLVAFI
                     VVLGIYPAVLSGPLHQTVSSFDQFIHSVAKIGG"
     misc_feature    59341..60912
                     /locus_tag="PM3016_62"
                     /note="NADH:ubiquinone oxidoreductase subunit M; Reviewed;
                     Region: PRK05846"
                     /db_xref="CDD:235622"
     misc_feature    59788..60678
                     /locus_tag="PM3016_62"
                     /note="NADH-Ubiquinone/plastoquinone (complex I), various
                     chains; Region: Oxidored_q1; pfam00361"
                     /db_xref="CDD:201180"
     gene            60962..62482
                     /locus_tag="PM3016_63"
                     /db_xref="GeneID:11882026"
     CDS             60962..62482
                     /locus_tag="PM3016_63"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase subunit N"
                     /protein_id="YP_005310201.1"
                     /db_xref="GI:379718070"
                     /db_xref="GeneID:11882026"
                     /translation="MESPLQLLTAADLALLAPELTLVAASVVLALLDLVLPKSSSRHV
                     LGWLSFVSILLSAYFVVSMLHPAEPKQLLQFSYRVDDFAGVLKLVLLAGAGLITFMSI
                     GSVKEEDIPHLGEFYYLILPATLGGMIMASSGELITLFVGLELLSITSYILVAMRKRN
                     LQSNEGAFKYIVLGGISSAIILYGMSFLYGMTGSTVIAEINAGLGQASQGMLPLMYLS
                     FFLLLAGFGFKVAAAPFHMWAPDVYQGAPTPVTAYLAVVSKAAAFAILFRVIYNVFGV
                     GELMGQPFQQDVLLSLMVVAAIAMVAGNFVALRQSNLKRLLAYSGVANSGYLLVPIAT
                     HFSLVHYSNFSEFAFYLIAYLFMNIGIFAVLMILEGATGDSELKSLAGLYYRAPWTAV
                     ATVLLVLSLAGLPLSGGFFGKLYIMFGTMQTQHYWLAAVLIGTSVVSFYYYFGFIRQM
                     FMRSNEEAGETRIPLTLGITMWLCAGASLLLGVIPHVVLGYIDSIFSLTKDLFFMF"
     misc_feature    61070..62449
                     /locus_tag="PM3016_63"
                     /note="NADH:ubiquinone oxidoreductase subunit N;
                     Provisional; Region: PRK05777"
                     /db_xref="CDD:235603"
     misc_feature    61358..62218
                     /locus_tag="PM3016_63"
                     /note="NADH-Ubiquinone/plastoquinone (complex I), various
                     chains; Region: Oxidored_q1; pfam00361"
                     /db_xref="CDD:201180"
     gene            complement(62659..63129)
                     /locus_tag="PM3016_64"
                     /db_xref="GeneID:11882027"
     CDS             complement(62659..63129)
                     /locus_tag="PM3016_64"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005310202.1"
                     /db_xref="GI:379718071"
                     /db_xref="GeneID:11882027"
                     /translation="MDQNAKLLQLDNQLCFAIYATSREITKLYQPFLERLGLTYPQYL
                     AMMVLWERQECSVKELGEALYLDSGTLTPLLKRLEASGLVTRNRSAEDERVVRIGLTE
                     QGKALREQAAIVPQALMEQTCLSAAEFEGLLQQFKSLLKRVHEAGGRTGNGDRG"
     misc_feature    complement(62701..63036)
                     /locus_tag="PM3016_64"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(62746..63036)
                     /locus_tag="PM3016_64"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    complement(order(62815..62817,62953..62955,62962..62964))
                     /locus_tag="PM3016_64"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(62836..62844,62866..62874,62890..62895,
                     62899..62904,62911..62916,62920..62931,62956..62964))
                     /locus_tag="PM3016_64"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            63209..63307
                     /locus_tag="PM3016_65"
                     /db_xref="GeneID:11882028"
     CDS             63209..63307
                     /locus_tag="PM3016_65"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310203.1"
                     /db_xref="GI:379718072"
                     /db_xref="GeneID:11882028"
                     /translation="MEVGEKDREPVMRKIRKGVARAEALSNSSIIL"
     gene            63402..65921
                     /locus_tag="PM3016_66"
                     /db_xref="GeneID:11882029"
     CDS             63402..65921
                     /locus_tag="PM3016_66"
                     /codon_start=1
                     /transl_table=11
                     /product="subtilisin-type proteinase"
                     /protein_id="YP_005310204.1"
                     /db_xref="GI:379718073"
                     /db_xref="GeneID:11882029"
                     /translation="MNATKWKLSTLTSLTCLALCLTFTQAARGAEASDPLAAKQTYLG
                     PTGMTKAWDISKGAGGVTIAIVDTGVDLNHPDLKGNLVPGVNLIQPGQPPADDNGHGT
                     NVAGIIGAAGGNDKGIAGMLWQARIMPVKALEADGSGGETMLGEGIRYAVDHGAKIVV
                     LSLGLNKYSDYLSEIVKYAESKDVLLVAATGNEGNRVKYPAAYPTVLAVGGMTAGGAV
                     DTRSNTGPEVDVVAPWNVFTTALGGSYEAKDGTSMAAPQVAAAAALLWERYPQMKAHQ
                     IRQWVRQTAQDLGPAGWDPGTGYGLLRVDRLLSERIAEDMYEPNDRKDQAKTVSNAKS
                     VTASFASGTDADWYVIDAQYDGTVSLSFAMDSSMTVSAQHTDASGVLSAKTVQGGGAV
                     TFPVSKGRSYVQLQLKDRGQAEAVPYRMTTSFEIYRDAFEDNDRQFKASVLPSRTLTV
                     KGTFHQTGDTDWYEFPVPESGSMRIRLTSDTARIDPVLLVQKQGEKSVTVDYGDDGAE
                     EGYELTEVFPGSYYIRVTNVKEYANAVVGEYTLKIEYDAKLADPNEPNNKSYQATVVS
                     LDTPYTGLLDKPNETDWFQFRVEQESRVGIGLTDIPAGVSLYMHLYDGSMRSIASSMN
                     EQGSAVQSLTGRLEPGTYYVKLTSSVPFDNRMYELTVEAKPLLGGYTDVSGHWAQSAI
                     LTLSGRGVINGYEDYLFQPDRPITRAEATAVLTRAYGLTKEKEIAYSDLGSGHWAYTY
                     IARAAQAGIIEGYPDRTFAPDQPVSRMEMTAMLARGAGMSGKRRGAVPFTDVDESYWG
                     TGLLKQMKAEGLIGGYADGTFRPDQQATRAEFVQLLAGMLK"
     misc_feature    63501..64268
                     /locus_tag="PM3016_66"
                     /note="Peptidase domain in the S8 and S53 families;
                     Region: Peptidases_S8_S53; cl10459"
                     /db_xref="CDD:263972"
     misc_feature    63585..64307
                     /locus_tag="PM3016_66"
                     /note="Subtilase family; Region: Peptidase_S8; pfam00082"
                     /db_xref="CDD:249571"
     misc_feature    order(63699..63701,63888..63890,64155..64157)
                     /locus_tag="PM3016_66"
                     /note="active site"
                     /db_xref="CDD:173787"
     misc_feature    order(63699..63701,64155..64157)
                     /locus_tag="PM3016_66"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173787"
     misc_feature    64776..64976
                     /locus_tag="PM3016_66"
                     /note="Bacterial pre-peptidase C-terminal domain; Region:
                     PPC; pfam04151"
                     /db_xref="CDD:252413"
     misc_feature    65409..65531
                     /locus_tag="PM3016_66"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    65580..65708
                     /locus_tag="PM3016_66"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    65763..65894
                     /locus_tag="PM3016_66"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            66037..66288
                     /locus_tag="PM3016_67"
                     /db_xref="GeneID:11882030"
     CDS             66037..66288
                     /locus_tag="PM3016_67"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310205.1"
                     /db_xref="GI:379718074"
                     /db_xref="GeneID:11882030"
                     /translation="MDYVDQMNASMGLKGVINIAVVLVFIGFSWWALQELKLEAILKR
                     PRSAAAKTLQIFLSIALGYQVARFVIDYLDWSTWFSKMF"
     misc_feature    66067..66267
                     /locus_tag="PM3016_67"
                     /note="Protein of unknown function (DUF1146); Region:
                     DUF1146; cl11486"
                     /db_xref="CDD:264396"
     gene            66331..67755
                     /locus_tag="PM3016_68"
                     /db_xref="GeneID:11882031"
     CDS             66331..67755
                     /locus_tag="PM3016_68"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MurA1"
                     /protein_id="YP_005310206.1"
                     /db_xref="GI:379718075"
                     /db_xref="GeneID:11882031"
                     /translation="MDSTTDINLSGLTNGIVTGGYKHIIQNTRRGTMMSKIIVRGGKK
                     LSGRVRIHGAKNAVLPIIAASILGSEGVSVIHDAPPLDDVLVINKVLESLGIAVEYRN
                     ETIRVDAGRITTCEASYDLVRKMRASFLVMGPLLTRMGQARISLPGGCAIGTRPIDQH
                     LKGFEAMGAEIELGQGYIEARVNGRLKGAKIYLDVASVGATENIMMAAALAEGTTLIE
                     NAAKEPEIVDLANYLNAMGAKIRGAGTGLIRIDGVERLQGAVHTVIPDRIEAGTYMIA
                     AAITGSDLYVEGAIGDHLRPVISKMQEMGVQIEEDENGIRVYTVGPLKAVDVKTLPYP
                     GFPTDMQSQMMALLLTAEGTSIVTETVFENRFMHVEQMANMSAQIKVEGRTAVISGGA
                     RLQGAKVCATDLRAGAALILAALVAEGDTEITGLHHIDRGYVGITEKLSLLGAEIRRL
                     PLEIVEETEREEVLPLFAVQPSLA"
     misc_feature    66445..67650
                     /locus_tag="PM3016_68"
                     /note="EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase); Region: EPSP_synthase;
                     pfam00275"
                     /db_xref="CDD:249736"
     misc_feature    66463..67659
                     /locus_tag="PM3016_68"
                     /note="UDP-N-acetylglucosamine enolpyruvyl transferase
                     catalyzes enolpyruvyl transfer as part of the first step
                     in the biosynthesis of peptidoglycan, a component of the
                     bacterial cell wall. The reaction is phosphoenolpyruvate +
                     UDP-N-acetyl-D-glucosamine =...; Region: UdpNAET; cd01555"
                     /db_xref="CDD:238796"
     misc_feature    order(66481..66492,67117..67128)
                     /locus_tag="PM3016_68"
                     /note="hinge; other site"
                     /db_xref="CDD:238796"
     misc_feature    order(66496..66498,66706..66708,66718..66720,66793..66810,
                     66913..66915,66922..66927,67345..67347)
                     /locus_tag="PM3016_68"
                     /note="active site"
                     /db_xref="CDD:238796"
     gene            68015..69064
                     /locus_tag="PM3016_69"
                     /db_xref="GeneID:11882032"
     CDS             68015..69064
                     /locus_tag="PM3016_69"
                     /codon_start=1
                     /transl_table=11
                     /product="Sporulation protein SpoIID"
                     /protein_id="YP_005310207.1"
                     /db_xref="GI:379718076"
                     /db_xref="GeneID:11882032"
                     /translation="MTKYKLNPRQKKVLGWFAVWLASFTAVVVLVPGLLVRSTTPSAD
                     PAAVRPASAQPEAGDVPLIPVYLSKSKSTDRIPLETYVRGVVAAEMPAEFEPEALKAQ
                     ALAARTYIIRRMLAGDRTGVPAGEALVTDTIAHQAYISDEELGQRWGADYARVRDKLN
                     RAVEETKDTILTYEGQPIEASFFSTSNGYTENSEDYWNVKIPYLRSVASPWDAKLSPR
                     YKETVRFSGKELQTRLGLPAAIPATTGASRGLKVLERSQGRRILKLSAGGKQFTGREV
                     REKLGLNSSGFQWSYKDGAWEITTFGYGHGVGMSQWGAQGMALEGRKAEEIVKHYYTG
                     VELSKASTLLSAKSF"
     misc_feature    68201..68533
                     /locus_tag="PM3016_69"
                     /note="Stage II sporulation protein; Region: SpoIID;
                     pfam08486"
                     /db_xref="CDD:254826"
     misc_feature    68240..69031
                     /locus_tag="PM3016_69"
                     /note="SpoIID/LytB domain; Region: SpoIID_LytB; TIGR02669"
                     /db_xref="CDD:233969"
     gene            69133..69855
                     /locus_tag="PM3016_70"
                     /db_xref="GeneID:11882033"
     CDS             69133..69855
                     /locus_tag="PM3016_70"
                     /codon_start=1
                     /transl_table=11
                     /product="stage II sporulation protein Q"
                     /protein_id="YP_005310208.1"
                     /db_xref="GI:379718077"
                     /db_xref="GeneID:11882033"
                     /translation="MNEQKRDSQNEAPKTIEGAQHTSSAWKRLLAKKWVFPATYIAAA
                     AIILTIMWVYQGGGGLTTNSDVSVDKPAGTVTDSVSGPDSVATTAKQETMQWPVKNRS
                     ELEVVLPYFDPNAANDVRQAAMVEYGDTFTPHIGMDFAKKDNAPFEVLAVMGGKVTAV
                     QKDPLVGNLVEITHANGLVSVYQSLAEVKVTKDAEVKKGDVIAQAGRNELEKDQGTHL
                     HFELRQGQGGPAVNPEQYIAEQ"
     misc_feature    <69508..69846
                     /locus_tag="PM3016_70"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    69526..69831
                     /locus_tag="PM3016_70"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            70139..70426
                     /locus_tag="PM3016_71"
                     /db_xref="GeneID:11882034"
     CDS             70139..70426
                     /locus_tag="PM3016_71"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SpoIIID"
                     /protein_id="YP_005310209.1"
                     /db_xref="GI:379718078"
                     /db_xref="GeneID:11882034"
                     /translation="MHDYIKERTIKIGRCLVETKHTVRTIAKEFGVSKSTVHKDLTER
                     LPEINPELANQVKHILEYHKSIRHLRGGEATKIKYRKTRSPKVQEKLVTVK"
     misc_feature    70142..70387
                     /locus_tag="PM3016_71"
                     /note="Stage III sporulation protein D; Region: SpoIIID;
                     pfam12116"
                     /db_xref="CDD:152551"
     gene            70626..71624
                     /locus_tag="PM3016_72"
                     /db_xref="GeneID:11882035"
     CDS             70626..71624
                     /locus_tag="PM3016_72"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310210.1"
                     /db_xref="GI:379718079"
                     /db_xref="GeneID:11882035"
                     /translation="MLSKDIGIDLGTANVLIHVKGRGVVLDEPSVVAIESDGKRVLAV
                     GEEAFRMVGRTPGNIVAIRPLKDGVIADFEITELMLKYFINKVGGRNWYSHPRILICA
                     PTNITSVEQKAIREAAERSGAREVFLEEEPKAAAIGAGMDIYQPSGNMVVDIGGGTTD
                     VAVLSMGDIVTSSSIKIAGDKFDSSIMKYIKSKYKLLIGERTSEDIKKRIGTVHPEGK
                     KETMDIRGRDMVSGLPLTMTINSQEIQEALDEPVSNIVAAAKSVLERTPPELSADIID
                     RGVILTGGGAMLHGIDQLLADELKVPVLIAEDPMHCVVKGTGIMLDNLDKVSKRKF"
     misc_feature    70626..71618
                     /locus_tag="PM3016_72"
                     /note="rod shape-determining protein Mbl; Provisional;
                     Region: PRK13928"
                     /db_xref="CDD:237563"
     misc_feature    70641..71600
                     /locus_tag="PM3016_72"
                     /note="MreB and similar proteins; Region: MreB_like;
                     cd10225"
                     /db_xref="CDD:212668"
     misc_feature    order(70650..70652,70656..70667,70827..70829,71016..71018,
                     71082..71084,71088..71099,71160..71165,71235..71237,
                     71244..71249,71472..71480,71484..71489,71553..71555,
                     71562..71564)
                     /locus_tag="PM3016_72"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212668"
     misc_feature    order(70650..70652,71082..71084)
                     /locus_tag="PM3016_72"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    order(70728..70730,70776..70778,70800..70802,71061..71063,
                     71067..71069,71127..71129,71223..71225,71229..71231,
                     71298..71300,71322..71324,71331..71333,71421..71423,
                     71430..71432,71526..71528,71598..71600)
                     /locus_tag="PM3016_72"
                     /note="putative protofilament interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    order(71043..71048,71070..71072,71448..71456,71529..71531,
                     71535..71537,71544..71546)
                     /locus_tag="PM3016_72"
                     /note="RodZ interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212668"
     gene            71641..72540
                     /locus_tag="PM3016_73"
                     /db_xref="GeneID:11882036"
     CDS             71641..72540
                     /locus_tag="PM3016_73"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein"
                     /protein_id="YP_005310211.1"
                     /db_xref="GI:379718080"
                     /db_xref="GeneID:11882036"
                     /translation="MLRGLYTAASGMIAQQRKHDIVTNNIANLNTPGFKGGNGINRSF
                     PEVLIERTRDDNSGPAAATRTVGRIHTGVLAEENVSLHAQGDLQETNNPFDFALVSNI
                     QVPGARFDSSGKYVDENGERVIQPQAFFTIQNAAGDTRYSLNGKFSLDVNGRMIDSEG
                     NQVLGSDGQPIVLMDGNTPVTNFRITRDGQFTNVDGRPINGANGQPLTMMITRVEDPN
                     LLIREGNGLYRLSEENQAMAQQAGGQDQFEVRQGFVERSNVDAGQSMVDMMSALRAYE
                     ANQKMIQFYDKSMEKAANDVGRV"
     misc_feature    71641..72531
                     /locus_tag="PM3016_73"
                     /note="Flagellar basal body rod protein [Cell motility and
                     secretion]; Region: FlgG; COG4786"
                     /db_xref="CDD:227125"
     misc_feature    71653..71745
                     /locus_tag="PM3016_73"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    72298..72522
                     /locus_tag="PM3016_73"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            72616..73488
                     /locus_tag="PM3016_74"
                     /db_xref="GeneID:11882037"
     CDS             72616..73488
                     /locus_tag="PM3016_74"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body protein"
                     /protein_id="YP_005310212.1"
                     /db_xref="GI:379718081"
                     /db_xref="GeneID:11882037"
                     /translation="MNNSMINSSVSMHSLQQKLDLVANNIANVNTTGYKRREASFQDV
                     LTSVKQQPQTFEKNGRLTPLGYGQGWGSKMVAAQLNLQQGSLQVTDNLLDMAIEGNGL
                     FEISANGEDENGNPARTTRWTRNGAFELSQSTDPADPRTFLTTKDGHYVMGADDQPIR
                     IPAGHRVQIQADGVIMAYNEANQTAAPVQAGQLKMVRVVRPQLLEQIGDNLYGLAGDI
                     TPQQRDEILQTVNAGNNEVDPITVRQGFLEQSNVNLSEEMTELLTVQRAYQLNSRAIS
                     SADQMMNLANNLRV"
     misc_feature    72616..73482
                     /locus_tag="PM3016_74"
                     /note="Flagellar basal body rod protein [Cell motility and
                     secretion]; Region: FlgG; COG4786"
                     /db_xref="CDD:227125"
     misc_feature    72649..72939
                     /locus_tag="PM3016_74"
                     /note="flagellar basal body rod protein FlgB; Provisional;
                     Region: flgB; cl19173"
                     /db_xref="CDD:267526"
     misc_feature    <72658..72720
                     /locus_tag="PM3016_74"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    73090..73422
                     /locus_tag="PM3016_74"
                     /note="flagellar basal-body rod protein FlgF; Region:
                     flgF; TIGR02490"
                     /db_xref="CDD:233892"
     gene            73573..73812
                     /locus_tag="PM3016_75"
                     /db_xref="GeneID:11882038"
     CDS             73573..73812
                     /locus_tag="PM3016_75"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310213.1"
                     /db_xref="GI:379718082"
                     /db_xref="GeneID:11882038"
                     /translation="MQSEVGVLSENPKKAPALSPRWKKITLTVLKWTWIPLLCLAALF
                     TGLSIGYAVIGQGDFKDVWDPGTWRHLFDLVFAEN"
     misc_feature    73681..73797
                     /locus_tag="PM3016_75"
                     /note="DNA-directed RNA polymerase subunit beta; Region:
                     EpuA; pfam11772"
                     /db_xref="CDD:152208"
     gene            73958..74500
                     /locus_tag="PM3016_76"
                     /db_xref="GeneID:11882039"
     CDS             73958..74500
                     /locus_tag="PM3016_76"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-alcohol phosphatidyltransferase"
                     /protein_id="YP_005310214.1"
                     /db_xref="GI:379718083"
                     /db_xref="GeneID:11882039"
                     /translation="MWNVPNILTLCRFLLIPAYLVVFEAGYIRSAFFILLLAGATDVL
                     DGYIARRRGLVTDLGSMLDPLADKSMMIAVILSLVFSQMISWQAACAMFLRDAGMIAG
                     SAYFHFRGKKTVPANAMGKLTTVLYYVAILLIIFELPYAHAYLWFVISVSILTSIIYI
                     LQFNLLHKRAGKPQSLDKPR"
     misc_feature    73958..74446
                     /locus_tag="PM3016_76"
                     /note="Phosphatidylglycerophosphate synthase [Lipid
                     metabolism]; Region: PgsA; COG0558"
                     /db_xref="CDD:223632"
     gene            74693..75124
                     /locus_tag="PM3016_77"
                     /db_xref="GeneID:11882040"
     CDS             74693..75124
                     /locus_tag="PM3016_77"
                     /codon_start=1
                     /transl_table=11
                     /product="protein FabZ"
                     /protein_id="YP_005310215.1"
                     /db_xref="GI:379718084"
                     /db_xref="GeneID:11882040"
                     /translation="MLDAKQIQQIIPHRYPFLLVDRILEVEAGKRAVGIKNVTINEPF
                     FQGHFPEYPVMPGVLIVEALAQVGTVAMLSVEENQGKIGFFAGIDNFRFREQVLPGDT
                     LTMEVVMTRVKGVIGKGHGTARVGDKVVAEGELMFALKAPN"
     misc_feature    74723..75112
                     /locus_tag="PM3016_77"
                     /note="FabZ is a 17kD beta-hydroxyacyl-acyl carrier
                     protein (ACP) dehydratase that primarily catalyzes the
                     dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP,
                     the third step in the elongation phase of the bacterial/
                     plastid, type II, fatty-acid...; Region: FabZ; cd01288"
                     /db_xref="CDD:238615"
     gene            75186..76895
                     /locus_tag="PM3016_78"
                     /db_xref="GeneID:11882041"
     CDS             75186..76895
                     /locus_tag="PM3016_78"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PgcA"
                     /protein_id="YP_005310216.1"
                     /db_xref="GI:379718085"
                     /db_xref="GeneID:11882041"
                     /translation="MNTQTRVQEQYELWLGDAAIDAATKEELRSIEGDAKEIEDRFYR
                     DLEFGTGGLRGVIGAGTNRINAYTVARATQGLAQFLLETAGKDQPSVVIAYDSRNQSP
                     EFALETAKVLAGNGIKAYVFESLRTTPELSFAVRHLNADAGVVITASHNPPEYNGYKV
                     YGNDGGQLVPHQAEQVIEQIRGVQSFADVKRSSRADAEKAGLLQWIGQAVDDEYIRAV
                     TAVSRNPQLIKETADDFRIVYTPLHGAGNLSVRAALAGVGFTQVHVVAEQELPDANFS
                     TVKSPNPEEREAFTLAINEAKKIGADIIIGTDPDCDRMGAVVKDPSGEYFVLSGNQSG
                     AIMVDYLLSSLKDRGEMPENGVVVKTIVTSEMGAVIAEHYGAKVVNTLTGFKYIGEKM
                     TQYEQTGEATFLFGYEESYGYLAGNYARDKDAVIASMLISEAAAYYKSQGKTLYDVLQ
                     ELYERHGYFLEKLESRTLKGKDGVEQIGSIMTDWRTNAPEQINGLKVTKIEDFSEGLY
                     GLPVENVLKYTLEDDSWFTLRPSGTEPKIKVYFAVRSSSSEGAASSLDQLVETVMSRV
                     DKK"
     misc_feature    75186..76877
                     /locus_tag="PM3016_78"
                     /note="phosphoglucomutase-2-like protein; Provisional;
                     Region: PTZ00150"
                     /db_xref="CDD:240294"
     misc_feature    75318..76817
                     /locus_tag="PM3016_78"
                     /note="This CD includes PGM2 (phosphoglucomutase 2) and
                     PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2
                     is thought to be a phosphopentomutase that catalyzes the
                     conversion of the nucleoside breakdown products,
                     ribose-1-phosphate and...; Region: PGM2; cd05799"
                     /db_xref="CDD:100092"
     misc_feature    order(75330..75332,75336..75338,75345..75347,75630..75638,
                     75660..75662,76107..76109,76113..76115,76119..76124,
                     76269..76271,76332..76340,76407..76409,76413..76415,
                     76419..76421,76770..76772,76776..76784,76797..76799)
                     /locus_tag="PM3016_78"
                     /note="active site"
                     /db_xref="CDD:100092"
     misc_feature    order(75336..75338,75630..75632,76122..76124,76269..76271,
                     76332..76334,76338..76340,76407..76409,76413..76415,
                     76419..76421,76770..76772,76776..76784,76797..76799)
                     /locus_tag="PM3016_78"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100092"
     misc_feature    order(75630..75632,76107..76109,76113..76115,76119..76121)
                     /locus_tag="PM3016_78"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100092"
     gene            76927..78981
                     /locus_tag="PM3016_79"
                     /db_xref="GeneID:11882042"
     CDS             76927..78981
                     /locus_tag="PM3016_79"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310217.1"
                     /db_xref="GI:379718086"
                     /db_xref="GeneID:11882042"
                     /translation="MKGRYLRLNQWAVKALWWLVILGMLASLAIAYERYQTEEGSGRR
                     VEFVMDYRDLLEISDLQTDPKRFVSDQLQKLKEHRVGSLAVYEATLNELQLSRRLQVY
                     SSQEAAVLTQSPGTIGENFTYVLFESGETERRLAPVIRQAFEDLGVAVRPWNYKNQPG
                     LRIEMAKEEAVLKSMDPDPMTLETLKSQGFTIVFRMSNRRAFEAARMDALLSTMKDLG
                     VRRIIVDGDSVPGFISEKDVSGLDGMGEILTKHKIGLAVIEMQKTPQRGFNGLAQRIR
                     HDVVRLHSFTENDAQKLTENITAEELKGRIQGVADRFVLAAKDRNIRMVLLNARAVKS
                     LEKGRILHPLDSIYEALTGADGAIPRIAKAGYKMAPAEPFQLVHSSWQTPAKLLVWAG
                     SVALIALMISYFIPEITAVVFLLGMIGSAGLYVLSSSLFSQGLALGAGTSAATLSIMV
                     ALQAARRKLDKPDGNRLLFAIGLLLRASLISVIGLLFIVGLLNQIQYSLVLEQFRGVS
                     VLHLAPIALVGLYWLLFMDKVSYKERWARAQSMLSSNISVLWIVAAAVLAAAGYYYLS
                     RTGNEGQASDWEKYFRSFLENTLGVRPRTKEFLLSHPLFILGAYLSFKYRSALLLILA
                     GVIGQASVVDTFAHLHTPLQISAIRVLYGLGFGTLIGIALIIVWEIITRSWQRWVPRL
                     NE"
     gene            78957..80093
                     /locus_tag="PM3016_80"
                     /db_xref="GeneID:11882043"
     CDS             78957..80093
                     /locus_tag="PM3016_80"
                     /codon_start=1
                     /transl_table=11
                     /product="protein CsaB"
                     /protein_id="YP_005310218.1"
                     /db_xref="GI:379718087"
                     /db_xref="GeneID:11882043"
                     /translation="MGTPVKRIVLSGYYGFNNSGDEAVLQSILLALQEQGERQGVTFH
                     PVVLSVNPAETARTYGVESAHRMRPMELWKALRGADGLISGGGSLLQDETSPKTIPYY
                     LGVIRLAQLLGKPVFVYSQGIGPVHRPKFFGWIRSAFQRCRVVTVRDEESKALLQQMG
                     LSGSEVEVVPDPVMGMPLKNAARHRDPAGADSGLAPVIGVSVRFWNKDRSELDAAAEA
                     LRKVMEETDAVVRFLPFHLPSDEEASEYVAQRLGETYKHRISIAKGVTHPQDMLAETA
                     SVSVLLGMRLHSLIYAAGRYVPMVGISYDPKIDQFLNRLSMQAACSTQAPNAAAIAET
                     LLHLLKSREAWREDKRQVIERLKSEAHRPAERIAAFYSKAQGRR"
     misc_feature    78978..79892
                     /locus_tag="PM3016_80"
                     /note="polysaccharide pyruvyl transferase CsaB; Region:
                     S_layer_CsaB; TIGR03609"
                     /db_xref="CDD:132648"
     gene            80439..81542
                     /locus_tag="PM3016_81"
                     /db_xref="GeneID:11882044"
     CDS             80439..81542
                     /locus_tag="PM3016_81"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_005310219.1"
                     /db_xref="GI:379718088"
                     /db_xref="GeneID:11882044"
                     /translation="MNLLYGIGFAAALLIALVMTPLVRRFAFWAKAVDAPNHRKVHSR
                     IMPRLGGLAIFIAFIGAYFIVSPAIDTLKADVVFGLLVGGTIVVLVGALDDRFDLSPK
                     IKLLGQILAASVVVYSGVTIDLVNVPFGDETISLSWLAVPLTIFWIVGVTNAINLIDG
                     LDGLSAGVSAIATTTILVLALMMGNVTVVLLCTLLLGSIIGFLFYNFHPAKIFMGDSG
                     ALFLGFTLATLSVLGFKQATVVSLLVPIMILGVPLSDTFFAIMRRWVNNLPISAADKS
                     HLHHCLLRMGFSHRTTVLIIYGIATFFGFSAVLLSYMSEQQALWGAVILVAVLLVVLV
                     VGAEFIGIISRTKRPVLHFLNKIRMKTMQRMTK"
     misc_feature    80553..81299
                     /locus_tag="PM3016_81"
                     /note="This subfamily contains Escherichia coli WecA,
                     Bacillus subtilis TagO and related proteins. WecA is an
                     UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate
                     (Und-P) GlcNAc-1-phosphate transferase that catalyzes the
                     formation of a phosphodiester bond...; Region:
                     GT_WecA_like; cd06853"
                     /db_xref="CDD:133463"
     misc_feature    80718..80723
                     /locus_tag="PM3016_81"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:133463"
     misc_feature    81075..81086
                     /locus_tag="PM3016_81"
                     /note="putative catalytic motif [active]"
                     /db_xref="CDD:133463"
     misc_feature    order(81225..81227,81267..81278)
                     /locus_tag="PM3016_81"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133463"
     gene            81715..85509
                     /locus_tag="PM3016_82"
                     /db_xref="GeneID:11882045"
     CDS             81715..85509
                     /locus_tag="PM3016_82"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310220.1"
                     /db_xref="GI:379718089"
                     /db_xref="GeneID:11882045"
                     /translation="MKRTTSLRISVLLLFNMLFSLLAPLTGLADGIQLKINGLDETTE
                     SSPAQLTTSTITLPVTINGISADQINSIYYEITNMNTGVTSVNKTNKAVKNANNANEV
                     VFSGVSLTEGLNKVVAKYGEATVVSSPAAWVHFTSVTNITDLKLNEVALNDNEMYPKS
                     APYTSLSITGTASNATRIQAYVNGTAYDPVVFNRGNFTFITNTGRNNDLALKPGDNEM
                     RLISTNNSNTYYIDRTFVYDNGQAFAYDAYVKSTPAAADQYQKLAAVPTVTKNTADQV
                     TVKAKLKVPVDSSNNLLYKEVDVAVGNQTPTKYVLSSLPVSSSVANQYRIYDFEYNFT
                     TDTSNKYQAVTFSFITTSDFVQPGGQYAFYVVDPNTPYVNYMEYSIPNGLTVKVNEVG
                     MTQLNRFPASLYVYTTTNASSVKLRVNNSDYATASVIDSTTTDTSGTTLNVWKFDIPT
                     LADGISTLTVVPVGVNGENVQGSKTYLVQISSAPYVILDSIYNGQVFTSASKILCGNT
                     GTGPCLTGRVVNLPEAEKDNVVLQVNDMQFNMSGLYKTPYDGSFTITSATPTADGTKT
                     FGHKDVMGADGKKTFLFSVKVGGKVITESKFEIFILSDNVPYINSVVPVEENPDNKVF
                     KTVKTDEYATTEDVVALTGSVRNATTYTVEYTIPGETAKRSVAIASKTQTYDNDTEKI
                     TFTETFNTNSAPLSVNGDYYFQITASNNSGVLATKTVKISKEAHPYVITLPEKLFTNE
                     NGKTQANINKNYQRIEIKAEGAISILFGKVEVFPRGGMFVYEAKGLKAGANEIKFTVN
                     RGTAQNAGSLVLYNVNTPIEGAQYKSEIASSMKVFGGDLEMKLGKDVKLMRNDRTSTD
                     TFLTNKRELLFGIANVQTGIVDKDIEFANSLATQSLSGAVETYRFKPASKLFWIDAGT
                     ISDQVDAGDAADLKGALEGGGTLPLVSSDPDVSSTLQPTPFYQRYDLQDLVVPTQPVT
                     LTFKYDPTITADAWKYVTVFQYSTFADRSGAEISAGVPVSQMGWKNLGGVVDSKKNTI
                     TVTVPSFGYFQVMYMNDSFNDVTNHGWARDIIDTLYSKGYMFNKDSGGSRFLPDDAIT
                     RGEFVSLLVKVFDIPLTNPDTSNPDFQGTFGDVRKGVTLQNSINMYDYLHIEAGARAG
                     IVRGTSQGLFLPNEAITRQDAAVMIARAAELKMGTDEDKVQASLDKLFTDSTDPKFSY
                     YAKPAVEAVTKAGFIEGRPNTLLAGQTELTNRFDPVDNITRAESAAIALRVLAKLKKV
                     PK"
     misc_feature    84856..84993
                     /locus_tag="PM3016_82"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    85063..85218
                     /locus_tag="PM3016_82"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            86063..86365
                     /locus_tag="PM3016_83"
                     /note="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:11882046"
     gene            86849..89131
                     /locus_tag="PM3016_84"
                     /note="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:11882047"
     gene            89198..89779
                     /locus_tag="PM3016_85"
                     /db_xref="GeneID:11882048"
     CDS             89198..89779
                     /locus_tag="PM3016_85"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310221.1"
                     /db_xref="GI:379718090"
                     /db_xref="GeneID:11882048"
                     /translation="MRALFTKSLILAGILSIAAVYVASADGTAPGVEPGSVDDPVITK
                     SYFDQNIANKVTDELSKQSITEAKVKELISAALAGGGSTAAPGEPVSSEGSALKVVQL
                     QPGQTILGAAGTEIIVRSGKVLAVSDTEDGIPDVTIGKDVTAGAPVDLNHLLIVPREG
                     RGIKPDPKSKADIYVMVRGGYTITEASDKKATP"
     gene            89868..90137
                     /locus_tag="PM3016_86"
                     /db_xref="GeneID:11882049"
     CDS             89868..90137
                     /locus_tag="PM3016_86"
                     /codon_start=1
                     /transl_table=11
                     /product="small acid-soluble spore protein"
                     /protein_id="YP_005310222.1"
                     /db_xref="GI:379718091"
                     /db_xref="GeneID:11882049"
                     /translation="MSKTNKKVVPESGKALDVLKYEIAAELGLPVGKSAANLNVEFAT
                     ELGAIPSQNMKEDYWGHIASRDAGAVGGTITSRLIRKAEEMMFNL"
     misc_feature    89880..90125
                     /locus_tag="PM3016_86"
                     /note="Small, acid-soluble spore proteins, alpha/beta
                     type; Region: SASP; pfam00269"
                     /db_xref="CDD:249731"
     gene            90328..91533
                     /locus_tag="PM3016_87"
                     /db_xref="GeneID:11882050"
     CDS             90328..91533
                     /locus_tag="PM3016_87"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine adenosyltransferase"
                     /protein_id="YP_005310223.1"
                     /db_xref="GI:379718092"
                     /db_xref="GeneID:11882050"
                     /translation="MSNPVGRRLFTSESVTEGHPDKICDQISDSVLDAFLKNDPNARV
                     ACEVSVATGLVLVIGEITSRSEYVDIQSIARETIKEIGYTRAKYGFDSTTCAVLVSLN
                     EQSPDIAQGVNQALEAREGQMTDDQIEAIGAGDQGMMFGFAVNETPELMPLPISLSHQ
                     LSRRLTEVRKNGTLSYLRPDGKTQVTVEYEGDTPVRVDTIVISTQHGEEVTLEQIQKD
                     IKEHVIKPIVPDNLIDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGG
                     GAFSGKDPTKVDRSGAYAARYVAKNIVAAGLADKCEVQLAYAIGVAKPVSIAVDTFGT
                     GKVSEEKLVEIVRSHFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLPWERTDKA
                     EALKAAAQA"
     misc_feature    90343..91500
                     /locus_tag="PM3016_87"
                     /note="S-adenosylmethionine synthetase; Validated; Region:
                     PRK05250"
                     /db_xref="CDD:235374"
     misc_feature    90343..90645
                     /locus_tag="PM3016_87"
                     /note="S-adenosylmethionine synthetase, N-terminal domain;
                     Region: S-AdoMet_synt_N; pfam00438"
                     /db_xref="CDD:249858"
     misc_feature    90712..91068
                     /locus_tag="PM3016_87"
                     /note="S-adenosylmethionine synthetase, central domain;
                     Region: S-AdoMet_synt_M; pfam02772"
                     /db_xref="CDD:251520"
     misc_feature    91072..91491
                     /locus_tag="PM3016_87"
                     /note="S-adenosylmethionine synthetase, C-terminal domain;
                     Region: S-AdoMet_synt_C; pfam02773"
                     /db_xref="CDD:111646"
     gene            91770..94397
                     /locus_tag="PM3016_88"
                     /db_xref="GeneID:11882051"
     CDS             91770..94397
                     /locus_tag="PM3016_88"
                     /codon_start=1
                     /transl_table=11
                     /product="copper amine oxidase domain-containing protein"
                     /protein_id="YP_005310224.1"
                     /db_xref="GI:379718093"
                     /db_xref="GeneID:11882051"
                     /translation="MKLQKNWHRLSCVMLSATIFISSWTVGTVSYATAEPVVTMVSEE
                     PLTSGAILKKYVWQTTRSGKAVKTNANVVEVDLTNPYVKIDVMTGTNNQFTKKQSVLA
                     MAKETKAVAGINGDFFNTKAEGVPMGAQIGNGQLMATPMLNSPGWYTFALDKNNKPIV
                     DAFTFQGNIITKDGASYPLGGINKTYYWYGPNDTHSHIDGLFMYTNAWGQVDRSNDGV
                     TYPTEVLVQNGIIKQVADNGIIQMIAPQDGYILRAAGKAADFVREHMKAGDPIQADYK
                     MLPQDASKNYDVDSFKMMIGGHTLLVDQGQPSIFTLDLTGLGGYRARTALGYSQDEKK
                     AFIITADASGDSKGLSMTELQQFMVKIGVWKGLNLDGGGSTQMAARPLGETTPVLINQ
                     TEGGGQRQVVNGVGVYTLAPKGAVKGLTIQAPLFLFIGENAPLSFRGYDEYYNPVEVG
                     TATAAWSTSSKLGSFKENIFTPTGAGLAKVTATAGTGTAIEDLEIIGRHQLTGLKINA
                     DRAVIANGASVKLPVIAMTSAGESREVPSSLIEWEVLGVKGEVVNGELKVSDLNGQKA
                     AQVIAKYDGYSTMAVIPVGEDKVWYDLDTNAVQTFSDAKPLGVTSSVYIRPDEKNNKY
                     LALQYDFSGGGTEADKWAFATLDTRIVIEGQPGQMKMRVNGDESLNWLRAELLDNSGK
                     IHRVDIARNINWKGWKELTVNLSDYPIDFPIRVQSVYLVNEGQGQDERAEKGQIGIDD
                     ITFTYRGSLPQPSNNSVSLTVGNKAVSVNGKGMTLEQAPVIVEGNTLIPIRFVTDALG
                     GTVRWDDQERKVTVIRGGKMIDLWIGNKDLVVNGERITAEVPPVIMSDLTMVPLRILS
                     ENLGWKVTWDGNTRQITLQ"
     misc_feature    92502..92993
                     /locus_tag="PM3016_88"
                     /note="Predicted periplasmic protein (DUF2233); Region:
                     DUF2233; pfam09992"
                     /db_xref="CDD:255681"
     misc_feature    94113..94391
                     /locus_tag="PM3016_88"
                     /note="Copper amine oxidase N-terminal domain; Region:
                     Cu_amine_oxidN1; pfam07833"
                     /db_xref="CDD:254459"
     gene            94570..95724
                     /locus_tag="PM3016_89"
                     /db_xref="GeneID:11882052"
     CDS             94570..95724
                     /locus_tag="PM3016_89"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_005310225.1"
                     /db_xref="GI:379718094"
                     /db_xref="GeneID:11882052"
                     /translation="MSVDVFDRVIKNAIDVMENSKYQIFEICENVRAEREALNKELQL
                     VIEETAITIDIVDKFEVDYRRSRVRLTEVSRDFKRFNEEDIRAAYEAATQLQAQLAIH
                     REKELHLKMRRDDLQKRLKNLDKQLERAEALVSQFGVVLEYLSGDLHQVTRLLESAKS
                     RQLMGLKIILAQEEERKRIAREIHDGLAQNMANMVLRTEITERMLAKEAYSAVKEELA
                     DLKSGVRAGIEEVRKIIFNLRPMALDDLGLVPTLRKFVQDYEERSKISTKFELIGKEV
                     RLPSGMEVAVYRLVQEAFSNVLKHAEASHITLELTFQQQMIKLTVTDNGVGFNTAGID
                     KKITQGSHYGLMGMRERVELLEGRFDIQSEVGAGTKVSMVIPIKSESKEE"
     misc_feature    94588..95064
                     /locus_tag="PM3016_89"
                     /note="Sensor protein DegS; Region: DegS; pfam05384"
                     /db_xref="CDD:147523"
     misc_feature    <95020..95700
                     /locus_tag="PM3016_89"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    95092..95298
                     /locus_tag="PM3016_89"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    95428..95694
                     /locus_tag="PM3016_89"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(95443..95445,95455..95457,95464..95466,95530..95532,
                     95536..95538,95542..95544,95548..95553,95593..95604,
                     95650..95652,95656..95658,95671..95676,95680..95682)
                     /locus_tag="PM3016_89"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    95455..95457
                     /locus_tag="PM3016_89"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(95542..95544,95548..95550,95593..95595,95599..95601)
                     /locus_tag="PM3016_89"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            95729..96454
                     /locus_tag="PM3016_90"
                     /db_xref="GeneID:11882053"
     CDS             95729..96454
                     /locus_tag="PM3016_90"
                     /codon_start=1
                     /transl_table=11
                     /product="DegU protein"
                     /protein_id="YP_005310226.1"
                     /db_xref="GI:379718095"
                     /db_xref="GeneID:11882053"
                     /translation="MDIMGSAKRPIKLVLADDHQLFREGVKRILNMESDLEVVGECGD
                     GIQVLELCNTLHPDIVLMDINMPVENGVVATEKLKEIFPDIKVIILSIHDDESYVFET
                     LRKGASGYLLKDMEAESLINAIRSVVAGHAYIHPKVTGKLINQLRRMTYLDEQGVTGT
                     SPVAKEAGVKYVHMDNSPLTRREAEVLRLMAEGKSNKNIGEFLYISEKTVKNHVSSIL
                     QKMEVDDRTQAVIIAIKNGWVTL"
     misc_feature    95759..96451
                     /locus_tag="PM3016_90"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    95771..96109
                     /locus_tag="PM3016_90"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(95777..95782,95915..95917,95939..95941,95999..96001,
                     96056..96058,96065..96070)
                     /locus_tag="PM3016_90"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    95915..95917
                     /locus_tag="PM3016_90"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(95924..95929,95933..95941)
                     /locus_tag="PM3016_90"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    96065..96073
                     /locus_tag="PM3016_90"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    96263..96433
                     /locus_tag="PM3016_90"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(96266..96274,96311..96319,96341..96346,96350..96355,
                     96359..96373,96404..96406)
                     /locus_tag="PM3016_90"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(96299..96301,96305..96307,96311..96313,96404..96412,
                     96419..96421,96428..96433)
                     /locus_tag="PM3016_90"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            96546..96944
                     /locus_tag="PM3016_91"
                     /db_xref="GeneID:11882054"
     CDS             96546..96944
                     /locus_tag="PM3016_91"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310227.1"
                     /db_xref="GI:379718096"
                     /db_xref="GeneID:11882054"
                     /translation="MMLGLVWIIGCYAAGIAVIHALHRQWKRRGTRRAAHYVLYAQNA
                     QMQLEWYLRSLYFFSWIKGRPIEVTLVDEGSTDETLQIAARIAQEQALNVVESPYWNM
                     DTWIEGHQEQDVVVIRLNQIKGLESAYKWL"
     misc_feature    96696..>96830
                     /locus_tag="PM3016_91"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     gene            96989..98773
                     /locus_tag="PM3016_92"
                     /db_xref="GeneID:11882055"
     CDS             96989..98773
                     /locus_tag="PM3016_92"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase domain-containing protein"
                     /protein_id="YP_005310228.1"
                     /db_xref="GI:379718097"
                     /db_xref="GeneID:11882055"
                     /translation="MKAWVYAVSTATGITWHVSLDMRADRDHWIRTAGRGFRLFVLEP
                     ELSFGQAQELAGRVKAGGPVRQLLGKIRAAGESLGMRTAEGSSAVWRLWEWEPGGEGG
                     IPASPIPGYEAMAAKIHALMPGRSLLPEEYLSLLAHSGLEEAAQSPYYYLQRGWLEGR
                     LHLEKGVELHREGRGFPFRRPKLRAQCKRCGSQGAQLPQKGTSSSASVVWTACPHCGG
                     PCPYCEACLTMGRVRFCTPLIRSAEQPSTSTWQRKTQGFDTEIYLQPWGLSDVQREAS
                     GSALLFLKGKNSVTRSKGKASSEYKPGRFLMWAVTGAGKTEMIFPMIHYTLTQGGRAA
                     VVTPRRDVVLELQPRLAKAFPGVQLVTLYGGSEQRWDQGDLVLATTHQLMRFYEAFDL
                     VIIDEIDAYPYHNNPMLQHAAEQVCRPDGAYILLSATPPEPLQREVRRGRLPHARVAA
                     RFHRHPLPVPLLLATPPLQRSMQQGSLPLRLKDKLQASLRRGAQLFVFVPKIASVGPL
                     TEILRSSFPGVPVEGTSSKDEQRAEKVTAFRQSQIRILVTTTILERGVTIPKSDVFIL
                     DADSRLFDAAALIQMAGREDHLRIRPGR"
     misc_feature    <97547..97657
                     /locus_tag="PM3016_92"
                     /note="Zinc finger domain of DnaJ and HSP40; Region:
                     DnaJ_zf; cl19048"
                     /db_xref="CDD:267401"
     misc_feature    97901..98278
                     /locus_tag="PM3016_92"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    97922..97936
                     /locus_tag="PM3016_92"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    98174..98185
                     /locus_tag="PM3016_92"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    98429..98740
                     /locus_tag="PM3016_92"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(98486..98497,98552..98557,98633..98641)
                     /locus_tag="PM3016_92"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(98657..98659,98726..98728,98738..98740)
                     /locus_tag="PM3016_92"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            98905..99672
                     /locus_tag="PM3016_93"
                     /db_xref="GeneID:11882056"
     CDS             98905..99672
                     /locus_tag="PM3016_93"
                     /codon_start=1
                     /transl_table=11
                     /product="ComFC protein"
                     /protein_id="YP_005310229.1"
                     /db_xref="GI:379718098"
                     /db_xref="GeneID:11882056"
                     /translation="MWTDKVRRWLAVLLGESESLLSRRDPPCLICGTPGGKQALPVCR
                     LCWAKIPWIADVRCSVCGRPEECQDCLRRERTYYTKNRSVVRYNDHMKEWLALYKYRG
                     KESMREVIGPMLQHAYRLHRMAETAPAVEVLSYVPLSQQRFGERGFNQAEQLARELGQ
                     RTNVPVLPLLLRTQHTGKQSFKSRSDRLRDLRGVFAAEAQGTAWIREACRRGPVRVYL
                     IDDVYTTGSTLNECARTIREAVNVKAPVEVCGISWAR"
     misc_feature    98986..99621
                     /locus_tag="PM3016_93"
                     /note="Predicted amidophosphoribosyltransferases [General
                     function prediction only]; Region: ComFC; COG1040"
                     /db_xref="CDD:223970"
     misc_feature    99337..>99621
                     /locus_tag="PM3016_93"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(99340..99342,99562..99570,99574..99588)
                     /locus_tag="PM3016_93"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            99778..100191
                     /locus_tag="PM3016_94"
                     /db_xref="GeneID:11882057"
     CDS             99778..100191
                     /locus_tag="PM3016_94"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein"
                     /protein_id="YP_005310230.1"
                     /db_xref="GI:379718099"
                     /db_xref="GeneID:11882057"
                     /translation="MSLNVENCNRCGKIYVKNNFGVCPACIKEIELQYEKCLKYLREN
                     KGSSMQELSEATEVPMKQIMKFIRDGRISIKNNPNMTYECDACGNSIREGNLCDSCRN
                     RLMKDTSDLHAQEERKRLYQEQHKATFQSKDKNDR"
     misc_feature    99787..100179
                     /locus_tag="PM3016_94"
                     /note="flagellar operon protein TIGR03826; Region: YvyF"
                     /db_xref="CDD:163538"
     gene            100293..100574
                     /locus_tag="PM3016_95"
                     /db_xref="GeneID:11882058"
     CDS             100293..100574
                     /locus_tag="PM3016_95"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma-28 factor FlgM family protein"
                     /protein_id="YP_005310231.1"
                     /db_xref="GI:379718100"
                     /db_xref="GeneID:11882058"
                     /translation="MKINGSNQMNAISRYKKTAEPQQAAAPAKAKPKDQVEISSQAKE
                     LLESQSVKSAGAAADARAEKIQSLKQAVQSGTYSVDAGKLAERLLPYLT"
     misc_feature    100293..100559
                     /locus_tag="PM3016_95"
                     /note="flagellar biosynthesis anti-sigma factor FlgM;
                     Region: FlgM_jcvi; TIGR03824"
                     /db_xref="CDD:213867"
     gene            100597..101097
                     /locus_tag="PM3016_96"
                     /db_xref="GeneID:11882059"
     CDS             100597..101097
                     /locus_tag="PM3016_96"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310232.1"
                     /db_xref="GI:379718101"
                     /db_xref="GeneID:11882059"
                     /translation="MSFEALLDTMTELNEIHNSLLELAEQKRHVLIHNQVEQLMQIVT
                     KENKMLKRIGELEQQRVEVTGAFLMEKGYKPNPRVTVSDLTKILFNIEDKKLLLDKQK
                     QLAAAIRKLRELNRVNQQMIEHSLAYIDYSLDLIVGPPEDEFVYKNPQAGASGPKRQG
                     MFDSRA"
     misc_feature    100609..101034
                     /locus_tag="PM3016_96"
                     /note="FlgN protein; Region: FlgN; pfam05130"
                     /db_xref="CDD:253028"
     gene            101185..102792
                     /locus_tag="PM3016_97"
                     /db_xref="GeneID:11882060"
     CDS             101185..102792
                     /locus_tag="PM3016_97"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgK"
                     /protein_id="YP_005310233.1"
                     /db_xref="GI:379718102"
                     /db_xref="GeneID:11882060"
                     /translation="MRSTFGGIEISKRSLFTQQAALTTTGHNIANANTKGYSRQVVNM
                     VASIPIEYPGLMRSNIPGQLGQGVEFDQINRIREKFLDNQFHNENKSLGDWSIRKDTL
                     EKLEAIMNEPSDTGIRQTIEGFWNAWQELSKSPENTTARVLVKERALAMTDAFNQTSR
                     QLSELATDLTESIGIKAQEANTALNQIAKLNEEIYRIEGLGNNANDLRDQRDLLMDDL
                     SKIVNITFTEEANGYNVRMGNVQLVAGRTVGTQFTTASMEAAAAAGDLSGGEVYGMIQ
                     SRDNYVGNYQFQLDNMLKTLVQGDMQIKLPSGAVIPEGTTLTIMKPDGTTEQKQFTGT
                     MADRTIGADTNVVVKGFNGLHALGYSGNDPISSGLEFFSLKTGYSEFSAASVTVNSTI
                     QSDVSNISSSFRTYMGADGNEKVVKGNNDMALLLANVRYERVDFDPTATGRPMLTDGT
                     FDEFFRSIIGQLGVQSQEATRQATNQQTLVDQVDSNRQAVSGVSLDEEMANMIKFQHA
                     YNAAARALTTFDEMLDKVINGMGTVGR"
     misc_feature    101185..102789
                     /locus_tag="PM3016_97"
                     /note="flagellar hook-associated protein FlgK; Validated;
                     Region: flgK; PRK07739"
                     /db_xref="CDD:236084"
     misc_feature    <102655..102768
                     /locus_tag="PM3016_97"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            102835..103731
                     /locus_tag="PM3016_98"
                     /db_xref="GeneID:11882061"
     CDS             102835..103731
                     /locus_tag="PM3016_98"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein 3"
                     /protein_id="YP_005310234.1"
                     /db_xref="GI:379718103"
                     /db_xref="GeneID:11882061"
                     /translation="MTMRVTQGMLNNQLLRNINSNLNRINTHQNELSTGRRINKPSDD
                     PVGMTFSLRYRSELSANDQYESNVTTAISWLEYTDTTLDQANTVIQRARELAVQGANG
                     TNPQQALDAIKTEIDQLYQQMVTIGNSEFNGKHVFNGQITDQAPYTAANAATTSVDTG
                     AIQFDIGAGVRVKANITGDEVFGQASSNTNVFKVLQDLSTALGAGNQNGINDALGRLD
                     QANDLFLQGRADVGARMNRIELAQSRLQDINVNLQTLQSRTEDADISEVITNLKTDEN
                     VYQASLSVGSKIISSSLVDFLR"
     misc_feature    102841..103728
                     /locus_tag="PM3016_98"
                     /note="flagellar hook-associated protein FlgL; Validated;
                     Region: flgL; PRK07701"
                     /db_xref="CDD:181087"
     misc_feature    102859..103260
                     /locus_tag="PM3016_98"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    103474..103725
                     /locus_tag="PM3016_98"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            103743..104324
                     /locus_tag="PM3016_99"
                     /db_xref="GeneID:11882062"
     CDS             103743..104324
                     /locus_tag="PM3016_99"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310235.1"
                     /db_xref="GI:379718104"
                     /db_xref="GeneID:11882062"
                     /translation="MSLSISPQIGIHQQYARIGIDADLGQFQISQSPASLEITTTPAK
                     HDYHTEGGKLTIDNSAWRDALGNGPHLEVMNRIYSKSQSIALQGIAKIVEDGNRMAAI
                     HTKENAIAALAADSTQDIDFREYMYMGDAAYDNIDLNYEPARVIRDIQPAQVHINVTR
                     NAPEIQYNRGKLDIYMQQHASVEFTPPQIDYKI"
     gene            104402..104845
                     /locus_tag="PM3016_100"
                     /db_xref="GeneID:11882063"
     CDS             104402..104845
                     /locus_tag="PM3016_100"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar assembly protein FliW"
                     /protein_id="YP_005310236.1"
                     /db_xref="GI:379718105"
                     /db_xref="GeneID:11882063"
                     /translation="MRINTLALGEIEYTEEEVLTFPNGIPGFEEYTRFLIIGRGEAFS
                     YLQSLEDEGISFVILNPFDIYRAYEFELSQEDQDELEIRSEEGIEIWSIVTLGKQPEQ
                     YTVNLMGPLVVNTVSCLGKQVVLHHSPYGTKHSLVELIANSKEGE"
     misc_feature    104402..104839
                     /locus_tag="PM3016_100"
                     /note="flagellar assembly protein FliW; Provisional;
                     Region: PRK13285"
                     /db_xref="CDD:237334"
     gene            104851..105087
                     /locus_tag="PM3016_101"
                     /db_xref="GeneID:11882064"
     CDS             104851..105087
                     /locus_tag="PM3016_101"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator CsrA"
                     /protein_id="YP_005310237.1"
                     /db_xref="GI:379718106"
                     /db_xref="GeneID:11882064"
                     /translation="MLVLSRKKGESIMIGDGIEVIVLGVEGETVKIGLKAPRQQSILR
                     KEIYLALKESNQEASTAQDGSGNQIDQLKKLLGK"
     misc_feature    104851..105039
                     /locus_tag="PM3016_101"
                     /note="Global regulator protein family; Region: CsrA;
                     cl00670"
                     /db_xref="CDD:260562"
     gene            105253..106137
                     /locus_tag="PM3016_102"
                     /db_xref="GeneID:11882065"
     CDS             105253..106137
                     /locus_tag="PM3016_102"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310238.1"
                     /db_xref="GI:379718107"
                     /db_xref="GeneID:11882065"
                     /translation="MRINHNISALNTHRQLGTNTANAAKNIEKLSSGLRINRAGDDAA
                     GLAISEKMRGQIRGLDQASRNAQDGISLIQTGEGALQEVHSILQRQRELAVQSANDTN
                     VTADRTALEAEFDQLSSEISRIKDNTTFNTQKLLDGSAAAALKIHVGADAGQTIDIDL
                     DTAGVDLTAIHTAASGATIATQTDANTAITTINTQIESVSSGRSYLGALQNRLEHTIN
                     NLNNASENLTASESRIRDVDMAKEMMEQTKNNILSQAAQAMLAQANQQPQAYCSSSVN
                     IIYPGGWRNAIPLSFFVS"
     misc_feature    105253..106056
                     /locus_tag="PM3016_102"
                     /note="flagellin; Provisional; Region: PRK12804"
                     /db_xref="CDD:183759"
     misc_feature    105259..105669
                     /locus_tag="PM3016_102"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    105817..>106008
                     /locus_tag="PM3016_102"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            106249..107478
                     /locus_tag="PM3016_103"
                     /db_xref="GeneID:11882066"
     CDS             106249..107478
                     /locus_tag="PM3016_103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310239.1"
                     /db_xref="GI:379718108"
                     /db_xref="GeneID:11882066"
                     /translation="MTTLVDTLIPEYVKRFTCIGGACEDTCCSGWTVNIDQHTLKKYK
                     KVKHTEFKTRLRENVVKNDKNPTENFAASMKLKQSRCSFLNEENLCDIQLNLGESFLC
                     TTCSVYPRRTNKVNGKLEQALSVSCPEAARLVMLNEGGISFEQGQDQKDAFRWIATNI
                     ETRGGGVSDWRSFFEEYRYVTIAILQNRAYTLEERLLIIGLMFGELQESVDTGKPESI
                     PDVLGNYLKCSEDGTFQGAFNEVAKRLDIQVRLCRELVVLGLKHTPGSTRYLECSRAM
                     MAGLGMEDGAEDHQVQESYEKAYGTYYLPFIQEHGYMLENYLVNYVFKNCMPLDSTSL
                     FESYARMIMHYSLIKIHMVGIAGHEQGLTSDSVIKLIQSISKTFEHSIEYFEKIMTLV
                     KENGFMSMPYMSILIKN"
     gene            107747..108574
                     /locus_tag="PM3016_104"
                     /db_xref="GeneID:11882067"
     CDS             107747..108574
                     /locus_tag="PM3016_104"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310240.1"
                     /db_xref="GI:379718109"
                     /db_xref="GeneID:11882067"
                     /translation="MRINHNISALNTHRQLGTNSANAAKNIEKLSSGLRINRAGDDAA
                     GLAISEKMRGQIRGLDQASRNAQDGISLIQTGEGALQEVHSILQRQRELAVQSANDTN
                     VTADRTALEAEFDQLSNEIGRIKDNTTFNTQKLLDGSATAALKIHVGADASQTIDIDL
                     DTAGVDLTAIHTAASGATIATQTDANTAITTINTQIESVSSGRSYLGALQNRLEHTIN
                     NLNNASENLTASESRIRDVDMAKEMMEQTKNNILSQAAQAMLAQANQQPQGVLQLLR"
     misc_feature    107747..108571
                     /locus_tag="PM3016_104"
                     /note="flagellin; Provisional; Region: PRK12804"
                     /db_xref="CDD:183759"
     misc_feature    107753..108169
                     /locus_tag="PM3016_104"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    108311..>108502
                     /locus_tag="PM3016_104"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            108847..109242
                     /locus_tag="PM3016_105"
                     /db_xref="GeneID:11882068"
     CDS             108847..109242
                     /locus_tag="PM3016_105"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlaG protein"
                     /protein_id="YP_005310241.1"
                     /db_xref="GI:379718110"
                     /db_xref="GeneID:11882068"
                     /translation="MDTPITGSGGVDRIPAASPALKSTNKEAEAAASSAVDSIHSVKE
                     MKLAEYRGEEITISDEQMVKALERAIKAVEGKNTSLNFSIHEKTKQIMVKVIDKESGQ
                     IIREVPPEKNLDFLAKLWEMAGILVDEKR"
     misc_feature    <108988..109236
                     /locus_tag="PM3016_105"
                     /note="FlaG protein; Region: FlaG; pfam03646"
                     /db_xref="CDD:252082"
     gene            109264..110760
                     /locus_tag="PM3016_106"
                     /db_xref="GeneID:11882069"
     CDS             109264..110760
                     /locus_tag="PM3016_106"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar capping protein"
                     /protein_id="YP_005310242.1"
                     /db_xref="GI:379718111"
                     /db_xref="GeneID:11882069"
                     /translation="MVNRITGITSGLDTDTLISQLMKANRIPVDKMAQQKQTVEWQRD
                     AYKEINAKILDFRNNKLFNFKREGTFAAKTLTTVGDTSAVGAKATSSSVPGTLKVEVV
                     SLAQPSVSTSTAAITADPAFKTNVPLKDTEFVAGFTPVAPATTPPTYQEFDITVNSKV
                     IRINPNTDSLDSMMSKISSQAGVTAFYDSTNRVVSMSGGGQAISVAGDFLTNTLKLGA
                     GSAPVDAQLKINGVATTRASNSFSVNGVDITLNGVGTTTIDVKSDTDKVMESIKTFIT
                     DYNSMLKTIQEKLGEDKFRDYTPLTSEQKEAMKDKDIELWEGKAKSGLLRNDSILSAL
                     ANTMRSSMSTPVETGNPNYKTLSAIGIDSGSYLEKGQLYIKSETKLREAIEKDPQAVI
                     NLFTQDGNGDTDRSDVGVGERLYQDLMGSLEKIAKKAGTSAFSDMSVFKSDSDLGKRL
                     TDLNTRIAKGNERLADIENRYYKQFAAMEAAMSKYNSQSSYLANAFSS"
     misc_feature    109264..110751
                     /locus_tag="PM3016_106"
                     /note="flagellar capping protein; Validated; Region: fliD;
                     PRK07737"
                     /db_xref="CDD:236082"
     misc_feature    109291..109590
                     /locus_tag="PM3016_106"
                     /note="Flagellar hook-associated protein 2 N-terminus;
                     Region: FliD_N; pfam02465"
                     /db_xref="CDD:251313"
     misc_feature    109933..110724
                     /locus_tag="PM3016_106"
                     /note="Flagellar hook-associated protein 2 C-terminus;
                     Region: FliD_C; pfam07195"
                     /db_xref="CDD:254097"
     gene            110798..111196
                     /locus_tag="PM3016_107"
                     /db_xref="GeneID:11882070"
     CDS             110798..111196
                     /locus_tag="PM3016_107"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FliS"
                     /protein_id="YP_005310243.1"
                     /db_xref="GI:379718112"
                     /db_xref="GeneID:11882070"
                     /translation="MLQAQQNKYLSTSVQTASPAHLLMMLYDGAIRFCRAGIEAMKQN
                     RYEEVNRNLVKAQDIVRELMVTLDPKQPISADLTRLYDYFIFRLVEANMKKQSEPAEE
                     VLEYLVSLKETWIQASRAAAGGQAVGATHA"
     misc_feature    110822..111154
                     /locus_tag="PM3016_107"
                     /note="Flagellar protein FliS; Region: FliS; cl00654"
                     /db_xref="CDD:242007"
     gene            111189..111527
                     /locus_tag="PM3016_108"
                     /db_xref="GeneID:11882071"
     CDS             111189..111527
                     /locus_tag="PM3016_108"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310244.1"
                     /db_xref="GI:379718113"
                     /db_xref="GeneID:11882071"
                     /translation="MREHIEALETLTAGMASRLPEAEYEELEQFVREREEIILSIRRG
                     LQTNPEAASLYAERVQQVLRQDEAIMECMEALRSEAAGQLQKVDTARTQRGAYDKAYT
                     PDSLFFDKRK"
     gene            111813..112010
                     /locus_tag="PM3016_109"
                     /db_xref="GeneID:11882072"
     CDS             111813..112010
                     /locus_tag="PM3016_109"
                     /codon_start=1
                     /transl_table=11
                     /product="protein CspC"
                     /protein_id="YP_005310245.1"
                     /db_xref="GI:379718114"
                     /db_xref="GeneID:11882072"
                     /translation="MQGKVKWFNAEKGYGFIEREDGGDVFVHFSAIQTEGFKTLEEGQ
                     SVEFDIVEGARGPQAANVIKL"
     misc_feature    111813..111998
                     /locus_tag="PM3016_109"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box...; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:239905"
     misc_feature    order(111831..111833,111858..111860,111888..111890,
                     111975..111977)
                     /locus_tag="PM3016_109"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    order(111849..111869,111885..111896)
                     /locus_tag="PM3016_109"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            112226..112783
                     /locus_tag="PM3016_110"
                     /db_xref="GeneID:11882073"
     CDS             112226..112783
                     /locus_tag="PM3016_110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310246.1"
                     /db_xref="GI:379718115"
                     /db_xref="GeneID:11882073"
                     /translation="MKFNIRGVNIEVTDALRDHVEKKLSRLEKYFEAPPTSEVSVSLS
                     VLKGLQAVEVTIPLPNLLLRAEERQADMYASVDLVVDKLERQIRKAKTKANRKIRQEG
                     GLKDLFRASEPDDSYVAVHEEEDDFELVRTKRFTLKPMDIDEAILQMNMVGHNFFVFA
                     NSDTSEVNVVYKRNDGKYGLIEPAK"
     misc_feature    112229..112504
                     /locus_tag="PM3016_110"
                     /note="RaiA ('ribosome-associated inhibitor A', also known
                     as Protein Y (PY), YfiA, and SpotY,  is a stress-response
                     protein that binds the ribosomal subunit interface and
                     arrests translation by interfering with aminoacyl-tRNA
                     binding to the ribosomal...; Region: RaiA; cd00552"
                     /db_xref="CDD:238308"
     misc_feature    order(112235..112237,112241..112243,112247..112249,
                     112301..112303,112310..112312,112334..112339,
                     112349..112351,112388..112390,112397..112408,
                     112415..112417,112421..112423,112430..112432,
                     112436..112438,112445..112447,112487..112492,
                     112502..112504)
                     /locus_tag="PM3016_110"
                     /note="30S subunit binding site; other site"
                     /db_xref="CDD:238308"
     gene            113132..115843
                     /locus_tag="PM3016_111"
                     /db_xref="GeneID:11882074"
     CDS             113132..115843
                     /locus_tag="PM3016_111"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SecA"
                     /protein_id="YP_005310247.1"
                     /db_xref="GI:379718116"
                     /db_xref="GeneID:11882074"
                     /translation="MLGLVKKIFGDPNDRELKRLWKAVEYINSLEPQFEGLSDEELRG
                     KTAEFRERLEKGETLDDLLPEAFAVVREAGKRALGKRHYDVQLIGGMVLHEGKIAEMR
                     TGEGKTLVGTLPVYLNALAGKGVHVVTVNDYLAQRDSAEMGQLHNFLGLTVGVNLSNM
                     SHEAKQAAYACDITYGTNNEFGFDYLRDNMVVYKEQMVQRPLSYCVIDEVDSILVDEA
                     RTPLIISGQAAKSTEMYLIADQVVSRLKEEEDYIIDIKVRSVTLTEAGVAKVERSFGI
                     ENLFDHEHVTINHHIQQALKAHAIMKRDVDYVVSEGEIMIVDEFTGRLMTGRRYSEGL
                     HQAIEAKEHLQVQNESMTLATITLQNYFRMYRKLSGMTGTAKTEEEEFKKIYGLEVIT
                     IPTNKPTIRQDIPDVVYKSVQSKFRAVVNEIAERHKNKQPVLVGTVSIENSEVLSEML
                     KKKGIPHKVLNAKYHAEEAEIVSRAGQLGAVTIATNMAGRGTDIMLGEGVAELGGLHI
                     IGTERHESRRIDNQLRGRAGRQGDPGSSQFYLSLEDELMRRFGAENIMGMMDRLGFEE
                     DQPIESKLISKAIESAQKRVEGNNFDVRKVVLQYDDVMNQQREIIYKQRREVIESENI
                     REIVMGMITPVIDRIVDAHCAEDLPEEWDLQAIVDYCNGTFLHEGQLKAEELEGKEKE
                     DIAEYLKGVLTRLYEEREAAIGAEFMREFEKVVLLRAVDSKWMDHIDAMDQLRQGIHL
                     RAYGGTDPLREYQFEGYEMFQEMIQNIQEEVATYIMKAHVETNLVREAVVDENEMATN
                     GEPAVNRPAQASEVIGRNGSVPLRQRQEVQGVPRHSEGITNVKRPGERPGRKKREVGA
                     RPRSPFSLNRHKVIIKLYNEVLTMLEADVKRDMQETAKRLAELRGSL"
     misc_feature    113132..115474
                     /locus_tag="PM3016_111"
                     /note="preprotein translocase subunit SecA; Reviewed;
                     Region: PRK12904"
                     /db_xref="CDD:237259"
     misc_feature    113408..113782
                     /locus_tag="PM3016_111"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cl17251"
                     /db_xref="CDD:266587"
     misc_feature    113810..114148
                     /locus_tag="PM3016_111"
                     /note="SecA preprotein cross-linking domain; Region:
                     SecA_PP_bind; smart00958"
                     /db_xref="CDD:214938"
     misc_feature    114350..114748
                     /locus_tag="PM3016_111"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(114443..114454,114512..114517,114584..114592)
                     /locus_tag="PM3016_111"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(114608..114610,114695..114697,114707..114709,
                     114716..114718)
                     /locus_tag="PM3016_111"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    114836..115471
                     /locus_tag="PM3016_111"
                     /note="SecA Wing and Scaffold domain; Region: SecA_SW;
                     pfam07516"
                     /db_xref="CDD:254253"
     gene            115887..116888
                     /locus_tag="PM3016_112"
                     /db_xref="GeneID:11882075"
     CDS             115887..116888
                     /locus_tag="PM3016_112"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PrfB"
                     /protein_id="YP_005310248.1"
                     /db_xref="GI:379718117"
                     /db_xref="GeneID:11882075"
                     /translation="MSAPDFWDDNEKAQKLIAEMNAIKGSIDQLQALTAEYEDLELMM
                     ELVQEENDESLASELTSGITALVKKLEGFELQLLLSQPYDKLNAILELHPGAGGTESQ
                     DWAEMLLRMYRRWAEKRGFKVEVLDYLPGDEAGVKSVTLLIQGYNAYGYLKAEKGVHR
                     LVRISPFDSSGRRHTSFVSCDIMPEIDDDVEIEIRTEDLKVDTYRASGAGGQHINTTD
                     SAVRITHMPTGVVVSCQTERSQIKNRDRAMKMLRSKLYEKKIEEQQKQLAEIRGEVAD
                     IAWGSQIRSYVFHPYSMVKDHRTGEETGNVGAVMDGDLDPFIDAYLRGRINKKDREE"
     misc_feature    115887..116864
                     /locus_tag="PM3016_112"
                     /note="peptide chain release factor 2; Provisional;
                     Region: PRK06746"
                     /db_xref="CDD:75726"
     misc_feature    115989..116351
                     /locus_tag="PM3016_112"
                     /note="This domain is found in peptide chain release
                     factors; Region: PCRF; smart00937"
                     /db_xref="CDD:214923"
     misc_feature    116439..116780
                     /locus_tag="PM3016_112"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            117063..118196
                     /locus_tag="PM3016_113"
                     /db_xref="GeneID:11882076"
     CDS             117063..118196
                     /locus_tag="PM3016_113"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310249.1"
                     /db_xref="GI:379718118"
                     /db_xref="GeneID:11882076"
                     /translation="MADRRKKTVRKAAPRKVGGRLSLEAAQDKRGDGASPAKVVHEAG
                     LRERTDAHAPDARSGESPPASQGLGPRGGVRPAEGSRMNKRSRKGGGGRPGWMQHIRE
                     YLLLLLGSLVVAVSFNTFLGPNQVASGGVTGISVIVEKLFGIEPAFTQWALNIPLFLL
                     GTLLLGRQFGAKTLVGSIVLPLFVLLTKDLPSMTDNVLLASIYGGIGIGAGLGLVFRG
                     RASTGGMDLAAQMLHRYTGISLGLCVALLDGLIILTAGVFLSPEKAMYALIGLFVTTK
                     TINIVQLGLSYSKVAFIISEAEEEIREGILYELDRGLTKLQATGGYTGESKRVLMVVV
                     SQTEVSRLKELVRRIDPGAFVILSDTNEVLGEGFKLTGSSLSP"
     misc_feature    117351..118172
                     /locus_tag="PM3016_113"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1284"
                     /db_xref="CDD:224203"
     misc_feature    117387..117614
                     /locus_tag="PM3016_113"
                     /note="Uncharacterized BCR, YitT family COG1284; Region:
                     DUF161; pfam02588"
                     /db_xref="CDD:251396"
     misc_feature    <117705..117896
                     /locus_tag="PM3016_113"
                     /note="Uncharacterized BCR, YitT family COG1284; Region:
                     DUF161; pfam02588"
                     /db_xref="CDD:251396"
     misc_feature    117993..118157
                     /locus_tag="PM3016_113"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2179); Region: DUF2179; pfam10035"
                     /db_xref="CDD:255714"
     gene            complement(118212..119021)
                     /locus_tag="PM3016_114"
                     /db_xref="GeneID:11882077"
     CDS             complement(118212..119021)
                     /locus_tag="PM3016_114"
                     /codon_start=1
                     /transl_table=11
                     /product="protein FdhD"
                     /protein_id="YP_005310250.1"
                     /db_xref="GI:379718119"
                     /db_xref="GeneID:11882077"
                     /translation="MHDEAVTPRTIWRYDGGALRPLRDTIVRETPLTVRVNGEEFATV
                     VCSPGDLEDFVVGFLASEGVLRLHSEITSLQLDPWKGFAYVELQNPLPARQRDQSKRF
                     IGSCCGKSRQFYFQSDARTARTVLSRHTVTPDQCLALMALLQEGSDVFRSTGGVHNAA
                     LCSTDALLVRRSDIGRHNALDKLFGHSLRQGLPLHDKLLAFSGRVSSEVLLKAAKMGI
                     GLLLSKSAPTDLALNLADDLGITVIGFIRGSSFNVYSHPERVQPTAGSARA"
     misc_feature    complement(118245..119021)
                     /locus_tag="PM3016_114"
                     /note="formate dehydrogenase accessory protein; Reviewed;
                     Region: PRK00724"
                     /db_xref="CDD:234823"
     gene            complement(119028..121382)
                     /locus_tag="PM3016_115"
                     /db_xref="GeneID:11882078"
     CDS             complement(119028..121382)
                     /locus_tag="PM3016_115"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit alpha"
                     /protein_id="YP_005310251.1"
                     /db_xref="GI:379718120"
                     /db_xref="GeneID:11882078"
                     /translation="MGQTKHSGQIPLPSLPDPSLWASRVPFGLNRIKPRHIRDTFKAV
                     WDNRDQLPYAYRILTQGVCDGCALGVAGLQDQTLTGPHLCTTRLNVLRLNTMPAIPRD
                     VLHADIDELRRMDSTALRGLGRLPYPLIRRKGQRRFTRLSWDEALDTIAAKISAVNPK
                     QLAFYLTARGITNESYYAAAKVARFLGTNHIDNASRICHSPSKTALKRSVGIGASSCS
                     YKDWIGTDVLVFWGSVAANNQPVSTKYMYAAKRRGTRIIVINPYHEPSMDQYWIPSVP
                     ESALFGTKLTDDFYQVNIGGDIAFMNGVMKVWFEMERAQPGSALDHAFLAAHTNGLEE
                     LRAHVEAQPWELLEQSSGLSRERMKEFAVLLAEAKSGVFVWSMGLTQHRFGTDNISQV
                     ANLALLRGFLGREHCGLMPIRGHSGVQGSGEMGADPFSLPGGEIGDAAARRRIEALWG
                     FPLPDWQGDIVGVSLENAMLPEDHERRLRVFYTSGGNFLETMPDPEFIRQCLERVELR
                     VHQDIILNTSTLVDAAETVIVLPAMTRYEQPGGGTSTSTERMVYFSPEIEGPRMPEAR
                     AEWQIYAELAARVKPQEAKRLGLQSAADIRREIAEAAPNYDGIQHLKSRGDVFQWGGA
                     WLCEGGICPTPDGRGRLLPIELPELRKPEGHFFVTTRRGKQFNSMIYSETDPFNGADR
                     YHVLMHPEDGRKLGLREDDAIVVYNRYGAMHGRAKWEPVKPGNIEVHWPEGNVLLPTG
                     VYEPHAGIPEYNTSVIVEKAETYHAMKDTKYVERRIEELELESE"
     misc_feature    complement(119100..121334)
                     /locus_tag="PM3016_115"
                     /note="oxidoreductase alpha (molybdopterin) subunit;
                     Region: Fdhalpha-like; TIGR01701"
                     /db_xref="CDD:233538"
     misc_feature    complement(119460..121205)
                     /locus_tag="PM3016_115"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a  large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:263922"
     misc_feature    complement(order(119769..119771,119784..119789,
                     119835..119837,119844..119852,119922..119930,
                     120255..120257,120492..120494,120600..120608,
                     120669..120674,120681..120683,120687..120692,
                     120786..120794,120798..120800))
                     /locus_tag="PM3016_115"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:238218"
     misc_feature    complement(119112..119420)
                     /locus_tag="PM3016_115"
                     /note="Molybdopterin-Binding, C-terminal (MopB_CT) domain
                     of the MopB superfamily of proteins, a  large, diverse,
                     heterogeneous superfamily of enzymes that, in general,
                     bind molybdopterin as a cofactor. The MopB domain is found
                     in a wide variety of molybdenum-...; Region: MopB_CT;
                     cl09929"
                     /db_xref="CDD:263923"
     misc_feature    complement(order(119127..119132,119181..119183,
                     119193..119195,119379..119390,119394..119399))
                     /locus_tag="PM3016_115"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239176"
     gene            complement(121642..121998)
                     /locus_tag="PM3016_116"
                     /db_xref="GeneID:11882079"
     CDS             complement(121642..121998)
                     /locus_tag="PM3016_116"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310252.1"
                     /db_xref="GI:379718121"
                     /db_xref="GeneID:11882079"
                     /translation="MTKLEAEFSNLVKAFRKKHMGKGPREIRTTFCRNWAICEMEGHL
                     SPVEKFIATATDGKQALRTARTEMVKEMYRTHRPVEMEELLGARFVDLFVDIDLDQDI
                     GMSIFVFDRDIPHKTG"
     misc_feature    complement(121651..121998)
                     /locus_tag="PM3016_116"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5609"
                     /db_xref="CDD:227896"
     gene            122426..123472
                     /locus_tag="PM3016_117"
                     /db_xref="GeneID:11882080"
     CDS             122426..123472
                     /locus_tag="PM3016_117"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ArgC"
                     /protein_id="YP_005310253.1"
                     /db_xref="GI:379718122"
                     /db_xref="GeneID:11882080"
                     /translation="MSQVRAAIVGATGYGGAETIRLLLAHPHVAITSVVSSSNAGASI
                     AEGFPHLNGILTDKLDAVDVDLLKEKADVVFLATPHGISSELSPKLLDAGLKVIDISG
                     DFRLKNGEDYEQWYKHKPADPAYIDKAVYGLSEVFGDDVKGTDFVSNPGCYPTATALG
                     LAPLAAHRWIDPKSIIVDAKSGVSGAGRGLSLTVHYSEMNENFLAYKVNKHQHTPEIE
                     QTISRLAGEEAVITFTTHLVPMTRGILSTIYVNLKEARSEDEIFALFRSYYEGRRFVR
                     ILEKGKFPATKQVLGSNYCDIGLSLDSRTGRLTVISVIDNVVKGAAGQAIQNLNLMMG
                     WDEGTGLAFSPVYP"
     misc_feature    122429..123469
                     /locus_tag="PM3016_117"
                     /note="N-acetyl-gamma-glutamyl-phosphate reductase;
                     Validated; Region: argC; PRK00436"
                     /db_xref="CDD:234761"
     misc_feature    122438..122854
                     /locus_tag="PM3016_117"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; pfam01118"
                     /db_xref="CDD:250373"
     misc_feature    122906..123382
                     /locus_tag="PM3016_117"
                     /note="Semialdehyde dehydrogenase, dimerization domain;
                     Region: Semialdhyde_dhC; pfam02774"
                     /db_xref="CDD:251521"
     gene            123513..124742
                     /locus_tag="PM3016_118"
                     /db_xref="GeneID:11882081"
     CDS             123513..124742
                     /locus_tag="PM3016_118"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ArgJ"
                     /protein_id="YP_005310254.1"
                     /db_xref="GI:379718123"
                     /db_xref="GeneID:11882081"
                     /translation="MTVGKAAFVVVPEGSVTTPAGFRAGGLHCGLKKTERHDLGVIVC
                     EVPAQAAGVYTLNQFQAAPLGVTKESIAEGGTLQVMLVNSGNANACTGQQGVDDARAM
                     RAAGAKAFGVAEHLVGVTSTGVIGELLPMGKVLPGIERLPAGVSADGGDDFCQAILTT
                     DLVKKEICVSLTVGGTTVHIAGAAKGSGMIHPNMATMLGFITTDANVASADLQKLLNE
                     VTDSTFNMITVDGDTSTNDMVVVMASGLAGGEALTPQHADWEAFKAAFAFVGEHLAKA
                     IARDGEGATKLVEVTITGADSKEAARAIAKTVIGSSLVKTAVYGADANWGRIIAAVGR
                     AGYKVETEKVDVRLGDITVLEQSRPVKFDEERAAEYLKGDFVLIHVDLHMGDVSATAW
                     GCDLTYDYVRINAAYRT"
     misc_feature    123567..124739
                     /locus_tag="PM3016_118"
                     /note="Ornithine acetyltransferase (OAT) family; also
                     referred to as ArgJ. OAT catalyzes the first and fifth
                     steps in arginine biosynthesis, coupling acetylation of
                     glutamate with deacetylation of N-acetylornithine, which
                     allows recycling of the acetyl group in...; Region: OAT;
                     cd02152"
                     /db_xref="CDD:239065"
     misc_feature    order(123678..123692,123780..123782,123885..123890,
                     124077..124079,124089..124091,124200..124211,
                     124443..124451,124458..124463,124467..124472,
                     124476..124478,124482..124493,124497..124502,
                     124509..124520,124572..124574,124698..124706)
                     /locus_tag="PM3016_118"
                     /note="heterotetramer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239065"
     misc_feature    order(123876..123881,123987..123992,124065..124067,
                     124074..124076,124098..124100,124722..124724,
                     124734..124739)
                     /locus_tag="PM3016_118"
                     /note="active site pocket [active]"
                     /db_xref="CDD:239065"
     misc_feature    124095..124100
                     /locus_tag="PM3016_118"
                     /note="cleavage site"
                     /db_xref="CDD:239065"
     gene            124849..125640
                     /locus_tag="PM3016_119"
                     /db_xref="GeneID:11882082"
     CDS             124849..125640
                     /locus_tag="PM3016_119"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="YP_005310255.1"
                     /db_xref="GI:379718124"
                     /db_xref="GeneID:11882082"
                     /translation="MKDCFVMKCGGSTLAALPDAFFEDLRILQEQGLIPVIVHGGGPA
                     ISDTLGKLGIETEFVNGLRRTDERVLDVVEMVLAGQINKEIVRKIQCSGAKAIGLSGV
                     DGHLIQAEPVKNAHEVGLVGDVTNVNGELVQGIVAMGYMPVIAPVGIGADGGQRYNIN
                     ADTAAGAVASHIGVERMIVVTDVPGILKTVDGEKRVLPSVTVREIDEMIESGEIYGGM
                     IPKVRAAVQCIQGKVREVVIVNGSEPAVLSRVLREGGIGTRIVRN"
     misc_feature    124861..125628
                     /locus_tag="PM3016_119"
                     /note="AAK_NAGK-like: N-Acetyl-L-glutamate kinase
                     (NAGK)-like . Included in this CD are the Escherichia coli
                     and Pseudomonas aeruginosa type NAGKs which catalyze the
                     phosphorylation of N-acetyl-L-glutamate (NAG) by ATP in
                     the second step of arginine...; Region: AAK_NAGK-like;
                     cd04238"
                     /db_xref="CDD:239771"
     misc_feature    order(124870..124872,124876..124881,124969..124974,
                     125389..125391,125407..125409,125485..125487,
                     125491..125493,125509..125511)
                     /locus_tag="PM3016_119"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239771"
     misc_feature    order(124969..124974,125035..125037,125320..125325,
                     125329..125331)
                     /locus_tag="PM3016_119"
                     /note="N-acetyl-L-glutamate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239771"
     gene            125682..126875
                     /locus_tag="PM3016_120"
                     /db_xref="GeneID:11882083"
     CDS             125682..126875
                     /locus_tag="PM3016_120"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine and succinylornithine
                     aminotransferase"
                     /protein_id="YP_005310256.1"
                     /db_xref="GI:379718125"
                     /db_xref="GeneID:11882083"
                     /translation="MGEAQSALFPNYARYPFAFVKGEGSRLWDENGKEYLDLMCGIAV
                     TNLGHAPKRVGDRLKEQIDTLWHTSNLYRIPNQEKLAGLLVQHSCADAVFFSNSGAEA
                     NEAAIKLARRYFQKVLGQPERCEIITFHMSFHGRTLATLTATGQDKVKEGFAPLPQGF
                     VYAPFNDAEALEKLVSSRTCAIMLEMVQGEGGVNAADPSFVKRIVELCEEHGLLLIVD
                     EIQTGMGRTGKLFAYEHYGIEPDIFTLAKGLGSGMPIGAMLGKEKLREAFSAGSHGST
                     FGGNYLATAAGLATLEVMLEEKLPERAAELGAYAVGELKKQLAGNPLVTEVRGLGLLL
                     GIGLTVPAGEIIGSLLDQGVLVISAGPNVIRLAPSLLISKEDLDRGLAAITAELAKKA
                     AAAAV"
     misc_feature    125712..126833
                     /locus_tag="PM3016_120"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    125715..126842
                     /locus_tag="PM3016_120"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(125973..125981,126078..126083,126087..126089,
                     126234..126236,126333..126335,126339..126344,
                     126420..126422)
                     /locus_tag="PM3016_120"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(125976..125981,126078..126083,126234..126236,
                     126333..126335,126342..126344,126420..126422)
                     /locus_tag="PM3016_120"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    126420..126422
                     /locus_tag="PM3016_120"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            126971..127927
                     /locus_tag="PM3016_121"
                     /db_xref="GeneID:11882084"
     CDS             126971..127927
                     /locus_tag="PM3016_121"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ArgF"
                     /protein_id="YP_005310257.1"
                     /db_xref="GI:379718126"
                     /db_xref="GeneID:11882084"
                     /translation="MAGTTEQDIEISLKGRDFIGLVDYAPEEIQYLIDLAINLKKKNQ
                     AGEVFQPLKGKTLGMIFEKSSTRTRVSFEVGMYQLGGHALFLSKNDLQLGRGETIHDT
                     AQTMSRYLDGIMIRTYAHRTVIELARGATVPVINGLTDLSHPCQALADYQTIQEKKGR
                     LQGLKMAYIGDGNNMVHSLMMGAAKLGMNFAVATPQGYEPDSEVLELSREAASKAGSS
                     IWVGTDPVEAIADADVVYTDVWASMGFEAEQKERELAFKNFQVNEALVKYAKKDYLFM
                     HCLPAHRGEEVSEGVIDGANSVIFDQAENRLHAQKAVMAAIM"
     misc_feature    127004..127924
                     /locus_tag="PM3016_121"
                     /note="ornithine carbamoyltransferase; Provisional;
                     Region: PRK00779"
                     /db_xref="CDD:234835"
     misc_feature    127016..127441
                     /locus_tag="PM3016_121"
                     /note="Aspartate/ornithine carbamoyltransferase,
                     carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
                     /db_xref="CDD:251498"
     misc_feature    127454..127921
                     /locus_tag="PM3016_121"
                     /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
                     binding domain; Region: OTCace; pfam00185"
                     /db_xref="CDD:249663"
     gene            128056..129297
                     /locus_tag="PM3016_122"
                     /db_xref="GeneID:11882085"
     CDS             128056..129297
                     /locus_tag="PM3016_122"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ArgG"
                     /protein_id="YP_005310258.1"
                     /db_xref="GI:379718127"
                     /db_xref="GeneID:11882085"
                     /translation="MAKQKIVLAYSGGLDTSIILKWLKETYDAEIIAFTADIGQKEEL
                     DGLEEKALSTGASKVYIDDLREEFAKDFIYPMFQAGALYEGQYLLGTSIARPLIAKRM
                     VEIALAEGATAIAHGATGKGNDQVRFELTAAALTPDIEVIAPWRLESFREQFPGRAEM
                     IAYAEKHGIPVTASASKPYSMDRNLLHISYESGVLEDPWFDASAPENKEMFLLSADPE
                     DAPDQAEYIELEFEQGNCVAINGERMIPLHIMEKLNELGGKHGVGRVDMVENRFVGMK
                     SRGVYETPGGAILFTAHRKIESLTMDREVMHLRDSLISKYASLVYNGFWFAPERLAVQ
                     ALVTESQKNVSGTVRLKLYKGNVIAAGVKSPVSLYNPNIATMEADPTKAYDQGDATGF
                     IRLNALRLRVAAGVKKNADQA"
     misc_feature    128071..129252
                     /locus_tag="PM3016_122"
                     /note="Argininosuccinate synthase. The Argininosuccinate
                     synthase is a urea cycle enzyme that catalyzes the
                     penultimate step in arginine biosynthesis: the
                     ATP-dependent ligation of citrulline to aspartate to form
                     argininosuccinate, AMP and pyrophosphate .  In...; Region:
                     Argininosuccinate_Synthase; cd01999"
                     /db_xref="CDD:238957"
     misc_feature    order(128080..128082,128101..128103,128155..128157,
                     128161..128163,128173..128175,128338..128340,
                     128404..128406,128437..128439,128593..128598)
                     /locus_tag="PM3016_122"
                     /note="ANP binding site [chemical binding]; other site"
                     /db_xref="CDD:238957"
     misc_feature    order(128314..128316,128326..128331,128422..128424,
                     128434..128436,128593..128601,128620..128622,
                     128626..128628,128860..128862,128896..128898,
                     129016..129018)
                     /locus_tag="PM3016_122"
                     /note="Substrate Binding Site II [chemical binding]; other
                     site"
                     /db_xref="CDD:238957"
     misc_feature    order(128407..128412,128419..128427)
                     /locus_tag="PM3016_122"
                     /note="Substrate Binding Site I [chemical binding]; other
                     site"
                     /db_xref="CDD:238957"
     gene            129476..130891
                     /locus_tag="PM3016_123"
                     /db_xref="GeneID:11882086"
     CDS             129476..130891
                     /locus_tag="PM3016_123"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ArgH"
                     /protein_id="YP_005310259.1"
                     /db_xref="GI:379718128"
                     /db_xref="GeneID:11882086"
                     /translation="MSKLWGGRFTKKTDQLVEEYTASILFDKELAEEDIQGSLAHVTM
                     LGKCGILPLDDVEKIKDGLHKVQNMIRRGEMEFTVSDEDIHMNIEKALIDEVGPVGGK
                     LHTGRSRNDQVATDMHLWLRKRVVEFVGLLNKIQEALIGQAKANLDTIVPGYTHLQRA
                     QPILFAHHLMAYVSMFQRDIERLQDSYKRINVLPLGAGALAGTTFPIDRHFVAQQLGF
                     DRVYENSLDAVSDRDFIVEFLANASLIMTHLSRLSEEFVMWSSTEFRFIELDDAFCTG
                     SSIMPQKKNPDVPELVRGKTGRVYGNLIGLLTVLKSLPLAYNKDMQEDKEGMFDTVRT
                     LQGALQLYAPMIATMKVNKDRMRQAVNQDFSNATDIADYLVNKGMPFRQAHEVIGKTV
                     LYCIQNGKYLLDLKLEEYHQFSKLFDQDIFQVLQPESVVNARNVYGGTASVQVSGAIE
                     RAEAVHAAAAAWFDEYFAKSR"
     misc_feature    129476..130828
                     /locus_tag="PM3016_123"
                     /note="argininosuccinate lyase; Provisional; Region:
                     PRK00855"
                     /db_xref="CDD:179143"
     misc_feature    129542..130828
                     /locus_tag="PM3016_123"
                     /note="Argininosuccinate lyase (argininosuccinase, ASAL);
                     Region: Argininosuccinate_lyase; cd01359"
                     /db_xref="CDD:176463"
     misc_feature    order(129542..129544,129554..129556,129722..129724,
                     129728..129730,129797..129805,129812..129814,
                     129938..129943,130169..130171,130298..130300,
                     130304..130306,130328..130330,130334..130336,
                     130343..130345,130424..130426,130430..130432,
                     130439..130441,130445..130450)
                     /locus_tag="PM3016_123"
                     /note="active sites [active]"
                     /db_xref="CDD:176463"
     misc_feature    order(129767..129769,129776..129778,129785..129790,
                     129935..129958,129974..129976,129986..129991,
                     130007..130009,130016..130021,130028..130030,
                     130040..130042,130073..130087,130091..130093,
                     130100..130102,130142..130156,130163..130168,
                     130172..130174,130184..130186,130193..130195,
                     130205..130207,130214..130219,130223..130228,
                     130235..130240,130253..130258,130265..130267,
                     130289..130291,130307..130318,130322..130330,
                     130334..130336,130343..130348,130352..130369,
                     130373..130381,130388..130390,130394..130402,
                     130424..130435,130442..130444,130451..130453,
                     130484..130486,130493..130495,130574..130576,
                     130589..130591,130616..130621,130628..130630,
                     130637..130639,130775..130777,130781..130795,
                     130817..130819)
                     /locus_tag="PM3016_123"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176463"
     gene            complement(131040..132560)
                     /locus_tag="PM3016_124"
                     /db_xref="GeneID:11882087"
     CDS             complement(131040..132560)
                     /locus_tag="PM3016_124"
                     /codon_start=1
                     /transl_table=11
                     /product="VanW family protein"
                     /protein_id="YP_005310260.1"
                     /db_xref="GI:379718129"
                     /db_xref="GeneID:11882087"
                     /translation="MTSITTSKRLHYGLAAGLLLLLASSLGTAAYGLHPHLPAEARIG
                     DWSIAGLTPAELEEQLAAKEAALLSLPVRLAVKEGEARLTKSVTLGELGLELRREELQ
                     AQLQPLRQGSPWERALARWRLRGVSWQLAVQLPEEKLRAALSATFAEVYARKPADALR
                     IIEADDTIRYVPEQAVSLIDEAKLHEALLAKLPSWGSLAGAPLSKDAPESGAAPPPLD
                     VELPMRTAAPGVTVQALQAQGISRKLIEYTTSYPPGSASPEGRVHNVRSTAAVIHDVL
                     LKPGEVFDYAPYIAETEKRFGFREAPVIVNGKLVPGVGGGICQVSSTLYNAVLRAGLT
                     IVERRNHSLPVSYVPLGQDATFASGHIGFKFRNSTGHYLLIRTSATDRSMTVKLFGQT
                     PPEWSYDIVSKTVETLPAPVKYVHNPTLRKGRQETLIKGKPGYIVETYRRKLKNGVVM
                     AEEKISRDTYSAQPTVIASSNGSAASRDHTSPSPGASPREPMIEDGVKGPNYRSAR"
     misc_feature    complement(131985..132269)
                     /locus_tag="PM3016_124"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_4; pfam12229"
                     /db_xref="CDD:256913"
     misc_feature    complement(131391..131786)
                     /locus_tag="PM3016_124"
                     /note="VanW like protein; Region: VanW; pfam04294"
                     /db_xref="CDD:252509"
     misc_feature    complement(131157..131369)
                     /locus_tag="PM3016_124"
                     /note="G5 domain; Region: G5; pfam07501"
                     /db_xref="CDD:254241"
     gene            133011..133696
                     /locus_tag="PM3016_125"
                     /note="FtsE"
                     /pseudo
                     /db_xref="GeneID:11882088"
     gene            133686..134609
                     /locus_tag="PM3016_127"
                     /db_xref="GeneID:11882089"
     CDS             133686..134609
                     /locus_tag="PM3016_127"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310261.1"
                     /db_xref="GI:379718130"
                     /db_xref="GeneID:11882089"
                     /translation="MRISTVARHLREGTKNVARNGWMSFASIASIAISLLILGVFLLL
                     TLNVNYLAQQIERQVEIRVYLEVNTSQEKIDEVAAKIKEIPQVKTVTFVSKEQGLADL
                     RERLGENGRQLLEGLEGEDDNPLNDSFTVEVTEPRDVASVAAAIEKLNAPEDPVKTIH
                     RVNYGKGTVETMFKVTSVVRNIGLVIVAGLALTAMFLIANTIKLTIIARRREISIMKL
                     VGATNAFIRWPFFIEGALLGLIGSLIPIVLLLYGYWQLMRWVSLDLNLMLIQLLPFEQ
                     VGPKTGALLLGIGVIIGVWGSTISVRKFMRV"
     misc_feature    133686..134606
                     /locus_tag="PM3016_127"
                     /note="Cell division protein [Cell division and chromosome
                     partitioning]; Region: FtsX; COG2177"
                     /db_xref="CDD:225088"
     misc_feature    133755..134465
                     /locus_tag="PM3016_127"
                     /note="cell division ABC transporter subunit FtsX;
                     Provisional; Region: ftsX; PRK11026"
                     /db_xref="CDD:182910"
     gene            134708..135973
                     /locus_tag="PM3016_128"
                     /db_xref="GeneID:11882090"
     CDS             134708..135973
                     /locus_tag="PM3016_128"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="YP_005310262.1"
                     /db_xref="GI:379718131"
                     /db_xref="GeneID:11882090"
                     /translation="MSNKPFVPFVVAAGLVGMLIAPQSGIAASETQRIQNELNQLRQQ
                     KNAYQKKQAETDKQIAQVQNEKARTESDLDALMGQIDSTNTKLNQLNEQIYTVKTSLE
                     QNAVELDEAEVRIETRDQLLKSRLRLMYMNGAVSYADVLLSSTSFSDFLDRLQALQSI
                     VSQDKDILEANKRDHKVIADKRVVIEQKLAEVKTLYGQVSEIKADLVEKEKEKEVRIA
                     SLSQQEEQLEHINEEIEQQVMAAAAAESKKQQALFKEQQRVAREAEAARKKNNTSNKG
                     VIAPPQAYAAPGGKFGYPLRSYVSKSSDFGSRRDPITGRTASHSGVDLPAPNGTDILA
                     AEDGVVIMAQSWSGYGNTVMIDHGGGIWTLYGHIRNGGIAVEKGETVKKGQKIAEVGS
                     TGRSTGNHLHFEVRINGNPVNPNGYIGQK"
     misc_feature    <134726..135178
                     /locus_tag="PM3016_128"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     misc_feature    134732..135967
                     /locus_tag="PM3016_128"
                     /note="Membrane-bound metallopeptidase [Cell division and
                     chromosome partitioning]; Region: COG4942"
                     /db_xref="CDD:227278"
     misc_feature    135167..>135577
                     /locus_tag="PM3016_128"
                     /note="Microtubule-binding stalk of dynein motor; Region:
                     MT; pfam12777"
                     /db_xref="CDD:193253"
     misc_feature    135662..135949
                     /locus_tag="PM3016_128"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            136068..137519
                     /locus_tag="PM3016_129"
                     /db_xref="GeneID:11882091"
     CDS             136068..137519
                     /locus_tag="PM3016_129"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative protease"
                     /protein_id="YP_005310263.1"
                     /db_xref="GI:379718132"
                     /db_xref="GeneID:11882091"
                     /translation="MTFKGRTVIAFVLLGMFASSIMTLTIVNPSIFAAVGRPGAEGAE
                     VKSGLTQKDYNKIATTYGLIENKFLTEVDREKIVNGAINGMLATLDDPFTVYMDQKEA
                     QQFDENISSSFQGIGAEVTSEDGRIMIVAPIKGSPAEKAGLHANDVILSVNGESLEGQ
                     TLNQAIMKIRGPKGTQAKIEIARPGSPEPIQIIVVRDDIDVETVYAEMLEGQIGKIEI
                     RQFASNTSKRFKEELKLLEDQGMKGLIIDVRNDPGGLLTAVVEIVEPFIPKDKAIVQI
                     ENRKGEKEVTPSKGSGKPYPVSVLINKGSASASEILAGALHDSVGSKLIGETTFGKGT
                     VQVTFEEEMGDGSNIKMTVYKWLTPNGTWIHKKGIAPDLAVEQPAFFKAAPLSKKETL
                     KPDTNSEDVKNLQIMLQGLALNPDRTDGYYSQQTATAVKAFQRLNDLPVTGEVDTETA
                     NKLEKAVLAAIREPKNDLQLKAALQYMQQTVKP"
     misc_feature    136104..137315
                     /locus_tag="PM3016_129"
                     /note="Periplasmic protease [Cell envelope biogenesis,
                     outer membrane]; Region: Prc; COG0793"
                     /db_xref="CDD:223864"
     misc_feature    136221..137195
                     /locus_tag="PM3016_129"
                     /note="C-terminal processing peptidase; serine protease
                     family S41; Region: Peptidase_S41_CPP; cd07560"
                     /db_xref="CDD:143476"
     misc_feature    136404..136658
                     /locus_tag="PM3016_129"
                     /note="PDZ domain of C-terminal processing-,
                     tail-specific-, and tricorn proteases, which function in
                     posttranslational protein processing, maturation, and
                     disassembly or degradation, in Bacteria, Archaea, and
                     plant chloroplasts. May be responsible for...; Region:
                     PDZ_CTP_protease; cd00988"
                     /db_xref="CDD:238488"
     misc_feature    order(136410..136421,136425..136427,136560..136565,
                     136572..136577)
                     /locus_tag="PM3016_129"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238488"
     misc_feature    order(136986..136988,137061..137063)
                     /locus_tag="PM3016_129"
                     /note="Catalytic dyad [active]"
                     /db_xref="CDD:143476"
     misc_feature    137256..137426
                     /locus_tag="PM3016_129"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_1; pfam01471"
                     /db_xref="CDD:250643"
     gene            137704..138987
                     /locus_tag="PM3016_130"
                     /db_xref="GeneID:11882092"
     CDS             137704..138987
                     /locus_tag="PM3016_130"
                     /codon_start=1
                     /transl_table=11
                     /product="Trypsin-like serine protease"
                     /protein_id="YP_005310264.1"
                     /db_xref="GI:379718133"
                     /db_xref="GeneID:11882092"
                     /translation="MGGLIDWGFRGLKALTELLLNPFYYVGILFIVLQYRRQILLERK
                     LFSVKLHSLISETWRTVLWGWIGGLAASAVMAGIGAVVQPEAVVLLWIVSLLLIWARV
                     RFLCWAYAIGVLGILQAVLVNFPALQEALSWRWAVDSVLALHMPSLFALVAVLHLIEA
                     LLVRRQGTRFGTPVFVESKRGKIVGGYQLQGFWPVALFLTVPVQGGAPLPWTPLLGGD
                     LYAGGWAVLALPVMIGFTDMTTSRLPREKVQLSSGLLVLYAALLLLLTALSAWWAPSL
                     LAVSLLCILLHEAIVFYSRWDESRRSPVFVHGNRGLKILGILPGSPAAELGLQVGESL
                     YKVNGMIVRTRQELHHALSQNAAFCRLEILNLAGESKFVKRAIFSGEHHLLGIILAPD
                     EDVLYYTKERPLPFWAYLGRRVRGLSDNRPRPKSM"
     misc_feature    138592..138795
                     /locus_tag="PM3016_130"
                     /note="PDZ domain, also called DHR (Dlg homologous region)
                     or GLGF (after a conserved sequence motif). Many PDZ
                     domains bind C-terminal polypeptides, though binding to
                     internal (non-C-terminal) polypeptides and even to lipids
                     has been demonstrated; Region: PDZ; cl00117"
                     /db_xref="CDD:260201"
     misc_feature    <138628..138771
                     /locus_tag="PM3016_130"
                     /note="Trypsin-like serine proteases, typically
                     periplasmic, contain C-terminal PDZ domain
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: DegQ; COG0265"
                     /db_xref="CDD:223343"
     gene            complement(139107..139862)
                     /locus_tag="PM3016_131"
                     /db_xref="GeneID:11882093"
     CDS             complement(139107..139862)
                     /locus_tag="PM3016_131"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotB"
                     /protein_id="YP_005310265.1"
                     /db_xref="GI:379718134"
                     /db_xref="GeneID:11882093"
                     /translation="MARRRKRENAPGGGHDRWLITYADLITLLLIFFVVMYSMSKVDL
                     DKYDEISDALRSEFNRSHSVLDGGDGITGGVNPPLGADDARLQLEREKRLYRERQFQQ
                     MVGQMQAYIEANNLQAQVNAATTTRGVTFTMNDLFLFDLGKAELKPEAKPVLEKLSSL
                     FAEIDATISIEGHTDDLPLATGSIYVDNWGLSGARSLSVLRYFLYDTQLDPQKFVSAS
                     YAHTRPVAENTSAENRAKNRRVEIVVLWEEPAS"
     misc_feature    complement(139686..139862)
                     /locus_tag="PM3016_131"
                     /note="Membrane MotB of proton-channel complex MotA/MotB;
                     Region: MotB_plug; pfam13677"
                     /db_xref="CDD:257982"
     misc_feature    complement(139128..139856)
                     /locus_tag="PM3016_131"
                     /note="flagellar motor protein MotS; Reviewed; Region:
                     PRK06925"
                     /db_xref="CDD:235887"
     misc_feature    complement(139131..139454)
                     /locus_tag="PM3016_131"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    complement(order(139149..139151,139161..139163,
                     139290..139292,139299..139304,139317..139319,
                     139338..139343,139437..139442))
                     /locus_tag="PM3016_131"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(139846..140637)
                     /locus_tag="PM3016_132"
                     /db_xref="GeneID:11882094"
     CDS             complement(139846..140637)
                     /locus_tag="PM3016_132"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MotA"
                     /protein_id="YP_005310266.1"
                     /db_xref="GI:379718135"
                     /db_xref="GeneID:11882094"
                     /translation="MDLTTIIGILAGLAALVGGYLWDGGDLSSLFVPSALLIVIGGTL
                     GAVAVSFPWSHLKGTLGALRMAFRIPLADPRRHIDEMMEMASVARREGVLSLEQRAQQ
                     HPDPFLREGLTLVVDGTDPSLTKQILELEMDALEQQYESRARVLESAGGYAPTMGIIG
                     TVMGLIHVLGNLSEPGNLAPAIAVAFTATLYGVATANLIYLPLANKIKVRGQEVIAEK
                     ELLLEGILALQAGENPYLIKKKMMTFLVKDQSGRTEEVEDDGTPA"
     misc_feature    complement(139900..140637)
                     /locus_tag="PM3016_132"
                     /note="MotA/TolQ/ExbB proton channel family; Region:
                     MotA_ExbB; cl00568"
                     /db_xref="CDD:260505"
     gene            140994..142991
                     /locus_tag="PM3016_133"
                     /db_xref="GeneID:11882095"
     CDS             140994..142991
                     /locus_tag="PM3016_133"
                     /codon_start=1
                     /transl_table=11
                     /product="UvrB protein"
                     /protein_id="YP_005310267.1"
                     /db_xref="GI:379718136"
                     /db_xref="GeneID:11882095"
                     /translation="MHNEVVVSDKKFQLVSDFTPQGDQPAAIEKLVEGFEAGERYQTL
                     LGATGTGKTFTAAHVIAKLNRPTLLMAHNKTLAAQLCSELKEFFPHNAVEYFVSYYDY
                     YQPEAYIPSSDTFIEKDSSINDEIDKLRHSATSALFERRDVIIVASVSCIYGLGSPME
                     YRNMVMSLRVGMERSRNDILHRLIDIQYQRNDMNFVRGTFRVRGDVVEIFPASHGEHA
                     VRVELFGDEIERITEIDVLTGEILGERDHIAIFPASHFVTGEETMKRALVNIERELEE
                     RLEELRGQGKLLEAQRLEQRTRYDIEMMQEMGFCSGIENYSGPLTFRERGATPYTLLD
                     YFPDDFICMIDESHVTLPQVRAMYNGDRARKEVLVDHGFRLPSAMDNRPLRFEEFEKK
                     VGQQLYISATPGPYELEKCPEMVQQIIRPTGLLDPIIEVRPTKGQIDDLLGEINDRIR
                     KDERVLVTTLTKKMAEDLTDYLKEIGIKVRYLHSDIKTLERMQILRELRLGVFHVLVG
                     INLLREGLDLPEVSLVAILDADKEGFLRAERSLIQTIGRAARNAEGRVIMYGDKITDS
                     MDKAIKETERRRTIQMAYNEKHGITPQTIQKKVRDVIEATKVAEQKTEYLADVKTKMS
                     KKDRMSLIERMEQEMKEAAKNLQFERAAELRDAVLELKAEL"
     misc_feature    141015..142988
                     /locus_tag="PM3016_133"
                     /note="excinuclease ABC subunit B; Provisional; Region:
                     PRK05298"
                     /db_xref="CDD:235395"
     misc_feature    141111..>141311
                     /locus_tag="PM3016_133"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    141138..141152
                     /locus_tag="PM3016_133"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    142284..142670
                     /locus_tag="PM3016_133"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(142371..142382,142440..142445,142518..142526)
                     /locus_tag="PM3016_133"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(142542..142544,142620..142622,142632..142634,
                     142641..142643)
                     /locus_tag="PM3016_133"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    142665..142796
                     /locus_tag="PM3016_133"
                     /note="Ultra-violet resistance protein B; Region: UvrB;
                     pfam12344"
                     /db_xref="CDD:256994"
     misc_feature    142881..142985
                     /locus_tag="PM3016_133"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:251123"
     gene            143014..145897
                     /locus_tag="PM3016_134"
                     /note="UvrA"
                     /pseudo
                     /db_xref="GeneID:11882096"
     gene            complement(146101..146715)
                     /locus_tag="PM3016_137"
                     /db_xref="GeneID:11882097"
     CDS             complement(146101..146715)
                     /locus_tag="PM3016_137"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005310268.1"
                     /db_xref="GI:379718137"
                     /db_xref="GeneID:11882097"
                     /translation="MTIYSTRKRVSPLTRNRIRAAALHEFAYKGYEGTPLSDIAKEVG
                     IKTPSFYAHFRSKESLLLHLFDDVLQERVETVCRLIRQLEASTPDEMLFRILVLFCHG
                     EDVSEEKLLFLKRLTLFPPPALEQEIKARFLASERLLSEPLCRIFREAADLGAIRPIP
                     ADELLASYYCLVDGCFVQRFYYPPHEAEHRLRLAWSIFWNGIRA"
     misc_feature    complement(146104..146703)
                     /locus_tag="PM3016_137"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(146524..146664)
                     /locus_tag="PM3016_137"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(146715..146882)
                     /locus_tag="PM3016_138"
                     /db_xref="GeneID:11882098"
     CDS             complement(146715..146882)
                     /locus_tag="PM3016_138"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310269.1"
                     /db_xref="GI:379718138"
                     /db_xref="GeneID:11882098"
                     /translation="MYPVSSAPCFVLSNDRTAAQTSLRTRSYRLPRLSRLMTQLRRQL
                     RRQRPLSRSLA"
     gene            147235..148137
                     /locus_tag="PM3016_139"
                     /db_xref="GeneID:11882099"
     CDS             147235..148137
                     /locus_tag="PM3016_139"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_005310270.1"
                     /db_xref="GI:379718139"
                     /db_xref="GeneID:11882099"
                     /translation="MDTPMLPLQGKVAVVAGATRGAGRAIAVSLGEAGAIVYCTGRSV
                     RGRLSPIGRQETIDETAELVTARGGRGIPVRVDHTVEDEVRGLFARVQEEQDGRLDIQ
                     VNDIWGGEHLTAWGKPFWESSLEDGLLMQRQAVHSHMITSYYGAPLMTARGQGLIIEV
                     TDGFDYRYRGNLYYSLAKISAIHLAEAMAAELKSTGVTALSVTPGFLRSEQMLDHFGV
                     SEENWRDAIAQEPHYAESETPYLLGRGIAALAADPKVADKAGRILTSWDLSEEYGYSD
                     IDGRRPHWGRYAAKHRLYDNPLTP"
     misc_feature    147241..148095
                     /locus_tag="PM3016_139"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    147256..148026
                     /locus_tag="PM3016_139"
                     /note="Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases) [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: FabG; COG1028"
                     /db_xref="CDD:223959"
     misc_feature    order(147283..147285,147289..147294,147298..147300,
                     147355..147363,147547..147555,147712..147720,
                     147754..147756,147766..147768,147844..147855)
                     /locus_tag="PM3016_139"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(147634..147636,147718..147720,147754..147756,
                     147766..147768)
                     /locus_tag="PM3016_139"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            148524..148742
                     /locus_tag="PM3016_140"
                     /db_xref="GeneID:11882100"
     CDS             148524..148742
                     /locus_tag="PM3016_140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310271.1"
                     /db_xref="GI:379718140"
                     /db_xref="GeneID:11882100"
                     /translation="MFMAAEAGAATASSFTGFDPFVILFTLVIAIGVIRLIGAKKKNP
                     FAIGFGLVSLAVFGLMTVVMVMGWMGQL"
     gene            148934..150136
                     /locus_tag="PM3016_141"
                     /db_xref="GeneID:11882101"
     CDS             148934..150136
                     /locus_tag="PM3016_141"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310272.1"
                     /db_xref="GI:379718141"
                     /db_xref="GeneID:11882101"
                     /translation="MIRRFGLGLFAGLTAAVLLLPSAADAGVVPATVFTIIGETEVYT
                     KEGGGGRPMGRIAPYQSVTLAPDGPFDWYDERPQDPWLKVSTWLGSQWIRDDDRVLYG
                     EFKEQTQTLTLIGTTRLFSRPDYGAATGESLAPQQVVSTASIGYAPKYITNTLSAMAQ
                     SGTWYRIETSWRGPVWIANPALMEEVKAEVVDYDVLLTGQESAYPLPYAEGEGDKLEA
                     GIVRASARWEDRAIPFAAKLWYKVKLPQGERWIQPEHESLENYRGEQKPIELKTKTRY
                     FEEPNLTYDRTRWLEPGTYPVVESFGDWMRIETPDGAKWIYPKRVLMERPEGILPVQE
                     TIRISGRTQTYYFPHNAEPCHTEGFFAPQEVQAFEKWTSPEGVVWYHITTFSGEEWVP
                     EEPLGQTG"
     gene            complement(150219..151187)
                     /locus_tag="PM3016_142"
                     /db_xref="GeneID:11882102"
     CDS             complement(150219..151187)
                     /locus_tag="PM3016_142"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein"
                     /protein_id="YP_005310273.1"
                     /db_xref="GI:379718142"
                     /db_xref="GeneID:11882102"
                     /translation="MKLGVFTVLFQQKPLEEALDYIAAQGLQAVEIGTGAYPGNAHCN
                     PDVLLADESKLKAFKHAVESRGLTISALSCHANPLHPQKAIAQEAHDTIIKTVDLAQK
                     LEVPVVNTFSGCPGDSDDAKYPNWPVAPWPPDFQEILDWQWANKVIPYWTETGKYASD
                     RSVKFGLELHGGFSVHTPATLLRLREAAGDVIGANLDPSHMWWQGIDPVQAIQILGRA
                     GAIHHFHAKDTSIDPINVNRYGLTDMQSYSNMLDRAWQFRTVGYGHDIKVWADIISAL
                     RLVGYDYVVSIEHEDGLMSVEEGFTKAVQNLQQVLIKEPLGEMWWV"
     misc_feature    complement(150249..151187)
                     /locus_tag="PM3016_142"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     misc_feature    complement(150474..151133)
                     /locus_tag="PM3016_142"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     misc_feature    complement(150222..150383)
                     /locus_tag="PM3016_142"
                     /note="AP endonuclease family 2 C terminus; Region:
                     AP_endonuc_2_N; pfam07582"
                     /db_xref="CDD:191792"
     gene            151450..151740
                     /locus_tag="PM3016_143"
                     /db_xref="GeneID:11882103"
     CDS             151450..151740
                     /locus_tag="PM3016_143"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310274.1"
                     /db_xref="GI:379718143"
                     /db_xref="GeneID:11882103"
                     /translation="MRKDTQIVETAVGTWLRFPGSFKKHQCLVELSDQLSLDINLKSG
                     LVHVHQKDGNDVFQHVGDLCLAPVGGQLQLSFVSTQPQDPRKELPLAQPDAS"
     gene            complement(152000..153151)
                     /locus_tag="PM3016_144"
                     /db_xref="GeneID:11882104"
     CDS             complement(152000..153151)
                     /locus_tag="PM3016_144"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane bound O-acyl transferase MBOAT family
                     protein"
                     /protein_id="YP_005310275.1"
                     /db_xref="GI:379718144"
                     /db_xref="GeneID:11882104"
                     /translation="MFYLNMNAVLAMLGMVIVLALTRKWRGNKRLLLLAFNLSFLVVF
                     SSKLFFFYLGYTALNYLAFRFLSVVTRARLAWFIGLIALNIGLVSSLRLFDMKIFTGT
                     WYDAALVIGLIYNVLKVIDALYFAYFFKQDAKAHVLDYFNYILFLPTFTSGPILKFRD
                     FMADAKQPYQVDAAQAEVNIKRIILGLFKRVVLVTWASTLFDYVSEGELQTHESLFLM
                     IVFYAWIYFDFSGYSDIAVGFGRLMGYNVPENFKKPFSSPTLTQYWRNWHATLGDWFR
                     DHIFIFFSRQTPTKWTAAGLSVLIMVLIGLWHGFSWLYLLWGIYHGLFIALENLLGRT
                     TVNKRKVSKTHFYARCALTQLIVTLAIIVYSPNEEAVLRIYRGLLNLPW"
     misc_feature    complement(152057..153061)
                     /locus_tag="PM3016_144"
                     /note="Predicted membrane protein involved in D-alanine
                     export [Cell envelope biogenesis, outer membrane]; Region:
                     DltB; COG1696"
                     /db_xref="CDD:224610"
     gene            complement(153246..153356)
                     /locus_tag="PM3016_145"
                     /db_xref="GeneID:11882105"
     CDS             complement(153246..153356)
                     /locus_tag="PM3016_145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310276.1"
                     /db_xref="GI:379718145"
                     /db_xref="GeneID:11882105"
                     /translation="MAGIARKILEVIVYLAMLILVIVYFTGEGVFIYEDF"
     gene            complement(153323..154243)
                     /locus_tag="PM3016_146"
                     /db_xref="GeneID:11882106"
     CDS             complement(153323..154243)
                     /locus_tag="PM3016_146"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310277.1"
                     /db_xref="GI:379718146"
                     /db_xref="GeneID:11882106"
                     /translation="MMAILRKNSFVLLLLAAFVLTDVAVSLWDPMVTSRRFYKNDFTK
                     TLYHHDWTAHGPVFYGNSAVTGAYIEPDAKKSPLIEMGLSYGKLTDLKAILEQERFQV
                     EEQLVIGIDVHTMIDSLETDPTYQWFKKPYQPYLYAYRDYFRDSGTEFVRQLYMGAVE
                     LDPTKLLAYQPRWIDKELYFGHKTEEELRKKWADYDKRFGWMGEPDYRENLAALDWLL
                     AYAKERSLPLRVVWMPWNRGYELPRYMPGLQQAVNARLQAAGVPVLDKLQGYDPRLFH
                     DLVHLSRQEGAPVFTKEVDAWLASLAKSSK"
     misc_feature    complement(153392..>153652)
                     /locus_tag="PM3016_146"
                     /note="GDSL-like Lipase/Acylhydrolase family; Region:
                     Lipase_GDSL_2; pfam13472"
                     /db_xref="CDD:257796"
     gene            complement(154452..155648)
                     /locus_tag="PM3016_147"
                     /db_xref="GeneID:11882107"
     CDS             complement(154452..155648)
                     /locus_tag="PM3016_147"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310278.1"
                     /db_xref="GI:379718147"
                     /db_xref="GeneID:11882107"
                     /translation="MECVVSLEGLASSQHGQLKYASAFIDETISDIRLEGGSIHIVHN
                     SPKGNEGIEERVRKLIDRFSQGDFGFKENILFEHQVATPYEGDIIAELTERKIIKVLE
                     PGLFIFREPFSSLMRFFDYSFVSKIAGRFTGVTEEQYPAVIHSTTLNKTNHFTSFPEH
                     IHFLTHLREDLDIIEAFSQSIREAGGWKEDMELDLNANMPLPKFTMNPSTCYHCYEGL
                     QNETLESDGLIVTAISKCHRFESRNHTDFGRLLDFSMREIIFVGKPEFVKEHRLQAIE
                     YLKELAVEWNVDSLLEIANDPFFTNDFQVKASFQRNQEMKYELRLTIPSVGKSIACSS
                     VNFHSNTFGNAFNIKVGKRPAVTGCVGFGIERWAFAFLAQYGLDEAQWPAAFREQYHA
                     WQAKAL"
     misc_feature    complement(154485..>155234)
                     /locus_tag="PM3016_147"
                     /note="hypothetical protein; Validated; Region: PRK07080"
                     /db_xref="CDD:235929"
     gene            complement(155656..155907)
                     /locus_tag="PM3016_148"
                     /db_xref="GeneID:11882108"
     CDS             complement(155656..155907)
                     /locus_tag="PM3016_148"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310279.1"
                     /db_xref="GI:379718148"
                     /db_xref="GeneID:11882108"
                     /translation="MQDLLQELESHIRTRYEIEEDDDDFTVDVHLFDYGYIDSIGATA
                     LIAHIEKTYGIAVTNQDLMLYPMNTVREIATFIHTKKGA"
     misc_feature    complement(155677..155859)
                     /locus_tag="PM3016_148"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     gene            complement(156017..159325)
                     /locus_tag="PM3016_149"
                     /db_xref="GeneID:11882109"
     CDS             complement(156017..159325)
                     /locus_tag="PM3016_149"
                     /codon_start=1
                     /transl_table=11
                     /product="FG-GAP repeat-containing protein"
                     /protein_id="YP_005310280.1"
                     /db_xref="GI:379718149"
                     /db_xref="GeneID:11882109"
                     /translation="MSEELSPAWYGGLELSLLRHRKALAAVLLLVAAGLTALLWTAEK
                     ELTVRMLYATQGDRYDTAAYSQLRQSPAAGLKLERRSLEGLGARQLRSYDTIVLDPNL
                     DGHLTGEQRKLLADYAAGGGHLFLENAFADDFPLEVLGAAALTPVKAPPKEKLQAAAL
                     SPPDKDTGLLAYPAVGLNEQGIQQLLRLFTETYLRHDTAGTLSGFSWGQGIVPGTAQP
                     LVTLDGTALFTLNRYGEGTVFFCGALLPSRYYPTGYDLVSGMDGTLGFDRLAAERNAS
                     LQPVTGAKYFNRLALKTEPSFNFSFAAGSALLRSEYAAFVSKEKLGYSVEKTYGPYGR
                     PAMAHQNHFEALEAIRDGEGIQWTELLKKYNQIPSFSLVRSAFTWQRWQESVVVHLNT
                     GTNDKPAFAGETPNSFYSSGTRLIGADGAVRGAYYPGSPSLGDPITLPYRAAPALADV
                     TGDGRADLIVGSADGTLSAYPNLGADDAAYAGQQLPAGLAAPPRFGARMPLRLAGGEP
                     LAVGEYASAAAYDLNADGRADLVIGRPDGTLAAAYGEAGGTFTAPAALTAGGAVLRGA
                     APLAAAVGDVTGDAVPDLLVGDGAGAVTLYRGERQPAGTGALSFGRGEPAVRTGQPFA
                     APSLHDMNGDGRLDLVVGGLEGDLRVYLQTGSSNADPAWAENGAIEAATLNQVGGREL
                     VGGHNAVPLWADLNGDGLDDLIAGQLEFGMPKPIDDPGFPYAGQLKEFIDYSRANALE
                     LYPHIYVHNYTSDEQERQEIELHRQAFAKLGIPWEHTGTNQHTWRINNPDRVQTLDNE
                     RDAGIWFNFGFKPSYAEHDPRLGPEYSWGLPFLMSDPSGEPLLTKPMMLYTPAPVLRK
                     GAYATTDLFDAYAALDLPVDYFEHIEYHFPLRVGELTEFVTYLDGLRNLYGYNFMTET
                     QMARSFLNAMTTEVELYRPWREVLLDRARRLLGQETEPRFRVRADASAVPQQAAEYRG
                     TLGLAVERGQAYAARDAVTDAEVRDTRGGKLYLGVPDQAEIRFAPPGTTAAEDTAAFH
                     LLRVNVPYTLETRDESRILRFGADGMQQVQLYSPVKPVFEGTDLRIEGDEARGIYTIT
                     HFGEAGTVTIRSPK"
     misc_feature    complement(157703..157999)
                     /locus_tag="PM3016_149"
                     /note="Ciliary BBSome complex subunit 2, middle region;
                     Region: BBS2_Mid; pfam14783"
                     /db_xref="CDD:258920"
     misc_feature    complement(157916..157999)
                     /locus_tag="PM3016_149"
                     /note="FG-GAP repeat; Region: FG-GAP; pfam01839"
                     /db_xref="CDD:250906"
     misc_feature    complement(157568..157765)
                     /locus_tag="PM3016_149"
                     /note="Repeat domain in Vibrio, Colwellia, Bradyrhizobium
                     and Shewanella; Region: VCBS; pfam13517"
                     /db_xref="CDD:257837"
     misc_feature    complement(157403..157603)
                     /locus_tag="PM3016_149"
                     /note="Repeat domain in Vibrio, Colwellia, Bradyrhizobium
                     and Shewanella; Region: VCBS; pfam13517"
                     /db_xref="CDD:257837"
     misc_feature    complement(157211..157438)
                     /locus_tag="PM3016_149"
                     /note="Repeat domain in Vibrio, Colwellia, Bradyrhizobium
                     and Shewanella; Region: VCBS; pfam13517"
                     /db_xref="CDD:257837"
     gene            159534..162053
                     /locus_tag="PM3016_150"
                     /db_xref="GeneID:11882110"
     CDS             159534..162053
                     /locus_tag="PM3016_150"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase U32"
                     /protein_id="YP_005310281.1"
                     /db_xref="GI:379718150"
                     /db_xref="GeneID:11882110"
                     /translation="MRDIRKSDIELLAPAGDWDCLRAAVANGADAVFFGVEKFNARAR
                     AHNFHTDELPDIISFLHRYGVKGFLTFNILVFEEELESAKELIEACIDAGVDAVIVQD
                     LGLVKMIRELSPDFPIHGSTQMTITSPEAVEFTKPFDIERVVLGRENNLKQIKTIGDQ
                     AKLPMEVFVHGALCVSYSGQCLTSEMWGGRSANRGECAQACRLPYDLMVDGEHKPMGD
                     IAYLLSPKDLAALELVPELIEAGVTSFKIEGRLKSPEYVANVVSKYRKAIDRYFDGEN
                     PRPTKEELRELEQSFSRGFTHGFLEGTNNKQLVEGTYPKSRGVYLGRVKQILRDGVVC
                     ELEAPLKRGDGIVFDAGDPTKKEEGGRVYDLRRKGVKFEGEAPGGEIEIIPGRNDVAL
                     ARLHVGDRIWKTNDPHLDKRLRQTFETDKPYRTFPVHVRVTGAAGQPLKSVWTDTILG
                     NTVTVESELPLAVAEKRPMTAELFEEQFGRLGGTVFELAGVDVQLAGDLIVPMRELNS
                     MRREAAERLLELREKPPAYIKRSVGAYDDAPLTPPVSALPSGGKAQARLTVLCRSLEQ
                     VVEACRSDIDMVYADFEFIKQFPAAVEAAHAAGKRIALATPRIHMPGETGYFKNILNL
                     GPDAVLVRNTGAVYWFLRYFAEHPSEKRPMLIGDFSLNVANHKAVSLFREAGLDRVTP
                     SYDLNVQQMVDLLRRSDTSTLEVVIHQHLPMFHTEHCVYCTFMSPGTNYTNCGRPCEE
                     QRASLRDRVGFSHPVRVDEGCRNTVYNAIDQSGAEYLKDFMELGVSTFRVEFLEESAE
                     KVREVLGLYGRALRGEISGTQVWKTLKSTNQLGVTRGQLVK"
     misc_feature    159558..160571
                     /locus_tag="PM3016_150"
                     /note="Collagenase and related proteases
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0826"
                     /db_xref="CDD:223896"
     misc_feature    160734..161108
                     /locus_tag="PM3016_150"
                     /note="Collagenase; Region: DUF3656; pfam12392"
                     /db_xref="CDD:257020"
     misc_feature    161364..161993
                     /locus_tag="PM3016_150"
                     /note="Peptidase family U32; Region: Peptidase_U32;
                     cl03113"
                     /db_xref="CDD:261590"
     gene            162319..162669
                     /locus_tag="PM3016_151"
                     /db_xref="GeneID:11882111"
     CDS             162319..162669
                     /locus_tag="PM3016_151"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310282.1"
                     /db_xref="GI:379718151"
                     /db_xref="GeneID:11882111"
                     /translation="MLVFGVYLLVLGLLLFLLPGPLRELLGIEEVPKVWLRFIGELLA
                     FLGGYYVLAARKGWYEFFRLSVWLRALVFISVTGFVLGKAMPVVFVPLGLIDLAGAAW
                     TGWAMKREPREQKH"
     gene            162929..164014
                     /locus_tag="PM3016_152"
                     /db_xref="GeneID:11882112"
     CDS             162929..164014
                     /locus_tag="PM3016_152"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="YP_005310283.1"
                     /db_xref="GI:379718152"
                     /db_xref="GeneID:11882112"
                     /translation="MLEVKGVSKLYENQRGVRNIDFSMNRGEIVGFLGPNGAGKTTTM
                     RMITGYLNPTHGSITIDGLSMAEHSKKARQKIGYLPETPPLYPEMTVSAYLQFIADLR
                     DIPARDQKRRIGEVIERLGLQGRERQIIRSLSKGYKQRIGLAQAILHNPDLLVLDEPT
                     SGLDPKQIIEIRQLIRELGENHTVLLSTHILPEINTLCNRVLIINGGQIVLDGQPDQL
                     ANSMGETFEVSLEVRGPREAVLAELASVPGVGSVRELGAEGAQTASAALPEVEAAELP
                     AADLAGQPADAAAAPASVKVIVTSSDREDIREALFYRLAEKRYPILTMKRESLSLEEI
                     FLKLTTSESLESAAAAETNEGEVKEHA"
     misc_feature    162932..163945
                     /locus_tag="PM3016_152"
                     /note="gliding motility-associated ABC transporter
                     ATP-binding subunit GldA; Region: GldA_ABC_ATP; TIGR03522"
                     /db_xref="CDD:132561"
     misc_feature    162932..163555
                     /locus_tag="PM3016_152"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    163028..163051
                     /locus_tag="PM3016_152"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(163037..163042,163046..163054,163169..163171,
                     163397..163402,163493..163495)
                     /locus_tag="PM3016_152"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    163160..163171
                     /locus_tag="PM3016_152"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    163325..163354
                     /locus_tag="PM3016_152"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    163385..163402
                     /locus_tag="PM3016_152"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    163409..163420
                     /locus_tag="PM3016_152"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    163481..163501
                     /locus_tag="PM3016_152"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            164016..164720
                     /locus_tag="PM3016_153"
                     /db_xref="GeneID:11882113"
     CDS             164016..164720
                     /locus_tag="PM3016_153"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005310284.1"
                     /db_xref="GI:379718153"
                     /db_xref="GeneID:11882113"
                     /translation="MMAMTKKELQHYFYSPIAYAAFAFFFLIAGYFFSANFLYPPYYV
                     DVRPIFGSTTFVFLFIIPLLTMRLVSDELRQGTDELLLTSPVSLTEIVLGKYLAAVVV
                     QLLLVVGSLIYPLILSAFGELDQPVLWMSYLAMFLMGAAMMAVGLFASSLSAHQMVSG
                     IIGFAILLVFWTIEWLGDTVGGRIKDYLGLFSIVGRTSDLQKGVLDFADVLFYVTLIA
                     VFLLLSIQVLERKRWR"
     misc_feature    164016..164708
                     /locus_tag="PM3016_153"
                     /note="gliding motility-associated ABC transporter
                     permease protein GldF; Region: ABC_perm_GldF; TIGR03518"
                     /db_xref="CDD:132557"
     gene            164736..166130
                     /locus_tag="PM3016_154"
                     /db_xref="GeneID:11882114"
     CDS             164736..166130
                     /locus_tag="PM3016_154"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310285.1"
                     /db_xref="GI:379718154"
                     /db_xref="GeneID:11882114"
                     /translation="MNKWIRGTNATVLSLAVIGIFIVLTIFLNSVKNLQVDFTKDNKF
                     TLADQTLQTLKALDQDVRIIAFTSDQTEPIISRQVSDLVQEYKRQNGKITFDEYDLVK
                     NPAVAKNYEVDPAGTLVVESGTQKKTLYYYDMFIPGQQQGEVYKFSGEEKLTQALANL
                     NSKEKRKVYFLSGHNEMPLSQMNLWRSGLEGENYEVNELNLLREGKIPDDAEVLFIIG
                     PENDLSDKEAELVKTYLSGKGKLYLALGFNKDMASGWKSLDSIMAQYGIKDQHAVAIE
                     PKQSMLYDPLTIIPEYGSHEITSKLQQYNLLTMMTLAVSLGSDQPVADFPATPILKTT
                     DKAYGETDLQTLANSSRSANDANDVKGPLNLGYVVEDKDKKPKAVVLGGSTFFQDSII
                     QQQGNRDFALNSVGWLQEQKDQVTIRPREGDAPQTAALTQSQGSTIFYGTVLLYPLFF
                     LIIGGLIWWRRRLG"
     misc_feature    164787..166121
                     /locus_tag="PM3016_154"
                     /note="gliding-associated putative ABC transporter
                     substrate-binding component GldG; Region: GldG; TIGR03521"
                     /db_xref="CDD:132560"
     misc_feature    164838..165539
                     /locus_tag="PM3016_154"
                     /note="ABC-type uncharacterized transport system; Region:
                     ABC_transp_aux; pfam09822"
                     /db_xref="CDD:255585"
     gene            166127..167125
                     /locus_tag="PM3016_155"
                     /db_xref="GeneID:11882115"
     CDS             166127..167125
                     /locus_tag="PM3016_155"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310286.1"
                     /db_xref="GI:379718155"
                     /db_xref="GeneID:11882115"
                     /translation="MKRLIPTLVLVLLCIGGFWYASSKDFFKEKPPETPALVTVSKQD
                     VTGYTIKNGDTVVEMAQKDGKWTMTKPSALPLNDYEPGAWVDSFTNAKKEKTVDANPS
                     DLAQFGLAQPNQEFTVTLKDGTKHTLSVGDPVAVQGFYYAKFGSSPEVFQLAEMHVTS
                     LAKQPLDFMEKSPVKLNYEAVRSIAVDYKGGKWTLTKAETDKKSYEANWKLGDQEVKG
                     ADASAYLDKVSFLTTDQPAKASAEVKGLDQPDLRLEVKEADAEGKETAALYTGKLDGA
                     NVWIAKQGDAWAFSVPAASVQELADLPKTKAAEGAAAGDAAAPAPAAPQDAAKEQK"
     misc_feature    166319..166873
                     /locus_tag="PM3016_155"
                     /note="Domain of unknown function (DUF4340); Region:
                     DUF4340; pfam14238"
                     /db_xref="CDD:258428"
     gene            167433..168134
                     /locus_tag="PM3016_156"
                     /db_xref="GeneID:11882116"
     CDS             167433..168134
                     /locus_tag="PM3016_156"
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="YP_005310287.1"
                     /db_xref="GI:379718156"
                     /db_xref="GeneID:11882116"
                     /translation="MKEAVIGFVLAHPDDETFGSAVLARELADAGHRVVLLSATKGDA
                     GQSGPLGPMSRGELAEVRVKELAEAAEILGIREVEHLGYPDGKLGDVPAEELSARITD
                     FLNRHGVEIVVTFPEDGGNRHPDHIAISRGARDAVFGGGSTSVRKLYYFLFGPAAEGR
                     RITFRLDSRAGWDVKRRALLAHRSQRTVIEKYFGDLETTFPEELKYESFALAWTKEGD
                     PAREEASLADFLAGG"
     misc_feature    167454..167807
                     /locus_tag="PM3016_156"
                     /note="GlcNAc-PI de-N-acetylase; Region: PIG-L; pfam02585"
                     /db_xref="CDD:251394"
     gene            168302..168922
                     /locus_tag="PM3016_157"
                     /db_xref="GeneID:11882117"
     CDS             168302..168922
                     /locus_tag="PM3016_157"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="YP_005310288.1"
                     /db_xref="GI:379718157"
                     /db_xref="GeneID:11882117"
                     /translation="MKKTVIFDFDGTLVASRDLAVRLFNELSGTYGYRRIQEEEIPAL
                     AALSVPDRLRAIGCPMYKLPSLLFEIKRRYKQAVTELEPVDGMPEVMRELRSRGIRTG
                     ILSSNRPDNIRAFLGRGGWDEPDFLFTATNLFGKDRAIRSLLRAERLQPEEALYVGDE
                     LRDIEACRRVSLPVAAVTWGYDAEDLLRGAAPDHVLGRPRELLELV"
     misc_feature    168302..168919
                     /locus_tag="PM3016_157"
                     /note="Predicted phosphatases [General function prediction
                     only]; Region: Gph; COG0546"
                     /db_xref="CDD:223620"
     misc_feature    168521..168832
                     /locus_tag="PM3016_157"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    168614..168616
                     /locus_tag="PM3016_157"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(168978..169313)
                     /locus_tag="PM3016_158"
                     /db_xref="GeneID:11882118"
     CDS             complement(168978..169313)
                     /locus_tag="PM3016_158"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310289.1"
                     /db_xref="GI:379718158"
                     /db_xref="GeneID:11882118"
                     /translation="MTDDVMYRRSNLKRIPDVQKLVPAAAGAYFRFEKEAFAEGAVPS
                     RTKELIAIAAAHITGCPYCIDVHVSKFKALGGTVEEVMEAAVVAGAVKAGAALAHSTH
                     AIRAYEELP"
     misc_feature    complement(<169065..169247)
                     /locus_tag="PM3016_158"
                     /note="Carboxymuconolactone decarboxylase family; Region:
                     CMD; pfam02627"
                     /db_xref="CDD:251430"
     gene            complement(169583..170008)
                     /locus_tag="PM3016_159"
                     /db_xref="GeneID:11882119"
     CDS             complement(169583..170008)
                     /locus_tag="PM3016_159"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator TrmB"
                     /protein_id="YP_005310290.1"
                     /db_xref="GI:379718159"
                     /db_xref="GeneID:11882119"
                     /translation="MEPSMNNLLGYWLKITYRHICNYLDEQLAPFGITNAQLGVLLLL
                     WEKEGLTQKDLQEGLGIRAASLSHLMKGLEAKGLIRRQADERDTRVNRVYPTDASREL
                     QEACLRITAEGERRLTEHLTAAEKEQLLGQMKQMSDNLK"
     misc_feature    complement(169601..169942)
                     /locus_tag="PM3016_159"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(169631..169933)
                     /locus_tag="PM3016_159"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    complement(order(169709..169711,169847..169849,
                     169856..169858))
                     /locus_tag="PM3016_159"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(169730..169738,169751..169756,
                     169766..169768,169784..169789,169793..169798,
                     169805..169810,169814..169825,169850..169858))
                     /locus_tag="PM3016_159"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            170214..170456
                     /locus_tag="PM3016_160"
                     /db_xref="GeneID:11882120"
     CDS             170214..170456
                     /locus_tag="PM3016_160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310291.1"
                     /db_xref="GI:379718160"
                     /db_xref="GeneID:11882120"
                     /translation="MYNQQQQQQTLSGNTVTAKELAYISDSLSNEELLAKLAVQGVME
                     SQTPQLKQKLAQIAQERLQNTDLLLRTLQQHTQMTH"
     gene            170481..171524
                     /locus_tag="PM3016_161"
                     /db_xref="GeneID:11882121"
     CDS             170481..171524
                     /locus_tag="PM3016_161"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310292.1"
                     /db_xref="GI:379718161"
                     /db_xref="GeneID:11882121"
                     /translation="MYQTNYNAPQGQQASEQRHLHLDEQDVAKLVLSELKRTAREYTT
                     AALEATHPAIRQTFMSLTQKTLQDQAELFTVLSQINGYGNIRMASQQDVQQELQNQFR
                     RAEQLQSTVQGAVQNAYSSSAGLYQQQSQQQAQMQSYQQQNQAFQQQQQPSPQAYQTS
                     YNVGGANIIAPSSQGGQSSYGTGSQGSSYSQPSSPAQSPSPGQGYSSSYNQPLLQGQS
                     YASSYSPSFGSAQQENEYSLKSSVAGTDAGEYYTAKHAVQEYNSGRYGSSASESYGSS
                     SQAGETGSSQGYTSSGQGSSASRQIGGYSMSGASASESSGSAGKMGSSSAAASRHQQS
                     GGQGSHQGTKYMM"
     misc_feature    170547..170726
                     /locus_tag="PM3016_161"
                     /note="Coat F domain; Region: Coat_F; pfam07875"
                     /db_xref="CDD:254480"
     gene            complement(171723..172040)
                     /locus_tag="PM3016_162"
                     /db_xref="GeneID:11882122"
     CDS             complement(171723..172040)
                     /locus_tag="PM3016_162"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310293.1"
                     /db_xref="GI:379718162"
                     /db_xref="GeneID:11882122"
                     /translation="MSKKKNPKPTLGRCELCLREDVETTEHHLTPKERGGTFLGTADL
                     CIPCHKQIHALFTNEELAAGLNTLESLRANETVAGFLRWIRKQPPTALPRVRKSQHVR
                     GKR"
     misc_feature    complement(171879..172001)
                     /locus_tag="PM3016_162"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cl00083"
                     /db_xref="CDD:260180"
     gene            172232..172831
                     /locus_tag="PM3016_163"
                     /db_xref="GeneID:11882123"
     CDS             172232..172831
                     /locus_tag="PM3016_163"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310294.1"
                     /db_xref="GI:379718163"
                     /db_xref="GeneID:11882123"
                     /translation="MKRLLMLGMLAALVAGCQTTGDGSNDANMKTLQKTVGRERLLQT
                     FSQVTPPPTGKEVLSGTDEQVITWIRQVDDWTHKVLSSPVTGEMDEYAMREMRKHLTQ
                     VYTPQMSQQLIDYFYRHDPTVGTYQANSTKAMLELRSEWDRYELRKEQPAKNQYKLTL
                     TGRRRGDGAESVMNHSSAYQIQGDRLVITDFRTESGSPR"
     gene            173212..173922
                     /locus_tag="PM3016_164"
                     /db_xref="GeneID:11882124"
     CDS             173212..173922
                     /locus_tag="PM3016_164"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PcrB"
                     /protein_id="YP_005310295.1"
                     /db_xref="GI:379718164"
                     /db_xref="GeneID:11882124"
                     /translation="MHLDLKTWKHVFKLDPDRELGDEELERVCLSGTDAILVGGSTGV
                     TFDNTVDLLARVRRYEVPCVLEVSEQEAIVPGFDLYFIPVVLNSRDPQWITGRQHAAL
                     KEYGAIMDWSQIVTEGYIMLNGESSAARITSSETELSGRDVEAYARLAERLFRCPVVY
                     MEYSGIFGDMALVKKVSGLLGESRLFYGGGIDGPDKARQAAEAAHTVVVGNSIYYDLE
                     SALQTVQAVREAGGAAGR"
     misc_feature    173236..173886
                     /locus_tag="PM3016_164"
                     /note="PcrB_like proteins. One member of this family, a
                     protein from Archaeoglobus fulgidus, has been
                     characterized as a (S)-3-O-geranylgeranylglyceryl
                     phosphate synthase (AfGGGPS). AfGGGPS catalyzes the
                     formation of an ether linkage between...; Region:
                     PcrB_like; cd02812"
                     /db_xref="CDD:239206"
     misc_feature    order(173248..173250,173689..173691,173695..173697,
                     173704..173706,173773..173781,173842..173844)
                     /locus_tag="PM3016_164"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239206"
     misc_feature    order(173254..173256,173332..173334,173689..173691,
                     173695..173697,173701..173703)
                     /locus_tag="PM3016_164"
                     /note="putative active site [active]"
                     /db_xref="CDD:239206"
     misc_feature    order(173467..173469,173482..173484,173494..173496,
                     173506..173508,173518..173520,173632..173634,
                     173641..173646,173656..173658,173665..173667,
                     173734..173736)
                     /locus_tag="PM3016_164"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239206"
     gene            173959..176274
                     /locus_tag="PM3016_165"
                     /db_xref="GeneID:11882125"
     CDS             173959..176274
                     /locus_tag="PM3016_165"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PcrA"
                     /protein_id="YP_005310296.1"
                     /db_xref="GI:379718165"
                     /db_xref="GeneID:11882125"
                     /translation="MINQPIDIFQAVNKLNPQQKQAVETVEGPLLIMAGAGSGKTRVL
                     THRIAYLIATRKAAPWSILAITFTNKAAREMQERVSSLVGPQGGDIWVSTFHSMCVRI
                     LRRDISRIGFTSNFSILDSGDQLSVIRNIMKEQNIDSKKFEPKAVQAAISNAKNELQT
                     PEMFERKIGDYFDGIVAKVYSSYQRKLRANNSLDFDDLIMTTIELFKQVPEVLDFYQN
                     KFQYIHVDEYQDTNRAQYMLCRMLADKHKRICVVGDSDQSIYKWRGADISNILDFEKD
                     YPNATTILLEQNYRSTSNILNAANKVIANNTGRKVKNLWTDKAEGDKIKVYQADSEHE
                     EGYFITGEIRRNLDNGRRYKDHAILYRTNAQSRVIEEILIKSDIPYQIVGGVKFYDRK
                     EIKDILAYLRLISNPDDDISFARVVNVPKRGIGDTSLDRLAGAAAQFGVSLFAMLENV
                     DSIEMAAKAKNALADFRDMIENLHRMVEYLSVTELTEKMLELSGYRDELRRENTIESQ
                     ARLENIDEFLSVTMDFEKRNEDKSLVSFLTDLALIADIDSMNADPEEGKQGVVLMTMH
                     SAKGLEFPVVFIMGLEEGVFPHSRAVADNEELEEERRLAYVGITRAEEQLFLTCARMR
                     TLFGRTAQNAPSRFLRELPPELLEPARPGGFGRGGGAGFGSAGGERRFGSAGGFGGSP
                     AAAAARTPVSFRGGGAAPATSATTGGASAASAPKSLDFAMGDKVSHGKWGTGTVVALK
                     GSGDDTELQIAFPAPVGVKRLLAKFAPITKV"
     misc_feature    173995..176262
                     /locus_tag="PM3016_165"
                     /note="ATP-dependent DNA helicase PcrA; Region: pcrA;
                     TIGR01073"
                     /db_xref="CDD:233261"
     misc_feature    174019..174255
                     /locus_tag="PM3016_165"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    <175633..175815
                     /locus_tag="PM3016_165"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            176331..178349
                     /locus_tag="PM3016_166"
                     /db_xref="GeneID:11882126"
     CDS             176331..178349
                     /locus_tag="PM3016_166"
                     /codon_start=1
                     /transl_table=11
                     /product="LigA protein"
                     /protein_id="YP_005310297.1"
                     /db_xref="GI:379718166"
                     /db_xref="GeneID:11882126"
                     /translation="MPSALETMQALIDEINKHNYLYYTLDQPSISDAEWDALYKRLQE
                     LEAQTGTILPDSPTLRVGGELLKGFESHRHMARLWSLDKAQTHDDLMAWHARVQKLVN
                     DYNSKHEDDPLPTPSFVVELKFDGLTLNLTYDKGELVQAATRGSGVVGEGILANVKTI
                     RSIPLRIPYTEGKIEVQGEGIMNLSVLEAYNQTAAEPLKNARNAAAGALRNLNPKVTA
                     ERKLNAYFYNIGYSESLQFTDHQEMVEFLRENRFKVSPHVKFFDSIEAVEAELQHLVS
                     IRHTFDFLIDGLVVKVNDMRTREVLGYTDKFPRWAVAYKFEAEEAVTTLLGVTWNVGR
                     TGKVTPLARVEPVDLAGVTVQNCTLNNMDDIERKNLKHALGSLIYIRRSNDVIPEILG
                     KVTEEADGEEIVPPSQCPYCGFPLEKKGPHLFCLNRYDCRPQLVGRIAHFASRDAMEI
                     DTFSEKTAEQLYDSLEVRDPSDLYYLTFDQLVGLERFGKKKAENLLSALERSKQCDLA
                     SFLYALGIPNTGKTTTKELADHYRSLEKVMTAEPEELVTLPDIGGIVAESISGFFRDP
                     AMLRSIERLLAAGVAPTAEEATVVVDENSEFFGKTVVLTGTLSSMGRDECAKKLEKLG
                     AKVTGSVSKKTDIVIAGESAGSKLTKAQELGIRIIEDEQELLRLLGEA"
     misc_feature    176331..178346
                     /locus_tag="PM3016_166"
                     /note="NAD-dependent DNA ligase LigA; Validated; Region:
                     ligA; PRK07956"
                     /db_xref="CDD:236137"
     misc_feature    176346..177284
                     /locus_tag="PM3016_166"
                     /note="NAD+ dependent DNA ligase adenylation domain. DNA
                     ligases catalyze the crucial step of joining the breaks in
                     duplex DNA during DNA replication, repair and
                     recombination, utilizing either ATP or NAD(+) as a
                     cofactor, but using the same basic reaction...; Region:
                     LIGANc; cd00114"
                     /db_xref="CDD:238062"
     misc_feature    order(176571..176573,176691..176693,176697..176699,
                     176760..176762,176865..176867,177009..177011,
                     177195..177197,177201..177203)
                     /locus_tag="PM3016_166"
                     /note="nucleotide binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238062"
     misc_feature    order(176697..176699,176703..176708)
                     /locus_tag="PM3016_166"
                     /note="K-X-D-G motif; other site"
                     /db_xref="CDD:238062"
     misc_feature    176697..176699
                     /locus_tag="PM3016_166"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238062"
     misc_feature    177291..177539
                     /locus_tag="PM3016_166"
                     /note="NAD-dependent DNA ligase OB-fold domain; Region:
                     DNA_ligase_OB; pfam03120"
                     /db_xref="CDD:145978"
     misc_feature    177651..177830
                     /locus_tag="PM3016_166"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     misc_feature    177858..178046
                     /locus_tag="PM3016_166"
                     /note="Helix-hairpin-helix motif; Region: HHH_2;
                     pfam12826"
                     /db_xref="CDD:257328"
     misc_feature    178125..178337
                     /locus_tag="PM3016_166"
                     /note="Breast Cancer Suppressor Protein (BRCA1),
                     carboxy-terminal domain. The BRCT domain is found within
                     many DNA damage repair and cell cycle checkpoint proteins.
                     The unique diversity of this domain superfamily allows
                     BRCT modules to interact forming homo...; Region: BRCT;
                     cd00027"
                     /db_xref="CDD:237994"
     misc_feature    order(178170..178172,178182..178184,178191..178193,
                     178200..178202,178206..178208)
                     /locus_tag="PM3016_166"
                     /note="Dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:237994"
     misc_feature    order(178320..178322,178332..178334)
                     /locus_tag="PM3016_166"
                     /note="BRCT sequence motif; other site"
                     /db_xref="CDD:237994"
     gene            178456..179454
                     /locus_tag="PM3016_167"
                     /db_xref="GeneID:11882127"
     CDS             178456..179454
                     /locus_tag="PM3016_167"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-24 subunit"
                     /protein_id="YP_005310298.1"
                     /db_xref="GI:379718167"
                     /db_xref="GeneID:11882127"
                     /translation="MLHIVNGDSFAAKLRKAVPDADILVWRESLYEGPLSVSFTDPKT
                     REARARYFTDLGVPAGQFEHFTSEQEQKLEGFRAYSQIVLWFEYDLYDQAMMIYLLQW
                     FARHNLEKVRLLLICIDSFPGIEPFRGLGSLTPQQILTLMGTWEEVTGEQLELAVRAW
                     NVYAGDNPAELFEFIRGDTAALPFLKRALECHLKRLPSLHNGLSAVLESALIGIRDGI
                     DSPAALFLKISDQWLDYGLGDVQFWRELNDAARCEKPLIVRRGGALPGFGNDNTGASV
                     KEIRLSLTPFGETVLAGKVDQVAVNGICTWFGGLFLSGKGPVWRWNQELGTAVYKK"
     misc_feature    178459..178755
                     /locus_tag="PM3016_167"
                     /note="Domain of unknown function (DUF1835); Region:
                     DUF1835; pfam08874"
                     /db_xref="CDD:255083"
     gene            179761..181285
                     /locus_tag="PM3016_r4"
                     /db_xref="GeneID:11882128"
     rRNA            179761..181285
                     /locus_tag="PM3016_r4"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:11882128"
     gene            181559..184486
                     /locus_tag="PM3016_r5"
                     /db_xref="GeneID:11882129"
     rRNA            181559..184486
                     /locus_tag="PM3016_r5"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:11882129"
     gene            184659..184774
                     /locus_tag="PM3016_r6"
                     /db_xref="GeneID:11882130"
     rRNA            184659..184774
                     /locus_tag="PM3016_r6"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11882130"
     gene            184789..184876
                     /locus_tag="PM3016_t3"
                     /db_xref="GeneID:11882131"
     tRNA            184789..184876
                     /locus_tag="PM3016_t3"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:11882131"
     gene            184906..184979
                     /locus_tag="PM3016_t4"
                     /db_xref="GeneID:11882132"
     tRNA            184906..184979
                     /locus_tag="PM3016_t4"
                     /product="tRNA-Met"
                     /db_xref="GeneID:11882132"
     gene            185022..185094
                     /locus_tag="PM3016_t5"
                     /db_xref="GeneID:11882133"
     tRNA            185022..185094
                     /locus_tag="PM3016_t5"
                     /product="tRNA-Val"
                     /db_xref="GeneID:11882133"
     gene            185113..185186
                     /locus_tag="PM3016_t6"
                     /db_xref="GeneID:11882134"
     tRNA            185113..185186
                     /locus_tag="PM3016_t6"
                     /product="tRNA-Met"
                     /db_xref="GeneID:11882134"
     gene            185204..185277
                     /locus_tag="PM3016_t7"
                     /db_xref="GeneID:11882135"
     tRNA            185204..185277
                     /locus_tag="PM3016_t7"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:11882135"
     gene            185329..185401
                     /locus_tag="PM3016_t8"
                     /db_xref="GeneID:11882136"
     tRNA            185329..185401
                     /locus_tag="PM3016_t8"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:11882136"
     gene            185410..185482
                     /locus_tag="PM3016_t9"
                     /db_xref="GeneID:11882137"
     tRNA            185410..185482
                     /locus_tag="PM3016_t9"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:11882137"
     gene            185495..185576
                     /locus_tag="PM3016_t10"
                     /db_xref="GeneID:11882138"
     tRNA            185495..185576
                     /locus_tag="PM3016_t10"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:11882138"
     gene            185595..185667
                     /locus_tag="PM3016_t11"
                     /db_xref="GeneID:11882139"
     tRNA            185595..185667
                     /locus_tag="PM3016_t11"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:11882139"
     gene            complement(185854..187104)
                     /locus_tag="PM3016_169"
                     /db_xref="GeneID:11882140"
     CDS             complement(185854..187104)
                     /locus_tag="PM3016_169"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310299.1"
                     /db_xref="GI:379718168"
                     /db_xref="GeneID:11882140"
                     /translation="MPNLRYGRGTVTLDIPPSLSWDSLSYPASLMEASPRLSLERIRQ
                     ALASPLGSPVLRDIAQGHERAIILISDGTRPCPNRLMLPLLLQELNDAGITDEQVDIV
                     VALGAHRRHTPKELVELAGEEIAARVRIHNHSSDSEDCRYVGTTKLGTPVEINRLVAD
                     ATLRIATGSIQPHALAGVSGGAKALVPGVASWRTIEHNHGLSLKYPGQAGEADTPLYA
                     DMVEAQSFTPLHFVLNVLLNHDNEVLEALAGDLLETHHRGAQLAAQYFLLPAHPLYDS
                     IVVSAGGAPRDLQLYQALKPLRNAAAFTRPGGKVLLVAECREMLGSGVLQDWLETMTD
                     LQRSTAALKQHFVLGAHKLLHVEEVLKRVEVHLYSSLAPHWVDLLGFSPVHDPSEWIL
                     SVTQQRNVSLAIIPFGSLTFPAPP"
     misc_feature    complement(185992..187098)
                     /locus_tag="PM3016_169"
                     /note="Domain of unknown function (DUF2088); Region:
                     DUF2088; cl15406"
                     /db_xref="CDD:265688"
     gene            187302..188402
                     /locus_tag="PM3016_170"
                     /db_xref="GeneID:11882141"
     CDS             187302..188402
                     /locus_tag="PM3016_170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310300.1"
                     /db_xref="GI:379718169"
                     /db_xref="GeneID:11882141"
                     /translation="MDWGTVREQLEGILSISVDTVRWPVSDWDHASEASGEPVSSVIK
                     NGRVYWLVQKQESEALLFAVDEQVVSDVERRLVDLVLSTKKEPEPKPARMPTEEERKA
                     GLVRDWLHQQQERGFTQAEMPDQLVSLLSLYSTKVPILLYGDYTTSRRVHYAELKKLL
                     DSFFDAEITLIPLTEKEWLILGSEKILTMDGGDDRISDEETLEDKLAAMGYGLHEMLE
                     NEWVGEAHLAVHYPMTPAKSLYSVVLQLRETIMLGRTYHVGSSMHLPWELQLEKLVHL
                     VPEAEKASFLERVLKRLDVAFDPETMTTLEQFFQLDCNVSETAKKLYIHRNTLLYRLD
                     KFKQETGLDVRTFNNAVLVKIAMLLYKVTKRK"
     misc_feature    <187437..188399
                     /locus_tag="PM3016_170"
                     /note="Regulator of polyketide synthase expression [Signal
                     transduction mechanisms / Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: COG2508"
                     /db_xref="CDD:225306"
     misc_feature    188211..188378
                     /locus_tag="PM3016_170"
                     /note="PucR C-terminal helix-turn-helix domain; Region:
                     HTH_30; pfam13556"
                     /db_xref="CDD:257873"
     gene            188493..189617
                     /locus_tag="PM3016_171"
                     /db_xref="GeneID:11882142"
     CDS             188493..189617
                     /locus_tag="PM3016_171"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MsmX"
                     /protein_id="YP_005310301.1"
                     /db_xref="GI:379718170"
                     /db_xref="GeneID:11882142"
                     /translation="MAGVRLNHIVKRYPGAAEATVKDFHLDIKDKEFLVLVGASGCGK
                     STTLRMIAGLEEITEGELYIGDRLVNDVAPKDRDIAMVFQSYALYPHMNVYQNMAFGL
                     KLRKFKKADIDARVREAAKILDIEHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMD
                     EPLSNLDAKLRVQMRAEIGKLHKRLETTIIYVTHDQTEAMTMGDRIVVMDKGIIQQAA
                     TPEEIYNYPKNMFVAGFIGSPSMNFVSGTFAEQNGGVYFKAQGLNVEVPEGKAKVLRE
                     KGYIGKEVVMGIRPEDFHEEAIFMEASPNTIVNVNIELSENLGHEMYLYLNGIGTQTV
                     IARVDGRASFKEGTTVKLALDMNKAHFFDKETTQSILVNA"
     misc_feature    188493..189602
                     /locus_tag="PM3016_171"
                     /note="glycerol-3-phosphate transporter ATP-binding
                     subunit; Provisional; Region: ugpC; PRK11650"
                     /db_xref="CDD:236947"
     misc_feature    188502..189140
                     /locus_tag="PM3016_171"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    188604..188627
                     /locus_tag="PM3016_171"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(188613..188618,188622..188630,188742..188744,
                     188970..188975,189072..189074)
                     /locus_tag="PM3016_171"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    188733..188744
                     /locus_tag="PM3016_171"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    188898..188927
                     /locus_tag="PM3016_171"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    188958..188975
                     /locus_tag="PM3016_171"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    188982..188993
                     /locus_tag="PM3016_171"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    189060..189080
                     /locus_tag="PM3016_171"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     gene            189742..190683
                     /locus_tag="PM3016_172"
                     /db_xref="GeneID:11882143"
     CDS             189742..190683
                     /locus_tag="PM3016_172"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HprK"
                     /protein_id="YP_005310302.1"
                     /db_xref="GI:379718171"
                     /db_xref="GeneID:11882143"
                     /translation="MAKKVKVSDLVREFHLEVICGEEGLKRPIATADLYRPGLELAGY
                     YEFHPHDRVQILGKTELTFFDGLTSEERTDRMERICSPKDIPCVILSRSLEAPIELLA
                     SANEHKIPVLRTAMATTILASRLTNFLENRLAPTTTIHGVLVDVYGIGMLISGSSGIG
                     KSETALELVKRGHRLIADDAVEIRQTADHQLIGNAPELIRHLLEIRGIGIINVMTLFG
                     AGAVRTEKKIAVVCKLETWQQDKQYDRLGLDEETTRIIDTDVPLVTIPVRPGRNLAVI
                     IEVAAMNYRLKRMGYNAALQFTNKLTESLAEDMDDLD"
     misc_feature    189748..190665
                     /locus_tag="PM3016_172"
                     /note="HPr kinase/phosphorylase; Provisional; Region:
                     PRK05428"
                     /db_xref="CDD:235459"
     misc_feature    189748..190131
                     /locus_tag="PM3016_172"
                     /note="HPr Serine kinase N terminus; Region: Hpr_kinase_N;
                     pfam02603"
                     /db_xref="CDD:190362"
     misc_feature    190144..190593
                     /locus_tag="PM3016_172"
                     /note="HprK/P, the bifunctional histidine-containing
                     protein kinase/phosphatase, controls the phosphorylation
                     state of the phosphocarrier protein HPr and regulates the
                     utilization of carbon sources by gram-positive bacteria.
                     It catalyzes both the ATP-dependent...; Region: HprK_C;
                     cd01918"
                     /db_xref="CDD:238899"
     misc_feature    order(190153..190155,190159..190161,190210..190215,
                     190222..190224,190237..190239,190249..190251,
                     190276..190281,190285..190287,190333..190335,
                     190351..190353,190363..190371,190384..190386,
                     190474..190482,190531..190533,190564..190566,
                     190573..190575)
                     /locus_tag="PM3016_172"
                     /note="Hpr binding site; other site"
                     /db_xref="CDD:238899"
     misc_feature    order(190159..190161,190213..190215,190219..190227,
                     190273..190278,190351..190353,190357..190359)
                     /locus_tag="PM3016_172"
                     /note="active site"
                     /db_xref="CDD:238899"
     misc_feature    order(190231..190233,190237..190239,190249..190254,
                     190261..190263,190333..190335,190345..190347,
                     190363..190365,190369..190377,190384..190392,
                     190528..190530,190576..190581,190585..190587)
                     /locus_tag="PM3016_172"
                     /note="homohexamer subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238899"
     gene            190765..191814
                     /locus_tag="PM3016_173"
                     /db_xref="GeneID:11882144"
     CDS             190765..191814
                     /locus_tag="PM3016_173"
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="YP_005310303.1"
                     /db_xref="GI:379718172"
                     /db_xref="GeneID:11882144"
                     /translation="MLFAMSTVAFSIGPISVHWYGIILGLAALTGLMLAVQEGKRFGI
                     PSDFFMDMLLIGVPSAIIGARIYYVAFQWDDYKDNPITALYIWQGGIAIYGALIGAII
                     GAGIYFKRKGYSFWRIADICAPGLIVGQAIGRWGNFINKEAHGGPVDAAFLSNNLHLP
                     SWIVSQMQIDGTYYHPTFLYESLWNLVGLLLLFVLRRQRFLRAGELFLSYFIWYGIGR
                     FFIEGLRTDSLGFTGPDWLAALMNGLWSPMTLLGFTPGDMSMNGGNVRVSQMLALLFI
                     IGAVALMIIRRATGASSEKYSDPIYRRGEAPSQDAGAAGNAAGTPAGTAGNGKQTAGT
                     EHHSKEPDHDPNRTV"
     misc_feature    190777..191658
                     /locus_tag="PM3016_173"
                     /note="prolipoprotein diacylglyceryl transferase;
                     Reviewed; Region: PRK12437"
                     /db_xref="CDD:183527"
     gene            191792..192445
                     /locus_tag="PM3016_174"
                     /db_xref="GeneID:11882145"
     CDS             191792..192445
                     /locus_tag="PM3016_174"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrophosphatase PpaX"
                     /protein_id="YP_005310304.1"
                     /db_xref="GI:379718173"
                     /db_xref="GeneID:11882145"
                     /translation="MIQTVLFDLDGTILDTNELIIQSFLHTFEGVTAEPLTRHHIIPN
                     MGRPLVEQMVFFSGREEVEDLVAKYRHFNLTRHDELVKEFPKVRETLARLHAAGIRMG
                     VVTSKIRKTTEMGLKLTGIYDYFGSIVTVEDVEKAKPDPEGIRKALQELGADPATAVM
                     VGDSHYDIEAAHNAGLPSVAVAWSLKGMEYLQGYSPTHIIHDIEQLLGIIGLEEKQV"
     misc_feature    191792..192433
                     /locus_tag="PM3016_174"
                     /note="pyrophosphatase PpaX; Provisional; Region:
                     PRK13288"
                     /db_xref="CDD:237336"
     misc_feature    191804..192334
                     /locus_tag="PM3016_174"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(191813..191821,192104..192109)
                     /locus_tag="PM3016_174"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    191813..191830
                     /locus_tag="PM3016_174"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    192104..192106
                     /locus_tag="PM3016_174"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            192442..192945
                     /locus_tag="PM3016_175"
                     /db_xref="GeneID:11882146"
     CDS             192442..192945
                     /locus_tag="PM3016_175"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310305.1"
                     /db_xref="GI:379718174"
                     /db_xref="GeneID:11882146"
                     /translation="MRQTDRYPVDGPNSLWQVYRTIPRWKAVRNFIFIQISRYAPSLP
                     LKLWIYRRILGMKVGRHTSFALMVMVDVFFPERIEVGENTIIGYNSTILTHEYLIKEY
                     RLGHVRIGSNVMIGANTTVLPGVTIGDGAIVGAGSVVHKDVAPYSFVAGNPLQVIRTD
                     VREDDRA"
     misc_feature    192484..192918
                     /locus_tag="PM3016_175"
                     /note="Acetyltransferase (isoleucine patch superfamily)
                     [General function prediction only]; Region: WbbJ; COG0110"
                     /db_xref="CDD:223188"
     misc_feature    <192499..192648
                     /locus_tag="PM3016_175"
                     /note="cyclophilin: cyclophilin-type peptidylprolyl cis-
                     trans isomerases. This family contains eukaryotic,
                     bacterial and archeal proteins which exhibit a
                     peptidylprolyl cis- trans isomerases activity (PPIase,
                     Rotamase) and in addition bind the...; Region:
                     cyclophilin; cl00197"
                     /db_xref="CDD:260252"
     misc_feature    192604..192912
                     /locus_tag="PM3016_175"
                     /note="Maltose O-acyltransferase (MAT)-like: This family
                     is composed of maltose O-acetyltransferase, galactoside
                     O-acetyltransferase (GAT), xenobiotic acyltransferase
                     (XAT) and similar proteins. MAT and GAT catalyze the
                     CoA-dependent acetylation of the...; Region: LbH_MAT_like;
                     cd04647"
                     /db_xref="CDD:100053"
     misc_feature    order(192622..192624,192628..192630,192652..192654,
                     192688..192690,192694..192696,192712..192714,
                     192730..192738,192775..192777,192781..192783,
                     192790..192792,192847..192849,192895..192897)
                     /locus_tag="PM3016_175"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100053"
     misc_feature    order(192628..192630,192634..192636,192730..192732,
                     192736..192738,192781..192783,192787..192792,
                     192805..192807,192841..192846,192859..192864,
                     192889..192894,192898..192900)
                     /locus_tag="PM3016_175"
                     /note="active site"
                     /db_xref="CDD:100053"
     misc_feature    order(192628..192630,192634..192636,192730..192732)
                     /locus_tag="PM3016_175"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100053"
     misc_feature    order(192730..192732,192736..192738,192781..192783,
                     192787..192792,192805..192807,192835..192837,
                     192841..192846,192859..192864,192883..192885,
                     192889..192894,192898..192900,192910..192912)
                     /locus_tag="PM3016_175"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100053"
     gene            193251..194429
                     /locus_tag="PM3016_176"
                     /db_xref="GeneID:11882147"
     CDS             193251..194429
                     /locus_tag="PM3016_176"
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase 2"
                     /protein_id="YP_005310306.1"
                     /db_xref="GI:379718175"
                     /db_xref="GeneID:11882147"
                     /translation="MSKPKVFEKPTGVKDYLPEAAAKLRSIELNVMQCMERWGYREII
                     TPTLEYYDTVGVASSTEDKKLFKLLDRNGTTLVLRSDMTAPIARVVSSLLQNEAFPLR
                     LSYQANVFRAFEAEAGRDAEFFQTGVELVGDASSESDAEVIALAIACLQAAGVKQFKI
                     AVGHVGFLNGLLQETLKHDAEAQTLLKGCLLNRDYVGYREALQELQLTERVRGELEGI
                     LRLRGGQEICRQARELTEDPVAQHAIAHLCEVWDVLQAYGVSDHVLIDLTMIGDFSYY
                     TGMTFEGYAADLGFPVCSGGRYDNLLKQFGRPAPATGFALKTNRILEVVGRETLGRRL
                     RKTLVLYTAGRRADALARAAELRTEEGRTVETRLIPEGFFVAVQGLPYDDVLEFVGEG
                     "
     misc_feature    193269..194384
                     /locus_tag="PM3016_176"
                     /note="ATP phosphoribosyltransferase regulatory subunit;
                     Provisional; Region: hisZ; PRK12292"
                     /db_xref="CDD:237043"
     misc_feature    193311..194225
                     /locus_tag="PM3016_176"
                     /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
                     catalytic core domain. HisRS is a homodimer. It is
                     responsible for the attachment of histidine to the 3' OH
                     group of ribose of the appropriate tRNA. This domain is
                     primarily responsible for...; Region: HisRS-like_core;
                     cd00773"
                     /db_xref="CDD:238396"
     misc_feature    order(193323..193325,193359..193361,193374..193394,
                     193452..193457,193491..193493,193497..193499,
                     193512..193517,193524..193529,193611..193616,
                     193635..193637,193659..193661,193671..193673,
                     193680..193682,194136..194138,194187..194192)
                     /locus_tag="PM3016_176"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238396"
     misc_feature    193368..193394
                     /locus_tag="PM3016_176"
                     /note="motif 1; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(193491..193493,193497..193499,193581..193583,
                     193587..193589,193608..193610,193617..193619,
                     193623..193625,193635..193637,194061..194063,
                     194067..194069,194073..194078,194121..194123,
                     194136..194138,194190..194192,194199..194201,
                     194208..194210)
                     /locus_tag="PM3016_176"
                     /note="active site"
                     /db_xref="CDD:238396"
     misc_feature    193578..193592
                     /locus_tag="PM3016_176"
                     /note="motif 2; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(194187..194201,194208..194210)
                     /locus_tag="PM3016_176"
                     /note="motif 3; other site"
                     /db_xref="CDD:238396"
     gene            194444..195091
                     /locus_tag="PM3016_177"
                     /db_xref="GeneID:11882148"
     CDS             194444..195091
                     /locus_tag="PM3016_177"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HisG"
                     /protein_id="YP_005310307.1"
                     /db_xref="GI:379718176"
                     /db_xref="GeneID:11882148"
                     /translation="MQELLKVAMPKGRIYKQASKLFREAGLAIPDDADDSRKLIIQVP
                     EANMEFIMAKPVDVPTYVEYGVADIGVVGKDVLMEENRDVYELLDLGIARCRMSVIAL
                     PDWQPVINPRVATKYPNVASQYFREQGQQVEVIKLNGSIELAPMIGLADRIVDMVETG
                     STIRENGLKEYEQIFSITSRLIANRVSYRMKNNAIQALCDRLQPAIAAATAGAGK"
     misc_feature    194456..>195052
                     /locus_tag="PM3016_177"
                     /note="ATP phosphoribosyltransferase [Amino acid transport
                     and metabolism]; Region: HisG; COG0040"
                     /db_xref="CDD:223118"
     misc_feature    194456..195052
                     /locus_tag="PM3016_177"
                     /note="ATP phosphoribosyltransferase catalytic subunit;
                     Reviewed; Region: hisG; PRK01686"
                     /db_xref="CDD:234971"
     gene            195243..196535
                     /locus_tag="PM3016_178"
                     /db_xref="GeneID:11882149"
     CDS             195243..196535
                     /locus_tag="PM3016_178"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HisD"
                     /protein_id="YP_005310308.1"
                     /db_xref="GI:379718177"
                     /db_xref="GeneID:11882149"
                     /translation="MKVMPASEFSLKREVEYGSPEQNEAVQRIIEEVRQDGDAALRRF
                     AQQFDGVNVGDLRVSSAEIEAAYQQVDEDFLTAIREASVNIRRFHEKQMRTSWMDLQG
                     DGSILGQVIRPLRRVGLYVPGGKAAYPSSVLMNAIPAQVAGVPEIVMVTPPATAGVEG
                     IDPHILVAAAEAGVKEIYRVGGAQAVAALAYGTESIPAADKIVGPGNIYVALAKRYVF
                     GAVDIDSIAGPSEIVVLADGSADPAYVAADLLSQAEHDEMASAILITPSEDLANAVRT
                     EVELQLQALPRREIAAQSIRDYGAILTVSSLEEGVDAVNRLAPEHLEILVADPFQYLS
                     RIENAGAVFLGPYSSEPVGDYFAGPNHVLPTNGTARFSSPLNVDDFLKKSSVIYYSKE
                     ALLRDGEKIMTLARHEGLEAHARAIEIRLEKEGNRNGQ"
     misc_feature    195312..196481
                     /locus_tag="PM3016_178"
                     /note="Histidinol dehydrogenase, HisD, E.C 1.1.1.23.
                     Histidinol dehydrogenase catalyzes the last two steps in
                     the L-histidine biosynthesis pathway, which is conserved
                     in bacteria, archaea, fungi, and plants. These last two
                     steps are (i) the NAD-dependent...; Region: Histidinol_dh;
                     cd06572"
                     /db_xref="CDD:119329"
     misc_feature    195318..196502
                     /locus_tag="PM3016_178"
                     /note="histidinol dehydrogenase; Region: hisD; TIGR00069"
                     /db_xref="CDD:232808"
     misc_feature    order(195384..195386,195600..195602,195606..195611,
                     195633..195635,195696..195698,195783..195788,
                     195792..195794,195855..195863,195867..195872,
                     196005..196007)
                     /locus_tag="PM3016_178"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    order(195459..195464,195471..195476,195480..195482,
                     195489..195494,195501..195506,195513..195518,
                     195537..195539,195543..195545,195555..195569,
                     195576..195578,195582..195584,195618..195632,
                     195840..195842,195885..195887,195897..195899,
                     195969..195974,195981..195986,195990..195998,
                     196002..196007,196215..196217,196230..196232,
                     196239..196244,196248..196274,196278..196280,
                     196284..196289,196293..196307,196311..196313,
                     196317..196319,196347..196352,196356..196370,
                     196374..196379,196386..196409,196452..196457,
                     196461..196481)
                     /locus_tag="PM3016_178"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    order(195624..195626,195630..195632,195930..195932,
                     196005..196007,196200..196205,196290..196292,
                     196302..196307,196323..196325,196464..196466,
                     196470..196472,196479..196481)
                     /locus_tag="PM3016_178"
                     /note="product binding site; other site"
                     /db_xref="CDD:119329"
     misc_feature    order(195630..195632,195930..195932,195996..195998,
                     196005..196007,196200..196205,196290..196292,
                     196302..196307,196323..196325,196464..196466,
                     196470..196472,196479..196481)
                     /locus_tag="PM3016_178"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    order(195996..195998,196005..196007,196302..196304,
                     196479..196481)
                     /locus_tag="PM3016_178"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    196200..196205
                     /locus_tag="PM3016_178"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:119329"
     gene            196525..197136
                     /locus_tag="PM3016_179"
                     /db_xref="GeneID:11882150"
     CDS             196525..197136
                     /locus_tag="PM3016_179"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HisB"
                     /protein_id="YP_005310309.1"
                     /db_xref="GI:379718178"
                     /db_xref="GeneID:11882150"
                     /translation="MANEQDQQAVRRSEVARKTNETDIRLAFAVDGSGVSEIETDVPF
                     LNHMLDLFTKHGQFDLRVDAKGDVEIDDHHTVEDIGICLGQTLREALGDKRGIKRYAS
                     VFVPMDEALAQVVIDVSNRPHFEYRAQYPSQTVGSFQVELVHEFLWKLALEARITLHV
                     IVHYGLNTHHMIEAVFKALGRALDEATSIDPRVQGVPSTKGVL"
     misc_feature    196561..197133
                     /locus_tag="PM3016_179"
                     /note="Imidazoleglycerol-phosphate dehydratase; Region:
                     IGPD; cd07914"
                     /db_xref="CDD:153419"
     misc_feature    order(196585..196587,196663..196665,196675..196677,
                     196684..196689,196741..196746,196753..196755,
                     196819..196821,196843..196848,196885..196887,
                     196957..196959,197029..197034,197041..197043)
                     /locus_tag="PM3016_179"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:153419"
     misc_feature    order(196651..196656,196663..196665,196729..196737,
                     196741..196746,196918..196932,196939..196941,
                     196945..196947,196954..196959,197020..197034)
                     /locus_tag="PM3016_179"
                     /note="4-fold oligomerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:153419"
     misc_feature    order(196663..196665,196741..196746,196753..196755,
                     196957..196959,197029..197034,197041..197043)
                     /locus_tag="PM3016_179"
                     /note="metal binding residues [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153419"
     misc_feature    order(196816..196818,196822..196824,196828..196836,
                     196840..196848,196852..196857,196867..196875,
                     196885..196887,196891..196893,196993..196995,
                     196999..197001,197005..197007,197011..197013,
                     197065..197067,197074..197076,197092..197094)
                     /locus_tag="PM3016_179"
                     /note="3-fold/trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:153419"
     gene            197140..197766
                     /locus_tag="PM3016_180"
                     /db_xref="GeneID:11882151"
     CDS             197140..197766
                     /locus_tag="PM3016_180"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HisH"
                     /protein_id="YP_005310310.1"
                     /db_xref="GI:379718179"
                     /db_xref="GeneID:11882151"
                     /translation="MIAIIDYGVGNLHSVRSAVERLGYEALVTSDEAEILGAAGAILP
                     GVGAFGDAMAHLREAKLADTVRKAADSGKPLLGICLGMQLLFSRSEEHGEHEGLGLLP
                     GEVIRFRGDYKVPHMGWNKLSYKQESPLFRELPEGHVYFVHSYHVLPEQASDLLATTD
                     YYQEVTAIVGRGNVFGMQFHPEKSGSVGMKLLGNFLALCEGRAAAGQL"
     misc_feature    197140..197715
                     /locus_tag="PM3016_180"
                     /note="imidazole glycerol phosphate synthase subunit HisH;
                     Provisional; Region: hisH; PRK13142"
                     /db_xref="CDD:171871"
     misc_feature    197143..197727
                     /locus_tag="PM3016_180"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in imidazole glycerol phosphate synthase (IGPS);
                     Region: GATase1_IGP_Synthase; cd01748"
                     /db_xref="CDD:153219"
     misc_feature    order(197257..197280,197368..197382,197677..197679,
                     197683..197685)
                     /locus_tag="PM3016_180"
                     /note="putative active site [active]"
                     /db_xref="CDD:153219"
     misc_feature    197257..197280
                     /locus_tag="PM3016_180"
                     /note="oxyanion strand; other site"
                     /db_xref="CDD:153219"
     misc_feature    order(197374..197376,197677..197679,197683..197685)
                     /locus_tag="PM3016_180"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153219"
     gene            197808..198566
                     /locus_tag="PM3016_181"
                     /db_xref="GeneID:11882152"
     CDS             197808..198566
                     /locus_tag="PM3016_181"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HisF"
                     /protein_id="YP_005310311.1"
                     /db_xref="GI:379718180"
                     /db_xref="GeneID:11882152"
                     /translation="MLAKRIIPCLDVKDGRVVKGVNFVNLRDAGDPVELAAIYDKEGA
                     DELVFLDISASHEGRATMVEVVQQTAEQVTIPFTVGGGIGSVDDMKRMLRAGADKIGI
                     NTAALRNPQLISDGARRFGSQCIVVAVDARFNSEWGEWEVFTHGGRNATGIRALEWVK
                     RAETLGAGELLLTSMDADGTKDGFDIKLTRAVSELVSIPVIASGGAGRKEHFAEVFEQ
                     GKADAGLAATIFHYKEMTIEEVKDDLRSKGVEVR"
     misc_feature    197817..198548
                     /locus_tag="PM3016_181"
                     /note="The cyclase subunit of imidazoleglycerol phosphate
                     synthase (HisF). Imidazole glycerol phosphate synthase
                     (IGPS) catalyzes the fifth step of histidine biosynthesis,
                     the formation of the imidazole ring. IGPS converts
                     N1-(5'-phosphoribulosyl)...; Region: HisF; cd04731"
                     /db_xref="CDD:240082"
     misc_feature    order(197862..197864,197955..197957,198051..198053,
                     198114..198119,198189..198191,198195..198197,
                     198243..198245,198324..198326,198339..198344,
                     198414..198422,198486..198491)
                     /locus_tag="PM3016_181"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240082"
     misc_feature    order(197925..197927,197940..197942,198006..198008,
                     198018..198020,198027..198029,198033..198035,
                     198090..198092,198099..198104,198174..198176,
                     198312..198314,198396..198398,198471..198473)
                     /locus_tag="PM3016_181"
                     /note="glutamase interaction surface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:240082"
     gene            198563..199270
                     /locus_tag="PM3016_182"
                     /db_xref="GeneID:11882153"
     CDS             198563..199270
                     /locus_tag="PM3016_182"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HisI"
                     /protein_id="YP_005310312.1"
                     /db_xref="GI:379718181"
                     /db_xref="GeneID:11882153"
                     /translation="MSGAQGAVESIEALQAAVKWDAHGLVPAIVQDALSKEVLMMAYM
                     NEESLKLTLESGETWFWSRSRQELWHKGATSGHTQKVTSLRYDCDGDTLLVLVEQKGP
                     ACHTGSYSCFFNDVKLGALAGAEAAAANESDRFAMLAKVEAVIAQRDAERPEGAYTTY
                     LFEKGIDKILKKIGEEAGEVIIAAKNQDNDELRYEATDLLFHLMVLLRERKVPLDDLM
                     FELGRRYNKPKSEYSLE"
     misc_feature    198593..199234
                     /locus_tag="PM3016_182"
                     /note="bifunctional phosphoribosyl-AMP
                     cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein;
                     Reviewed; Region: PRK02759"
                     /db_xref="CDD:235067"
     misc_feature    198596..198913
                     /locus_tag="PM3016_182"
                     /note="phosphoribosyl-AMP cyclohydrolase; Reviewed;
                     Region: hisI; PRK00051"
                     /db_xref="CDD:234598"
     misc_feature    198974..199225
                     /locus_tag="PM3016_182"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) MazG-like domain found in Escherichia coli
                     phosphoribosyl-ATP pyrophosphohydrolase (HisIE or
                     PRATP-PH) and its homologs; Region: NTP-PPase_HisIE_like;
                     cd11534"
                     /db_xref="CDD:212141"
     misc_feature    order(199088..199090,199097..199099,199145..199147,
                     199154..199156)
                     /locus_tag="PM3016_182"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212141"
     gene            199283..200098
                     /locus_tag="PM3016_183"
                     /db_xref="GeneID:11882154"
     CDS             199283..200098
                     /locus_tag="PM3016_183"
                     /codon_start=1
                     /transl_table=11
                     /product="HisJ family histidinol phosphate phosphatase"
                     /protein_id="YP_005310313.1"
                     /db_xref="GI:379718182"
                     /db_xref="GeneID:11882154"
                     /translation="MRIDYHTHHVRCGHASGDLEEYVVKGIEIGLTQLGLSDHMPLLH
                     VDPETYLPGMAMPMDELPRYVEEAFRLQQKYKDQIDIRVGLEGDYIEGWEKQIEEIIR
                     AYPWDYVIGSVHFLGEWDITDYRQTDGWKERDAYAVYEQYYDAVVKACRTGFYDYIGH
                     IDVIKRFGFKPDRNVEHLENMALEAVKAANMAIELNASGLRMPVQEMFPSRRMLEYAL
                     KLGIPVTLGSDAHQPERLAQYLDEASALLQDVGFTDLATFKVRNRQNVPIGFE"
     misc_feature    199283..200089
                     /locus_tag="PM3016_183"
                     /note="histidinol-phosphatase; Provisional; Region:
                     PRK07328"
                     /db_xref="CDD:235992"
     misc_feature    199289..200011
                     /locus_tag="PM3016_183"
                     /note="Polymerase and Histidinol Phosphatase domain of
                     Histidinol phosphate phosphatase of Hisj like; Region:
                     PHP_HisPPase_Hisj_like; cd12110"
                     /db_xref="CDD:213994"
     misc_feature    order(199298..199300,199304..199306,199322..199324,
                     199397..199399,199538..199540,199622..199624,
                     199760..199762,199967..199969,199973..199975)
                     /locus_tag="PM3016_183"
                     /note="active site"
                     /db_xref="CDD:213994"
     misc_feature    order(199307..199315,199319..199330,199334..199339,
                     199466..199471,199478..199483,199487..199495,
                     199499..199501)
                     /locus_tag="PM3016_183"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:213994"
     gene            200218..201168
                     /locus_tag="PM3016_184"
                     /db_xref="GeneID:11882155"
     CDS             200218..201168
                     /locus_tag="PM3016_184"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310314.1"
                     /db_xref="GI:379718183"
                     /db_xref="GeneID:11882155"
                     /translation="MYSDKMKIFSGSSNPKLAEQICRELEVPLGQIKLSRFKSGEIYC
                     LYEESIRNCDVFLVQTFSHSINENFMELLVMMDAAKRASARTINLVVPYYGYSRQERK
                     AAPREPISAKLVADLLTAAGADRVITIDLHAPAIQGFFDIPVDHLTALDLISDYMKKL
                     NVPNPIIVSPDAGRATTAEKMANILDAPFAMMIKKRPAHNEAVITHVIGDVAGMTPII
                     IEDLIDTGTTIVNVVEGLKERGAHDAYICATHPVFSGPALQRLDHPNIKEVVITDSIA
                     IPEDHSARFRVLSVSHLLADAINIIMSGGSLSSLFKYGGV"
     misc_feature    200233..201150
                     /locus_tag="PM3016_184"
                     /note="ribose-phosphate pyrophosphokinase; Provisional;
                     Region: PRK01259"
                     /db_xref="CDD:234929"
     misc_feature    200233..200583
                     /locus_tag="PM3016_184"
                     /note="N-terminal domain of ribose phosphate
                     pyrophosphokinase; Region: Pribosyltran_N; pfam13793"
                     /db_xref="CDD:258077"
     misc_feature    200662..201039
                     /locus_tag="PM3016_184"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(200728..200730,200734..200736,200875..200883,
                     200887..200901,200971..200973)
                     /locus_tag="PM3016_184"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            201339..203093
                     /locus_tag="PM3016_185"
                     /db_xref="GeneID:11882156"
     CDS             201339..203093
                     /locus_tag="PM3016_185"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310315.1"
                     /db_xref="GI:379718184"
                     /db_xref="GeneID:11882156"
                     /translation="MEKKKRALPQTHTNVVPMKMDATFFFEKAVQSMDRYHYDKALKY
                     FRRAAEYEPENAVNHCNLAGLLSEMGNYEESNRILQHVLDQIDPAMTECYFYMANNFA
                     NMENYESAEKAIVHYLENDPTGQFLEESEEMMELLSFELERPAKLSTIKSREGLFEHD
                     RARALLEEGKFSEAVRILENIVKKHSDFMAARNNLALAYYYMGHFDKSVDMIKQVLEL
                     EPGNLHALCNLAIFYQHFGDKVALGELLEVLRKTYPFHQDHVFKLATTMGILSEHDKA
                     YRLFKRLLKTGEAGLDPCLFHYTAVAAYNTGRYAEAERQWRQAEKFDPTSEIPKFYLN
                     LLNKYKQDKIKPNVSYHYHLPFEEQFRGIERGENGLPEHLKRDPLVRSSFFWALRHGD
                     GDTKLQVIQAFALIGDDEVKDSLTQFILEPGEDDYLKKVAIFVLRSIGVREPLQAVLE
                     GKETTVAPSPFAPNLPVWDRKWQGIMEMAMRHMARRYDMVQQYDLQTLWVEYLTRVFP
                     NVPKMAKPEGWAAALEYLTAKMHRRPITYGDAAARYGVSIATVSKNAKTIDEACGLRE
                     KMAAIFSKFAELDSSHES"
     misc_feature    201399..201602
                     /locus_tag="PM3016_185"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    201435..201707
                     /locus_tag="PM3016_185"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(201459..201461,201471..201473,201480..201482,
                     201525..201527,201561..201563,201573..201575,
                     201582..201584,201630..201632,201666..201668,
                     201678..201680,201687..201689)
                     /locus_tag="PM3016_185"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(201516..201521,201525..201530,201537..201542,
                     201621..201626,201633..201638,201645..201650)
                     /locus_tag="PM3016_185"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    201816..202004
                     /locus_tag="PM3016_185"
                     /note="Tetratricopeptide repeat; Region: TPR_16;
                     pfam13432"
                     /db_xref="CDD:257757"
     misc_feature    201819..202079
                     /locus_tag="PM3016_185"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(201822..201824,201858..201860,201870..201872,
                     201879..201881,201924..201926,201960..201962,
                     201972..201974,201981..201983,202026..202028,
                     202062..202064,202074..202076)
                     /locus_tag="PM3016_185"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(201825..201830,201915..201920,201924..201929,
                     201936..201941,202017..202022,202029..202034,
                     202041..202046)
                     /locus_tag="PM3016_185"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    201921..202106
                     /locus_tag="PM3016_185"
                     /note="Tetratricopeptide repeat; Region: TPR_16;
                     pfam13432"
                     /db_xref="CDD:257757"
     gene            203138..204091
                     /locus_tag="PM3016_186"
                     /db_xref="GeneID:11882157"
     CDS             203138..204091
                     /locus_tag="PM3016_186"
                     /codon_start=1
                     /transl_table=11
                     /product="protein TrxB"
                     /protein_id="YP_005310316.1"
                     /db_xref="GI:379718185"
                     /db_xref="GeneID:11882157"
                     /translation="MYKSIVIGTGPAGLTAAIYLARANLNPLVIEGPEPGGQLTTTTE
                     VENFPGFPEGIMGPELMANMRKQAERFGAEFKTGWVNNVDLSKRPFKLNVEGLGDIEA
                     ESLIISTGASAKLLGIANEKESIGRGVSTCATCDGFFFRGKKIIVVGGGDSAMEEANF
                     LTRFATEVRLVHRREELRASKIMQDRARENSKITWSLNRTPLEVISGEKGVTGLKVKN
                     NETGEEEILETDGIFVAIGHKPNTDFLKGQIVTDEVGYIQVKPGSSLTNIEGVFACGD
                     VQDSKYRQAITAAGSGCMAALDCEKFLEGHMVHDWSQSLNK"
     misc_feature    203150..204046
                     /locus_tag="PM3016_186"
                     /note="thioredoxin-disulfide reductase; Region:
                     TRX_reduct; TIGR01292"
                     /db_xref="CDD:233345"
     misc_feature    203150..203662
                     /locus_tag="PM3016_186"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    203567..203773
                     /locus_tag="PM3016_186"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            204248..209482
                     /locus_tag="PM3016_187"
                     /db_xref="GeneID:11882158"
     CDS             204248..209482
                     /locus_tag="PM3016_187"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310317.1"
                     /db_xref="GI:379718186"
                     /db_xref="GeneID:11882158"
                     /translation="MYRILWILGKEKSDSLKKLSKRIIPAVLSSVLLIGGSLPVGAAP
                     DAGQGLAVDPANMLLVPSLQLQGLAASPVQLLQQKGLTVTENKDTGAPRFLMGALSAR
                     LNTDEAVLQYVSLNQQVFGLQNAAAELGLVRKNTDDIGQSHYLYQQKYRGVPVYGKYI
                     NLHLDSSKKAYAIQNQLMGSVGGLSVDVTPALSGQEAVAKLQAELESTIGQSITLGGK
                     IGEKVEVPLPEAKLVVYPFEGETHLAYEIKFTYIQPEIGSWVGFVDAHTGAIIHKYSN
                     LHHADGDGAVVSENVGHKGDKKQLNVLKDGNTYYLADITKRMFMEHPGHEDSGEVLTL
                     EYAGETPQGFLGKLQSSNSPVFNSQKGTSAAHGVDAHYYAGHVYDFFLKEFGRNSLDG
                     KGMDIVSMVHVPQAMDNAYWLGGANAIIYGDGDRYDCLACAGDIVAHELSHGVTQFSA
                     GLVYENQPGALNESFSDIIASVFDSEDWLLGEDTGNILRSLENPEQHGQPKHMDHFQE
                     LYDDIVIGDNGGVHINSGIPNHAAYLIAQKVDALKIAGWNGRKVLGQLAYGTLTKYLT
                     PVSEFEDARDGFVASVSDWQKANGIPVEQAQKVKESVIAAWTEVGLAYTSGSEAHQSS
                     NITSFTIPSVANEQQTQIDLANATVTYYAPKGTNISNLAPQFTVSSGAAVSPAAGTPQ
                     DFSKGGVKYTVTSQSGASKVWTVFVVEAGKDTDAPKYQRSSFSYDNKTLTVEFNEHVL
                     DFRYYAGARERTLKDKIWVVDADGKNKPLGAEDTAQVKDGKLQISFGHPVTYASVRSI
                     VIEPAAVVDLTGNYTVKEEDTVFIPVIPAPVPVPLGTTIIAGGANGALVELYNAENDK
                     LVSSIQLGQQENRAHFFYIPDGKYILRQVIASDSNPASLASAPITIARLQAPANLHAT
                     EVTPQSVRLQWEPVSNGTPVTYEVYGYNSSNGSVVAAASGVTDAVYNVTGLTPGGYMF
                     SVKAVDAAGGRVSTPAVTTVDHAVTVSADTYAPFWSTYAALGDSLAAGVTHEGRLGLG
                     YPDYIWNELKNQGQPVYFDKRYASPGYTSGDVLSDLKRSVTRSVYGQPGEGSIADTVR
                     SANLITLNAGANDLLAADKIAGGTLSETQAQQLLASIGSNIGSILDLIKEINPNASVF
                     VMGYYNPFPHGTEQEKQRAQLLIEELNKVIKDVAEKRGATFVATMNAIAADTANNLPN
                     PANIHPSDKGYKLIAAEFLKVIPAGAAKSKLTVSDVTRTGAKLTWESAVDSKGVTQYR
                     VYRDDTVVGTVYGGETSYAISGLSPSKTYQFRIEAGDAAGNWSTGGPTASATTTKGSN
                     SPGGGGGAGALPADAFTVSDTGVTLKSGAYTSVQKTENGQFVTEITLDGARLAEVFQK
                     LKTLGSASRTITLEVDTKQGVTVVAPGQALLEGLKAVPDASLQIKTNTAGYHVPLNVV
                     PGDITEQLKAAKPGDVMVRFGIRVHPGSSVTAAKLQGDLYGFDVTAAAGTASRKLVIP
                     ANKAGVITLTLDGEIDEAQASLVGYDPDKGAIRFAPALFQEKEGKTTVTVARNVSPAY
                     GVVITVPAFTDLDGHWSSKDVELLAGKRVIEGTTDTTFEPESPMTRAQFATLLVRALG
                     VDPAVESASRFTDVTPGAWYGSSVSSAVYAGLIEGFEDGSFQPDASITRAQMATMLSR
                     ALKFADRKPSVSAALLDSFTDKGDIGEWAEAAVAEAVHAGIIQGMTDTTFAPAENATR
                     AQAAVMLKRMLLYIEYLN"
     misc_feature    204509..206083
                     /locus_tag="PM3016_187"
                     /note="Zinc metalloprotease (elastase) [Amino acid
                     transport and metabolism]; Region: LasB; COG3227"
                     /db_xref="CDD:225768"
     misc_feature    204638..204778
                     /locus_tag="PM3016_187"
                     /note="Fungalysin/Thermolysin Propeptide Motif; Region:
                     FTP; pfam07504"
                     /db_xref="CDD:254244"
     misc_feature    <204926..205069
                     /locus_tag="PM3016_187"
                     /note="Peptidase propeptide and YPEB domain; Region:
                     PepSY; pfam03413"
                     /db_xref="CDD:251934"
     misc_feature    205316..206083
                     /locus_tag="PM3016_187"
                     /note="Peptidase M4 family includes thermolysin,
                     protealysin, aureolysin and neutral protease; Region:
                     M4_neutral_protease; cd09597"
                     /db_xref="CDD:189004"
     misc_feature    order(205472..205477,205553..205555,205562..205567,
                     205574..205576,205607..205609,205634..205636,
                     205709..205714,205811..205813)
                     /locus_tag="PM3016_187"
                     /note="active site"
                     /db_xref="CDD:189004"
     misc_feature    order(205562..205564,205574..205576,205634..205636)
                     /locus_tag="PM3016_187"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:189004"
     misc_feature    206123..>206437
                     /locus_tag="PM3016_187"
                     /note="Putative glycoside hydrolase xylanase; Region:
                     Xylanase; pfam13201"
                     /db_xref="CDD:257568"
     misc_feature    206966..207223
                     /locus_tag="PM3016_187"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(207146..207148,207188..207190)
                     /locus_tag="PM3016_187"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    order(207191..207193,207197..207202)
                     /locus_tag="PM3016_187"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    207272..207922
                     /locus_tag="PM3016_187"
                     /note="SGNH_hydrolase, or GDSL_hydrolase, is a diverse
                     family of lipases and esterases. The tertiary fold of the
                     enzyme is substantially different from that of the
                     alpha/beta hydrolase family and unique among all known
                     hydrolases; its active site closely...; Region:
                     SGNH_hydrolase; cl01053"
                     /db_xref="CDD:260768"
     misc_feature    order(207293..207295,207413..207415,207545..207547,
                     207863..207865,207872..207874)
                     /locus_tag="PM3016_187"
                     /note="active site"
                     /db_xref="CDD:238141"
     misc_feature    order(207293..207295,207863..207865,207872..207874)
                     /locus_tag="PM3016_187"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238141"
     misc_feature    order(207293..207295,207413..207415,207545..207547)
                     /locus_tag="PM3016_187"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238141"
     misc_feature    207944..208192
                     /locus_tag="PM3016_187"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(208106..208108,208151..208153)
                     /locus_tag="PM3016_187"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    order(208157..208162,208166..208171)
                     /locus_tag="PM3016_187"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    208925..209053
                     /locus_tag="PM3016_187"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    209105..209236
                     /locus_tag="PM3016_187"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    209303..209437
                     /locus_tag="PM3016_187"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            209835..210788
                     /locus_tag="PM3016_188"
                     /db_xref="GeneID:11882159"
     CDS             209835..210788
                     /locus_tag="PM3016_188"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glucokinase"
                     /protein_id="YP_005310318.1"
                     /db_xref="GI:379718187"
                     /db_xref="GeneID:11882159"
                     /translation="MGDQVYVGVDLGGTAIKVGLCDEQGKLLQTYEGPTGTEHGADVV
                     LENIAQYVRKLVAESPYEWEQVAGVGAGIAGFMDIPEGFMKLSPNLGWRNVPVKKILE
                     EKLGVPVKIDNDANVAALGEAWSGAGAGIPNVVCYTLGTGVGGGIIIHSRIYQGSNGM
                     AGELGHMVVVPDLEAIECGCGKKGCLETVSSGTGIIRMAKEAVARGEHTSLALVENIM
                     AKDVFDAAKTGDETALRIINRAALYLGKSMAAVSVVLNPKRFIVGGGVSKAGDILFDA
                     IRKYYQEFTQETAQEGVDIVPAVLGNDAGVVGAAGLNLHSI"
     misc_feature    209850..210671
                     /locus_tag="PM3016_188"
                     /note="BadF/BadG/BcrA/BcrD ATPase family; Region:
                     BcrAD_BadFG; cl17271"
                     /db_xref="CDD:266600"
     misc_feature    209853..210770
                     /locus_tag="PM3016_188"
                     /note="ROK family protein (putative glucokinase); Region:
                     ROK_glcA_fam; TIGR00744"
                     /db_xref="CDD:233110"
     misc_feature    209853..>210218
                     /locus_tag="PM3016_188"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cd00012"
                     /db_xref="CDD:212657"
     misc_feature    order(209862..209873,209877..209879,209883..209885,
                     210174..210176)
                     /locus_tag="PM3016_188"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            210951..211850
                     /locus_tag="PM3016_189"
                     /db_xref="GeneID:11882160"
     CDS             210951..211850
                     /locus_tag="PM3016_189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310319.1"
                     /db_xref="GI:379718188"
                     /db_xref="GeneID:11882160"
                     /translation="MEENHSLGKLVIITGMSGAGKTIAVQSLEDLGFFCVDNLPPVLI
                     PKFAELIEQSKGRIGKVALVIDLRGREFFTSLSESLRYLNENYTLTYEILFLDATDSV
                     LVQRYKESRRKHPLAPTGAPLEGIQAERKLLEELKGLATQVIDTSNLKPVALKEKIAS
                     RFTNVEGSSISVNVISFGFKYGVPIDADLIFDVRFLPNPHYIDHLRPNTGQDPEVYEY
                     VMKWNETQEFLAKLLDMLQFLVPQYKKEGKSQVVVGIGCTGGKHRSVAIAEYLGKMMG
                     SSETETVRVSHRDSERDRVEVKR"
     misc_feature    210975..211832
                     /locus_tag="PM3016_189"
                     /note="glmZ(sRNA)-inactivating NTPase; Provisional;
                     Region: PRK05416"
                     /db_xref="CDD:235450"
     misc_feature    210978..211358
                     /locus_tag="PM3016_189"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     gene            211847..212836
                     /locus_tag="PM3016_190"
                     /db_xref="GeneID:11882161"
     CDS             211847..212836
                     /locus_tag="PM3016_190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310320.1"
                     /db_xref="GI:379718189"
                     /db_xref="GeneID:11882161"
                     /translation="MTDALERENYIPRIVVIGGGTGLSVMLRGLKHKPMDITAVVTVA
                     DDGGSSGILRSELEIIPPGDIRNVLTALADVEPLLGKLLEYRFDKGNGLAGHSLGNLM
                     LAAMRDITGDFVTGVRELSRVLAVRGRVLPAADEAIVLRAEMMDGQVVEGESKIPKAG
                     GVIRRVMIEPRDVKALPEAVEALKTADAILVGPGSLYTSIMPNLLVPEIAETIVKSKA
                     LKMFICNVMTQPGETDDYKVSDHLKAIRDHVGHALFDYVIVNNGVIPDPVKRKYADKG
                     AEVVPLDLDAVTQEGYKVIADKLVLFQTYLRHDAEKLSQHIYQLVESWMFKKR"
     misc_feature    211886..212803
                     /locus_tag="PM3016_190"
                     /note="family of mostly uncharacterized proteins similar
                     to B.subtilis YvcK; Region: YvcK_like; cd07187"
                     /db_xref="CDD:132873"
     misc_feature    order(211901..211909,212426..212431,212441..212443,
                     212528..212533)
                     /locus_tag="PM3016_190"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:132873"
     misc_feature    order(211979..211981,211991..211993,212033..212035,
                     212042..212044,212144..212146)
                     /locus_tag="PM3016_190"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:132873"
     misc_feature    order(212123..212125,212138..212140,212147..212152,
                     212159..212164,212168..212173,212201..212203,
                     212210..212215)
                     /locus_tag="PM3016_190"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132873"
     gene            212843..213781
                     /locus_tag="PM3016_191"
                     /db_xref="GeneID:11882162"
     CDS             212843..213781
                     /locus_tag="PM3016_191"
                     /codon_start=1
                     /transl_table=11
                     /product="WhiA protein"
                     /protein_id="YP_005310321.1"
                     /db_xref="GI:379718190"
                     /db_xref="GeneID:11882162"
                     /translation="MSFAAQTKKELTLMEADPCCEKAELSALIRMNGAVSLTSQKIIL
                     DISTENAAIARRIYSLLKKSYTVHIELLVRKKMRLKKNNVYIVRVPSQVQSILSDLQI
                     VSEGFLFASEIEPSLIAKDCCKRAYLRGAFLAGGSVNNPEGTSYHLEIYSMYEEHCQA
                     LCKLACEFGLNARCIERKKGFVLYIKEGEKIIDFLSLIGAHQALLRFEDVRIMKDMRN
                     SVNRLVNCETANLNKTIGAAVRQIDNIKLLQKELGLDNLPEKLREVAEIRLQHPDMNL
                     KEVGDLLKGKVSKSGVNHRLRKIDEMAEKLRKSQVL"
     misc_feature    212843..213766
                     /locus_tag="PM3016_191"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1481"
                     /db_xref="CDD:224398"
     misc_feature    212894..213151
                     /locus_tag="PM3016_191"
                     /note="WhiA N-terminal LAGLIDADG-like domain; Region:
                     WhiA_N; pfam10298"
                     /db_xref="CDD:150898"
     misc_feature    213212..213493
                     /locus_tag="PM3016_191"
                     /note="WhiA LAGLIDADG-like domain; Region: LAGLIDADG_WhiA;
                     pfam14527"
                     /db_xref="CDD:258667"
     misc_feature    213500..213754
                     /locus_tag="PM3016_191"
                     /note="WhiA C-terminal HTH domain; Region: HTH_WhiA;
                     pfam02650"
                     /db_xref="CDD:251447"
     gene            214216..214485
                     /locus_tag="PM3016_192"
                     /db_xref="GeneID:11882163"
     CDS             214216..214485
                     /locus_tag="PM3016_192"
                     /codon_start=1
                     /transl_table=11
                     /product="HPr-like protein crh"
                     /protein_id="YP_005310322.1"
                     /db_xref="GI:379718191"
                     /db_xref="GeneID:11882163"
                     /translation="MSRRPVVVKLKTGLHARPAALFVQEANKFSSEIFVEKDEKKVNA
                     KSIMGIMSLAISTGTEVHISAEGSDAEQAVNALVTLVSKEELENQ"
     misc_feature    214231..214458
                     /locus_tag="PM3016_192"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    214231..214239
                     /locus_tag="PM3016_192"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    order(214255..214257,214261..214266,214270..214275,
                     214285..214287,214294..214296,214348..214359,
                     214366..214371)
                     /locus_tag="PM3016_192"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    214258..214260
                     /locus_tag="PM3016_192"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    214351..214353
                     /locus_tag="PM3016_192"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            214690..216480
                     /locus_tag="PM3016_193"
                     /db_xref="GeneID:11882164"
     CDS             214690..216480
                     /locus_tag="PM3016_193"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310323.1"
                     /db_xref="GI:379718192"
                     /db_xref="GeneID:11882164"
                     /translation="MKRIKKELALLLVVSLLMSIMWVSPGTAAEQEKNPLASASTTYV
                     LLYIDKAEAFLNGTQVTLDAPATIIKDKMYVPAKFLGDALGMKVEWNDATRQIEMETP
                     GYEIMLDIDNKSVWINGYWMAFDDVAAIVNGRLMIKLTWLADYMGAKYTYNNELRRVE
                     VLHVNAPQGLYDPNTSNSKPVAKFTFAKQTYKIGEPIKFVDLSYDPDAEGIAKFEWKG
                     KEDAYFQAGTYPITLTVWDSNGNKSEPYTRNLVISKETFLSAVEYPIYMKPVGSFIKT
                     NWSTLWSHFWELPELPKTATEVPGRTLLVSDSPEEFYEQGILYQDEVEGKVRLYADHI
                     NGTKEKVSFAILAKNMTDKPVTIKTTNKGEVWPSVYANLIGSEATVDFLLGDPLNETM
                     TIPAGQTFTYKQMPDFYPAQGVNLFYDLETDGKVQFSFIAAKDVSQKALALPKLAFSG
                     HVRGTFPVSEVKWNIDASSFTTPSRLILGDGIKDPFLPGYDPQRKAEVKNDGNYGVIY
                     KIHADKPRKMAIMILAKGGVFKGPIKINGDIRLIPESGVITAFDGMQILAKTTGKEES
                     LDIEFSPPAGSAFPVDLIFYPLDDRMDQQP"
     misc_feature    <214813..214980
                     /locus_tag="PM3016_193"
                     /note="Copper amine oxidase N-terminal domain; Region:
                     Cu_amine_oxidN1; pfam07833"
                     /db_xref="CDD:254459"
     misc_feature    214909..215172
                     /locus_tag="PM3016_193"
                     /note="Copper amine oxidase N-terminal domain; Region:
                     Cu_amine_oxidN1; pfam07833"
                     /db_xref="CDD:254459"
     misc_feature    215230..215421
                     /locus_tag="PM3016_193"
                     /note="Repeats in polycystic kidney disease 1 (PKD1) and
                     other proteins; Region: PKD; smart00089"
                     /db_xref="CDD:214510"
     gene            216661..217473
                     /locus_tag="PM3016_194"
                     /db_xref="GeneID:11882165"
     CDS             216661..217473
                     /locus_tag="PM3016_194"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310324.1"
                     /db_xref="GI:379718193"
                     /db_xref="GeneID:11882165"
                     /translation="MSSWRTDPQRIWRWLGWSCIVIGVFYFPAFPWYLLGEVKEEEIG
                     HWALCSMVGGTVILLGARLYRKGGGQTKRLLLLVSLVGMAVLLLGQVPALYSWMIYQG
                     NLIRHWPVSPSVGFFLGVALHGWLVLLALAALTAACLSLAGRGHSEIRLSRREGLRFL
                     LGLGSLLALWWGWDAYQARGWIANTYPADGMEHVPVRTVVTVAWKGSYETMGMRVRYE
                     DSPEAAVPGASGATQYGMTFEPEGGFQPGRRVRIEVEAGRRTHVFRFTTDTK"
     misc_feature    217204..217461
                     /locus_tag="PM3016_194"
                     /note="Bacterial Ig-like domain; Region: Big_5; pfam13205"
                     /db_xref="CDD:257572"
     gene            complement(217565..218146)
                     /locus_tag="PM3016_195"
                     /db_xref="GeneID:11882166"
     CDS             complement(217565..218146)
                     /locus_tag="PM3016_195"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ClpP1"
                     /protein_id="YP_005310325.1"
                     /db_xref="GI:379718194"
                     /db_xref="GeneID:11882166"
                     /translation="MSFIPMVVEPDARGERAYDIYSRLLKDRIIFLGSGINDVVANSI
                     IAQLLFLAASDPDKDIHLYINSPGGSITSGMAIYDTMQFIKPDVSTICVGMAASMGAF
                     LLAAGAPGKRFALPNSEVMIHQPLGGAEGQASDIEIRAKRILKMRDKLNTILSERTGQ
                     SFERIEKDTDRDNFMSAEEARAYGLIDKVIEKV"
     misc_feature    complement(217580..218092)
                     /locus_tag="PM3016_195"
                     /note="Caseinolytic protease (ClpP) is an ATP-dependent,
                     highly conserved serine protease; Region: S14_ClpP_2;
                     cd07017"
                     /db_xref="CDD:132928"
     misc_feature    complement(order(217625..217627,217631..217633,
                     217700..217702,217706..217708,217712..217714,
                     217721..217723,217763..217774,217790..217792,
                     217796..217798,217862..217864,217886..217888,
                     217898..217903,217910..217912,217919..217921,
                     217931..217933,217952..217954,217997..217999,
                     218006..218011,218018..218023,218048..218050,
                     218054..218056))
                     /locus_tag="PM3016_195"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132928"
     misc_feature    complement(order(217631..217633,217778..217780,
                     217853..217855))
                     /locus_tag="PM3016_195"
                     /note="active site residues [active]"
                     /db_xref="CDD:132928"
     gene            complement(218279..218350)
                     /locus_tag="PM3016_t12"
                     /db_xref="GeneID:11882167"
     tRNA            complement(218279..218350)
                     /locus_tag="PM3016_t12"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:11882167"
     gene            218612..219643
                     /locus_tag="PM3016_196"
                     /db_xref="GeneID:11882168"
     CDS             218612..219643
                     /locus_tag="PM3016_196"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005310326.1"
                     /db_xref="GI:379718195"
                     /db_xref="GeneID:11882168"
                     /translation="MREILDIQKQLLPDLMDTMKKRYTVLHHILVSGMIGRRTLAGML
                     NTTERVLRAEVDFLKEQGLVDVDASGIRISMAGRELLERIEPLVKDLFGLTELEEQLR
                     VHFGLKQVVIVPGDSDASPQVKKELGRAGASVLRKLVTENDVVAVTGGSTMAEVANHL
                     TAAPAMKGIWFVPARGGLGESLEMQANTIASTMAKKTGARYRLLHVPDHLGEEAYQSL
                     IQDTTISEIIQFIRQARMVIHGMGDAMVMARRRKVDRETTESLQREGALAEAFGYYFD
                     RSGRMLHRMPTIGLRLEDIHGMDTVIGVAGGRSKGEAIASVLKYGHEDVLVTDEAAAQ
                     EIIRTISSS"
     misc_feature    218642..219625
                     /locus_tag="PM3016_196"
                     /note="Transcriptional regulator, contains sigma
                     factor-related N-terminal domain [Transcription]; Region:
                     DeoR; COG2390"
                     /db_xref="CDD:225263"
     misc_feature    218876..219625
                     /locus_tag="PM3016_196"
                     /note="Putative sugar-binding domain; Region: Sugar-bind;
                     pfam04198"
                     /db_xref="CDD:252446"
     gene            219735..220739
                     /locus_tag="PM3016_197"
                     /db_xref="GeneID:11882169"
     CDS             219735..220739
                     /locus_tag="PM3016_197"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GapA"
                     /protein_id="YP_005310327.1"
                     /db_xref="GI:379718196"
                     /db_xref="GeneID:11882169"
                     /translation="MVKVGINGFGRIGRNVFRAALGNPEVEIVAINDLTDVNTLAHLL
                     KYDTTHGKLNATVEATEGALIVNGKTVKVFAERNPENLPWGANGVEIVVESTGIFTAK
                     EKAELHLKGGAKKVIISAPATNEDITIVMGVNEDKYDASQHTIISNASCTTNCLAPFA
                     KVINDKFGIVKGMMTTVHSYTNDQSVLDLPHKDLRRARAAAENIIPSTTGAAKAVSLV
                     LPELKGKLNGMAMRVPTPNVSVTDLVVELSQNVTVDDVNNALKEAANGPLKGILNYSE
                     EPLVSSDYNGDPASSTIDALSTMVVGDNMVKVVSWYDNEWGYSNRVVDLANFIAKKGL
                     "
     misc_feature    219735..220730
                     /locus_tag="PM3016_197"
                     /note="Glyceraldehyde-3-phosphate
                     dehydrogenase/erythrose-4-phosphate dehydrogenase
                     [Carbohydrate transport and metabolism]; Region: GapA;
                     COG0057"
                     /db_xref="CDD:223135"
     misc_feature    219738..220187
                     /locus_tag="PM3016_197"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase, NAD
                     binding domain; Region: Gp_dh_N; smart00846"
                     /db_xref="CDD:214851"
     misc_feature    220200..220670
                     /locus_tag="PM3016_197"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase,
                     C-terminal domain; Region: Gp_dh_C; pfam02800"
                     /db_xref="CDD:251539"
     gene            221131..222315
                     /locus_tag="PM3016_198"
                     /db_xref="GeneID:11882170"
     CDS             221131..222315
                     /locus_tag="PM3016_198"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310328.1"
                     /db_xref="GI:379718197"
                     /db_xref="GeneID:11882170"
                     /translation="MMNKKSVRDVEVGGKRVFVRVDFNVPLENGKITDDTRIRETVPT
                     IKYLTERGAKVILASHMGRPNGAVVEELRLTPVAARLSELLGQPVTKADEAVGAAVQA
                     QVAELKDGDVLLLENVRFYAGEEKNDAELAKQFAELADLYVNDAFGAAHRAHASTEGI
                     AHHLPAVGGLLMEKELDVLGRALNNPERPFTAIVGGAKVKDKIAVIEKLIEIADNIII
                     GGGLSYTFFKSKGLEIGKSLVDNDRLELVQEFERKAKEKGINFLLPVDVVVGDKFGAD
                     ANTKIVNIDEIPADWEAFDIGPKTREIYAKTIAESKLVVWNGPMGVFELEPFKNGTQA
                     VAEACAATAGYTVIGGGDSAAAVEKFHLGDKMDHISTGGGASLEFMEGKALPGVVALQ
                     DK"
     misc_feature    221149..222309
                     /locus_tag="PM3016_198"
                     /note="Phosphoglycerate kinase (PGK) is a monomeric enzyme
                     which catalyzes the transfer of the high-energy phosphate
                     group of 1,3-bisphosphoglycerate to ADP, forming ATP and
                     3-phosphoglycerate. This reaction represents the first of
                     the two substrate-level...; Region:
                     Phosphoglycerate_kinase; cd00318"
                     /db_xref="CDD:238195"
     misc_feature    order(221194..221196,221200..221202,221239..221241,
                     221308..221310,221485..221487)
                     /locus_tag="PM3016_198"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238195"
     misc_feature    order(221677..221688,222235..222243)
                     /locus_tag="PM3016_198"
                     /note="hinge regions; other site"
                     /db_xref="CDD:238195"
     misc_feature    order(221791..221793,222007..222009,222079..222081,
                     222085..222087,222091..222102,222181..222189)
                     /locus_tag="PM3016_198"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:238195"
     misc_feature    222184..222186
                     /locus_tag="PM3016_198"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238195"
     gene            222331..223083
                     /locus_tag="PM3016_199"
                     /db_xref="GeneID:11882171"
     CDS             222331..223083
                     /locus_tag="PM3016_199"
                     /codon_start=1
                     /transl_table=11
                     /product="TpiA protein"
                     /protein_id="YP_005310329.1"
                     /db_xref="GI:379718198"
                     /db_xref="GeneID:11882171"
                     /translation="MRKPIIAGNWKMFKTVQEAVSFVNEVKGKAEVEGVESVICSPFT
                     NLPALVEAVKGTTLKVGAQNLHFEDNGAYTGEISGVMLKDLGVEYVIIGHSERRAYFG
                     ETDEIVNKKVQAAFKHGLTPIVCVGEKLEEREANQTKDVCKVQTEGAFAGLSAEQAAQ
                     VVIAYEPIWAIGTGKSSTAADAQDVIGYIREVVSGLYGAETAAAVRIQYGGSVKPNNI
                     AEYMQQPDIDGALVGGASLEPASYIALIEGAK"
     misc_feature    222340..223071
                     /locus_tag="PM3016_199"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    order(222355..222357,222361..222363,222610..222612,
                     222826..222828,222844..222846,222964..222966,
                     223021..223023,223027..223032)
                     /locus_tag="PM3016_199"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    order(222355..222357,222364..222366,222457..222465,
                     222469..222471,222478..222480,222517..222519,
                     222571..222573,222580..222585,222616..222621)
                     /locus_tag="PM3016_199"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    order(222361..222363,222610..222612,222826..222828)
                     /locus_tag="PM3016_199"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            223085..224629
                     /locus_tag="PM3016_200"
                     /db_xref="GeneID:11882172"
     CDS             223085..224629
                     /locus_tag="PM3016_200"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GpmI"
                     /protein_id="YP_005310330.1"
                     /db_xref="GI:379718199"
                     /db_xref="GeneID:11882172"
                     /translation="MARPKPVAVIILDGFGLRGDVQGNAVAQAKKPNYERYWNEFPHT
                     TLIACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQDLTRISKSIRDGEFYENETILGAI
                     RHAKDNGKKLHLYGLLSDGGVHSHIEHLFALLDVCKKENFEEVYIHAFLDGRDVAPDS
                     AAGYMERLLKKIADVGVGRIATVQGRYYAMDRDKRWERTEKSYRAMVYGDGPTFEDPM
                     NAIQESYIRSVYDEFVMPTVIVKPDHTPVGLVESGDSVVFFNFRPDRAIQLSQVFTNS
                     DFRGFDRGDKAPTDLYYVCLTLFSETVGGYVAYKPKNLDNTLGEVLAQNDLKQLRIAE
                     TEKYPHVTFFFSGGRDVELPGETRILIPSPKVATYDLQPEMSAYEVAAAAVAEIEAER
                     QDVIILNFANPDMVGHSGLLEPTIKAVEATDECLGKVVDAIIAKGGVALITADHGNAD
                     VVTNPDGSRNTAHTTNPVPFIVTDGRVTLRNDGILADIAPTVLDLLGVSKPAEMTGTT
                     LAASRS"
     misc_feature    223085..224611
                     /locus_tag="PM3016_200"
                     /note="phosphoglyceromutase; Provisional; Region:
                     PRK05434"
                     /db_xref="CDD:235463"
     gene            224681..225973
                     /locus_tag="PM3016_201"
                     /db_xref="GeneID:11882173"
     CDS             224681..225973
                     /locus_tag="PM3016_201"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310331.1"
                     /db_xref="GI:379718200"
                     /db_xref="GeneID:11882173"
                     /translation="MTVISNVYAREVLDSRGNPTVEVEVHLESGARGRAIVPSGASTG
                     AYEAVELRDGDKSRYLGKGVLKAVENVNDVIAPEIIGMNALDQVGIDKRMIELDGTPN
                     KGKLGANAILAVSMAVARAAAEALDIPLYLYLGGFNAKQLPVPMMNIINGGAHADNNV
                     DVQEFMVLPVGAPSFKEALRTGAEIFHSLRSVLKEKGLNTAVGDEGGFAPNLGSNEEA
                     IQTIITAIERAGYKPGVDVFLGMDVASTEFFKDGKYHLEGEGKSYTSAEWVDFLAAWV
                     DKYPIITIEDGCSEDDWEGWKLLTEKLGGKVQLVGDDLFVTNTERLSRGIEENIGNSI
                     LVKVNQIGSLTETFDAIEMAKRAGYTAVISHRSGESEDSTIADIAVATNAGQIKTGAP
                     SRTDRVAKYNQLLRIEDQLTDVAQYAGKSAFYNLKNFK"
     misc_feature    224681..225961
                     /locus_tag="PM3016_201"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     misc_feature    224696..225910
                     /locus_tag="PM3016_201"
                     /note="Enolase: Enolases are homodimeric enzymes that
                     catalyse the reversible dehydration of
                     2-phospho-D-glycerate to phosphoenolpyruvate as part of
                     the glycolytic and gluconeogenesis pathways. The reaction
                     is facilitated by the presence of metal ions; Region:
                     enolase; cd03313"
                     /db_xref="CDD:239429"
     misc_feature    order(224702..224704,224708..224734,224744..224746,
                     224780..224782,225146..225154,225215..225220,
                     225227..225232,225239..225244,225281..225286,
                     225305..225307,225311..225313,225785..225793,
                     225860..225868,225872..225877,225884..225886,
                     225893..225898,225905..225907)
                     /locus_tag="PM3016_201"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239429"
     misc_feature    order(224804..224806,225404..225406,225533..225535,
                     225614..225616)
                     /locus_tag="PM3016_201"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239429"
     misc_feature    order(225143..225145,225293..225295,225689..225691,
                     225773..225781,225842..225844)
                     /locus_tag="PM3016_201"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:239429"
     gene            226284..226994
                     /locus_tag="PM3016_202"
                     /db_xref="GeneID:11882174"
     CDS             226284..226994
                     /locus_tag="PM3016_202"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310332.1"
                     /db_xref="GI:379718201"
                     /db_xref="GeneID:11882174"
                     /translation="MNRWLKTIAFLVLSVFLSHFIPFNEFFRNLDTMIHEFGHAVVTL
                     LLQGQVMYIELFANHSGVTYSQISSPWSLIPIAMAGYMTASLFALFLFRVRAHDRERL
                     GLQVITLIAIAALILFVRGEFGVMWLIGFILLNVVMLAFMPAWIRDLYYLLIAFLTLE
                     ESVMGPFSLVLYALRDPSRAGDATNLSLVTPIPAVAWGAFFTLFALWCAVRAITLFLQ
                     GRKSEYRRTPAHYTRYED"
     misc_feature    226305..226913
                     /locus_tag="PM3016_202"
                     /note="Peptidase M50B-like; Region: Peptidase_M50B;
                     pfam13398"
                     /db_xref="CDD:257723"
     gene            227169..227408
                     /locus_tag="PM3016_203"
                     /db_xref="GeneID:11882175"
     CDS             227169..227408
                     /locus_tag="PM3016_203"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310333.1"
                     /db_xref="GI:379718202"
                     /db_xref="GeneID:11882175"
                     /translation="MEVALKIILVIASLGLIAVVLLQPGKSAGLSGAISGGAEHLFGK
                     QKARGLELFLNRLTMGLAVAFFVLSLIVAYFVKAV"
     misc_feature    227169..227399
                     /locus_tag="PM3016_203"
                     /note="preprotein translocase subunit SecG; Reviewed;
                     Region: secG; PRK06870"
                     /db_xref="CDD:235881"
     gene            227503..228306
                     /locus_tag="PM3016_204"
                     /db_xref="GeneID:11882176"
     CDS             227503..228306
                     /locus_tag="PM3016_204"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase"
                     /protein_id="YP_005310334.1"
                     /db_xref="GI:379718203"
                     /db_xref="GeneID:11882176"
                     /translation="MTRQYRTTEPFHLKGTGERASTELLLIHGFTGSPSEFRRLGYYL
                     NDLGYTVRGILLPGHGTTPEDMIRTGLNDWSRHVTESFDTIRAQGGPDRRIVAVGHSM
                     GGLLALKLAMERPLAGVVSLAAPIFLASRKTVLAVLLQYFVKYVERRPTVPPHIIEEA
                     CSYSRTPIPCVVDLRKLLKHVKTSLNEVKAPLFIGQGGRDKLVLPRSAEYIYRHVSSA
                     FRQMAHYPSTSHAILLDEERERVYADIHRFLVTLEHIGTWEQTAAGYAP"
     misc_feature    227530..228249
                     /locus_tag="PM3016_204"
                     /note="Esterase/lipase [General function prediction only];
                     Region: COG1647"
                     /db_xref="CDD:224561"
     misc_feature    227584..228177
                     /locus_tag="PM3016_204"
                     /note="Alpha/beta hydrolase of unknown function (DUF1057);
                     Region: DUF1057; pfam06342"
                     /db_xref="CDD:115027"
     gene            228337..230367
                     /locus_tag="PM3016_205"
                     /db_xref="GeneID:11882177"
     CDS             228337..230367
                     /locus_tag="PM3016_205"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310335.1"
                     /db_xref="GI:379718204"
                     /db_xref="GeneID:11882177"
                     /translation="MITKDILLDFMQEEAYKPLTYQELEQHFQLDSAQAFKDFLKLLN
                     ELENEGLIVRTRNDRYGVPERMNLLRGRLQAHAKGFGFLIPDDKEHPDVYIHANDMST
                     AMNGDIILVRITSRSPSGGRMEGEVVRVVSRANTRIVGLFQAHEEYAFVIPDDKRVVR
                     DIFIPKDSFGGAMDGHKVVVNIVSYPEGRAAAQGEVIEILGHKNDPGVDILSIIRKHG
                     LPEAFPDEVMEEASEAPDVITEEEIVSQGRRDLRNKRIVTIDGEDAKDLDDAVNVEVL
                     ENGNYVLGVHIADVSYYVRENSALDQEAYSRGCSVYLVDRVIPMLPHRLSNGICSLNP
                     RVDRLTMSCEMEFDAQANVVRHDVFTSVIRTSERMTYKNVRNLLKGEAEPEVQEKYAY
                     LMDDFRRMEDLAMRLRNKRMRRGAIDFDFQESKILVDESGKPTDIVKRERSIAEMIIE
                     EFMLAANETVAEHFHWLKVPFLYRIHEDPDAEKLQHFLEFITNFGYVVRGKGNTIHPK
                     ALQSLLEEIKGTKEETVISTVMLRSMKQAKYDANSMGHYGLAAEFYSHFTSPIRRYPD
                     LVIHRVMREVLEGGGTGLTDKRHEYLTSRMDDIAKQSSERERVAVDAERETEALKKAE
                     FMLDKVGEEFTGIISSVTSFGMFIGWRIRWKVSSVSRISQTTTTTSMMRSTR"
     misc_feature    228337..230280
                     /locus_tag="PM3016_205"
                     /note="ribonuclease R; Region: RNase_R; TIGR02063"
                     /db_xref="CDD:233703"
     misc_feature    228547..228726
                     /locus_tag="PM3016_205"
                     /note="Ribonuclease B OB domain; Region: OB_RNB;
                     pfam08206"
                     /db_xref="CDD:254660"
     misc_feature    228754..228933
                     /locus_tag="PM3016_205"
                     /note="Ribonuclease B OB domain; Region: OB_RNB;
                     pfam08206"
                     /db_xref="CDD:254660"
     misc_feature    229078..230067
                     /locus_tag="PM3016_205"
                     /note="RNB domain; Region: RNB; pfam00773"
                     /db_xref="CDD:250123"
     misc_feature    230224..>230280
                     /locus_tag="PM3016_205"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(230251..230253,230275..230277)
                     /locus_tag="PM3016_205"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     gene            230970..231455
                     /locus_tag="PM3016_206"
                     /db_xref="GeneID:11882178"
     CDS             230970..231455
                     /locus_tag="PM3016_206"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SmpB"
                     /protein_id="YP_005310336.1"
                     /db_xref="GI:379718205"
                     /db_xref="GeneID:11882178"
                     /translation="MAQKNPNEAKLLAQNKKASHDILSKYTYECGLVLTGTEIKSLRL
                     GKANIGDAFATIRNGEAFIHNMHISPFAQGNRFNPEDPTRARKLLLRKEQIHKLLGQS
                     KQEGYTIVPLKVYVRNGYAKLLIGLGRGKKQYDKRESAAKKDAQREIARALREKQKVA
                     R"
     misc_feature    231012..231362
                     /locus_tag="PM3016_206"
                     /note="Small protein B (SmpB) is a component of the
                     trans-translation system in prokaryotes for releasing
                     stalled ribosome from damaged messenger RNAs; Region:
                     SmpB; cd09294"
                     /db_xref="CDD:187755"
     misc_feature    order(231054..231071,231075..231080,231084..231089,
                     231096..231098,231147..231149,231234..231251,
                     231333..231335)
                     /locus_tag="PM3016_206"
                     /note="SmpB-tmRNA interface; other site"
                     /db_xref="CDD:187755"
     gene            232145..232804
                     /locus_tag="PM3016_207"
                     /db_xref="GeneID:11882179"
     CDS             232145..232804
                     /locus_tag="PM3016_207"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310337.1"
                     /db_xref="GI:379718206"
                     /db_xref="GeneID:11882179"
                     /translation="MAKFNGETETKDPYVRVTFEALLEAVLPVTYRTPPGTGSDLIPV
                     PGGVELKLHEYLIRELDHSQFQPVNAPDGLPPLSRSTAQMLDLGAEQYIRRGLALPLT
                     EGFPGGGQFTRLAPIDRLLTLELIDRLEIPLGELSLPFKNNPGLVQTMVNSFTQLPYF
                     GYYCEWYGYGTTRFAPPADRRLQFVPPGWQLAGYPGPSFGYREFRGFLLTYPACQGGS
                     Q"
     gene            232801..234501
                     /locus_tag="PM3016_208"
                     /db_xref="GeneID:11882180"
     CDS             232801..234501
                     /locus_tag="PM3016_208"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310338.1"
                     /db_xref="GI:379718207"
                     /db_xref="GeneID:11882180"
                     /translation="MRDPDVIVIGSGGGGAVMAKELGEMGLQVLVLEAGPWYGHSGWP
                     EPNQERGAKSGSDPGELNVSLFKEQYSKLEGDMNEQITGKLRWGPADRNRPPWFRNLT
                     ERGFVWQNSGVGGTTQSYLANCPRAFPVRVDGVWPISYRELVPYYERVEATLPVEFAP
                     VTAKEELFFFGAQKAGWELIPTLNVTTPGYRPQPNAILPPNRHLTDPAYSLEQLSWME
                     GCTLAGHCVNGCPHGPSVDKIAKRSTNVSYIPLALRTGRVTVRPNTFVTRILTEAHPS
                     EGLRATGVRIRDTWTGEIEELRADVIVMAAGAIESPRLWLNSGLPANRWVGRGLSNHY
                     FGWVTGMFDERDLLRILGSPEINPFVGHTSGGRLDIPGLGSLMVTGMSPGLTASMSYG
                     FSQNGYSFLHPAAAETGDLVGRLVGAEFQYWMENYRRTLSIVIFTDDEPDYRNGITVD
                     AAVQDEHGPVPKIRYVPGAREERSRMELAKIAVDILRKAGARKVHRSDWPGSLLIHME
                     STMRMGFVVNENCEAYQVRRLYITDNSVHFNALGGANPTLTTQALATRAAEKLVQTYF
                     "
     misc_feature    232801..234486
                     /locus_tag="PM3016_208"
                     /note="Choline dehydrogenase and related flavoproteins
                     [Amino acid transport and metabolism]; Region: BetA;
                     COG2303"
                     /db_xref="CDD:225186"
     misc_feature    233131..233802
                     /locus_tag="PM3016_208"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    234121..234462
                     /locus_tag="PM3016_208"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            234581..235108
                     /locus_tag="PM3016_209"
                     /db_xref="GeneID:11882181"
     CDS             234581..235108
                     /locus_tag="PM3016_209"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310339.1"
                     /db_xref="GI:379718208"
                     /db_xref="GeneID:11882181"
                     /translation="MNLFEVFKDAIKPFLDGEKPPLNVGEVMNLWFYTTATEQTMRGE
                     QVSYNIVQEPELKEMLRVVIHDVHGPIMEEVTEFMRAEGVPLPSMTPDKTIGDFRELP
                     EGAHLSDEEVANLLSFNIVLGINYACRGMTEAVRPDVAAMFVKFQMRKMTYAVSLREF
                     LMRKGWLKVPPVYKP"
     misc_feature    234623..235093
                     /locus_tag="PM3016_209"
                     /note="Protein of unknown function (DUF3231); Region:
                     DUF3231; pfam11553"
                     /db_xref="CDD:151989"
     gene            complement(235198..235443)
                     /locus_tag="PM3016_210"
                     /db_xref="GeneID:11882182"
     CDS             complement(235198..235443)
                     /locus_tag="PM3016_210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310340.1"
                     /db_xref="GI:379718209"
                     /db_xref="GeneID:11882182"
                     /translation="MSGDWFYGCIFPLYALLGVPSGGRIRMSVRIALPGMFLDIFSLA
                     FHSYVFPSLPPEGIPLLAGWLLWAYGLILATGRLPKS"
     gene            complement(235476..236063)
                     /locus_tag="PM3016_211"
                     /db_xref="GeneID:11882183"
     CDS             complement(235476..236063)
                     /locus_tag="PM3016_211"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005310341.1"
                     /db_xref="GI:379718210"
                     /db_xref="GeneID:11882183"
                     /translation="MARPNLISKAELLQAARICLAEKGIEKTTLKAIADEAKVSQGTV
                     YYHFRTKDQLMLELTQSLCAASWQSQNQHKESGSIEEALQGAKDRCGYDSFYHRLFFT
                     SMAASFQSEPNRERLGAMLREENEQLASLLCSRWNGSPVDGIPLEHWGVLINAMVDGL
                     AVQALLDKDFPKDAVFNSFGRLLHAISGGVNNLEL"
     misc_feature    complement(235497..236063)
                     /locus_tag="PM3016_211"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(235890..236030)
                     /locus_tag="PM3016_211"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            236620..237744
                     /locus_tag="PM3016_212"
                     /db_xref="GeneID:11882184"
     CDS             236620..237744
                     /locus_tag="PM3016_212"
                     /codon_start=1
                     /transl_table=11
                     /product="WD40 domain-containing protein"
                     /protein_id="YP_005310342.1"
                     /db_xref="GI:379718211"
                     /db_xref="GeneID:11882184"
                     /translation="MTYPPDVEQAPGRQIVLIRDRSTGGCERVKTPDETGSVLYFDMT
                     PDARYIAYTYADTVISGQSKVYLYDRTTETLETVNGTTGRKEFRMEEGDYVSISADGR
                     YVAFDTDAEGLVPGDTNGERDVYLFDRLGSGSRLERISVPLEEGRNHDSRHPSISSDG
                     NRIVLVSQAKLTDLDEPDGTESLYLYDRQAAAGTYPKRIAEGETPSISGDGRYVAFTT
                     FRDDLVQGEDTNNRDDIYVYDVTDAVFHRVSKEADGTQHTGDSRHPSISRSGAYVAYE
                     VDSSDNGDESELYVAARQGAASARIEVPEASVSLLPSGKRPAVGDTGASVTFFSSYLE
                     RIGGVEVRLWDYFVAASGASPSLASGIAPEASDLVGQNQR"
     misc_feature    <236725..237273
                     /locus_tag="PM3016_212"
                     /note="Periplasmic component of the Tol biopolymer
                     transport system [Intracellular trafficking and
                     secretion]; Region: TolB; COG0823"
                     /db_xref="CDD:223893"
     misc_feature    <237079..>237522
                     /locus_tag="PM3016_212"
                     /note="Periplasmic component of the Tol biopolymer
                     transport system [Intracellular trafficking and
                     secretion]; Region: TolB; COG0823"
                     /db_xref="CDD:223893"
     gene            complement(237752..238582)
                     /locus_tag="PM3016_213"
                     /db_xref="GeneID:11882185"
     CDS             complement(237752..238582)
                     /locus_tag="PM3016_213"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005310343.1"
                     /db_xref="GI:379718212"
                     /db_xref="GeneID:11882185"
                     /translation="MNANIPWPSMGVLRMQEGSRRFRLTRHDPSEELAFFVKHYWVVR
                     WDVSDGATYPQEVLPNPCVNLVVEREKSAIFGPSKQKFTYPLHGRGCVFGVKFKPGGF
                     HPFSRRPAAHLADQPLAIGSVFGVNAGELEDAMLSEPEESRMIELAEALLRPKLPPRD
                     EQVPFIGRIVDRIREDRSLTRVDQAADAFGLSVRGLQRLFHQYVGVTPKWVIQLYRLH
                     NAAEAMEQSGPPDSLELSMELGYHDQAHFIKDFKAIVGRTPEQHAKGRIGREEAEKSS
                     "
     misc_feature    complement(237956..>238042)
                     /locus_tag="PM3016_213"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(237800..238027)
                     /locus_tag="PM3016_213"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     gene            238712..239170
                     /locus_tag="PM3016_214"
                     /db_xref="GeneID:11882186"
     CDS             238712..239170
                     /locus_tag="PM3016_214"
                     /codon_start=1
                     /transl_table=11
                     /product="Activator of Hsp90 ATPase 1 family protein"
                     /protein_id="YP_005310344.1"
                     /db_xref="GI:379718213"
                     /db_xref="GeneID:11882186"
                     /translation="MDREALKYEFYIGAGVEEVWNAFISPEGTRKTFFGCVLQSTFEQ
                     GAPFQYVGPGQEGDETVHVYGTILNYEPLKEISYLEHPGASYQDNHAELESRVTFTLD
                     TVGACTKLTLVNDGWTPGHPSYENAKSHWWMILSNIKTVAETGKALDFGW"
     misc_feature    238733..239143
                     /locus_tag="PM3016_214"
                     /note="Putative hydrophobic ligand-binding SRPBCC domain
                     of an uncharacterized subgroup of CalC- and Aha1-like
                     proteins; some contain an N-terminal GntR family winged
                     HTH DNA-binding domain; Region:
                     SRPBCC_CalC_Aha1-like_GntR-HTH; cd08893"
                     /db_xref="CDD:176902"
     misc_feature    order(238733..238735,238739..238741,238766..238774,
                     238778..238783,238796..238798,238823..238825,
                     238844..238846,238850..238852,238856..238858,
                     238862..238864,238895..238897,238901..238906,
                     238910..238912,238919..238921,238937..238939,
                     238943..238948,238997..239002,239006..239008,
                     239012..239014,239042..239044,239048..239050,
                     239054..239056,239060..239062,239078..239104,
                     239108..239116,239123..239125)
                     /locus_tag="PM3016_214"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176902"
     gene            239450..239623
                     /locus_tag="PM3016_215"
                     /db_xref="GeneID:11882187"
     CDS             239450..239623
                     /locus_tag="PM3016_215"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310345.1"
                     /db_xref="GI:379718214"
                     /db_xref="GeneID:11882187"
                     /translation="MTYTELLERRSEILKRHLGSLILKDNQYGLNERESCMFRDLVKE
                     LHRNKYEWNESMK"
     gene            239848..240942
                     /locus_tag="PM3016_216"
                     /db_xref="GeneID:11882188"
     CDS             239848..240942
                     /locus_tag="PM3016_216"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-dependent phosphate transporter"
                     /protein_id="YP_005310346.1"
                     /db_xref="GI:379718215"
                     /db_xref="GeneID:11882188"
                     /translation="MVMWVTWIAIGIALFFAANIGASGAAASMGVAYGSGAVSRKMAA
                     LSLVAVGVFLGAYLGGGEVVKTLGSGIIPPKLLTVELVIIILLSATLTLFGANLLGIP
                     LSTSEVTVGAVVGVGIAYETVFVQKLLVIVSFWVILPVVAFTLAWGMGHVIRRLERRD
                     ARWRGEGEGWWTKGLMWLVLAAGFTEAFSAGMNNVANAVGPLVGAGLLGTEEGIFWGG
                     LFVALGALVLGGKVLETNGKKITRMSLLQGTAISGTGGTLVIISSLYGIPVPLTQITT
                     TAILGMGSAEHGFRLWQKGIVLKILKVWLVSPLLSMTVSFTLVKLFIEPAPYLIVVMV
                     AVLISLIGLKSLYDTEQAERRAMNEEGAGI"
     misc_feature    239854..240813
                     /locus_tag="PM3016_216"
                     /note="Phosphate/sulphate permeases [Inorganic ion
                     transport and metabolism]; Region: PitA; COG0306"
                     /db_xref="CDD:223383"
     gene            complement(241014..242303)
                     /locus_tag="PM3016_217"
                     /db_xref="GeneID:11882189"
     CDS             complement(241014..242303)
                     /locus_tag="PM3016_217"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="YP_005310347.1"
                     /db_xref="GI:379718216"
                     /db_xref="GeneID:11882189"
                     /translation="MNSSGGLQRTIGLPQAVALYIGAVLGSGILIVPGLAAEIAGPAS
                     LLAWGLMALLIFPLAWSMGLLSAQYPNAGGVSHFVTLAYGRRAGTLTGWFFLMSVPIG
                     APVAALTGAGYMTAALGWGEQAKIAIAAGMLVLALLVNYVGMKIAGQLQLIVVLAILA
                     VLILAIAGAQPHIQAGNLTPFLPHGWVSVGQAAAILFWCFIGWEAVSHLSEEFQEPKK
                     AAIQGVTAAALIVGVLYFLTAFAVVGTGSYRGAASDASLVWVILRLLGPAGAWISGIT
                     GIFICTATIIAYAGASSRLAYALAREGEAPRWMGGLSARFGTPTGGLGFLAITAAAVL
                     TLYGSGAVSLAELIQFPNATFILTYLGGCAAGMKLLRGSRWGKRVSTLSFACTLTVFP
                     FVGWAMLYPIVIVLVYWLVSRVRAAKASRSRSASQAS"
     misc_feature    complement(241050..242273)
                     /locus_tag="PM3016_217"
                     /note="putative transporter; Provisional; Region:
                     PRK11021"
                     /db_xref="CDD:236823"
     misc_feature    complement(<241569..242261)
                     /locus_tag="PM3016_217"
                     /note="Spore germination protein; Region: Spore_permease;
                     cl17796"
                     /db_xref="CDD:266844"
     gene            242422..243327
                     /locus_tag="PM3016_218"
                     /db_xref="GeneID:11882190"
     CDS             242422..243327
                     /locus_tag="PM3016_218"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator YwqM"
                     /protein_id="YP_005310348.1"
                     /db_xref="GI:379718217"
                     /db_xref="GeneID:11882190"
                     /translation="MESRYLFTFLVVVEMGSFTRAAAHLGYAQSSVTAQIQALEAELE
                     APLFDRIGKKILITDAGRRLLPYAQEISRLHTLAKDALRSDAELAGTLAIGAPESLAA
                     FRLPEILREYRERYPKVKITLKPGVCWTLRDLTRSGELDLTFLLQPETEDKDLFIRTL
                     VQERMALVAPPAHPLAASQRVEPLDLQGETILHTEPGCTYRAMFEQHLHHHGVFPDPD
                     LEFYSIETIKNCVMSGLGLSFLPWITVRNEIREGKLAGLAWDDRPQRPATQIAYHTKK
                     WRSPALHEFLALVDKHAERWRKELE"
     misc_feature    242422..243318
                     /locus_tag="PM3016_218"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    242431..242607
                     /locus_tag="PM3016_218"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    242692..243288
                     /locus_tag="PM3016_218"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(242737..242742,242746..242751,242758..242760,
                     242770..242772,242776..242796,243073..243090,
                     243106..243111,243115..243120)
                     /locus_tag="PM3016_218"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            243490..244368
                     /locus_tag="PM3016_219"
                     /db_xref="GeneID:11882191"
     CDS             243490..244368
                     /locus_tag="PM3016_219"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310349.1"
                     /db_xref="GI:379718218"
                     /db_xref="GeneID:11882191"
                     /translation="MLVTNKNSAWVTLLLGSSLLLSACGQSSAPAASGSAQKETAAKP
                     AEAVPAADVQKEAIEKYRQYVIGQTDEFVKAADAFTKAVKAGDIETAKSLYAPSRMHF
                     ERIEPIAESLGDFDPWIDAREGDVPDNEWRGYHRLEKALWETKSVAGQDKVADQLLQD
                     VKQLRVKVESVEIDTAMLVTGAVELLNEVSSSKVTGEEERYSHTDLYDFAANVEGAHE
                     IYQVLKPAVENKDAALAGEINSRFKELDQALQPYRKDKGYVSYTELTPEQTKKLSQAV
                     DALAEPLSKMGTVIGG"
     misc_feature    243658..244347
                     /locus_tag="PM3016_219"
                     /note="Imelysin; Region: Peptidase_M75; pfam09375"
                     /db_xref="CDD:255325"
     gene            244372..245649
                     /locus_tag="PM3016_220"
                     /db_xref="GeneID:11882192"
     CDS             244372..245649
                     /locus_tag="PM3016_220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310350.1"
                     /db_xref="GI:379718219"
                     /db_xref="GeneID:11882192"
                     /translation="MSGSSKKDLFQKSFSRRDALKLAGAGGIGLLLGVGGIKAGALGE
                     GMLAPAVPADGAKGKVVPFYGEHQAGIITPMQDFICMGAFDLTAKNLGEVRELFTRWT
                     EAAARMSQGQGAGDNNSSPLVPPDDTGEAEGLNPSRTTITFGLGASFFDERYGLSGQR
                     PAALVDLPRFKGDALLSEWSGGDVAVQVCADDPQVAFHAIRNLIRIARGKAVLRWLQE
                     GFQRTGAADPQGSTPRNLLGFKDGTNNPDVQDAAAAKEIVWTEGGDHPSWMTGGSYLV
                     MRRIRMRIEVWDRTTLGEQEATFGRHRATGAPLGGRTEFEPLDLAKKDAAGKPMIPAD
                     SHVALANMEGKVKILRRGYSYSNGIDLKTGQLDAGLLFLCYNRDPREQFIPMQMRLAA
                     ADKLNEYIVHVGSGLYACLPGVKPGGYIGSTLF"
     misc_feature    244408..245646
                     /locus_tag="PM3016_220"
                     /note="Dyp-type peroxidase family; Region: Dyp_perox;
                     cl01067"
                     /db_xref="CDD:260772"
     gene            245670..247463
                     /locus_tag="PM3016_221"
                     /db_xref="GeneID:11882193"
     CDS             245670..247463
                     /locus_tag="PM3016_221"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310351.1"
                     /db_xref="GI:379718220"
                     /db_xref="GeneID:11882193"
                     /translation="MRRCLLWLCMAALLLMPVSPLLAAEADGTAAGRSQQLIALASDA
                     LIGAGDRDWPAVSAAVGKLKAEWTALSPAASAEFKLVDEAFEAADRELGKPQKDDKAA
                     YQAVSALVKAVDGYVSAGSGGAAMEKAHKQVQTALVPLLQKSLAAVKAGNSAQAKAAY
                     TSFVSGWGKAESVIRQDNPKLYGSMEVKISGVRIALNTEPMDTAKAEGKLQELIGSLE
                     AYASGSPDTAAEAAAADETLRSIGDLIALLDTVAADVQRQRSTEAASGMDRFISAWPA
                     LEGAVSTRSPEAYNRVETKMVEVPTLLLSTPPQWEQAAAALGALRSELEPYAEASSYT
                     AWDAGVIIFREGLEAILIISALVAFLNRSGNRDKRGWIWSGAAAGLVFSVVMALVLTL
                     MLSRLTAGGSRELIEGITGLIAVIFMVSIGAWLHSKSNLKSWNRFVEHSIGSSLAKGT
                     LWSLFFTSFLSVMREGAETLIFYMGMASSIAAGDMLLGIGTALVLLAVIGFVIIRMSG
                     RIPVRPFFLAASFLLYYLAFKFVGVSLHALQVTGHLSAHTSDGLVNLSWLGMYNSWET
                     TIPQLGVLAVIVWNAVHTERRTGENSAQRAA"
     misc_feature    <246477..247415
                     /locus_tag="PM3016_221"
                     /note="High-affinity Fe2+/Pb2+ permease [Inorganic ion
                     transport and metabolism]; Region: FTR1; COG0672"
                     /db_xref="CDD:223744"
     gene            complement(247705..250953)
                     /locus_tag="PM3016_222"
                     /db_xref="GeneID:11882194"
     CDS             complement(247705..250953)
                     /locus_tag="PM3016_222"
                     /codon_start=1
                     /transl_table=11
                     /product="putative extracellular protease"
                     /protein_id="YP_005310352.1"
                     /db_xref="GI:379718221"
                     /db_xref="GeneID:11882194"
                     /translation="MENYSFLKKISAASLAFAVLSTTAFTQAFAAPSDSSVIHRLTPE
                     GSPSKTLPNGHTVYISPKLKNKTKSGEEVRVIVQLSGQPVAVGKYAAKQGISSFTNES
                     AESTIAQEQNTFVSGAKNKGIGMKVNYRYNTVLNGLEISVPANQIPELAKLPGVKSIH
                     ESATYYPIPVSSPVSMETDNPNYDIAPLKQIGVDAAWVKGYTGKGLKVGVIDTGVDYL
                     HPDLKGAYKGGYDSFEQDADPYEEPPLSPAEDPYGTGFEGTSHGTHVSGTIVGRAANP
                     TSDIVQKGVAYEADLYVYKVLGRNPETGRASGSSAQVIDGIERAVKDGMNVINLSLGS
                     DAEKDVNSPDVVAINNAVLGGVIAVIANGNAADDGPYYYSLGSPATSQLAISVGAVTS
                     PTNHYTATVTEAAYAAGSTVIGAAYAAYDLNVMAWETGQENFASLIGTEPTDVVYAGL
                     GAEADFEGKDVAGKVVLVSRGSFAFVDKISSAKARGAKAVIIFNGNAAAGDAAAADLS
                     ESVPGRDGHIGSAAFLGDGFDFVPTFDMKGTEGRALARKALASPNHTLKLAFGAEYPK
                     TSSAGDTMATFSSRGPNVDADLSIKPDVVAPGVSVLSTWPAFGKFDPGASYQRAYNRI
                     NGTSMATPHVAGLALLLKQQHPTWSTSDIRAALANTADSIHDENGTLYDVYSQGAGRA
                     NVANAIQTPALIKTIEPITILDKYWNPKAVTNYGSSVSFGLVQPGKTVQKELEIKNLS
                     KQPLSYSAKVVLHPSVTSDPTAPTATPDVNNLNVQLIGIPASGKLSPAPGTAKRFYLS
                     VTPKSGAAQGVYEGEVVMESAGLPTLHLPFAVHVGSEKPSTGFGIQELEQTESVIYPG
                     NSEDLPVSTDLSFRLSAKDINVVDLWAVGLDDVPIGIIDSLSNLSGSGQPRLLEPGVY
                     SFEGIDGSYVDGEQDADGSLVVKHLEAGTYKLLLRAQLVDSLGNPLGGSVYEAYSSLR
                     LSDSESDRVARAKDAFKAKVVNTRIIGQPVLQLPVTEGIVYKVTNSTSKAYIDNSGLL
                     KLIPSSGIVNVELTVTISSAKDPSIKTTVKVPVVLSKVSVSQKTTSGSAAAQ"
     misc_feature    complement(250456..250662)
                     /locus_tag="PM3016_222"
                     /note="Peptidase inhibitor I9; Region: Inhibitor_I9;
                     pfam05922"
                     /db_xref="CDD:253461"
     misc_feature    complement(248893..250347)
                     /locus_tag="PM3016_222"
                     /note="Peptidase S8 family domain in Vpr-like proteins;
                     Region: Peptidases_S8_subtilisin_Vpr-like; cd07474"
                     /db_xref="CDD:173800"
     misc_feature    complement(248911..250335)
                     /locus_tag="PM3016_222"
                     /note="Subtilase family; Region: Peptidase_S8; pfam00082"
                     /db_xref="CDD:249571"
     misc_feature    complement(order(249070..249072,249862..249864,
                     249955..249963,250171..250173,250318..250320))
                     /locus_tag="PM3016_222"
                     /note="putative active site [active]"
                     /db_xref="CDD:173800"
     misc_feature    complement(order(249070..249072,250171..250173,
                     250318..250320))
                     /locus_tag="PM3016_222"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:173800"
     misc_feature    complement(249208..249624)
                     /locus_tag="PM3016_222"
                     /note="PA_C5a_like: Protease-associated domain containing
                     proteins like Streptococcus pyogenes C5a peptidase. This
                     group contains various PA domain-containing proteins
                     similar to S. pyogenes C5a, including, i) Vpr, a minor
                     extracellular serine protease from...; Region:
                     PA_C5a_like; cd02133"
                     /db_xref="CDD:239048"
     misc_feature    complement(249538..249546)
                     /locus_tag="PM3016_222"
                     /note="putative integrin binding motif; other site"
                     /db_xref="CDD:239048"
     misc_feature    complement(order(249388..249390,249394..249405,
                     249526..249531))
                     /locus_tag="PM3016_222"
                     /note="PA/protease domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239048"
     gene            251992..253740
                     /locus_tag="PM3016_223"
                     /db_xref="GeneID:11882195"
     CDS             251992..253740
                     /locus_tag="PM3016_223"
                     /codon_start=1
                     /transl_table=11
                     /product="fibronectin type III domain-containing protein"
                     /protein_id="YP_005310353.1"
                     /db_xref="GI:379718222"
                     /db_xref="GeneID:11882195"
                     /translation="MMYRAIQARRSTGFRTLTFLLIAALLLSLTPLTGLAADRGAWAP
                     GVAYQTNDTASYSGKIYTVLQSHTSQIGWEPPNVPALWKETAGGGTGSDTQAPAAPAG
                     LRVNGTTSSSVSLSWTAATDNVAVTGYDIYRGSVLAGSVSGSTLSFTNTGLAAGTYSF
                     TVKAKDAAGNVSAASGAVSATVSGSGGSDTQAPSVPAGLKVTGTTSSSVSLSWTASTD
                     NTGVTGYDVYRGTILAASVSGTTAIVTGLAASTSYTFTVKAKDAAGNVSAASSSISAT
                     TAASAGGTLPKRLLTGYWHNFINNSANLKLSQVPAAYDIIAVSFGEMDLANPGGVTFT
                     VDPSLSSALGGYTDADLIHDIKAKQAQGKKVILSLGGEKGNVNLSSASPNVSNFVNSV
                     SGLITKFGFDGIDIDLEHGFNVANLTSGVRQIQQKFGSGFILTMAPQTIDMQSQSSTY
                     LQFYANVKDITTVINTQYYNSGCMLGRDGKCYSQGTVDFLTALSDVALQWVSDSQLGL
                     GLPAVPSAAGGGYVSPAVVNDALNCLATGNSCGSYKPAQKYPNIRGAMTWSINWDSTN
                     GYNFANTVRPFLNSMP"
     misc_feature    252112..252246
                     /locus_tag="PM3016_223"
                     /note="chitin-binding domain of Chi A1-like proteins;
                     Region: ChiA1_BD; cd12214"
                     /db_xref="CDD:213177"
     misc_feature    252280..252537
                     /locus_tag="PM3016_223"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(252280..252282,252454..252456,252496..252498)
                     /locus_tag="PM3016_223"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    order(252502..252507,252511..252516)
                     /locus_tag="PM3016_223"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    252568..252783
                     /locus_tag="PM3016_223"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(252568..252570,252736..252738,252781..252783)
                     /locus_tag="PM3016_223"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    252853..253722
                     /locus_tag="PM3016_223"
                     /note="GH18 domain of Chitinase D (ChiD).  ChiD, a
                     chitinase found in Bacillus circulans, hydrolyzes the
                     1,4-beta-linkages of N-acetylglucosamine in chitin and
                     chitodextrins.  The domain architecture of ChiD includes a
                     catalytic glycosyl hydrolase family 18; Region:
                     GH18_chitinase_D-like; cd02871"
                     /db_xref="CDD:119350"
     misc_feature    252865..253680
                     /locus_tag="PM3016_223"
                     /note="Glycosyl hydrolases family 18; Region:
                     Glyco_hydro_18; pfam00704"
                     /db_xref="CDD:250070"
     misc_feature    order(252868..252870,252949..252951,253210..253212,
                     253216..253218,253390..253392,253396..253398,
                     253663..253665)
                     /locus_tag="PM3016_223"
                     /note="putative active site [active]"
                     /db_xref="CDD:119350"
     gene            253882..254526
                     /locus_tag="PM3016_224"
                     /db_xref="GeneID:11882196"
     CDS             253882..254526
                     /locus_tag="PM3016_224"
                     /codon_start=1
                     /transl_table=11
                     /product="Pentapeptide repeat-containing protein"
                     /protein_id="YP_005310354.1"
                     /db_xref="GI:379718223"
                     /db_xref="GeneID:11882196"
                     /translation="MASYLVSQTGVHTMFQYIDQEYTEVDFSQRDLREGELRGCVFIR
                     CRFRGAQLDEIETTGCQFVECDFTGATFNASMHERSAFTNCKFGGANLFVSKFRECKM
                     IGSDFAKAQLDGITIEQGDWSYTNLRQTNLGKQDLRNVKFMEADLSECNLEKANLREA
                     DLTRALLGRARLSGSDLRGAKMDGVDFRAMDVKGARMDLAQAAALARAYGARID"
     misc_feature    253936..254109
                     /locus_tag="PM3016_224"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_4; pfam13599"
                     /db_xref="CDD:257914"
     misc_feature    254053..254367
                     /locus_tag="PM3016_224"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_4; pfam13599"
                     /db_xref="CDD:257914"
     misc_feature    254248..254358
                     /locus_tag="PM3016_224"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     misc_feature    254287..254475
                     /locus_tag="PM3016_224"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_4; pfam13599"
                     /db_xref="CDD:257914"
     misc_feature    254314..254433
                     /locus_tag="PM3016_224"
                     /note="Pentapeptide repeats (8 copies); Region:
                     Pentapeptide; pfam00805"
                     /db_xref="CDD:109845"
     gene            complement(254548..254637)
                     /locus_tag="PM3016_225"
                     /db_xref="GeneID:11882197"
     CDS             complement(254548..254637)
                     /locus_tag="PM3016_225"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310355.1"
                     /db_xref="GI:379718224"
                     /db_xref="GeneID:11882197"
                     /translation="MMFDLEKVRWLLFVLFAVVLILKQKHTQL"
     gene            255207..256731
                     /locus_tag="PM3016_r7"
                     /db_xref="GeneID:11882198"
     rRNA            255207..256731
                     /locus_tag="PM3016_r7"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:11882198"
     gene            257019..259946
                     /locus_tag="PM3016_r8"
                     /db_xref="GeneID:11882199"
     rRNA            257019..259946
                     /locus_tag="PM3016_r8"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:11882199"
     gene            260046..260161
                     /locus_tag="PM3016_r9"
                     /db_xref="GeneID:11882200"
     rRNA            260046..260161
                     /locus_tag="PM3016_r9"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11882200"
     gene            260216..260289
                     /locus_tag="PM3016_t13"
                     /db_xref="GeneID:11882201"
     tRNA            260216..260289
                     /locus_tag="PM3016_t13"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:11882201"
     gene            260312..260384
                     /locus_tag="PM3016_t14"
                     /db_xref="GeneID:11882202"
     tRNA            260312..260384
                     /locus_tag="PM3016_t14"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:11882202"
     gene            260404..260475
                     /locus_tag="PM3016_t15"
                     /db_xref="GeneID:11882203"
     tRNA            260404..260475
                     /locus_tag="PM3016_t15"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:11882203"
     gene            260485..260566
                     /locus_tag="PM3016_t16"
                     /db_xref="GeneID:11882204"
     tRNA            260485..260566
                     /locus_tag="PM3016_t16"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:11882204"
     gene            260590..260662
                     /locus_tag="PM3016_t17"
                     /db_xref="GeneID:11882205"
     tRNA            260590..260662
                     /locus_tag="PM3016_t17"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:11882205"
     gene            260669..260741
                     /locus_tag="PM3016_t18"
                     /db_xref="GeneID:11882206"
     tRNA            260669..260741
                     /locus_tag="PM3016_t18"
                     /product="tRNA-Val"
                     /db_xref="GeneID:11882206"
     gene            260764..260837
                     /locus_tag="PM3016_t19"
                     /db_xref="GeneID:11882207"
     tRNA            260764..260837
                     /locus_tag="PM3016_t19"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:11882207"
     gene            260861..260933
                     /locus_tag="PM3016_t20"
                     /db_xref="GeneID:11882208"
     tRNA            260861..260933
                     /locus_tag="PM3016_t20"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:11882208"
     gene            260949..261021
                     /locus_tag="PM3016_t21"
                     /db_xref="GeneID:11882209"
     tRNA            260949..261021
                     /locus_tag="PM3016_t21"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:11882209"
     gene            261032..261115
                     /locus_tag="PM3016_t22"
                     /db_xref="GeneID:11882210"
     tRNA            261032..261115
                     /locus_tag="PM3016_t22"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:11882210"
     gene            261122..261193
                     /locus_tag="PM3016_t23"
                     /db_xref="GeneID:11882211"
     tRNA            261122..261193
                     /locus_tag="PM3016_t23"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:11882211"
     gene            261209..261280
                     /locus_tag="PM3016_t24"
                     /db_xref="GeneID:11882212"
     tRNA            261209..261280
                     /locus_tag="PM3016_t24"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:11882212"
     gene            261296..261369
                     /locus_tag="PM3016_t25"
                     /db_xref="GeneID:11882213"
     tRNA            261296..261369
                     /locus_tag="PM3016_t25"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:11882213"
     gene            261375..261448
                     /locus_tag="PM3016_t26"
                     /db_xref="GeneID:11882214"
     tRNA            261375..261448
                     /locus_tag="PM3016_t26"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:11882214"
     gene            261607..261679
                     /locus_tag="PM3016_t27"
                     /db_xref="GeneID:11882215"
     tRNA            261607..261679
                     /locus_tag="PM3016_t27"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:11882215"
     gene            261687..261759
                     /locus_tag="PM3016_t28"
                     /db_xref="GeneID:11882216"
     tRNA            261687..261759
                     /locus_tag="PM3016_t28"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:11882216"
     gene            261765..261851
                     /locus_tag="PM3016_t29"
                     /db_xref="GeneID:11882217"
     tRNA            261765..261851
                     /locus_tag="PM3016_t29"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:11882217"
     gene            261874..261961
                     /locus_tag="PM3016_t30"
                     /db_xref="GeneID:11882218"
     tRNA            261874..261961
                     /locus_tag="PM3016_t30"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:11882218"
     gene            261979..262051
                     /locus_tag="PM3016_t31"
                     /db_xref="GeneID:11882219"
     tRNA            261979..262051
                     /locus_tag="PM3016_t31"
                     /product="tRNA-Val"
                     /db_xref="GeneID:11882219"
     gene            262060..262131
                     /locus_tag="PM3016_t32"
                     /db_xref="GeneID:11882220"
     tRNA            262060..262131
                     /locus_tag="PM3016_t32"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:11882220"
     gene            262174..262262
                     /locus_tag="PM3016_t33"
                     /db_xref="GeneID:11882221"
     tRNA            262174..262262
                     /locus_tag="PM3016_t33"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:11882221"
     gene            262304..262386
                     /locus_tag="PM3016_t34"
                     /db_xref="GeneID:11882222"
     tRNA            262304..262386
                     /locus_tag="PM3016_t34"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:11882222"
     gene            262610..263515
                     /locus_tag="PM3016_227"
                     /db_xref="GeneID:11882223"
     CDS             262610..263515
                     /locus_tag="PM3016_227"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GlcT"
                     /protein_id="YP_005310356.1"
                     /db_xref="GI:379718225"
                     /db_xref="GeneID:11882223"
                     /translation="MYNPGFFGILSELGSLRGAGVESLQVRKVLNNNVIIAVHPEYGE
                     TVVIGKGIGFSRKQGDAIALDSIEKMFILTNEKAKEQYKLLMHQVDEKLIEVMNDVIF
                     YISQHAGAPLNEQIHIALTDHIAFAIKRYRQHIPIHNPFQYETRELYPREYLLAQHVI
                     DEINRRLGVQLPEDEVGFVALHIYSAITNRHVVEVKEHSRLVTDLIDLIERKLEIKIK
                     KDSLDYARLLRHLMVALERIRRGERVEEPTKIAEIIKNEYPEMYSFAWTLMKVIQQRM
                     QKPVYEAEAIYLTIHLQRMLPSEGS"
     misc_feature    262676..263494
                     /locus_tag="PM3016_227"
                     /note="transcriptional antiterminator BglG; Provisional;
                     Region: PRK09772"
                     /db_xref="CDD:170086"
     misc_feature    262679..262840
                     /locus_tag="PM3016_227"
                     /note="CAT RNA binding domain; Region: CAT_RBD;
                     smart01061"
                     /db_xref="CDD:215004"
     misc_feature    262901..263167
                     /locus_tag="PM3016_227"
                     /note="PRD domain; Region: PRD; pfam00874"
                     /db_xref="CDD:250194"
     misc_feature    263219..263491
                     /locus_tag="PM3016_227"
                     /note="PRD domain; Region: PRD; pfam00874"
                     /db_xref="CDD:250194"
     gene            263783..265834
                     /locus_tag="PM3016_228"
                     /db_xref="GeneID:11882224"
     CDS             263783..265834
                     /locus_tag="PM3016_228"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PtsG"
                     /protein_id="YP_005310357.1"
                     /db_xref="GI:379718226"
                     /db_xref="GeneID:11882224"
                     /translation="MFKQLFGVLQKVGKALMLPVAILPAAGILLALGNVLHNASLLEL
                     MPALNAGWIQLIATVMEQAGNIVFSNLALLFAVGVAVGLAGGDGVAGIAAIIGFLIMN
                     VTMGVFKGVTPEMVKTDMSYANVLGINTLQTGVFGGVIIGILAASMYNRFFKIQLPSY
                     LGFFAGKRFVPIITAVSSLVLGILMIFIWPPIQSGLNHFSHNMLDANPTLAAFFFGLI
                     ERSLIPFGLHHIFYSPFWFEFGQYVDKAGEIVRGDQKIFFAQLKDGVALTAGTFMVGK
                     FPFMMFGLPAAALAIYHEARPEQKKYVAGIMGSAALTSFLTGITEPLEFSFLFVAPFL
                     FAIHAVFAGLSFMVMQILNVKIGMTFSGGVIDFLLFGVIQNRTAWWLVIPVGLVLAVI
                     YYFGFRFAIRKFNLKTPGREDTEGAADKQAGAADELPSNVLAALGGQSNIENLDACIT
                     RLRVQVKESKQVDKDRLKQLGAAGVLEVGNNIQAIFGTHSDILKSQIHDIMQGRAVTA
                     APAPAAPAAPAAVQTTDASGAVTEEPIVAPLDGELVDISEVPDEVFSQRMTGDGFAIL
                     PKNGIVASPVNGTIYNVFPSKHAIGIQSEGGKELLVHFGVNTVKLKGKGFTALVAQGD
                     TVKAGQPILEVDIDFVRENAPSIATPVIFTNLPEGASVKLNKTGPVTLGEKDIITIKL
                     P"
     misc_feature    263783..265045
                     /locus_tag="PM3016_228"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG; COG1263"
                     /db_xref="CDD:224183"
     misc_feature    263786..265291
                     /locus_tag="PM3016_228"
                     /note="PTS system, glucose-specific IIBC component;
                     Region: PTS-II-BC-glcB; TIGR02002"
                     /db_xref="CDD:233681"
     misc_feature    265058..265285
                     /locus_tag="PM3016_228"
                     /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIB_glc; cd00212"
                     /db_xref="CDD:238130"
     misc_feature    265121..265141
                     /locus_tag="PM3016_228"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    265124..265126
                     /locus_tag="PM3016_228"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     misc_feature    265373..265828
                     /locus_tag="PM3016_228"
                     /note="Phosphotransferase system IIA components
                     [Carbohydrate transport and metabolism]; Region: NagE;
                     COG2190"
                     /db_xref="CDD:225101"
     misc_feature    order(265433..265444,265454..265459,265523..265528,
                     265532..265537,265553..265561,265577..265585,
                     265589..265591,265601..265603,265607..265612,
                     265646..265648,265742..265744,265751..265753)
                     /locus_tag="PM3016_228"
                     /note="HPr interaction site; other site"
                     /db_xref="CDD:238128"
     misc_feature    order(265433..265435,265439..265444,265448..265450,
                     265454..265459,265526..265528,265532..265534,
                     265544..265546,265583..265585,265589..265591,
                     265601..265603,265607..265612,265616..265618,
                     265742..265744)
                     /locus_tag="PM3016_228"
                     /note="glycerol kinase (GK) interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238128"
     misc_feature    order(265538..265540,265544..265546,265589..265591,
                     265595..265597)
                     /locus_tag="PM3016_228"
                     /note="active site"
                     /db_xref="CDD:238128"
     misc_feature    265589..265591
                     /locus_tag="PM3016_228"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238128"
     gene            266014..266286
                     /locus_tag="PM3016_229"
                     /db_xref="GeneID:11882225"
     CDS             266014..266286
                     /locus_tag="PM3016_229"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PtsH"
                     /protein_id="YP_005310358.1"
                     /db_xref="GI:379718227"
                     /db_xref="GeneID:11882225"
                     /translation="MQKTFKITSEDGIHARPATALVNTANKFKSEVFAESGGRKVTMK
                     SILGVLSFGLEPGDTITFLASGEDEAEVMAALEDIMVKEGLGDLHE"
     misc_feature    266023..266253
                     /locus_tag="PM3016_229"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    266023..266034
                     /locus_tag="PM3016_229"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    order(266050..266052,266056..266061,266065..266070,
                     266080..266082,266089..266091,266143..266154,
                     266161..266166)
                     /locus_tag="PM3016_229"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    266053..266055
                     /locus_tag="PM3016_229"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    266146..266148
                     /locus_tag="PM3016_229"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            266279..268003
                     /locus_tag="PM3016_230"
                     /db_xref="GeneID:11882226"
     CDS             266279..268003
                     /locus_tag="PM3016_230"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PtsI"
                     /protein_id="YP_005310359.1"
                     /db_xref="GI:379718228"
                     /db_xref="GeneID:11882226"
                     /translation="MNNIHGIAAASGIAIAKAFRLEAAHLDIRKAEGKDPEAEIQKFE
                     SALEQSRADLEALKERTRVQLGDEKAEIFESHLLVLGDPELIDPVKEKIRSERINAEW
                     ALQEVAAGFIAMFENMKSAYLRERAADMRDVTKRVQSYMLGVKFVNLTAIDEEVVLIA
                     EDLTPSDTAQLNRQFVKGFATNIGGRTSHSAIMARSLEIPAVVGTKNVLEVVQDGDLV
                     ILDGLTGQVIVKPEPAVVEEYREKQAQYEAQRAEWAKLRSEPSVTADGHHVELAANIG
                     TPNDVAGVIDNGGEAVGLYRTEFLYMGRDKLPTEKEQFNAYKAVLEKMEGKPVVVRTL
                     DIGGDKELPYLDLPKEMNPFLGFRAVRLCLEQQDLFRTQLRALLRASVYGNLRIMFPM
                     IATLDEFREAKAILLEEKAKLIEEQIPVSDSIQLGIMVEIPSTAVMADQFAKEVDFFS
                     IGTNDLIQYTMAADRMNERVSYLYQPYNPAILRLVQMVIDAAHKEGKWTGMCGEMAGD
                     ATAIPLLIGLGLDEFSMSASSILPARSQISKLSLAEMKKLAAEALQQRTAADVVALVK
                     RATEDQVN"
     misc_feature    266309..266659
                     /locus_tag="PM3016_230"
                     /note="PEP-utilizing enzyme, N-terminal; Region:
                     PEP-utilizers_N; pfam05524"
                     /db_xref="CDD:253237"
     misc_feature    266333..267997
                     /locus_tag="PM3016_230"
                     /note="Phosphoenolpyruvate-protein kinase (PTS system EI
                     component in bacteria) [Carbohydrate transport and
                     metabolism]; Region: PtsA; COG1080"
                     /db_xref="CDD:224006"
     misc_feature    266732..266944
                     /locus_tag="PM3016_230"
                     /note="PEP-utilizing enzyme, mobile domain; Region:
                     PEP-utilizers; pfam00391"
                     /db_xref="CDD:249825"
     misc_feature    267026..267898
                     /locus_tag="PM3016_230"
                     /note="PEP-utilizing enzyme, TIM barrel domain; Region:
                     PEP-utilizers_C; pfam02896"
                     /db_xref="CDD:251603"
     gene            complement(268354..268860)
                     /locus_tag="PM3016_231"
                     /db_xref="GeneID:11882227"
     CDS             complement(268354..268860)
                     /locus_tag="PM3016_231"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310360.1"
                     /db_xref="GI:379718229"
                     /db_xref="GeneID:11882227"
                     /translation="MLKTLRVTCLTVALATSLGTAALASDGAAGTTDSGMTGSSTSTS
                     STGTMNSTGSGTSTSGTDSTSGTSTMSGSDSTSGGINTNSGIDGTSDGTSSGGTSNNL
                     SGTSGTGTGYNQTSAADDDGMDWGWLGLLGLAGLMGLRGRERDRDHDTYTTTTTTNGS
                     VTGREKAR"
     gene            complement(268927..269136)
                     /locus_tag="PM3016_232"
                     /db_xref="GeneID:11882228"
     CDS             complement(268927..269136)
                     /locus_tag="PM3016_232"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GsiB"
                     /protein_id="YP_005310361.1"
                     /db_xref="GI:379718230"
                     /db_xref="GeneID:11882228"
                     /translation="MAENNDNKMSREEAGRKGGEATARTHDKEFYQEIGRKGGEATAE
                     SHDKEFYQEIGEKGGEARARQRQES"
     misc_feature    complement(268954..269136)
                     /locus_tag="PM3016_232"
                     /note="General stress protein [General function prediction
                     only]; Region: GsiB; COG3729"
                     /db_xref="CDD:226252"
     gene            complement(269426..269719)
                     /locus_tag="PM3016_233"
                     /db_xref="GeneID:11882229"
     CDS             complement(269426..269719)
                     /locus_tag="PM3016_233"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310362.1"
                     /db_xref="GI:379718231"
                     /db_xref="GeneID:11882229"
                     /translation="MTEYNESKEAEAEALFGMNPPAGEAAANRNAENDAAGPSAQMSE
                     GFAGSGQHQGSDEDEADEGTDRWFQIMQNAALAGRASFPDQIDYYDPESDEFV"
     gene            269925..270311
                     /locus_tag="PM3016_234"
                     /db_xref="GeneID:11882230"
     CDS             269925..270311
                     /locus_tag="PM3016_234"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310363.1"
                     /db_xref="GI:379718232"
                     /db_xref="GeneID:11882230"
                     /translation="MAKGMRTAQSVLLVTADAALASYIDSILNKGLGIRIVHVHSFAE
                     ARTGFAQGGFSAVLADLPDVSVEELGFWKTEVPVLLLATEEARPAARRAVEEGLALLY
                     MIRDGLSPDTLIGAVMDAVERPGTLW"
     gene            270361..271449
                     /locus_tag="PM3016_235"
                     /db_xref="GeneID:11882231"
     CDS             270361..271449
                     /locus_tag="PM3016_235"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_005310364.1"
                     /db_xref="GI:379718233"
                     /db_xref="GeneID:11882231"
                     /translation="MNGIKADRRLGKEGMTLNKSKGPEETLPRWNRKLLNAYWFFVIS
                     MTAGETANLFLAESPAWEFIVQSIVRPTLLFVAIMALSEWGYRKLSMSSPLIVIFTGH
                     LLITVGVWVHAVVDSILLIYVLPLLVSVFYFQKKYVYLASALNLASFLLLYLLNPILY
                     ERTSGVEVMTTVLLLGYGSPYVAAKIMDRGVDLMRDLKTDALTGLYNHITFHGFLDRA
                     LERQQAGAGGAMLAVMDIDHFKSVNDTYGHRAGDFVLRRVAAIIQSRIGPDDTAARYG
                     GEEFALLMPSRSEQEAYALCEDIRLQLAAAAHQELDGRAVTISVGLCRLRPGMDKEAW
                     FQRADALLYRAKREGRNRTVREDDPGGA"
     misc_feature    270955..271422
                     /locus_tag="PM3016_235"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(271063..271065,271192..271194)
                     /locus_tag="PM3016_235"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(271078..271080,271087..271092,271102..271104,
                     271114..271116,271180..271182,271186..271197)
                     /locus_tag="PM3016_235"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(271168..271170,271252..271254)
                     /locus_tag="PM3016_235"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(271591..271905)
                     /locus_tag="PM3016_236"
                     /db_xref="GeneID:11882232"
     CDS             complement(271591..271905)
                     /locus_tag="PM3016_236"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310365.1"
                     /db_xref="GI:379718234"
                     /db_xref="GeneID:11882232"
                     /translation="MTQRSSLVALIGLWFIMAPWIMGFAGSSGALWSSVIGGGVLLLS
                     SLLGYGKSGWDSLFNWISLLSGVWLMIFAMAFPFPLLQASLYLLLGLAAVLLTFYNME
                     GR"
     misc_feature    complement(<271798..271878)
                     /locus_tag="PM3016_236"
                     /note="SPW repeat; Region: SPW; pfam03779"
                     /db_xref="CDD:202765"
     gene            272134..273045
                     /locus_tag="PM3016_237"
                     /db_xref="GeneID:11882233"
     CDS             272134..273045
                     /locus_tag="PM3016_237"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HprK2"
                     /protein_id="YP_005310366.1"
                     /db_xref="GI:379718235"
                     /db_xref="GeneID:11882233"
                     /translation="MNTVTVQQLVDRFSLEVLAGKDQLHRTIAKTRVYRPGLEFAGYY
                     DFFSHAHVQILGRKEINYLHKLTEEERNLRIGNVVKYHPPCFVVTRGQEGLKYLKKYC
                     EEEGIPLLRTGEATSKVMPMMDIYLAKELAEEAAIHGVCVNVSGIGILLRGKSGVGKS
                     ETAHTLIRRGHRLVADDIVVLKKISPETIIGTHNGKTKEFLALRSIGLINVSRLYGRK
                     AFQDETRIVLDIELTKWQENALNNELELEPKYTEYMDVKIPHIEIQLQPGRDVAGLVE
                     AAANNWYLRQQGYSAAEDFMKRLQSED"
     misc_feature    272137..272517
                     /locus_tag="PM3016_237"
                     /note="HPr Serine kinase N terminus; Region: Hpr_kinase_N;
                     pfam02603"
                     /db_xref="CDD:190362"
     misc_feature    272143..273039
                     /locus_tag="PM3016_237"
                     /note="Hpr(Ser) kinase/phosphatase; Region: hpr-ser;
                     TIGR00679"
                     /db_xref="CDD:233088"
     misc_feature    272530..272979
                     /locus_tag="PM3016_237"
                     /note="HprK/P, the bifunctional histidine-containing
                     protein kinase/phosphatase, controls the phosphorylation
                     state of the phosphocarrier protein HPr and regulates the
                     utilization of carbon sources by gram-positive bacteria.
                     It catalyzes both the ATP-dependent...; Region: HprK_C;
                     cd01918"
                     /db_xref="CDD:238899"
     misc_feature    order(272539..272541,272545..272547,272596..272601,
                     272608..272610,272623..272625,272635..272637,
                     272662..272667,272671..272673,272719..272721,
                     272737..272739,272749..272757,272770..272772,
                     272860..272868,272917..272919,272950..272952,
                     272959..272961)
                     /locus_tag="PM3016_237"
                     /note="Hpr binding site; other site"
                     /db_xref="CDD:238899"
     misc_feature    order(272545..272547,272599..272601,272605..272613,
                     272659..272664,272737..272739,272743..272745)
                     /locus_tag="PM3016_237"
                     /note="active site"
                     /db_xref="CDD:238899"
     misc_feature    order(272617..272619,272623..272625,272635..272640,
                     272647..272649,272719..272721,272731..272733,
                     272749..272751,272755..272763,272770..272778,
                     272914..272916,272962..272967,272971..272973)
                     /locus_tag="PM3016_237"
                     /note="homohexamer subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238899"
     gene            273241..274047
                     /locus_tag="PM3016_238"
                     /db_xref="GeneID:11882234"
     CDS             273241..274047
                     /locus_tag="PM3016_238"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_005310367.1"
                     /db_xref="GI:379718236"
                     /db_xref="GeneID:11882234"
                     /translation="MEHSKRLLITGAGGRIGSCLAEGLRAHGGYEVVAADLKEDKTAG
                     ILQLDVTDGERLNELAQGVDTIMHFAWAKDEGDFLGKVLPVNVTGAYHVYEAARLNGV
                     KRVIFASSNHATGFYEVGEDVMPDEPYRPDSFYGLSKCYIELLGRYYADKYGVSSINL
                     RIGNFPGDDQPHSERAAHIFISERDMISLAVCCIEAGPEIDFLSLYGTSANTDNYYDI
                     GYLEELIGYKPQDDGRTLLEEARRRHVKIKDDETCFQGGAVEKEQPQDRR"
     misc_feature    273253..>273789
                     /locus_tag="PM3016_238"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    273256..>273786
                     /locus_tag="PM3016_238"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(273271..273273,273277..273282,273286..273288,
                     273346..273348,273445..273450,273472..273474,
                     273562..273570,273643..273645,273655..273657,
                     273724..273735)
                     /locus_tag="PM3016_238"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(273496..273498,273568..273570,273643..273645,
                     273655..273657)
                     /locus_tag="PM3016_238"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            274253..274621
                     /locus_tag="PM3016_239"
                     /db_xref="GeneID:11882235"
     CDS             274253..274621
                     /locus_tag="PM3016_239"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310368.1"
                     /db_xref="GI:379718237"
                     /db_xref="GeneID:11882235"
                     /translation="MDLDKLLIKLAGNGFIVVLFLMMLTDASFLGALVTALLLSIVAW
                     FLGDRFLLPRSSNVIATAADGVLAAMVLWAAARIAPWEMSVPKLIGLVVILGAFEALF
                     HFFLQRRDPYYRGEAGRAKA"
     misc_feature    274268..274609
                     /locus_tag="PM3016_239"
                     /note="Protein of unknown function (DUF2512); Region:
                     DUF2512; pfam10710"
                     /db_xref="CDD:256130"
     gene            complement(274850..276136)
                     /locus_tag="PM3016_240"
                     /db_xref="GeneID:11882236"
     CDS             complement(274850..276136)
                     /locus_tag="PM3016_240"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YaaH"
                     /protein_id="YP_005310369.1"
                     /db_xref="GI:379718238"
                     /db_xref="GeneID:11882236"
                     /translation="MQIHVVQPGQTLFRLSQAYDVTVQELADANEIPVGRSLVVGQAL
                     VIPIVGRYYWVRAGDTLTSIAARFGTTPARLAQVNGLNAGQPLRVGLRLYIPPGPKRT
                     AEFNAYLEPRGDEVSPRLTQSAREAAPYLTYLAPFSFRINRNGTLQPPPLDNLRRIAQ
                     AQGVTLMMVVTNLENDQFSADLGRVILTNETLQNTLLDNILRTARLLGFRDIHFDIEH
                     LRPVDREAYNNFLRKAADRIHQQGYLMSTALAPKTSAAQTGEWYTAHDYKAHGEIADF
                     VVIMTYEWGYSGGPAMPVSPIREVRRVLEYALTEMPGSKIMMGQNLYGYDWTLPFVPG
                     GAYAKALSPQQAIELAHREQVSIEYDYTAQAPHFSYWDNNRKQHIVWFEDARSIQAKF
                     NLVKELGLRGVSYWKLGLPFPQNWLLIQDNFTVVKR"
     misc_feature    complement(274865..276136)
                     /locus_tag="PM3016_240"
                     /note="Predicted glycosyl hydrolase [General function
                     prediction only]; Region: COG3858"
                     /db_xref="CDD:226376"
     misc_feature    complement(275999..276133)
                     /locus_tag="PM3016_240"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    complement(275852..275986)
                     /locus_tag="PM3016_240"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    complement(274880..275830)
                     /locus_tag="PM3016_240"
                     /note="Cortical fragment-lytic enzyme (CFLE) is a
                     peptidoglycan hydrolase involved in  bacterial endospore
                     germination.  CFLE is expressed as an inactive preprotein
                     (called SleB) in the forespore compartment of sporulating
                     cells.  SleB translocates across the...; Region:
                     GH18_CFLE_spore_hydrolase; cd02874"
                     /db_xref="CDD:119353"
     misc_feature    complement(order(274919..274921,275168..275170,
                     275288..275293,275297..275299,275486..275488,
                     275492..275494,275498..275500,275603..275605,
                     275723..275728,275816..275818))
                     /locus_tag="PM3016_240"
                     /note="active site"
                     /db_xref="CDD:119353"
     gene            complement(276424..277113)
                     /locus_tag="PM3016_241"
                     /db_xref="GeneID:11882237"
     CDS             complement(276424..277113)
                     /locus_tag="PM3016_241"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310370.1"
                     /db_xref="GI:379718239"
                     /db_xref="GeneID:11882237"
                     /translation="MAWLFDAFRLLHIAGGFLALFTFWIPLVTVKGGRTHNRSGWFYV
                     YCMGFVALSALYMGVYRIFLDPSADESLIAFSWFLIFIAVLSSASAWYGLRVLRIKSR
                     RAPHRGLRDLGFSLLLFLSGIAVCVYGFRIGFPLLQYFPLIGIVLGAQQLYYWRSVPK
                     TRRHWILEHIGAMMGCCIATITAFTVFGAPRLLGVSSVSIILWFLPTIVMVPLIIAFS
                     RHYRNKYNPPA"
     gene            277342..277836
                     /locus_tag="PM3016_242"
                     /db_xref="GeneID:11882238"
     CDS             277342..277836
                     /locus_tag="PM3016_242"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310371.1"
                     /db_xref="GI:379718240"
                     /db_xref="GeneID:11882238"
                     /translation="MENNRQIRSNIWNTVEDLSDMQINTRVEEGKWTIAQVLEHLYLM
                     EKAITASMSRELNGGEIRPAEEKNFFLTLDRSRSVPAPAPLVPAEGFYTMNELKDKLG
                     ESRRTLEELLAGIPDEELAQRSFLHPVFGLMDLRQWLTFIGVHEQRHWGQIEELKMGL
                     PPEE"
     misc_feature    277354..277800
                     /locus_tag="PM3016_242"
                     /note="DinB superfamily; Region: DinB_2; pfam12867"
                     /db_xref="CDD:257360"
     gene            277977..278777
                     /locus_tag="PM3016_243"
                     /db_xref="GeneID:11882239"
     CDS             277977..278777
                     /locus_tag="PM3016_243"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_005310372.1"
                     /db_xref="GI:379718241"
                     /db_xref="GeneID:11882239"
                     /translation="MGLAASAALAQRGFRVTMVCRSRERGEQALKEAISLSGSEELEL
                     MLCDLGSLRSIRAFAADFRAKYDKLDVLLNNAGVFALKREFTEDGFESMMGVNHLGHF
                     LLTHLLLKPLLQAPQGRIVVVSSGAHRAGKIHWDDPFLSRGFNFWKGYAQSKLANVLF
                     TKELARRLAGSGVTANCLHPGAVATSIGVDRRTGFGRSVLRMLKPVFLTPAEGASTAV
                     YLAVSEEAAGVSGEYYYKQKPAPVSRLAADPEAAGRLWAWSEKAVGLT"
     misc_feature    277977..278744
                     /locus_tag="PM3016_243"
                     /note="retinol dehydrogenase (retinol-DH), Light dependent
                     Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and
                     related proteins, classical (c) SDRs; Region:
                     retinol-DH_like_SDR_c_like; cd05327"
                     /db_xref="CDD:212492"
     misc_feature    order(277977..277979,278034..278042,278115..278123,
                     278199..278207,278262..278264,278361..278369,
                     278424..278426,278436..278438,278514..278525,
                     278529..278534)
                     /locus_tag="PM3016_243"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:212492"
     misc_feature    277980..278672
                     /locus_tag="PM3016_243"
                     /note="3-oxoacyl-(acyl-carrier-protein) reductase; Region:
                     3oxo_ACP_reduc; TIGR01830"
                     /db_xref="CDD:233590"
     misc_feature    order(278265..278267,278367..278369,278424..278426,
                     278436..278438)
                     /locus_tag="PM3016_243"
                     /note="active site"
                     /db_xref="CDD:212492"
     gene            278774..279262
                     /locus_tag="PM3016_244"
                     /db_xref="GeneID:11882240"
     CDS             278774..279262
                     /locus_tag="PM3016_244"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="YP_005310373.1"
                     /db_xref="GI:379718242"
                     /db_xref="GeneID:11882240"
                     /translation="MMIMNEKIKAAEVELTGLDGESLGVVSRDEALAMAKKLKVDLVC
                     TSLMSSPPPCRLIGRGAAKEAQQKEKRAAGGGAPAKVKELRLTPHIEEHDYETKQRQA
                     EKLLASGHAVQLVVKTGSAKESAAAKALLERLLKDLAPAGSGESGIQVSGKGAQVKVN
                     PQ"
     misc_feature    278783..278992
                     /locus_tag="PM3016_244"
                     /note="Translation initiation factor IF-3, N-terminal
                     domain; Region: IF3_N; pfam05198"
                     /db_xref="CDD:191228"
     misc_feature    279011..>279124
                     /locus_tag="PM3016_244"
                     /note="Translation initiation factor IF-3, C-terminal
                     domain; Region: IF3_C; pfam00707"
                     /db_xref="CDD:250071"
     gene            279303..279626
                     /locus_tag="PM3016_245"
                     /db_xref="GeneID:11882241"
     CDS             279303..279626
                     /locus_tag="PM3016_245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310374.1"
                     /db_xref="GI:379718243"
                     /db_xref="GeneID:11882241"
                     /translation="MGRRWLPAWQQRLTPPAPSAPGLGRLRVELHEFEAVAVRGVDPA
                     LPVAVFAHLGLDTERHAMAAQVGGHGFNALGLQAEVREADRAFDGLRAVPAAVVQLDE
                     LQPDT"
     gene            279936..281054
                     /locus_tag="PM3016_246"
                     /db_xref="GeneID:11882242"
     CDS             279936..281054
                     /locus_tag="PM3016_246"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit C"
                     /protein_id="YP_005310375.1"
                     /db_xref="GI:379718244"
                     /db_xref="GeneID:11882242"
                     /translation="MPFVFQAAVYPERPGCYIMKNEAGRILYVGKSKNLRSRLRSYFQ
                     TNHKRKRLRQLVEEIASIEVMLVNNEAESLLLENNLIKIHKPPFNRALKKDNSGYAYL
                     HMTAERLPRLDVYYRDRRPSAVRAASAASGEKKPETPDKEQRFGPYRSSRFRNAVMEF
                     VADHYRLRTCTTMPKRVCLLYHIGRCSGVCEGKISEEEYRETARQAAELLLRHGDDLI
                     AAMYGKMEYYAERLQFEEAASMLRHIRVLEQMPAKQIVDREALVDQDVLYFGEERVLV
                     GKVQEGMLRDFDLLPLDQGLGDAACDRFLVSRYSAERPHELIVNRICDPRMVRSLLHR
                     GGGPPVKITQPKRGLKYELLQLCKENYEYRLQRELQGC"
     misc_feature    279966..280205
                     /locus_tag="PM3016_246"
                     /note="Catalytic GIY-YIG domain of nucleotide excision
                     repair endonucleases UvrC, Cho, and similar proteins;
                     Region: GIY-YIG_UvrC_Cho; cd10434"
                     /db_xref="CDD:198381"
     misc_feature    order(279978..279986,280017..280025)
                     /locus_tag="PM3016_246"
                     /note="GIY-YIG motif/motif A; other site"
                     /db_xref="CDD:198381"
     misc_feature    order(279984..279986,280017..280019,280023..280028,
                     280047..280049,280059..280061,280164..280166,
                     280200..280202)
                     /locus_tag="PM3016_246"
                     /note="active site"
                     /db_xref="CDD:198381"
     misc_feature    order(280017..280019,280047..280049,280164..280166)
                     /locus_tag="PM3016_246"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198381"
     misc_feature    order(280017..280019,280047..280049,280164..280166)
                     /locus_tag="PM3016_246"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:198381"
     misc_feature    280164..280166
                     /locus_tag="PM3016_246"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198381"
     misc_feature    280446..>280763
                     /locus_tag="PM3016_246"
                     /note="ATP-NAD kinase; Region: NAD_kinase; cl01255"
                     /db_xref="CDD:260858"
     gene            281263..281871
                     /locus_tag="PM3016_247"
                     /db_xref="GeneID:11882243"
     CDS             281263..281871
                     /locus_tag="PM3016_247"
                     /codon_start=1
                     /transl_table=11
                     /product="5-carboxymethyl-2-hydroxymuconate
                     delta-isomerase"
                     /protein_id="YP_005310376.1"
                     /db_xref="GI:379718245"
                     /db_xref="GeneID:11882243"
                     /translation="MIYGRDVTRKVICIGPNFRAFREEKGITNDGELSLSLKSPESLT
                     FGDTVRVSREMGAFICEVEMAVIIGRDAKNVSEDEAASVIAGYAIANDMTAADHFGDG
                     RLKMYDEMTPIGPMVELRDPSDVELELWVNGQRIQQGHTSEMLFAPLWQVAHLSRIMT
                     LRRGDVILSGTPANPQVCQPGDRIELRSPQLGTLSHTVVVEP"
     misc_feature    <281287..281868
                     /locus_tag="PM3016_247"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    281290..281859
                     /locus_tag="PM3016_247"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            complement(281930..282877)
                     /locus_tag="PM3016_248"
                     /db_xref="GeneID:11882244"
     CDS             complement(281930..282877)
                     /locus_tag="PM3016_248"
                     /codon_start=1
                     /transl_table=11
                     /product="putative UV damage endonuclease"
                     /protein_id="YP_005310377.1"
                     /db_xref="GI:379718246"
                     /db_xref="GeneID:11882244"
                     /translation="MEIRIGYVSMALAIFNNTPSSTFTYKLFSQRPREEAMQRAIEVG
                     RKNLEATRRILYYNAAHGIRLFRLSSSLIPLATHPEVLIDVGEVYKKELAELGGFARR
                     HDIRLSMHPNQFTLLNGKDPVVEAAIRDLEYHAALLDGMGLDDSAVINIHVGGVYGDK
                     ASAMERLYEKFPEVPAPVAARMTFENDDKTYTLLETLEVCERLGRPMMLDLHHDWCNP
                     SGTDPLDVLGRIRATWGGRPMKIHVSSPKEEKDFRSHADYINPEPLAAFLRGCREAGM
                     ERIDVMVEAKMKDLAALRLAEDLGKIRGLKRTDGGMLKW"
     misc_feature    complement(281969..282877)
                     /locus_tag="PM3016_248"
                     /note="putative UV damage endonuclease; Provisional;
                     Region: uvsE; PRK02308"
                     /db_xref="CDD:235029"
     gene            283068..283634
                     /locus_tag="PM3016_249"
                     /db_xref="GeneID:11882245"
     CDS             283068..283634
                     /locus_tag="PM3016_249"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310378.1"
                     /db_xref="GI:379718247"
                     /db_xref="GeneID:11882245"
                     /translation="MDHRFPGDPRAGACRLPDGYAVLAERYANTALSAAVNVTGDWPA
                     GRAAVRAALANAARKKAELPPPHEAGRWLYLQARREALRMRRKEGLPGWSMSRAEAAE
                     AVLPGGAAPYEALGRVQEQDRGLFLLRELGGLGEAEIARAVNLTLNAVRVRLRRTERR
                     WDSASLAAVCRSLAARRLPRGWASAMAE"
     misc_feature    <283251..283520
                     /locus_tag="PM3016_249"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     misc_feature    283401..>283520
                     /locus_tag="PM3016_249"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cl17257"
                     /db_xref="CDD:266592"
     gene            284061..284522
                     /locus_tag="PM3016_250"
                     /db_xref="GeneID:11882246"
     CDS             284061..284522
                     /locus_tag="PM3016_250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310379.1"
                     /db_xref="GI:379718248"
                     /db_xref="GeneID:11882246"
                     /translation="MEANPKQGLSPEQEKAIGDNMTKYEKHYSEEGFWSKIKKYAKQA
                     GEVVVHAGLLLYYALNSPKTPTRAKMQIYGALGYLILPVDLIPDFVIGMGFLDDWGAL
                     ALAIKSVSEAIDDEVKRQAKEKVDDLFGGTEEDGQPKSTVMNSPAQEVRQP"
     misc_feature    284151..284438
                     /locus_tag="PM3016_250"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3339"
                     /db_xref="CDD:225876"
     gene            complement(284501..284596)
                     /locus_tag="PM3016_251"
                     /db_xref="GeneID:11882247"
     CDS             complement(284501..284596)
                     /locus_tag="PM3016_251"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310380.1"
                     /db_xref="GI:379718249"
                     /db_xref="GeneID:11882247"
                     /translation="MKRARPLGAVLFWRPALLSSLQILHYGCRTS"
     gene            complement(284625..284831)
                     /locus_tag="PM3016_252"
                     /db_xref="GeneID:11882248"
     CDS             complement(284625..284831)
                     /locus_tag="PM3016_252"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310381.1"
                     /db_xref="GI:379718250"
                     /db_xref="GeneID:11882248"
                     /translation="MYFSKRTMEPAPQEETPVWTCSKEGCNSWMRDNFAFEEQPYCPL
                     CSSVMVQNTKMLPVLVNHFTNAKK"
     misc_feature    complement(284655..284831)
                     /locus_tag="PM3016_252"
                     /note="Cold-inducible protein YdjO; Region: YdjO;
                     pfam14169"
                     /db_xref="CDD:258372"
     gene            284906..285175
                     /locus_tag="PM3016_253"
                     /db_xref="GeneID:11882249"
     CDS             284906..285175
                     /locus_tag="PM3016_253"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310382.1"
                     /db_xref="GI:379718251"
                     /db_xref="GeneID:11882249"
                     /translation="MDAGELQLDYILGLWSAVALNHIELYALAFVQGFVAFSLNGAEV
                     NEYVLAAFHFDEAKSFFRVKPFHCSCFHDRHSLQRSAKCAYTAVK"
     gene            285359..286270
                     /locus_tag="PM3016_254"
                     /db_xref="GeneID:11882250"
     CDS             285359..286270
                     /locus_tag="PM3016_254"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase type 2"
                     /protein_id="YP_005310383.1"
                     /db_xref="GI:379718252"
                     /db_xref="GeneID:11882250"
                     /translation="MPAQNYKLNEIDLRLEPYLTELYRLHRTRAAAIDWSYHEFIPWE
                     LGRSFKEHPWSIDQRTLPDPIYLAVETSLLTEVNLPFFYHHLAVTFKGSLKVLQDFVH
                     TWVSEEDQHSSLLETYLIITRNADPAALHQLRKTVVEGGFVPDFDTAMETMVYTAVQE
                     LATMVFYNNVAKSAGPYDKNLASLLRRLAKDESLHFAFYRDVVKGYLGQDHNFVYYIH
                     KAMTSFAMPGRDMPMFKERMDVIAQEAGYGPVSYFNQVFDHLIQVWGIQDIKPSRTEA
                     ENARLDLLEYHGKLKRISARLAARGMK"
     misc_feature    285383..286246
                     /locus_tag="PM3016_254"
                     /note="Ferritin-like superfamily of diiron-containing
                     four-helix-bundle proteins; Region: Ferritin_like;
                     cl00264"
                     /db_xref="CDD:260311"
     misc_feature    order(285584..285586,285680..285682,285689..285691,
                     285836..285838,285932..285934,285941..285943)
                     /locus_tag="PM3016_254"
                     /note="dinuclear metal binding motif [ion binding]; other
                     site"
                     /db_xref="CDD:153097"
     gene            286393..287151
                     /locus_tag="PM3016_255"
                     /db_xref="GeneID:11882251"
     CDS             286393..287151
                     /locus_tag="PM3016_255"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_005310384.1"
                     /db_xref="GI:379718253"
                     /db_xref="GeneID:11882251"
                     /translation="MSEIRYYEEWAMNAWPCLQTQAVDGWLLRWADGYTKRANSVQPL
                     YPAHLPLGQKIREAEAFYRRLELPVIFKMTEASEPAGLDAELEKRGYALVEPVSIQTL
                     RFGENDLPQPAHGEIELSPGLTKEWLSSFLAMSPSHAPHKETIRRLFAQPLSDCCFAA
                     LKVNGETAACGLSVLHGGEAGLFDIVTGPAYRRRGYGEALILHLLHWGRERGARGAFL
                     QVLAENEPAVRLYAKLGFTERFRQWYRVKQEVRD"
     misc_feature    286864..287046
                     /locus_tag="PM3016_255"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(286945..286953,286981..286986)
                     /locus_tag="PM3016_255"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            287263..288048
                     /locus_tag="PM3016_256"
                     /db_xref="GeneID:11882252"
     CDS             287263..288048
                     /locus_tag="PM3016_256"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310385.1"
                     /db_xref="GI:379718254"
                     /db_xref="GeneID:11882252"
                     /translation="MPSKDGVMESAGRPRRLLALLSSFGVTSLQRQNPYIVAWWSAAF
                     PGFGHLLLQQYIRGVLLTLSEVFTNTLAHINEAIVYSFSGRYLMAREVLDPVWLYGYC
                     VIYLYAIWDSYRSTLETNRQCELAEIENARLQAMVLRPVTIQYLERKSPRAAAAASFF
                     FPGLGQLYNHRVGLAFYAMIWWWVYLYLSNLHASLLALLLGHPAESAAMLRPHWLLFM
                     PSVMCGSIYHAYVTAVEHNRLFRVEQRQYLKERYPAAGFKILP"
     gene            288061..288579
                     /locus_tag="PM3016_257"
                     /db_xref="GeneID:11882253"
     CDS             288061..288579
                     /locus_tag="PM3016_257"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310386.1"
                     /db_xref="GI:379718255"
                     /db_xref="GeneID:11882253"
                     /translation="MLVIGTFEHRVELEQALLQLEYQGVPQRCILAVPMAVTPQGPFK
                     YSGQPSDLSAKSFEVGMACATAFSVLGISAGFVLEPGPIICGIIAAVGGFFLGQGLYR
                     KYTASSGQLSPLRAPRLPEVTVIVRCSRQQVPQVAEVMWKHHALTVGEAEDEGEPEER
                     EAGRHKSAGSGA"
     gene            288621..288794
                     /locus_tag="PM3016_258"
                     /db_xref="GeneID:11882254"
     CDS             288621..288794
                     /locus_tag="PM3016_258"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310387.1"
                     /db_xref="GI:379718256"
                     /db_xref="GeneID:11882254"
                     /translation="MATSRNHQGAHGIGQTEEQLNNQAQAAVQIQGESETDQEVLAAA
                     NREDSELDEIIES"
     gene            289037..290896
                     /locus_tag="PM3016_259"
                     /db_xref="GeneID:11882255"
     CDS             289037..290896
                     /locus_tag="PM3016_259"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_005310388.1"
                     /db_xref="GI:379718257"
                     /db_xref="GeneID:11882255"
                     /translation="MKLSFQLKMIAGLSVIILLSCGLSGYLSYINQLRLFEEEVGRQY
                     EKNVEGALSHLELRIGEMYRISNYIVFNSLIEKAVTELMHGRVQGDIGEYETHSRLED
                     LLRQVKLDAPFIDSLYIYDLEGRNYYFGHMKETLGSLDPEVFQQIKSRAGASSGELVW
                     TRVRVPSYVERAGYSDAVIAARWLRSKSLGTYGLLVMVLDESLLGSPLQELFRGDRGG
                     IYLYDAQDRLLYLKETSGTEPALAELEGGQRIRKEGGESYLYAVHSSATYNWTLVSRV
                     SLAALQDKSRVTLQMALVSALVAILLGGMLIVLLSGRLTRPLKDLVKAMRAMREGDFN
                     VRIQPRTHDELAFIGEGFNTMAANVRSLIEEVYLRQLSEREAELKAIQAQLNPHFLYN
                     TLNGLYWKLYVKDDRESAELVSALSGLLRYSLERASTDTELREELRQIRNYVEIQKAF
                     VESRFEAEIEAEETVLACAVPRLLLQPLVENVFVHAFLSGPEDKRLSVRAYAEGQVLV
                     VDIADNGAGMEEGQIVRLLRPVSEEEGVRPSIGIRSVLRRIDLLYGEPYGLGIESSPG
                     RGTQVRLRLPLRYRGGEGAEAWEGVEYGAAEAPCGDGRPKRPGEAGCSTTGEG"
     misc_feature    <289811..290770
                     /locus_tag="PM3016_259"
                     /note="Predicted signal transduction protein with a
                     C-terminal ATPase domain [Signal transduction mechanisms];
                     Region: COG2972"
                     /db_xref="CDD:225519"
     misc_feature    289976..290116
                     /locus_tag="PM3016_259"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(289976..289981,289988..289993,289997..290002,
                     290009..290014,290018..290020,290066..290071,
                     290075..290080,290087..290092,290096..290101,
                     290108..290113)
                     /locus_tag="PM3016_259"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    290165..290416
                     /locus_tag="PM3016_259"
                     /note="Histidine kinase; Region: His_kinase; pfam06580"
                     /db_xref="CDD:253806"
     misc_feature    290447..290761
                     /locus_tag="PM3016_259"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(290465..290467,290477..290479,290486..290488,
                     290567..290569,290573..290575,290579..290581,
                     290585..290590,290654..290662,290717..290719,
                     290723..290725,290738..290743,290747..290749)
                     /locus_tag="PM3016_259"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    290477..290479
                     /locus_tag="PM3016_259"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(290579..290581,290585..290587,290657..290659)
                     /locus_tag="PM3016_259"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            290899..292430
                     /locus_tag="PM3016_260"
                     /note="AraC family transcriptional regulator"
                     /pseudo
                     /db_xref="GeneID:11882256"
     gene            292804..296478
                     /locus_tag="PM3016_262"
                     /db_xref="GeneID:11882257"
     CDS             292804..296478
                     /locus_tag="PM3016_262"
                     /codon_start=1
                     /transl_table=11
                     /product="agarase"
                     /protein_id="YP_005310389.1"
                     /db_xref="GI:379718258"
                     /db_xref="GeneID:11882257"
                     /translation="MNVRRLLSGGCAGVLLFSGIGVSNAAGTAGGSGGVSAPQLKTVT
                     YSGAGAAGEAAVNGTAQGGAPASGEAVPRLAADAGGSAGTAETETQALATAVQVDRFG
                     QWVSATFPEKVTSESQLLEDVAADAAYYGALQAPDWDPYGGLKGSREQYGLNATGFYS
                     IQEAAGRKVMVTPEGNLFFSLGVNGIAPTDTYTVVTGREGIYEWIPPYESEYKSAFLN
                     TKDNFSYYLANRIRKTGQPYTSRSLYTEGIQRIRKWGFNTAAGWTPVNLSREFSVPHV
                     PFLPLSDMAWAKVNGLKFFDIFVDGAEAKLDAALGPLLTEHKNNPYIIGYFFGNESYY
                     HKLAPDLPKMKGSEVAAKRRLVQMLQEKYGTIEAFNAAWNGTYASFTALIDAPLYIDS
                     QQAQYDVDDFVKLYLDTFFGTVSRVFRKYDPNHLLIGDRWLTLPVNNVKVRGFLAEAA
                     GRHLDVISINHYSKNLDTVMLNHIHQASGGKPIMLTEIGYGSSEQGLGAPTQMLVADQ
                     NERMLRYRNYVEGAASLGYIVGVHWFAYLDQAATGRWAEGTTGERYNFGLLNVADRPY
                     KPFLEGVMASNKDIYPVLLGQRVPFKHEFGDVPRQPGTNKMEIPYTPAPIPIDGEVNG
                     FPGDAAAVTLGPGQLVNGTGGEGMQGEYTFAWDENRLYVTAVIKDPTPMKNNNPNINV
                     WRGDGVELFFGPQDLTTPGDPLFLDRQLIASAGLNNGQPFWYWYFTNRQKPVEMAVKL
                     LPDGSGYVLEAALTWDSINLQGQADTRFLFDFGFDDSEDGNTRKRQWVWNGTSANSTN
                     RGHWGQATLVKRAAPAIRITGVEEGGDYTDEVLPVVEVEDATGVRSRTVTLDGAPWTD
                     GTPVTAPGSHELTVEAVNTVGITAKKTVTFAVYGSTALELSPAAGQYSDEVQLEAKLS
                     GSSGGPVPGAELSFEVNGSAAGTAVTDAQGRAVLPYRISTGPESGQLSVKAAYTPAAG
                     LYLRPAASEGALTVRPEDAALQYTGETYVKERRPAVLSAQVVQADDGSAGALSGLPVR
                     FTVSEVRPDGTLRELAGVTDSVYATGADGRAEAAAQLPPGLYEVRAELLAGPLYKAPA
                     PVRSTLAVAAPVAGHSVTVNGTVPGGTFLGKPAGTLVLNSMVSYDLAGGLTGALRVSG
                     EPGGAELYVKSFDWLVIAGDRAYVQGTAVSGRQTYTVRLLLKELTTVSLYVWKGRDTS
                     AEPVHKQLNAQLTGAVLTLP"
     misc_feature    <293725..>294264
                     /locus_tag="PM3016_262"
                     /note="Beta-galactosidase; Region: Glyco_hydro_42;
                     pfam02449"
                     /db_xref="CDD:251301"
     misc_feature    294646..295227
                     /locus_tag="PM3016_262"
                     /note="Domon-like ligand-binding domains; Region:
                     DOMON_like; cl14783"
                     /db_xref="CDD:265451"
     misc_feature    order(294868..294870,294928..294930,295120..295122)
                     /locus_tag="PM3016_262"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187675"
     misc_feature    295513..295698
                     /locus_tag="PM3016_262"
                     /note="Bacterial Ig-like domain (group 1); Region: Big_1;
                     cl17740"
                     /db_xref="CDD:266802"
     gene            296786..297757
                     /locus_tag="PM3016_263"
                     /db_xref="GeneID:11882258"
     CDS             296786..297757
                     /locus_tag="PM3016_263"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_005310390.1"
                     /db_xref="GI:379718259"
                     /db_xref="GeneID:11882258"
                     /translation="MKSVQTSRLGSLGAEERPGLSGERLRRRRQWKQNVPLLLMFLPG
                     VLFYVIFKYVPMGGLVIAFKDYNFADGVFGSPWVGWANFELLFSQAQTLNIIRNTLLL
                     SLLSLVVGFPVPIVLAILLNEARRMWFKRIVQTLVYLPHFLSWVIVGGIVLSLFSLES
                     GSINRWITSLAGEPYPFLYEPVSWIAVFIGSGIWKEMGFSAIIYLAALTTIDPHLYES
                     AAMDGAGKLRQIWHITLPGISSTVILLLILGVGKIMEVGFDQVWVLQNEAVSSVSGVI
                     STYIYTFGIQRGQFSVTTAMGLFDSLVGFILVLTANSIARRFNQGLW"
     misc_feature    296861..297742
                     /locus_tag="PM3016_263"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    297071..>297547
                     /locus_tag="PM3016_263"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(297119..297124,297131..297136,297149..297151,
                     297182..297193,297197..297226,297233..297238,
                     297242..297244,297359..297364,297374..297376,
                     297380..297382,297389..297394,297398..297400,
                     297410..297415,297422..297424,297473..297475,
                     297515..297520,297527..297529)
                     /locus_tag="PM3016_263"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    297200..297244
                     /locus_tag="PM3016_263"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(297425..297463,297479..297484,297494..297496)
                     /locus_tag="PM3016_263"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            297774..298649
                     /locus_tag="PM3016_264"
                     /db_xref="GeneID:11882259"
     CDS             297774..298649
                     /locus_tag="PM3016_264"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_005310391.1"
                     /db_xref="GI:379718260"
                     /db_xref="GeneID:11882259"
                     /translation="MKSTFTEKIFYTVNYLILFLIAMTCLLPLVHLASLSLSDSHAVL
                     SGRVTLWPVGWTLESYQMLWEGTRIVEAFGNSLIITVVGVILSMICTILTAYPLSRRY
                     FFGRRWFLLAAVFTMLFAGGTIPTYLVIKELGLVNNYGALWLPALVNTYNMLVLRTFF
                     ENIPEELEDAARMDGCGEWRMLIGMMLPLSLPALATLTLFYGVGFWNSFLSVLIYINE
                     TDKYNLTVLVQQMIRKQSLLQELVSVQPEDAANLTPEGIKAAGVMVLIIPMMIVYPFL
                     QKYFVKGVMLGSIKG"
     misc_feature    297774..298643
                     /locus_tag="PM3016_264"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    297990..298481
                     /locus_tag="PM3016_264"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(298038..298043,298050..298055,298068..298070,
                     298098..298109,298113..298124,298125..298130,
                     298134..298136,298209..298214,298218..298220,
                     298224..298226,298233..298238,298242..298244,
                     298254..298259,298266..298268,298317..298319,
                     298359..298364,298371..298373,298392..298403,
                     298410..298415,298452..298457)
                     /locus_tag="PM3016_264"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(298116..298124,298125..298136,298392..298409)
                     /locus_tag="PM3016_264"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(298134..298136,298194..298196,298410..298412,
                     298446..298448,298455..298457)
                     /locus_tag="PM3016_264"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(298269..298307,298323..298328,298338..298340)
                     /locus_tag="PM3016_264"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            298682..300337
                     /locus_tag="PM3016_265"
                     /db_xref="GeneID:11882260"
     CDS             298682..300337
                     /locus_tag="PM3016_265"
                     /codon_start=1
                     /transl_table=11
                     /product="family 1 extracellular solute-binding protein"
                     /protein_id="YP_005310392.1"
                     /db_xref="GI:379718261"
                     /db_xref="GeneID:11882260"
                     /translation="MQVKRIGKKVVASLIASLSMGLLLAACTDSDQKPKEAVDDPSKP
                     PAKQDISVTIYDKGAVPKAEGTVESNRWTKWINEKGPANVKFVAVPRWESQEKLNVLF
                     SSASAPDLIFEYAPHIKNPIYDQKQMMPIDELIEKHSTEYKKLLADNPALRKVGMKAD
                     GKLYEFARLSEVVPIHAILIREDWLQKLNLQAPKTTEELYQVAKAFAEKDPDGNGKKD
                     TYGMAISFQSGYVVDQIFQATRWVVTDGKLVRNWENFRHMAEFKKRLFDEGIVDRDYL
                     NDKNGAKAKQDFINGKIGIYPLQISWPSFTNGELAGLKKNVPDAKVAPIAYPKSPAGE
                     FNPAFTNPVQATAFVNRAAKHPEAVMKYVDFLVKQDTAKTLKYGIENEHWKVGPTGCP
                     VPIDPEKSKNEVNWTADYQMLSSGILDEKCGKTVSTFNSEVPIQKEGLELYQKALAIY
                     LDLSKPYVELTHPEHMPQLPKDINVISDSMTKPIDDIWVKAVLGGKEYTPEQAMKDAQ
                     DTWNKGNGKKVEDWFLNWYEKDRDKAFLAKDIYDIMKKQHNLK"
     misc_feature    298703..299821
                     /locus_tag="PM3016_265"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    298928..299800
                     /locus_tag="PM3016_265"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            300596..304708
                     /locus_tag="PM3016_266"
                     /db_xref="GeneID:11882261"
     CDS             300596..304708
                     /locus_tag="PM3016_266"
                     /codon_start=1
                     /transl_table=11
                     /product="agarase"
                     /protein_id="YP_005310393.1"
                     /db_xref="GI:379718262"
                     /db_xref="GeneID:11882261"
                     /translation="MNLRRGLLMLCLWSLMFSTFTGWAPQGGVQAAEPAASVLNDEFQ
                     SWSLTHEHSPTLTLESAGTGGFDPTRVKRSAAYKEFITYKTAEPLQSFAVYGYYHPQG
                     KPYDHPLFYVSPNGTDYTKVTPGLIELGGYFPLIIYELEGLPAGSVYLKIEYTGGLIV
                     RSPLIGRVVLNGPSVVVPGMPPGEVSAGSKLTLSSTAGASIFYTTDGSDPRTSPAKKL
                     YTDGIGLSGISLLKAYSQFGTNTASASAVNTFRYIVKGTQDRVVPVTEDVYVDGTVPD
                     TNRGTEPLLFMKALKNREAYLKFDLSKVDAGTQKVYLNLYGQTYDSSQAPARLKLYGV
                     DSSWSEGTMTYNTKPLPTPAPAGAEIGEAVWPYEPSGWMSIDITGYIKGQKALGKTTA
                     SVGIVNTTDGAAYVNAKEAGGNAPYLLLVQGQPGTGPGEEPVNLPGLVDPLDTFEHVM
                     ARTNMRTEGADAQYLGGDLKRATRSTTALGSLTYKTAYDIQSFAIHSYFFMGVAVDPL
                     KVYASPNGTSFTEVVLQPYKSGAPVSNWQMFVYEAKGLPAGTRYLKIEVKGDVKAWTP
                     QIGKVILNKNVMSVLAVPDHGTVVGQPISVTLSTPTSGAQIFYKLNAETEARPYTGAI
                     SVQDSTTLHAFAIKNGLEASAPRSYVYRSKADWVVDKYGQMNSADFPEKVKTDDELRA
                     DLAADKAYYDGLQAPNWDAYGGLVGSKETYGLQAKGYYNVQTAADGRKILVTPLGTAF
                     FSVGINGISPNDTYTMVTGREEIFEWLPDYANTEYKSAFMGTKDYFSYYLANYIKKTG
                     TPYTSEAFYQTSWARMKKWGFNSAGGWSPTPLSEQFKVPYFPFLPLGSLEWAKIEGVK
                     IFDIFADGAEAKLEAALEPVLTPNKNNPLIVGYFLGNENHYQKIAPEIPKLKGSVVAA
                     KRRLVQMLQEKYGTIEAFNTAWNGTYGSFAELNDAVLYVDSQQAQYDVDDFVKLYLDT
                     YYGTIARVFRKYDPNHLLLGDRWLTIPMNNAKLRGFMAEAAGRHMDVISMNHYAKNLN
                     VTMLGEVHAKSGGKPLILTENGFGTMEQGLGSPLLVADQNERQLRYRTYVEGAASLGY
                     VVGAHWFTYLDQAATGRWSEADDGEHYNFGLVNVADRPYKTFLQGVMATNHDIYSVML
                     GRKEPFRYDFGDAPRQPGNNTMAIPYTPVPVPIDGEVNGFPAGAPKFVLDEAQRVVGT
                     DGAGMSGEYTLAWDNTNLYVTASITDPTPMRNQYTDMNVWRGDGVELFFGPGDLTTPG
                     DPLFNDRQLIMSAQPTAEGQPFWYWFNTSRQKAVNMAVKARSGGYVIEAAIPWETVNM
                     QASEGLQFLFDLGFDDSEDGENRKRQWMWNGTNTNSTERSNWGKATLVKP"
     misc_feature    301166..301351
                     /locus_tag="PM3016_266"
                     /note="Fn3 associated; Region: Fn3_assoc; pfam13287"
                     /db_xref="CDD:257628"
     misc_feature    302381..302548
                     /locus_tag="PM3016_266"
                     /note="Fn3 associated; Region: Fn3_assoc; pfam13287"
                     /db_xref="CDD:257628"
     misc_feature    <303236..>303670
                     /locus_tag="PM3016_266"
                     /note="Beta-galactosidase; Region: Glyco_hydro_42;
                     pfam02449"
                     /db_xref="CDD:251301"
     misc_feature    304130..304699
                     /locus_tag="PM3016_266"
                     /note="Domon-like ligand-binding domains; Region:
                     DOMON_like; cl14783"
                     /db_xref="CDD:265451"
     misc_feature    order(304343..304345,304403..304405,304592..304594)
                     /locus_tag="PM3016_266"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187675"
     gene            complement(305032..305970)
                     /locus_tag="PM3016_267"
                     /db_xref="GeneID:11882262"
     CDS             complement(305032..305970)
                     /locus_tag="PM3016_267"
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="YP_005310394.1"
                     /db_xref="GI:379718263"
                     /db_xref="GeneID:11882262"
                     /translation="MSTPIDIKFAPTYELINSLHTYLCRIWHKRIDLGADWHAGVRDR
                     LSPGFRSHLDASELRPEWRFVYLLAHLYPGRGGPASFLDWLEELSPGDMYELLAPRLP
                     AVTGDLAGLQQWLAGLLRPWYEQYFAGFDQDMLVRLEQAAGQHRALLGTLPPAELAEE
                     LTNGLRFEEDGGIRQLVLTPQYHFQPGNVFYLYGGGLLLCQYPADLHAPQPDDGPSPP
                     LYRTLRSLGERSRLRILRYVSGGPRSFTDILRHVGLSKGITHEHISNLRCAGLLRAHV
                     VGENVTVFSLRSSAVIRLQEQLLSYVEGDADNSHDV"
     misc_feature    complement(305092..305304)
                     /locus_tag="PM3016_267"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(305095..305100,305161..305163,
                     305251..305253,305260..305265,305272..305277,
                     305284..305286,305293..305295,305299..305304))
                     /locus_tag="PM3016_267"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(305119..305127,305143..305151,
                     305167..305172,305176..305181,305188..305193,
                     305197..305208,305233..305241,305278..305286,
                     305296..305301))
                     /locus_tag="PM3016_267"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(305098..305100,305230..305232,
                     305239..305241))
                     /locus_tag="PM3016_267"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(306122..307138)
                     /locus_tag="PM3016_268"
                     /db_xref="GeneID:11882263"
     CDS             complement(306122..307138)
                     /locus_tag="PM3016_268"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AppF"
                     /protein_id="YP_005310395.1"
                     /db_xref="GI:379718264"
                     /db_xref="GeneID:11882263"
                     /translation="MNRSSLHPHTGAPVGSTDGGSLLDVRDLKTHFPVTGGFLGRTVG
                     HVKAVDGLSLTLRRGEAFGLVGESGSGKSTAGRTILRLTEKTSGGVFYKGRDLYALPK
                     EELRRLRPELQMIFQDPYSSLSPRLRIGDAIGEALLEHGRATRQEVRSRVAEVMELCG
                     LPPGQMDRYPHEFSGGQRQRIGIARAMALRPELLVADEPVSALDVSIQAQIINLFSDL
                     RESRSLTYLFISHDLSVVEHLCDRVGVMYLGSLVELAPRDELFTRPLHPYTRALLSAV
                     PVPDPAARRERIVLRGDIPSPAAPPPGCKFHTRCPYVMPRCREEEPAYRQVVEERFAA
                     CHFV"
     misc_feature    complement(306125..307075)
                     /locus_tag="PM3016_268"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppF; PRK11308"
                     /db_xref="CDD:236898"
     misc_feature    complement(306374..307075)
                     /locus_tag="PM3016_268"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(306920..306943)
                     /locus_tag="PM3016_268"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(306446..306448,306545..306550,
                     306788..306790,306917..306925,306929..306934))
                     /locus_tag="PM3016_268"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306788..306799)
                     /locus_tag="PM3016_268"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306593..306622)
                     /locus_tag="PM3016_268"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306545..306562)
                     /locus_tag="PM3016_268"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306527..306538)
                     /locus_tag="PM3016_268"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306440..306460)
                     /locus_tag="PM3016_268"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306128..306391)
                     /locus_tag="PM3016_268"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(307135..308160)
                     /locus_tag="PM3016_269"
                     /db_xref="GeneID:11882264"
     CDS             complement(307135..308160)
                     /locus_tag="PM3016_269"
                     /codon_start=1
                     /transl_table=11
                     /product="Y4tR protein"
                     /protein_id="YP_005310396.1"
                     /db_xref="GI:379718265"
                     /db_xref="GeneID:11882264"
                     /translation="MTTRNETKNLPLREEPPLLEIRHLHTHFATEEGIVKAVNDVSLT
                     VREGETVCIVGESGCGKSVTALSILQLIQGPHGRIAGGEILFGGRDLLQAAPNDIRRI
                     RGNEIAMIFQEPMTSLHPVLTIGEQLTEPILEHRPVSRRAARLEALDLIRLVGIARPE
                     AVYASYPHELSGGMLQRIMIAMALSCHPRLLIADEPTTALDVTIQAQILDLLRRIKEE
                     RGTSILLITHDLGVVAEMADHVVVMYAGRIVEQAPVLELFRHPQHPYTQGLLRAKPVL
                     HRREPRLYTIPGQVPSLAGLGDFCHFSDRCPQASDLCRSRQPELLPIADGHEAACWLY
                     GREVSAP"
     misc_feature    complement(307156..308109)
                     /locus_tag="PM3016_269"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppD; COG0444"
                     /db_xref="CDD:223521"
     misc_feature    complement(307405..308109)
                     /locus_tag="PM3016_269"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(307975..307998)
                     /locus_tag="PM3016_269"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(307477..307479,307576..307581,
                     307825..307827,307972..307980,307984..307989))
                     /locus_tag="PM3016_269"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307825..307836)
                     /locus_tag="PM3016_269"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307624..307653)
                     /locus_tag="PM3016_269"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307576..307593)
                     /locus_tag="PM3016_269"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307558..307569)
                     /locus_tag="PM3016_269"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307471..307491)
                     /locus_tag="PM3016_269"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307162..307422)
                     /locus_tag="PM3016_269"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(308168..309112)
                     /locus_tag="PM3016_270"
                     /db_xref="GeneID:11882265"
     CDS             complement(308168..309112)
                     /locus_tag="PM3016_270"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005310397.1"
                     /db_xref="GI:379718266"
                     /db_xref="GeneID:11882265"
                     /translation="MALLFPSAPNKAGLPPAPEPLSVPAASLWRQSLHRLRSNRMAML
                     GCGFLIFIALFCLLGPLFSPYSSGLVNTGQIKAPPSASHWLGTDQLGRDILTRLMQAG
                     RISITVGLASMTLSVVIGAALGIAAGYYRRGVDQVVMRTADVLMTIPELPLLFIMAAV
                     LSELKVPADYRLYIVMLLLSLVGWPGLARMVRSEVLSLRERPFMLAAEALGLRDRRKL
                     FKHLLPNIMPLLLVAATLRVGGAIIGESTLSYFGLGVVPPTPSWGNMIDAANSLIDFQ
                     RRPWLWVPPGLAIFVTVISINLLGDGLRDALDPKRKRR"
     misc_feature    complement(308171..309049)
                     /locus_tag="PM3016_270"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(308873..309034)
                     /locus_tag="PM3016_270"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    complement(308204..308806)
                     /locus_tag="PM3016_270"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(308204..308209,308216..308221,
                     308228..308233,308237..308242,308249..308254,
                     308318..308323,308360..308365,308372..308383,
                     308405..308407,308414..308419,308459..308461,
                     308510..308512,308519..308524,308534..308536,
                     308540..308545,308552..308554,308558..308560,
                     308564..308569,308639..308641,308645..308650,
                     308657..308686,308690..308701,308729..308731,
                     308744..308749,308756..308761))
                     /locus_tag="PM3016_270"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(308366..308383,308639..308683))
                     /locus_tag="PM3016_270"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(308252..308254,308318..308320,
                     308327..308329,308363..308365,308582..308584,
                     308639..308641))
                     /locus_tag="PM3016_270"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(308438..308440,308450..308455,
                     308471..308509))
                     /locus_tag="PM3016_270"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(309136..310092)
                     /locus_tag="PM3016_271"
                     /db_xref="GeneID:11882266"
     CDS             complement(309136..310092)
                     /locus_tag="PM3016_271"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005310398.1"
                     /db_xref="GI:379718267"
                     /db_xref="GeneID:11882266"
                     /translation="MPSYLLNRLFYIVVTLLGASLLIFALYALTPGDFVDSSPKLTEA
                     RKLELKALYGLDKPLVARYFTWLGQAVKGDLGFSLQHQKPVTSLIFHFIGNSFLIAFA
                     SLVLTWAAAIAVGLLSAVRQHSWFDALVTLFVFGAMSLPAFFIGLLAIKIFAVDLGWL
                     PPGGMITTGSRSTGLAYALEVADHMFLPVVVLALLSVGSLTRYFRTNLLEVIRQDFVR
                     TARAKGLKERTVLCKHALRSALLPAITLMGFEIPALFGGAIITEKVFNWPGIGSVYMQ
                     AFAVRDYPVLMGFTMFIAALTVVSNLIADLLYRLADPRIRLK"
     misc_feature    complement(309142..310092)
                     /locus_tag="PM3016_271"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(309193..309816)
                     /locus_tag="PM3016_271"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(309193..309195,309202..309207,
                     309214..309219,309223..309228,309235..309240,
                     309268..309273,309304..309309,309316..309327,
                     309346..309348,309355..309360,309400..309402,
                     309451..309453,309460..309465,309475..309477,
                     309481..309486,309493..309495,309499..309501,
                     309505..309510,309643..309645,309649..309654,
                     309661..309690,309694..309705,309736..309738,
                     309751..309756,309763..309768))
                     /locus_tag="PM3016_271"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(309310..309327,309643..309687))
                     /locus_tag="PM3016_271"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(309238..309240,309268..309270,
                     309277..309279,309307..309309,309523..309525,
                     309643..309645))
                     /locus_tag="PM3016_271"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(309379..309381,309391..309396,
                     309412..309450))
                     /locus_tag="PM3016_271"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(310115..311848)
                     /locus_tag="PM3016_272"
                     /db_xref="GeneID:11882267"
     CDS             complement(310115..311848)
                     /locus_tag="PM3016_272"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_005310399.1"
                     /db_xref="GI:379718268"
                     /db_xref="GeneID:11882267"
                     /translation="MKPQPWKTALAVMTVTALLTGCTAPESGGTDVPAAQQPAGSSAQ
                     PEIVKDAVIPASDKSKSPAAATARTDTVVVSLTEPGGVFNPYFYQNGYDGNVTSVMFS
                     PLVNIDENGKPVPDLAEKWEISPDGLVYTYYLRPNLKFSDGSPLTAEDVAFTLTLLHD
                     KAYDGETDLTETHIKGGQAYKEGKADAIEGIQVIDPLTIRITTEKVNARSLLLLGGQP
                     LSKAYYGKNYAPGQLDYLKSLHAKPLATGPYKYDQYIPGQEVRFTANEHYYGGKPKVG
                     HFIYKTTEGDATQFFQTGETDYSSFTANPDNLDLLKQLGYANINIYTSTAYSYIKFNH
                     SKAPFKDKRVRQAFVYGLDRAKTVQAAYQGYAQIANVPVSPVSWAYTEEGINPYPYDP
                     EKAKKLLDEAGWKPGADGVREKDGQKLIVRYFTTKGAVSDILIPIAKENYKALGIQLE
                     SELMDYNALLARTTKGDHDLASFSTTLLPDPSDGVNQFSSKAGGSFTGTNGYSNPKVD
                     ELIEKGTATLDLAARKAAYAELYKEIAEDPPFIFLAYRKILSAHNARVEGFRPNGYTG
                     LSSSLPNLEIK"
     misc_feature    complement(310163..311698)
                     /locus_tag="PM3016_272"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(310172..311638)
                     /locus_tag="PM3016_272"
                     /note="The substrate-binding domain of an ABC-type
                     nickel/oligopeptide-like import system contains the type 2
                     periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like; cd00995"
                     /db_xref="CDD:173853"
     gene            312094..313062
                     /locus_tag="PM3016_273"
                     /db_xref="GeneID:11882268"
     CDS             312094..313062
                     /locus_tag="PM3016_273"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA methylase"
                     /protein_id="YP_005310400.1"
                     /db_xref="GI:379718269"
                     /db_xref="GeneID:11882268"
                     /translation="MNVKEESRPGGASPEAAACLYTYACHEDELELCGLELRELFGCP
                     AEGGWLRSPRVLDPGRSPFLKQRLDVRFEADSLPALLERLPELELGGGTFKVVYAEAG
                     LGADYGGQRALERQAGARIRGRADMRTPQHVLGLACADGRWLLGPLHRAEAHWLRHAQ
                     KPQNYSTALSTRVARAVVNIAVPEGAGRRLIDPCCGMGTVLVEALSMGIDSEGCDINP
                     LAVRGARANLRHFGFAESAVRLADMTGVAGRYDAAVLDLPYNLCSKLSAEEQAGLLSG
                     ARRLAERAVIVATEEIGAEIAAAGFRIAGHAVLRKGSFSRQVYLGL"
     misc_feature    312310..313053
                     /locus_tag="PM3016_273"
                     /note="TIGR01177 family protein; Region: TIGR01177"
                     /db_xref="CDD:233303"
     misc_feature    312658..312960
                     /locus_tag="PM3016_273"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(312670..312690,312736..312741,312814..312822,
                     312859..312861)
                     /locus_tag="PM3016_273"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            313145..313603
                     /locus_tag="PM3016_274"
                     /db_xref="GeneID:11882269"
     CDS             313145..313603
                     /locus_tag="PM3016_274"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310401.1"
                     /db_xref="GI:379718270"
                     /db_xref="GeneID:11882269"
                     /translation="MNGFWHDLRHHPTLLGAFLLGIGTIGMLDGIIFHQLLQWHSVNM
                     HTDRQHQIISDGLFHLAVTVVMVWGAVVLWNSGRADEPGARKLFLSGLFTGAGLFNFV
                     EGIINHHVLQLHHVHPGDYQTAYDLAYDASGLLLLLVGLVLYRGSQSRAR"
     misc_feature    313196..313540
                     /locus_tag="PM3016_274"
                     /note="Predicted membrane protein (DUF2243); Region:
                     DUF2243; cl01783"
                     /db_xref="CDD:261066"
     gene            313882..316994
                     /locus_tag="PM3016_275"
                     /note="Cph2"
                     /pseudo
                     /db_xref="GeneID:11882270"
     gene            317293..318111
                     /locus_tag="PM3016_277"
                     /db_xref="GeneID:11882271"
     CDS             317293..318111
                     /locus_tag="PM3016_277"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="YP_005310402.1"
                     /db_xref="GI:379718271"
                     /db_xref="GeneID:11882271"
                     /translation="MLQYFRDVYTSWIDYPLREGRRLGGRYEIVRFLGMGSYGLTYLC
                     RDSREAGAEVVVKMAKPSKKELGRRLLQREHEILKKLQHPRIPAAGGTFEERGRLCLV
                     TEYIAGETVEDLIFREERRFTEEVSLLFMRELLEIVAFVHGQGYVHLDVRIPNVMVRG
                     GDIHLIDFGLARRIGDTEGQEPFENDEMRRRRTPEAQSDLYAAGHFLLFLLYSTYRAD
                     WNSPEAGWEEELTVSEGTRTLIRRLLQEEPPYADAVICMAELDRVLGALQRSSP"
     misc_feature    317371..318036
                     /locus_tag="PM3016_277"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    317389..318036
                     /locus_tag="PM3016_277"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    order(317389..317403,317413..317415,317455..317457,
                     317461..317463,317551..317553,317599..317610,
                     317620..317622,317626..317628,317740..317742,
                     317746..317748,317752..317757,317761..317763,
                     317791..317793,317800..317802,317866..317871)
                     /locus_tag="PM3016_277"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    order(317389..317403,317413..317415,317455..317457,
                     317461..317463,317551..317553,317599..317610,
                     317620..317622,317740..317742,317746..317748,
                     317752..317757,317761..317763,317791..317793)
                     /locus_tag="PM3016_277"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    order(317401..317403,317620..317622,317626..317628,
                     317740..317742,317746..317748,317752..317754,
                     317800..317802,317866..317871)
                     /locus_tag="PM3016_277"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    order(317788..317808,317866..317871)
                     /locus_tag="PM3016_277"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            complement(318133..318312)
                     /locus_tag="PM3016_278"
                     /db_xref="GeneID:11882272"
     CDS             complement(318133..318312)
                     /locus_tag="PM3016_278"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310403.1"
                     /db_xref="GI:379718272"
                     /db_xref="GeneID:11882272"
                     /translation="MLKHLLQKILHSVTGSKHSNRRYSSSHRFNRPMRRGSSSDRYGS
                     GYGQRYYKNRHGSSS"
     gene            complement(318435..318626)
                     /locus_tag="PM3016_279"
                     /db_xref="GeneID:11882273"
     CDS             complement(318435..318626)
                     /locus_tag="PM3016_279"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310404.1"
                     /db_xref="GI:379718273"
                     /db_xref="GeneID:11882273"
                     /translation="MTKRGAGVAFCALSAFLTGVYELSAAIYPGGTPSGTLTFWSRTA
                     LIVGIIYLILCEIREWDKD"
     gene            complement(318713..321154)
                     /locus_tag="PM3016_280"
                     /db_xref="GeneID:11882274"
     CDS             complement(318713..321154)
                     /locus_tag="PM3016_280"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein"
                     /protein_id="YP_005310405.1"
                     /db_xref="GI:379718274"
                     /db_xref="GeneID:11882274"
                     /translation="MQKPFFKPWGIAGLTTALLLTSASPLAAMTPDAASKQTSAVLLP
                     AAGPSAPAKEALPAASDAPVNTAVSRERAIELAGTYVTIPTDYKLQSVNYQVTPFSGG
                     SARGAWHLSFVKQDAKGYYGSISVTVDSNNGGLLSYQIYDGDPDRKPSFPPQVSLDKA
                     KTIAEAHLAKMLPKEQSQLTYALEDEKNFRKPLSGETQYPLRWVRSVNGIPFYGNEVR
                     ITVDGDGRIISYSKQWDESLAFAPSGTPVAADKAADTLQEATNPRLQYVTPYNAESGA
                     QQLYVAYTADPLMVDAATGEVLTLSGGKPAPAVKPVPLSDKPLAELPSAPLKLTKEQA
                     VERITGKFTLPKEAKLEDASYREYTDPRTNRTTSAWDLRWSVGGSPENGGTMIYASVD
                     SSTGVILAFSPNDFRPLAASTDTAGADLTSDELKSRAEKHLREILPAYVHELYLDPQN
                     EASPEWTSKLASMPYYPVNYRRIVGGIPTEYESVSLGLDRKTGEIKEFHSNLSTIPYP
                     AEPRKVIAEDEARKLLLGQYDIKLQYVIDYKGKPSPYGYDGAGGMPVEKYNVMAAAGE
                     IAPTGGEKLQTRLVYGLVPKFTEREQQLFLDGESGKWRSRESGRTVDPFAAPPADIAG
                     HWAEEALNLMIDYGALEVTDGKVQPDGLITRGEMVKMLLAAVNGGYMPLSAGAYAERA
                     ASFADVAKDSKYFAYVENAADRGLIDRTSGTFQPDASLSRADLAELLVRAMGYRKLAQ
                     TEGLFVLQATDLENGAAANPGAVALVNGLGIMTLEDGKFRPKTEMTRAQAATAFYKYL
                     QVRAELQDSPVNPRW"
     misc_feature    complement(319178..319294)
                     /locus_tag="PM3016_280"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    complement(318977..319105)
                     /locus_tag="PM3016_280"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    complement(318782..318907)
                     /locus_tag="PM3016_280"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            complement(321263..322036)
                     /locus_tag="PM3016_281"
                     /db_xref="GeneID:11882275"
     CDS             complement(321263..322036)
                     /locus_tag="PM3016_281"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310406.1"
                     /db_xref="GI:379718275"
                     /db_xref="GeneID:11882275"
                     /translation="MRQNLPLTLLLTLLGTIGAAAILPYQLALLGGKLPDTGGLPLPA
                     ALALGVVQQAVLLFILTAAALKLQERTLLDLPYLRAWVSRTPQPPVSRSWMAIGIAGS
                     LIGCLLIALLDAYVFTPAIEAPQADPIPRPAWWQGLLAMFYGGITEELLLRLFAMTLI
                     VWLLSKITGRTGARIPSGYFWCAILLSTLLFGIGHLPAAAGLYGTLNGVIVARILILN
                     GLLGIWFGYLYWKKGLEYAMVSHMSADLCLHVVFASISS"
     misc_feature    complement(321299..321649)
                     /locus_tag="PM3016_281"
                     /note="CAAX protease self-immunity; Region: Abi;
                     pfam02517"
                     /db_xref="CDD:251346"
     gene            complement(322033..322653)
                     /locus_tag="PM3016_282"
                     /db_xref="GeneID:11882276"
     CDS             complement(322033..322653)
                     /locus_tag="PM3016_282"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310407.1"
                     /db_xref="GI:379718276"
                     /db_xref="GeneID:11882276"
                     /translation="MKHYLPSLTLFILAVALSFYAYPYMPDQMAVHFRFDGTPDGFMT
                     KFWALATAPLFMLLLMAAALLVPVNPSDARTLSAQTLVRETSIGLLFGAHIAIILYAV
                     GYEFDMAKYVTILMGIVFLILGNYMPRFQPNRYIGIRTPWTLASEENWRRTHRTAGKI
                     WFIGGLLMLACLLLPEGTTAFGFLFVLIAVMGLTLAVTFYHSRGRA"
     misc_feature    complement(322507..322632)
                     /locus_tag="PM3016_282"
                     /note="Protein of unknown function (DUF1648); Region:
                     DUF1648; pfam07853"
                     /db_xref="CDD:254469"
     misc_feature    complement(322051..322626)
                     /locus_tag="PM3016_282"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5658"
                     /db_xref="CDD:227945"
     misc_feature    complement(322054..322272)
                     /locus_tag="PM3016_282"
                     /note="SdpI/YhfL protein family; Region: SdpI; pfam13630"
                     /db_xref="CDD:257940"
     gene            complement(322650..322883)
                     /locus_tag="PM3016_283"
                     /db_xref="GeneID:11882277"
     CDS             complement(322650..322883)
                     /locus_tag="PM3016_283"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor SdpR-like protein"
                     /protein_id="YP_005310408.1"
                     /db_xref="GI:379718277"
                     /db_xref="GeneID:11882277"
                     /translation="MTAGEIADKFDMSKPSISHHLNLLKQAELVWDERRGQHIVYSLN
                     LTVFQELMKWLLAFPLPAEERTAPASKERKDPT"
     misc_feature    complement(322752..>322883)
                     /locus_tag="PM3016_283"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(322761..322769,322782..322790,
                     322806..322811,322815..322820,322827..322832,
                     322836..322847,322872..322880))
                     /locus_tag="PM3016_283"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(322869..322871,322878..322880))
                     /locus_tag="PM3016_283"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(323847..324695)
                     /locus_tag="PM3016_284"
                     /db_xref="GeneID:11882278"
     CDS             complement(323847..324695)
                     /locus_tag="PM3016_284"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005310409.1"
                     /db_xref="GI:379718278"
                     /db_xref="GeneID:11882278"
                     /translation="MPSSKRTYTPAPSAVPGMELKLYYCGAEDCTPGHSWGPGLKDHY
                     KIHLVRRGRGIFRRGGRTYAVTAGQGFLIRPQDVAYYEADADEPWSYAWAAFNGLQAD
                     SFLSRAGLGPESPVFTCSDEESGGLWRLIEEMIGAGSRPASRDLRLLSSLYALLGGLV
                     DRAENARNTVLPGGGSPAGEGYVARAVAFIETNYSRSMTVEELAAELGLDRKYAARLF
                     KEALGVPPRQFLLQYRMEQAGLLLRRESLSVAEVAHSVGYRDPLLFSRMFKKVKGCSP
                     QAYRNR"
     misc_feature    complement(324228..324623)
                     /locus_tag="PM3016_284"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:145456"
     misc_feature    complement(323850..324209)
                     /locus_tag="PM3016_284"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(324003..324128)
                     /locus_tag="PM3016_284"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(323853..323963)
                     /locus_tag="PM3016_284"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            324933..325925
                     /locus_tag="PM3016_285"
                     /db_xref="GeneID:11882279"
     CDS             324933..325925
                     /locus_tag="PM3016_285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310410.1"
                     /db_xref="GI:379718279"
                     /db_xref="GeneID:11882279"
                     /translation="MTYLAESNRYESMKYNRSGRSGLRLPAISLGLWHNFGGIDTYEN
                     GRAMVRRAFDLGITHFDLANNYGPPPGSAEENFGKILEQDLAPYRDEIIISTKAGYYM
                     WPGPYGEWGSKKYLISSLDQSLKRMGLDYVDIFYHHRPDPNTPLEETMSALDLVVRQG
                     KALYVGISNYRPEEAKEAIGILRRLGTPCLIHQPSYSMLNRWVEDGLLDVLEEEGVGS
                     IAFSPLHKGILTDRYLNGIPSDSRAAGPSVFLRPEELTDSVLGKVRELNAIAQERGQK
                     LSQMALAWVLRGGRVTSALIGASKVSQIEDAVGAVANLEFSGEELERIERILQG"
     misc_feature    324975..325916
                     /locus_tag="PM3016_285"
                     /note="voltage-dependent potassium channel beta subunit,
                     animal; Region: Kv_beta; TIGR01293"
                     /db_xref="CDD:213602"
     misc_feature    324975..325913
                     /locus_tag="PM3016_285"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    order(325023..325031,325113..325115,325128..325130,
                     325221..325223,325344..325349,325434..325439,
                     325509..325511,325593..325610,325764..325766,
                     325815..325826,325839..325841,325848..325853)
                     /locus_tag="PM3016_285"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(325113..325115,325128..325130,325221..325223,
                     325344..325346)
                     /locus_tag="PM3016_285"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            325958..326086
                     /locus_tag="PM3016_286"
                     /db_xref="GeneID:11882280"
     CDS             325958..326086
                     /locus_tag="PM3016_286"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310411.1"
                     /db_xref="GI:379718280"
                     /db_xref="GeneID:11882280"
                     /translation="MLRLTAFCLCIDMPGELTGMENLCGKPIAKTNHISYYTNIIS"
     gene            326107..326811
                     /locus_tag="PM3016_287"
                     /db_xref="GeneID:11882281"
     CDS             326107..326811
                     /locus_tag="PM3016_287"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310412.1"
                     /db_xref="GI:379718281"
                     /db_xref="GeneID:11882281"
                     /translation="MRMERIDGLHGITFFPVWFPVNCYLVEEEAELTLIDAALPMSAK
                     GILAAAERIGKPITRIVLTHAHDDHVGALDALHAALPDAKVLISARDARLLGGDRTLD
                     PGEPQMPIRGGVPKGVQTRADITLADGDRIGSLQAVSVPGHTPGSMAFLDTRSGALIA
                     GDAFQTRGGVAVSGRLVPWFPFPAFATWNKEAAVESARRLRDLKPSVLAVGHGRMLKQ
                     PLAAMDRAIQAAAAAR"
     misc_feature    326170..326742
                     /locus_tag="PM3016_287"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            326830..327414
                     /locus_tag="PM3016_288"
                     /db_xref="GeneID:11882282"
     CDS             326830..327414
                     /locus_tag="PM3016_288"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005310413.1"
                     /db_xref="GI:379718282"
                     /db_xref="GeneID:11882282"
                     /translation="MGRAGLDSGSVLQAAAALADREGYEGVTLAALAAELGVKTPSLY
                     NHISGLPGLRKELAVYGLVQLRHRLAEAVAGKAGSRAVHATGLAYVEFARRHPGLYEG
                     IMRAPDVMDAEVEAAGDALLHLLLQVLDAYGLEREDALHTVRGLRSLLHGFATLEMRG
                     GFGMSLDNNKSLDLLLRTYLAGLEQSVQAAEAGP"
     misc_feature    326860..>326967
                     /locus_tag="PM3016_288"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    326863..327384
                     /locus_tag="PM3016_288"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    327076..327315
                     /locus_tag="PM3016_288"
                     /note="WHG domain; Region: WHG; pfam13305"
                     /db_xref="CDD:257642"
     gene            327905..329860
                     /locus_tag="PM3016_289"
                     /db_xref="GeneID:11882283"
     CDS             327905..329860
                     /locus_tag="PM3016_289"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310414.1"
                     /db_xref="GI:379718283"
                     /db_xref="GeneID:11882283"
                     /translation="MRRSLDTKGQPKSSRSKLARAGRNGVILSALLIVPVLLVFGMEF
                     IQRGSWEDTWTWISGNRYLFALNAVMTFLVFSLLYSLIGSLLPAVGVSTLLLMLVSMI
                     SYFKQKLIGEPFFPWDIFLNKESMNILPLVTSKAAMVRLGAVFGTVILIFLLSRWVPR
                     LRPRPVTRLSLALMSLFILHSFGVQSPWTLKVMSAAGANEIVWNQGQNYGTNGLSLAF
                     TMNVKNTIVPKPPGYSEMSIASMAERLNELVGASKAKAAAGEKPNVVFIMNEAFWDPT
                     LLPGVKFSEDPLPTVHRLQEESTSGYLLSPQFGGGTSNVEFEVLTGQSMSFLPAGSVP
                     YQQYISKPIMSMASYFKGQGYRSAAIHSYEGWFWNREQVYKHMGFDSFLSKEGMTSPE
                     YKGAFISDDEVSRSILKEIDTNEEPTFIYAVTMQNHGPYDDKRYGETEISVEGELTDS
                     ARDVLQTYTQGIRDADRSLQLLIDSLEKSGEPTVIVFFGDHLPMMGYDYDVYVQSNFI
                     HTGKAEQWSLEEQKRMHSVPFVMWSNTDLPKEEVPVLSNSFLSAYVLDQLDLPIPAAW
                     AYNVELAKKTPGLLRSLVVDSNQGLHTKVPPSAEEDVEKYRELQYDEMFGKQYLAKYT
                     ESHGLTRHEGPVPGEDTAYAASERAAP"
     misc_feature    327977..329812
                     /locus_tag="PM3016_289"
                     /note="Phosphoglycerol transferase and related proteins,
                     alkaline phosphatase superfamily [Cell envelope
                     biogenesis, outer membrane]; Region: MdoB; COG1368"
                     /db_xref="CDD:224287"
     misc_feature    328688..329584
                     /locus_tag="PM3016_289"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     gene            330030..331496
                     /locus_tag="PM3016_290"
                     /db_xref="GeneID:11882284"
     CDS             330030..331496
                     /locus_tag="PM3016_290"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MtlA"
                     /protein_id="YP_005310415.1"
                     /db_xref="GI:379718284"
                     /db_xref="GeneID:11882284"
                     /translation="MSTTATQPASAGGGIRVKVQRFGRFLSGMVMPNIGAFIAWGLIT
                     ALFIPTGWFPNEDLAKLVGPMITYLLPILIGYTGGTMIHGARGGVIGAVTTMGVIIGT
                     DIPMFLGAMIVGPFAAWVLKQFDRAVEGRIRSGFEMLVNNFSAGIIGALLAVIAYLFV
                     GPVVQVFSKALASGVQGLVNAGLLPLANVLIEPAKILFLNNAINHGVLSPIALDQAAK
                     TGQSMLFMLESNPGPGLGILLAYWLVGRGSVKQSAPGAVIIHFFGGIHEIYFPYILMN
                     PRLILAVIAGGITGTFTFGLFHAGLVAPPSPGSIFAFMAMAPKGGLLPVFSGVLTGAA
                     ASFAVAALLLKTTKQEEQEESLEQAAARMKEMKGTQPAAAVPAAEAAAASEAAAAPEV
                     SRKAKEDVRKIVFSCDAGMGSSAMGASILRKKLKDAGADVTVINTAISEIPGDADIVI
                     THRSLTDRAKAQAPKAEHISIDNFMKSPEYDELTKRLA"
     misc_feature    330072..331490
                     /locus_tag="PM3016_290"
                     /note="Phosphotransferase system, mannitol-specific IIBC
                     component [Carbohydrate transport and metabolism]; Region:
                     MtlA; COG2213"
                     /db_xref="CDD:225123"
     misc_feature    330081..331073
                     /locus_tag="PM3016_290"
                     /note="PTS system, mannitol-specific IIC component;
                     Region: mtlA; TIGR00851"
                     /db_xref="CDD:129930"
     misc_feature    331230..331490
                     /locus_tag="PM3016_290"
                     /note="PTS_IIB_mannitol: subunit IIB of enzyme II (EII) of
                     the mannitol-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In this system, EII is a
                     mannitol-specific permease with two cytoplasmic domains
                     (IIA and IIB) and a transmembrane...; Region:
                     PTS_IIB_mannitol; cd05567"
                     /db_xref="CDD:99909"
     misc_feature    331245..331271
                     /locus_tag="PM3016_290"
                     /note="active site"
                     /db_xref="CDD:99909"
     misc_feature    order(331248..331259,331263..331271)
                     /locus_tag="PM3016_290"
                     /note="P-loop; other site"
                     /db_xref="CDD:99909"
     misc_feature    331248..331250
                     /locus_tag="PM3016_290"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99909"
     gene            331578..333638
                     /locus_tag="PM3016_291"
                     /db_xref="GeneID:11882285"
     CDS             331578..333638
                     /locus_tag="PM3016_291"
                     /codon_start=1
                     /transl_table=11
                     /product="PRD domain-containing protein"
                     /protein_id="YP_005310416.1"
                     /db_xref="GI:379718285"
                     /db_xref="GeneID:11882285"
                     /translation="MRVSTRQRQIIQLLLLRSDGITAGEIAEEIKVSTRTVHRELDEL
                     EAVLAEYGVELLKKAGKGLLLQAPGEELEALHRRLFEAVPEDYTAEDRKALILFMLLQ
                     AEEPVKLFALAHSLKVTVPTVTNDLDELEGWLARSGLTLVRRRGYGVELTGEEDGLRS
                     MLSLLAMQHLDEADLFGRPEDLAREPVKRRLLELIGRPHLKAAEDALWAADRLWLKLL
                     AEHEYARLLIRMSVMLGRIREGRQIREVRQEQQLPEHLLKLAEELSPALGGLPPEEVR
                     YLAGLLQLADTPDRHGLVPEANPGSMDLAKRLVSALEAELQAGFGEDRQLLEGLTSHL
                     ESALPRIREGFQIRNPLLSQIRRDYDRLFVQIREAADTVLPGLPIPDEEIGFLVMHFG
                     ASLERLKSLRRSVRAIIVCTSGIGSSKMLAIRLNKELPQVEIISHASWYEAVRIPEEE
                     YDLIISTVDLPLEEHRYIKLSPLLTTEESERLRRFIREVTLQRGPGRGGVGSPPAESL
                     ERLHRLQAYLNEIVSIVDQFRVHGPLEARGGLRGILEEACGRVRQRAEITDLPAVVEL
                     LLERQKMSSQVIPDTGIALFHTRSGQIGTPSFTLFTLQEELPLKSGEGAGVKHLLLML
                     GPRELSKESLEVLSEISSFLLDAEFVELLKQGSEEEIRLELSTKLTEFFESIYKTDKR
                     RIIR"
     misc_feature    331587..333041
                     /locus_tag="PM3016_291"
                     /note="Transcriptional antiterminator [Transcription];
                     Region: BglG; COG3711"
                     /db_xref="CDD:226234"
     misc_feature    331599..331763
                     /locus_tag="PM3016_291"
                     /note="HTH domain; Region: HTH_11; pfam08279"
                     /db_xref="CDD:254705"
     misc_feature    331863..332018
                     /locus_tag="PM3016_291"
                     /note="HTH domain; Region: HTH_11; pfam08279"
                     /db_xref="CDD:254705"
     misc_feature    332493..332759
                     /locus_tag="PM3016_291"
                     /note="PRD domain; Region: PRD; pfam00874"
                     /db_xref="CDD:250194"
     misc_feature    332790..333041
                     /locus_tag="PM3016_291"
                     /note="PTS_IIB_bgl_like: the PTS (phosphotransferase
                     system) IIB domain of a family of sensory systems composed
                     of a membrane-bound sugar-sensor (similar to BglF) and a
                     transcription antiterminator (similar to BglG) which
                     regulate expression of genes involved...; Region:
                     PTS_IIB_bgl_like; cd05568"
                     /db_xref="CDD:99910"
     misc_feature    order(332808..332819,332823..332831)
                     /locus_tag="PM3016_291"
                     /note="P-loop; other site"
                     /db_xref="CDD:99910"
     misc_feature    order(332808..332810,332814..332819,332826..332831)
                     /locus_tag="PM3016_291"
                     /note="active site"
                     /db_xref="CDD:99910"
     misc_feature    332808..332810
                     /locus_tag="PM3016_291"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99910"
     misc_feature    333204..333563
                     /locus_tag="PM3016_291"
                     /note="Phosphoenolpyruvate-dependent sugar
                     phosphotransferase system, EIIA 2; Region: PTS_EIIA_2;
                     pfam00359"
                     /db_xref="CDD:249799"
     misc_feature    order(333285..333287,333336..333338)
                     /locus_tag="PM3016_291"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    333336..333338
                     /locus_tag="PM3016_291"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            333635..334072
                     /locus_tag="PM3016_292"
                     /db_xref="GeneID:11882286"
     CDS             333635..334072
                     /locus_tag="PM3016_292"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein-N-phosphohistidine--sugar
                     phosphotransferase"
                     /protein_id="YP_005310417.1"
                     /db_xref="GI:379718286"
                     /db_xref="GeneID:11882286"
                     /translation="MSILSPNKVLLNAKAQDKTEAIRIAGQLLVDAGHAAPGYIEKML
                     EREEALSTYMGGGLAIPHGTKDSKEMISSAGLSIVLFPDGVDFGGDEPAHLVIGIAAA
                     GSDHLGILTNVAMICSDEANMEQILKASSKEEIIRIFEEGMGE"
     misc_feature    333644..334051
                     /locus_tag="PM3016_292"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    order(333770..333772,333818..333820)
                     /locus_tag="PM3016_292"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    333818..333820
                     /locus_tag="PM3016_292"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            334069..335223
                     /locus_tag="PM3016_293"
                     /db_xref="GeneID:11882287"
     CDS             334069..335223
                     /locus_tag="PM3016_293"
                     /codon_start=1
                     /transl_table=11
                     /product="Mannitol dehydrogenase domain-containing
                     protein"
                     /protein_id="YP_005310418.1"
                     /db_xref="GI:379718287"
                     /db_xref="GeneID:11882287"
                     /translation="MKAVHFGAGNIGRGFIGLLLSRAGYEVCFVDVNEMLVSELQHRG
                     EYTVSLASDGRETYHVTGVTALHGGDTDRVAEAVAGADLVTTAVGVNILKHIAEGIAK
                     GVKLRLQAGGGPQHLIACENAIGGSAQLQAHVFGYLSEEEQRLAEGRLAFPNAAVDRI
                     VPLQHHEDPLHVTVEPFYEWVVDRSQTIPGLPEIPGVHYADGLEPYIERKLFTVNTGH
                     CCAAYMGFLHGKSTIQESMADERIAAEVRAVLGETGRLLTAKHGFDAGEHQAYIEKTM
                     ERFRNPHLTDEVARVGRSPVRKLSPNDRLVRPALGLHDMDVRPAALARAMAAALKFRA
                     EDDPEVQQIRAELEEHGLSAAVSRFTSLAADHPVHAIIVEQYEALSRELA"
     misc_feature    334069..335208
                     /locus_tag="PM3016_293"
                     /note="mannitol-1-phosphate 5-dehydrogenase; Provisional;
                     Region: PRK02318"
                     /db_xref="CDD:235031"
     misc_feature    334069..334434
                     /locus_tag="PM3016_293"
                     /note="Mannitol dehydrogenase Rossmann domain; Region:
                     Mannitol_dh; pfam01232"
                     /db_xref="CDD:144722"
     misc_feature    334519..335169
                     /locus_tag="PM3016_293"
                     /note="Mannitol dehydrogenase C-terminal domain; Region:
                     Mannitol_dh_C; pfam08125"
                     /db_xref="CDD:149275"
     gene            complement(335830..336552)
                     /locus_tag="PM3016_294"
                     /db_xref="GeneID:11882288"
     CDS             complement(335830..336552)
                     /locus_tag="PM3016_294"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310419.1"
                     /db_xref="GI:379718288"
                     /db_xref="GeneID:11882288"
                     /translation="MFVTCRSFLLLSLALLLPMPGCASRVSPAPSAPEPAIITLQVSA
                     LALNRIPVDPPAPLPAVTPIEPYAIIANRALREDVIELRIAGNSADAVTSFLRRGDRL
                     YEIGAAGYLPLVDPGIIGIREVYAFFRKLIKISGFCGANCPVTFYVDPTPETPVLFLR
                     IDAHGVEADADGNGTIDVIGTAGTAAESTLYTLEEDTLAASSLNRLLGAVSVRYDEAG
                     RFFWAERPGGPARIRITDHPIH"
     gene            336798..338114
                     /locus_tag="PM3016_295"
                     /db_xref="GeneID:11882289"
     CDS             336798..338114
                     /locus_tag="PM3016_295"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosinetriphosphate triphosphohydrolase"
                     /protein_id="YP_005310420.1"
                     /db_xref="GI:379718289"
                     /db_xref="GeneID:11882289"
                     /translation="MDLRKLRLDEPSSGTFSEERDEYERDYARLIQSPAFRRLQGKSQ
                     VFGAGSGDYYRTRLTHSLEVSQIARETARRMGKLYPFLGRREHPGLILDPAVVECASL
                     AHDLGHPPFGHKGEEVLDRLLAKEHGMKYEGNAQNFRILMFLEKRAGSDSGLDLTAAV
                     LLAINKYPYCIEAPGRLKGCYGMEWEGISELRRKWNMPTGCSTLEAQLMDLCDDIAYS
                     THDIEDGIRAGKIGMNRTFFESERLIEHLVQEIVDDQGNLEVGWESVDIEGMVRRVLE
                     DYLAQWEEIYEQCGRESSRTRREMKARWVSTFAGRVGIIDDTARGWKKVTFVRDGQQD
                     LELLRTMEILKKLAWVTLIKDFRVQRLQKRSEIMIKRLWDSFKVPEQGRMIIPPDWID
                     NYKAHQGKWTWPRFIADYISGMTDAYAEKVYAELFASKSGSIYEMD"
     misc_feature    336846..338081
                     /locus_tag="PM3016_295"
                     /note="dGTP triphosphohydrolase [Nucleotide transport and
                     metabolism]; Region: Dgt; COG0232"
                     /db_xref="CDD:223310"
     misc_feature    336960..337460
                     /locus_tag="PM3016_295"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(336975..336977,337107..337112,337434..337436)
                     /locus_tag="PM3016_295"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    337110..337112
                     /locus_tag="PM3016_295"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    337803..338072
                     /locus_tag="PM3016_295"
                     /note="Phosphohydrolase-associated domain; Region:
                     HD_assoc; pfam13286"
                     /db_xref="CDD:257627"
     gene            338362..339195
                     /locus_tag="PM3016_296"
                     /db_xref="GeneID:11882290"
     CDS             338362..339195
                     /locus_tag="PM3016_296"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein-glutamine gamma-glutamyltransferase"
                     /protein_id="YP_005310421.1"
                     /db_xref="GI:379718290"
                     /db_xref="GeneID:11882290"
                     /translation="MIVLPESSFSVSAAVQMLPPLEREIYEQKHGSPNAFHYPSLAAL
                     LFELKLRSAIVEAAVQLQKSDAEFESFKDSRCSEAYWIRTEGGGFRQKPGVRTSEAIR
                     DIYINGKAYAFECATAVIIVLYKAVLETIGEEAFDRLFRYLFLMSWNHDSLLHLITVY
                     GKGEVYPGDVQYVKNPDVDPKAIEWQGENIVKLRGDRYFGHGVGIGDVDMFIRKLNRH
                     RLPGSTVSAYLLDEATYPNFLALFEAAGTGQLPSYLPQLPMRSHGLIVSRIGTRTAIY
                     S"
     misc_feature    338362..339189
                     /locus_tag="PM3016_296"
                     /note="transglutaminase; Provisional; Region: tgl;
                     PRK03187"
                     /db_xref="CDD:235109"
     gene            339282..339443
                     /locus_tag="PM3016_297"
                     /db_xref="GeneID:11882291"
     CDS             339282..339443
                     /locus_tag="PM3016_297"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310422.1"
                     /db_xref="GI:379718291"
                     /db_xref="GeneID:11882291"
                     /translation="MPETNDSRERTAQSEPAGDSFSESREYQHERNPVAAAQKQMASQ
                     ETAGLLDEQ"
     gene            complement(339554..340297)
                     /locus_tag="PM3016_298"
                     /db_xref="GeneID:11882292"
     CDS             complement(339554..340297)
                     /locus_tag="PM3016_298"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="YP_005310423.1"
                     /db_xref="GI:379718292"
                     /db_xref="GeneID:11882292"
                     /translation="MTRTLVISDIHGCITELQALLRQMAYRPDADRLLLLGDYVDRGP
                     DSRAVVEEVMRLVRGGAEALRGNHDQRFVDLMLGRPEHADKFVKHGGLQTLQSYGITE
                     LPEGPADPLLAEKLGAAAEAVRSRFGDHLAFLDSLPHYAEDDRHIYAHAGLHPQYTPW
                     HEQPLREFLLVREDFLPHPVTADRTVVFGHTKTVDIHGTPEVWFAGDKIGIDGGCPFG
                     FRLNGLEIMESGAYAVHHVLSSCRWVLKD"
     misc_feature    complement(339626..340288)
                     /locus_tag="PM3016_298"
                     /note="bis(5'-nucleosyl)-tetraphosphatase (symmetrical);
                     Region: apaH; TIGR00668"
                     /db_xref="CDD:233082"
     misc_feature    complement(339626..340282)
                     /locus_tag="PM3016_298"
                     /note="phosphoprotein phosphatases of the
                     metallophosphatase superfamily, metallophosphatase domain;
                     Region: MPP_PPP_family; cd00144"
                     /db_xref="CDD:163613"
     misc_feature    complement(order(339728..339730,339788..339790,
                     339848..339850,340094..340099,340172..340174,
                     340184..340186,340265..340267,340271..340273))
                     /locus_tag="PM3016_298"
                     /note="active site"
                     /db_xref="CDD:163613"
     misc_feature    complement(order(339728..339730,339848..339850,
                     340097..340099,340184..340186,340265..340267,
                     340271..340273))
                     /locus_tag="PM3016_298"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163613"
     gene            complement(340380..340877)
                     /locus_tag="PM3016_299"
                     /db_xref="GeneID:11882293"
     CDS             complement(340380..340877)
                     /locus_tag="PM3016_299"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310424.1"
                     /db_xref="GI:379718293"
                     /db_xref="GeneID:11882293"
                     /translation="MTRRRLTWTALSLGLYGLLTLGAGLLAAEADPADQGSLYPMAAN
                     LLTGPQFLVKGLLGEGNIITYRFNLLPFLLGGLVWLLLTFLTLRRLERKPDAHGLMGL
                     GFTLAGVEIVLALLTVGFVMTVPSLFEPFLRLAGGLLIWGLFGLLLIGIGLIRYVQEL
                     SGSRG"
     gene            341194..341883
                     /locus_tag="PM3016_300"
                     /db_xref="GeneID:11882294"
     CDS             341194..341883
                     /locus_tag="PM3016_300"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005310425.1"
                     /db_xref="GI:379718294"
                     /db_xref="GeneID:11882294"
                     /translation="MAPEQETEIYKAIKQAIIEQKLRPNTQLVEEVVAESFGVSRTPV
                     RNVVRRLASEKLVTIIPYKGAFVSCPTIQEAREVFDMRRVLESAVIHKVCKLLTEEQY
                     GQLEKLLEDEREAQGKGDIFGAIQITGDFHLKLAGFSGSSYYSRFLEELVSLTYVIIA
                     LYGEQKTKCCQDHRTILDYIRSGDAEKAERAMLAHLREMEEALRFDQAGNQSLSLTEI
                     FKSGMRHTVRR"
     misc_feature    341215..341829
                     /locus_tag="PM3016_300"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    341215..341397
                     /locus_tag="PM3016_300"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(341278..341280,341281..341286,341308..341322,
                     341326..341331,341338..341340,341368..341373,
                     341377..341388)
                     /locus_tag="PM3016_300"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    341422..341784
                     /locus_tag="PM3016_300"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            341998..342741
                     /locus_tag="PM3016_301"
                     /db_xref="GeneID:11882295"
     CDS             341998..342741
                     /locus_tag="PM3016_301"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate/sulfonate/bicarbonate ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_005310426.1"
                     /db_xref="GI:379718295"
                     /db_xref="GeneID:11882295"
                     /translation="MKLVVEQVGKRFGERVILKDVCLSVRENEFVCILGHSGCGKSTL
                     LNMVAGYLFPDEGAIRVDGRTVEGPSKSRGMVFQDHALFPWYSVLENVAFGPEVQGMP
                     RPKARELAAEFLSLVGLESYAAHYPAELSGGMKQRVGIARALASRPDILLMDEPFGAL
                     DILTRDMMQRELRSIYEKLKPTILFVTHSISEAVSLADRVVVMKHGVIADTFEIGIPH
                     PRSYDSPGFGEYMARIEKLLMDTGEGVPA"
     misc_feature    341998..342714
                     /locus_tag="PM3016_301"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    342004..342645
                     /locus_tag="PM3016_301"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    342100..342123
                     /locus_tag="PM3016_301"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    order(342109..342114,342118..342126,342229..342231,
                     342457..342462,342559..342561)
                     /locus_tag="PM3016_301"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    342220..342231
                     /locus_tag="PM3016_301"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    342385..342414
                     /locus_tag="PM3016_301"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    342445..342462
                     /locus_tag="PM3016_301"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    342469..342480
                     /locus_tag="PM3016_301"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    342547..342567
                     /locus_tag="PM3016_301"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            342738..343610
                     /locus_tag="PM3016_302"
                     /db_xref="GeneID:11882296"
     CDS             342738..343610
                     /locus_tag="PM3016_302"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate/sulfonate/bicarbonate ABC transporter
                     permease"
                     /protein_id="YP_005310427.1"
                     /db_xref="GI:379718296"
                     /db_xref="GeneID:11882296"
                     /translation="MSELQSAAVPQKDAAVLPPKSQALRKGGRPSAATGWNMAPYVLF
                     FAVWEIFSRVNGSLALFNPLFLPAPSVLVIEGWALAKTGVVADSLLSSSIRIAAGFMI
                     GSVLAVALAVLMVKFSRLERWISPVLTLVSPIPALALLPLFIIWFGIGEFPKVLLIAW
                     TTFVPVLVNTLDGFKSVPSTLIRSALSLGASERQVFTRVMIPSAVPNLLIGAQISLGL
                     SFSALIVAEMMGADSGLGYIIVDARNYFKITNMFVAIILIGMEYSLFSFLLKLLERRV
                     LAWRKGGMSGAVEK"
     misc_feature    342810..343583
                     /locus_tag="PM3016_302"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    342999..343511
                     /locus_tag="PM3016_302"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(343038..343043,343050..343055,343068..343070,
                     343107..343118,343122..343151,343158..343163,
                     343167..343169,343212..343217,343221..343223,
                     343230..343232,343239..343244,343248..343250,
                     343260..343265,343272..343274,343323..343325,
                     343365..343370,343377..343379,343398..343409,
                     343416..343421,343452..343457,343485..343490,
                     343497..343502,343506..343511)
                     /locus_tag="PM3016_302"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(343125..343169,343398..343415)
                     /locus_tag="PM3016_302"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(343167..343169,343197..343199,343416..343418,
                     343446..343448,343455..343457,343485..343487)
                     /locus_tag="PM3016_302"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(343275..343313,343329..343334,343344..343346)
                     /locus_tag="PM3016_302"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            343653..344747
                     /locus_tag="PM3016_303"
                     /db_xref="GeneID:11882297"
     CDS             343653..344747
                     /locus_tag="PM3016_303"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate/sulfonate/bicarbonate ABC transporter
                     substrate-binding protein"
                     /protein_id="YP_005310428.1"
                     /db_xref="GI:379718297"
                     /db_xref="GeneID:11882297"
                     /translation="MKRKNGTGSILAAALVLLLSACGTGGPSGGSPAASEKAVTATGT
                     AEGSGALETKDITLIGVRDAQISSQQIIADKLGYFKEAGLNVTSKLIESGPDIGPMVS
                     GGSAPVSIQTNFMDIILKSNGIGVKIVAPLAQIAGTQAVVGAKDLDLKSAKDLEGKTI
                     GIPNGADVKIAIDNMGKELGVDVSKIKFVNLAPSDAVVALQNGDIDAMACWEPFITKA
                     TQAGGKFLFSGTKSELPEKKGDVNWMSVHTTMQVTDAYLQKNPNTVKAVLGALKKATD
                     YINTNRDEAIKILAPELHLTEGELKEIMNRNVYSMEAGDTYVNGSNGPAVGAYLKSVG
                     NIKTVPEPASYHDLSLLQAVDASLVKSQFK"
     misc_feature    343764..344696
                     /locus_tag="PM3016_303"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    343863..344507
                     /locus_tag="PM3016_303"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            complement(344833..345243)
                     /locus_tag="PM3016_304"
                     /db_xref="GeneID:11882298"
     CDS             complement(344833..345243)
                     /locus_tag="PM3016_304"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="YP_005310429.1"
                     /db_xref="GI:379718298"
                     /db_xref="GeneID:11882298"
                     /translation="MRLPPKHIVSAAAIVLNERGELLLVRGPQRGWEMPGGQVEEGES
                     LGTAAVRETLEESGVEIEIVRFCGIFQNVRGSICNTLFLGRPIGGEPVPTEESLESGF
                     FPLPEALERVTWGNFRQRIEYCLRPSAEPFYIPF"
     misc_feature    complement(344878..345219)
                     /locus_tag="PM3016_304"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cd02883"
                     /db_xref="CDD:239217"
     misc_feature    complement(order(345073..345099,345127..345135))
                     /locus_tag="PM3016_304"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            complement(345240..345731)
                     /locus_tag="PM3016_305"
                     /db_xref="GeneID:11882299"
     CDS             complement(345240..345731)
                     /locus_tag="PM3016_305"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription activator effector binding
                     protein"
                     /protein_id="YP_005310430.1"
                     /db_xref="GI:379718299"
                     /db_xref="GeneID:11882299"
                     /translation="MSLPILSKPGIHLVSLEKLQLIGLHVTIPFELGKDGERSVHRVR
                     EEFIRRRHEIRHAVQPARYVCAHYASEVLFTYFYCLEVSSLDAIPGGMTGFTVPPHRY
                     AAIRSDGDPYLDIENGLLANGLRKDIRALALEFYSFERPLWPSEVDVYVPLEPSDETE
                     ALA"
     misc_feature    complement(345270..345701)
                     /locus_tag="PM3016_305"
                     /note="Bacterial transcription activator, effector binding
                     domain; Region: AraC_E_bind; smart00871"
                     /db_xref="CDD:214874"
     gene            complement(346312..350031)
                     /locus_tag="PM3016_306"
                     /db_xref="GeneID:11882300"
     CDS             complement(346312..350031)
                     /locus_tag="PM3016_306"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310431.1"
                     /db_xref="GI:379718300"
                     /db_xref="GeneID:11882300"
                     /translation="MYRPLQAVQPNPAAQKNGISERSAYMIYPLGDTHRTRPRKTASP
                     LPLPHPKFTNIGDDLIMSSKPSNRKNLLIASSLLLASQSLGTAGAAGTDTQGSSSPSA
                     SGSATVTASTYGSVTAATYGTDTTAPTAPASLTSTAVTASSVTLSWSSAADNVKVTGY
                     DIYQGATKVASVPDTSYTVTGLAPNTTYSFTVKAKDAAGNASPASKSLSVTTPAIAAL
                     TAGELLFEAELLTQRDSGDATTQYSDTAASGGKWEYYNANAVADYIEYDLNVPQAGTY
                     AITGLVRSANNRSIVQLSVDGKAQGSPVDAYSTTAAYAEKSFGSITFAAGGTKKFRFA
                     VTGRNASSTDYKIALDAIKLTPQGAADNVAPTAPSGLTSTGKTDTTVSLSWKAAADNI
                     GVTGYDIYSGATKLATVTGTTHVVTGLAPAAAYSFTVKALDAAGNASPASSPLAVTTN
                     AASSTSLTFEAESAPQADSGDATTLTADAAASGGQWESYNANAVGDYVEYALNVGAAG
                     SYEVRVAGKAGANAGSYEVRVAGKAGANAGTAVLTVDGTAQGAPIDFYKPAAQSAITE
                     YSRGQVYFNSPGFKIFRFTVTGKNASSTGYTVPLDAMKLVKVADSQAPSVPANVTVTA
                     KTGTSVSLAWTASTDDVKVACYDIYNGTAKAGSSTEPSFTVTGLSPNTSYTFTVKAKD
                     TAGNESAASAPVTAVTSAALGAVPLAVSLLGNHTMFIKSDGTVWGWGYNGHGQLGTGT
                     SNSTSVPGKVINLTGMKMIAGGENHTVALRSDGTLHTWGYNGYGQLGDDSTTTRYSPV
                     QVSTLTNWTAVSAGENHSLALKSDGTVWAFGYNGYGQLGDGTTSSQRTPVQVKDLTGV
                     VAIAAGKDFSLALKSDGTVWSWGQNTYGELGNGTTTRSSVPVQVALLTDVKAIAAGDY
                     HGVALKKDGSVFAWGYNGNGELGNSSTISQSTPVQSGVTGIKGIAAGPYHTLALKSDG
                     TVWSWGYNGYGQLGNGNNTSRSVPAAIPGLASIASIAAGENQSIAYGNDGILYSWGRN
                     ANGQLGNGTTVDTNVPHKVIGPNINPADTTAPAAVSDLRVSSQNVRSLTLNWSRATDD
                     VEVASYEIYNGSVLVATTGPTNTSHTLSNLALNTTYQITIRAKDATGNKAAASNVASA
                     TTSDKTPPATPKDVALTGLTSTTATLSWAASTDNDLVKQYNIYQGTTKVGSTASTSFT
                     VTGLTSKTAYSFTVKAEDDAANESTASAALSVTTE"
     misc_feature    complement(349396..349650)
                     /locus_tag="PM3016_306"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(349435..349437,349480..349482,
                     349648..349650))
                     /locus_tag="PM3016_306"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(349417..349422,349426..349428,
                     349432..349434))
                     /locus_tag="PM3016_306"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(348970..349356)
                     /locus_tag="PM3016_306"
                     /note="Carbohydrate Binding Module 6 (CBM6); appended to
                     several carbohydrate binding enzymes, including several
                     glycoside hydrolase (GH) family 26 mannanase domains;
                     Region: CBM6_mannanase-like; cd04086"
                     /db_xref="CDD:193491"
     misc_feature    complement(order(348982..348984,349348..349350,
                     349354..349356))
                     /locus_tag="PM3016_306"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:193491"
     misc_feature    complement(348685..348939)
                     /locus_tag="PM3016_306"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(348724..348726,348769..348771,
                     348937..348939))
                     /locus_tag="PM3016_306"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(348706..348711,348715..348717,
                     348721..348723))
                     /locus_tag="PM3016_306"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(348217..348663)
                     /locus_tag="PM3016_306"
                     /note="Carbohydrate Binding Module 6 (CBM6) and CBM35_like
                     superfamily; Region: CBM6-CBM35-CBM36_like; cl14880"
                     /db_xref="CDD:265472"
     misc_feature    complement(order(348229..348231,348646..348648,
                     348652..348654))
                     /locus_tag="PM3016_306"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193482"
     misc_feature    complement(347938..348192)
                     /locus_tag="PM3016_306"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(347977..347979,348022..348024,
                     348190..348192))
                     /locus_tag="PM3016_306"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(347959..347964,347968..347973))
                     /locus_tag="PM3016_306"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(347725..347868)
                     /locus_tag="PM3016_306"
                     /note="Regulator of chromosome condensation (RCC1) repeat;
                     Region: RCC1; pfam00415"
                     /db_xref="CDD:249843"
     misc_feature    complement(347575..347718)
                     /locus_tag="PM3016_306"
                     /note="Regulator of chromosome condensation (RCC1) repeat;
                     Region: RCC1; pfam00415"
                     /db_xref="CDD:249843"
     misc_feature    complement(347425..347568)
                     /locus_tag="PM3016_306"
                     /note="Regulator of chromosome condensation (RCC1) repeat;
                     Region: RCC1; pfam00415"
                     /db_xref="CDD:249843"
     misc_feature    complement(347275..347418)
                     /locus_tag="PM3016_306"
                     /note="Regulator of chromosome condensation (RCC1) repeat;
                     Region: RCC1; pfam00415"
                     /db_xref="CDD:249843"
     misc_feature    complement(347128..347268)
                     /locus_tag="PM3016_306"
                     /note="Regulator of chromosome condensation (RCC1) repeat;
                     Region: RCC1; pfam00415"
                     /db_xref="CDD:249843"
     misc_feature    complement(347080..347169)
                     /locus_tag="PM3016_306"
                     /note="Regulator of chromosome condensation (RCC1) repeat;
                     Region: RCC1_2; pfam13540"
                     /db_xref="CDD:257859"
     misc_feature    complement(346981..347121)
                     /locus_tag="PM3016_306"
                     /note="Regulator of chromosome condensation (RCC1) repeat;
                     Region: RCC1; pfam00415"
                     /db_xref="CDD:249843"
     misc_feature    complement(<346873..346971)
                     /locus_tag="PM3016_306"
                     /note="Regulator of chromosome condensation (RCC1) repeat;
                     Region: RCC1; pfam00415"
                     /db_xref="CDD:249843"
     misc_feature    complement(346627..346848)
                     /locus_tag="PM3016_306"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(346627..346629,346672..346674,
                     346846..346848))
                     /locus_tag="PM3016_306"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(346318..346572)
                     /locus_tag="PM3016_306"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(346354..346356,346402..346404,
                     346570..346572))
                     /locus_tag="PM3016_306"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(346339..346344,346348..346353))
                     /locus_tag="PM3016_306"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     gene            complement(350290..350892)
                     /locus_tag="PM3016_307"
                     /db_xref="GeneID:11882301"
     CDS             complement(350290..350892)
                     /locus_tag="PM3016_307"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="YP_005310432.1"
                     /db_xref="GI:379718301"
                     /db_xref="GeneID:11882301"
                     /translation="MTGVITTVYFVRHADSPYSAERERERGLSAAGEEAARRAALLLE
                     DEGIGFLVSSPYRRAVLTLQPLADRLGLPVAEEEDLRERKLSAEPLFPSREAFFEAKR
                     SLFADPQLRYPGGESSEEARQRGTAVLRGLLLRHRGSRLALGTHGDIMTLMLGAWDPA
                     YGFRFWQSTSMPDIYKAEFMEDAAGPCLYAVTRLWRGPGA"
     misc_feature    complement(350395..350874)
                     /locus_tag="PM3016_307"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    complement(order(350452..350457,350719..350721,
                     350854..350859))
                     /locus_tag="PM3016_307"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            complement(350943..351863)
                     /locus_tag="PM3016_308"
                     /db_xref="GeneID:11882302"
     CDS             complement(350943..351863)
                     /locus_tag="PM3016_308"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310433.1"
                     /db_xref="GI:379718302"
                     /db_xref="GeneID:11882302"
                     /translation="MKRRSMAAVLSFLLTVSLPVPYAQGAGEDLSAPAPTAAADSTTE
                     RPVSQSGIVFQGKVDIGGYGLYVTIRGERREGLPTVVFENGYGDSSGIWDAAAPELAK
                     VTQVVSYDRANIGLSDAPSSASYSALDAANRLNLLLKKTGVNGPLVLIGHSMGGLYIR
                     EYAYLYPTSVKGLIFVDASHEHMEDVLFPEYPVETRRSIVEDDLVTSGGREGHYYPDV
                     DNTYRQIDQGRQTDFLRSVPITVLSGGNHGYPDTFIDGEARWAQLQRSLAALSNDSVH
                     VTDGNSGHYLHTQNPSLVVASAVTMFGRIK"
     misc_feature    complement(350976..351626)
                     /locus_tag="PM3016_308"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    complement(<351363..351626)
                     /locus_tag="PM3016_308"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            352204..353508
                     /locus_tag="PM3016_309"
                     /db_xref="GeneID:11882303"
     CDS             352204..353508
                     /locus_tag="PM3016_309"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family protein"
                     /protein_id="YP_005310434.1"
                     /db_xref="GI:379718303"
                     /db_xref="GeneID:11882303"
                     /translation="MKKAARWLCLLLGLAAAAGIEGCGSQSPVPPAGQQPPQSLQPER
                     SGNEAAQEPVEPAMKPRDDIRDRVEAMSLDEKVGQLLLVGLEGTEVDGRAREWIHTYH
                     AGGFILFRDNIQNTAQLAKLVGDLKEANRSSGGVPLWLSLDEEGGRVSRMPAELTKPP
                     SAAAVGRADKPAASLAVGRAVGRELAAFGMNMNFAPVLDVFSNPANTVIGDRAYGRDP
                     AQVSRIGIQTMKGLQSQQVAAVVKHFPGHGDTVEDSHYGLPVVAHDLERLRKLELKPF
                     AEAITSGADAVMVAHILLPKLDAEAPASLSRRIVTGLLREEMGFGGVVVTDDLVMGAI
                     TKRYDLGQAGVQAVAAGVDVLLVGHGHEAGTAVFSAVKRAVQEGVITEARLKESVTRI
                     LRLKAKYRLTDERPGAVDTAALNAGLKNAMKELEVTAPAGGK"
     misc_feature    352414..353463
                     /locus_tag="PM3016_309"
                     /note="Beta-glucosidase-related glycosidases [Carbohydrate
                     transport and metabolism]; Region: BglX; COG1472"
                     /db_xref="CDD:224389"
     gene            complement(353884..356991)
                     /locus_tag="PM3016_310"
                     /db_xref="GeneID:11882304"
     CDS             complement(353884..356991)
                     /locus_tag="PM3016_310"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_005310435.1"
                     /db_xref="GI:379718304"
                     /db_xref="GeneID:11882304"
                     /translation="MPHDLNPATPALLAQSGLYPSLFEHHPDAVYILDRQGRHLHANP
                     AAMRLTGYSVQEAAKAVTEQLSRDRRLLGQREREFSKALRGEATSPYVMRLTCRDGRT
                     VDLEVTYIPIVSDGRIIGAYGIGKDVTEKLENERKRRECEDRYELISTHAQDIISYST
                     PDGICRFISPSVSKLLGYTPEELEGTRLSALYHPEDYEALRGRSFEDEDVFTCRFRRA
                     SGEYIWVETTFKTVRGADGAVQYYLGIGRDITHRRRMEEHLKHSENSLAAAQRVARCG
                     SWHWDVLSDSIEGSAEFQRILGREVRSYGVFLSCIHPEDRDGVDRAVRLALQGAPFNY
                     DYRIVLPDGELRHIHAQADICRGPDGRVCSMIGTTQDITERKHMENRLRESEQRFKSL
                     FDYHPSAIYSMDLEGRLTSVNASLEKLVGCSRGELLGSPHERLAAPGDLAKASGYFTL
                     ACQGVPQNGEMVLRSREGRDIDVQMQYVPIVVEGRVVGVYGMASDITERKRHVVEIQK
                     LSSQYTLILNSVAEGIYGVDLSGRGVFLNPAASDMLGYTPEEFEGRPVHTSVHHSKPD
                     GSPYPRRECPIYLTARDGLSRYVTDEVFWRKDGTSFLVEYRTHPIYDQGKLVGAVVVF
                     TDTTSEREIIQAKESAERAAEAKSEFLAVMSHEIRTPMNGIIGMTDILLDTDLTGEQR
                     EYTEIIRQSGASLLRILGDILDFSRIEAGKMALEHHRFQVEDTVREVLDLFTPKAQEK
                     GLRLQADLETGVPPLLGDSTRVKQILINLVGNALKFTERGSVTLTVRSRPAPAGSRML
                     DFTVEDTGIGIPAGKLHHLFQSFSQVHPAMNRKYGGTGLGLAICKKLVELMGGTIAVE
                     STEGAGSSFTFTLLFPEEGSEAPMAVGLPAHSAPEEGRRQEQAAGGEPGEDGPGKPLR
                     ILVAEETQAARMHLQRILSRLGHTVHTVPNGLAAVKAVQRQPYDLLLMSTVLPVMDGV
                     TAASRIRSLLPPERRPLVIGLAPGGGRGGQERYAHAGMAYVAARPPGTAELRTLLRRV
                     QVRHV"
     misc_feature    complement(356635..356913)
                     /locus_tag="PM3016_310"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(356224..356907)
                     /locus_tag="PM3016_310"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    complement(order(356692..356694,356707..356709,
                     356791..356802,356836..356838,356854..356856,
                     356866..356868))
                     /locus_tag="PM3016_310"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(356665..356667,356671..356673,
                     356755..356760,356767..356769,356797..356799,
                     356809..356811))
                     /locus_tag="PM3016_310"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(356245..356532)
                     /locus_tag="PM3016_310"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(356332..356334,356347..356349,
                     356410..356421,356458..356460,356476..356478,
                     356488..356490))
                     /locus_tag="PM3016_310"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(356305..356307,356311..356313,
                     356392..356394,356416..356418,356428..356430))
                     /locus_tag="PM3016_310"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(355489..356160)
                     /locus_tag="PM3016_310"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    complement(355876..>356073)
                     /locus_tag="PM3016_310"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(355936..355938,355942..355944,
                     356023..356028,356035..356037,356059..356061,
                     356071..356073))
                     /locus_tag="PM3016_310"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(355963..355965,355978..355980,
                     356053..356064))
                     /locus_tag="PM3016_310"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(355504..355782)
                     /locus_tag="PM3016_310"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(355588..355590,355603..355605,
                     355678..355689,355726..355728,355744..355746,
                     355756..355758))
                     /locus_tag="PM3016_310"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(355561..355563,355567..355569,
                     355651..355656,355684..355686,355696..355698))
                     /locus_tag="PM3016_310"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(354385..355476)
                     /locus_tag="PM3016_310"
                     /note="phosphate regulon sensor kinase PhoR; Region:
                     phoR_proteo; TIGR02966"
                     /db_xref="CDD:234074"
     misc_feature    complement(355114..355431)
                     /locus_tag="PM3016_310"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(355195..355197,355210..355212,
                     355297..355299,355309..355317,355354..355356,
                     355372..355374,355384..355386))
                     /locus_tag="PM3016_310"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(355168..355170,355174..355176,
                     355258..355260,355270..355272,355279..355281,
                     355312..355314,355324..355326))
                     /locus_tag="PM3016_310"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(354871..355059)
                     /locus_tag="PM3016_310"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(354886..354888,354898..354900,
                     354907..354909,354919..354921,354928..354930,
                     354940..354942,354988..354990,354997..354999,
                     355009..355011,355018..355020,355030..355032,
                     355042..355044))
                     /locus_tag="PM3016_310"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(355024..355026)
                     /locus_tag="PM3016_310"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(354385..354705)
                     /locus_tag="PM3016_310"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(354397..354399,354403..354408,
                     354421..354423,354427..354429,354475..354486,
                     354565..354570,354574..354576,354580..354582,
                     354586..354588,354667..354669,354676..354678,
                     354688..354690))
                     /locus_tag="PM3016_310"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(354676..354678)
                     /locus_tag="PM3016_310"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(354478..354480,354484..354486,
                     354568..354570,354574..354576))
                     /locus_tag="PM3016_310"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(353902..354246)
                     /locus_tag="PM3016_310"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(353941..353946,353956..353958,
                     354079..354081,354103..354105,354232..354237))
                     /locus_tag="PM3016_310"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(354103..354105)
                     /locus_tag="PM3016_310"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(354079..354087,354091..354096))
                     /locus_tag="PM3016_310"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(353938..353946)
                     /locus_tag="PM3016_310"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            357180..357455
                     /locus_tag="PM3016_311"
                     /db_xref="GeneID:11882305"
     CDS             357180..357455
                     /locus_tag="PM3016_311"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310436.1"
                     /db_xref="GI:379718305"
                     /db_xref="GeneID:11882305"
                     /translation="MSIRAYNPYEDPALHATQTHRSRGWDAEERVPFNDAISHFDTVN
                     GFRMPKRIGELPARVRTAFRIYASVSAVTLAAALADSLISSIGGLLP"
     gene            357576..358754
                     /locus_tag="PM3016_312"
                     /db_xref="GeneID:11882306"
     CDS             357576..358754
                     /locus_tag="PM3016_312"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310437.1"
                     /db_xref="GI:379718306"
                     /db_xref="GeneID:11882306"
                     /translation="MKWSKGTAERVRVLVLSGNLGDGHRQAAKALAEASRLGTREAVD
                     TEVVDFMQRVYPQLQHVVKYGFLKMVEKTPSIYGYLYHRTKYDEGLSPLFSLFLRLGR
                     RALMRLAAEYRPDAIICTFPLAAAAVSLLKEEGRLHVPLITVITDHTDHALWLNPATD
                     LYLVGSEQVASALRARGIASSRVAVSGIPVAPRFHAEEDRTVVRQQLGLQPDMPVVLV
                     MGGGGGLLSEGIRSLLRSEAVCAGMQLVIVCGSNRAVMRELEEELAHRPSGRVRLLGF
                     AEDIHRWMSAADLLLTKPGGLTTSEAVAKALPMLLYKPIPGQEEDNAAVLMRAGVAVQ
                     AEGGRALTDQLLELVHDPARLAHMRGRAEAFRIARPAERAWEALQPRPQPELSMSKAR
                     "
     misc_feature    357609..358691
                     /locus_tag="PM3016_312"
                     /note="diacylglycerol glucosyltransferase; Provisional;
                     Region: PRK13609"
                     /db_xref="CDD:237445"
     misc_feature    357645..358145
                     /locus_tag="PM3016_312"
                     /note="Monogalactosyldiacylglycerol (MGDG) synthase;
                     Region: MGDG_synth; pfam06925"
                     /db_xref="CDD:253978"
     misc_feature    357840..358694
                     /locus_tag="PM3016_312"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            complement(359256..359441)
                     /locus_tag="PM3016_313"
                     /db_xref="GeneID:11882307"
     CDS             complement(359256..359441)
                     /locus_tag="PM3016_313"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310438.1"
                     /db_xref="GI:379718307"
                     /db_xref="GeneID:11882307"
                     /translation="MHMRSSEFYENLPLKCCDTCGSAIEEMADCYSSTCTSCRGLTFY
                     PLSPLTRSLADPTYSSE"
     misc_feature    complement(359328..359435)
                     /locus_tag="PM3016_313"
                     /note="YhfH-like protein; Region: YhfH; pfam14149"
                     /db_xref="CDD:258360"
     gene            complement(360626..363838)
                     /locus_tag="PM3016_314"
                     /db_xref="GeneID:11882308"
     CDS             complement(360626..363838)
                     /locus_tag="PM3016_314"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310439.1"
                     /db_xref="GI:379718308"
                     /db_xref="GeneID:11882308"
                     /translation="MYFHITAFSRLALTALLLLVLAAAGAGLLGFLPVPPASSGGYDL
                     GMRDGGWSVHIGDLPVQAGRAPDESAADWKPWNEAVPQYEGKRYTGYLWLKRPLPAGD
                     WKHPVLYVRDLAAYEVYLGAQPLDSSFSLLELQASGPSLRQTSSGSGSPGSGTLLVRS
                     YQDAKGIQLGHLSIGSERDVWLGLFRRDLNHLAPGTLFLGAAVTGCLLYLRRRTKPAY
                     LYFALLAGSAAFGTLLTTEMAALFLLDRLQELALLALPAGGCALFALLDSFCGSGPLR
                     LRRWMSRSMLGLLAISLAASLWDRVLYKDTITLVFPLLFLVCLLLSAWLTVQSYRSSR
                     ERSDAWLLAGYGVGALALVLSVLTRLLPGTWRDAGVPSLGDAADGIFLTVLLFLVCLG
                     MMLLQRSSEAYIRAERFLEEFQRQNHMLAAAGRLNEERLAIASRELQAPLNGIIGLAE
                     SLLDGAAGPLNRTARSSLELAVSSGKRLSCLTRDLIDFSLAKHPQPLRRTEVEVGRSI
                     RLALDVFTPLAAKKGVALTASLPAGLPAASAEESRLEQILYALLGQALAFTSAGEIGV
                     KAGSRDGFIEVTVFGTGVGLQKEARERIQLAFGTDTVPAERASHEGEPALSLTRTLVE
                     GYGGTLEDRQGLDRILFRFTLPMWERTPGVVSSPIDGERLVRTAGIHADPSLEASVFS
                     AAQGRQEVSAGRHSGAPGLPADSRSHHAFRPAARILIVDEDPVNLQVLGNLLALQPYT
                     IVQAASGPEALASITAEKPDLLLIDLMMPRMTGYDIIRHIRRLYKATELPILLVTDKD
                     RVDGLVEGFEAGANDCVTKPVVKKELLARIEQQLQLYRMHRSLEMQMEERTLAHEETK
                     LRLQESMRETAEAVAELSVAEERGRAAREIHDIVGHTLTTTVVQIEAAKRLIAKNDEK
                     GFQKLDVSQELVRKSLNEIRHSVHMLSASTADYDLAAALRQLLHDTQDTSGIEVEHRI
                     SPMPPLSALQKKVIYHALQEGLANGMRHGDSRRFRFRLTQEERELHFLLTNDGRPYTG
                     APMGYGLTAMKERVQQLGGSMNLSAGDLDGCRLDIVLPVD"
     misc_feature    complement(362681..363220)
                     /locus_tag="PM3016_314"
                     /note="7TM diverse intracellular signalling; Region:
                     7TMR-DISM_7TM; cl09440"
                     /db_xref="CDD:263781"
     misc_feature    complement(362372..362548)
                     /locus_tag="PM3016_314"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(362384..362386,362396..362398,
                     362405..362407,362417..362419,362426..362428,
                     362438..362440,362495..362497,362504..362506,
                     362516..362518,362525..362527,362537..362539))
                     /locus_tag="PM3016_314"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(362531..362533)
                     /locus_tag="PM3016_314"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(361904..362209)
                     /locus_tag="PM3016_314"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(361916..361918,361922..361927,
                     361940..361942,361991..361996,361997..361999,
                     362081..362086,362090..362092,362096..362098,
                     362102..362104,362168..362170,362177..362179,
                     362189..362191))
                     /locus_tag="PM3016_314"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(362177..362179)
                     /locus_tag="PM3016_314"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(361994..361996,361997..361999,
                     362084..362086,362090..362092))
                     /locus_tag="PM3016_314"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(361082..361690)
                     /locus_tag="PM3016_314"
                     /note="heavy metal response regulator; Region:
                     cztR_silR_copR; TIGR01387"
                     /db_xref="CDD:130454"
     misc_feature    complement(361343..361687)
                     /locus_tag="PM3016_314"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(361385..361390,361397..361399,
                     361454..361456,361520..361522,361544..361546,
                     361673..361678))
                     /locus_tag="PM3016_314"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(361544..361546)
                     /locus_tag="PM3016_314"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(361520..361528,361532..361537))
                     /locus_tag="PM3016_314"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(361382..361390)
                     /locus_tag="PM3016_314"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(360632..>361339)
                     /locus_tag="PM3016_314"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    complement(361019..361207)
                     /locus_tag="PM3016_314"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    complement(360629..360883)
                     /locus_tag="PM3016_314"
                     /note="Histidine kinase-, DNA gyrase B-, and HSP90-like
                     ATPase; Region: HATPase_c; pfam02518"
                     /db_xref="CDD:251347"
     gene            complement(364166..364837)
                     /locus_tag="PM3016_315"
                     /db_xref="GeneID:11882309"
     CDS             complement(364166..364837)
                     /locus_tag="PM3016_315"
                     /codon_start=1
                     /transl_table=11
                     /product="two component LuxR family transcriptional
                     regulator"
                     /protein_id="YP_005310440.1"
                     /db_xref="GI:379718309"
                     /db_xref="GeneID:11882309"
                     /translation="MNSATTIVLADDQTLMRDGLHTILTLEDDLEVVGTAENGQQALE
                     LVEQLRPNLVLMDIQMPVMNGIESTKRIKKQFPETIILILTTFAEDDYIVEGLANGAS
                     GFLLKDMPGDKLIQSIRDCVKGQLMMPAVIASKLAARLSSASAAATAEFDPKRLKSEG
                     ISFTEREKNIISLMMEGKNNRQIAGLLFMSEGTVKNYVSMIYNKIGTNDRTKAILALK
                     EWMTP"
     misc_feature    complement(364181..364819)
                     /locus_tag="PM3016_315"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(364475..364813)
                     /locus_tag="PM3016_315"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(364514..364519,364526..364528,
                     364583..364585,364643..364645,364667..364669,
                     364802..364807))
                     /locus_tag="PM3016_315"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(364667..364669)
                     /locus_tag="PM3016_315"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(364643..364651,364655..364660))
                     /locus_tag="PM3016_315"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(364511..364519)
                     /locus_tag="PM3016_315"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(364196..364351)
                     /locus_tag="PM3016_315"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(364208..364210,364241..364255,
                     364259..364264,364268..364273,364295..364303,
                     364340..364348))
                     /locus_tag="PM3016_315"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(364202..364210,364301..364303,
                     364307..364309,364313..364315))
                     /locus_tag="PM3016_315"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            365101..365445
                     /locus_tag="PM3016_316"
                     /db_xref="GeneID:11882310"
     CDS             365101..365445
                     /locus_tag="PM3016_316"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310441.1"
                     /db_xref="GI:379718310"
                     /db_xref="GeneID:11882310"
                     /translation="MKPMEPGRPISEKEDIERNKTSAVLAYILFFLPLLTAKDSRFAM
                     YHANQGLLLLLTAMAFNIILGLIPVIGWLLMPVTNLAVLVLAVLGMVKAARGERRPLP
                     VVGSFTLIPSPE"
     misc_feature    365137..365421
                     /locus_tag="PM3016_316"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4818"
                     /db_xref="CDD:227155"
     gene            365854..366789
                     /locus_tag="PM3016_317"
                     /db_xref="GeneID:11882311"
     CDS             365854..366789
                     /locus_tag="PM3016_317"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310442.1"
                     /db_xref="GI:379718311"
                     /db_xref="GeneID:11882311"
                     /translation="MGVRHAAAARPVRRRARPRPRGPASRAGRASPEAAAHGRRRRCS
                     RGSAGRTAAGCAAALGPGNRGHSRGSAELLRAAGRPLPGRVAVYAAEADPAALLAGER
                     ALQRAGTACGLPVRFHALPLHGCALPAAWPAELSAGSGTLLAYAACGLPGAGPSGFTP
                     QAEQLAAVGALRPRALVLSAPDADFAAGGPLGRFEAAWPYYEALFRWLGDRLLPAGVR
                     SGLHARYGAGLASVLGEAASPDGAQASRALFVRTAEWIRRLQAAGYRPAPIPPGAGLG
                     SPAADGLRVEPHPWHYGLSYAGVNLQSVLCAIPAS"
     gene            366863..368308
                     /locus_tag="PM3016_318"
                     /db_xref="GeneID:11882312"
     CDS             366863..368308
                     /locus_tag="PM3016_318"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor hybrid histidine
                     kinase"
                     /protein_id="YP_005310443.1"
                     /db_xref="GI:379718312"
                     /db_xref="GeneID:11882312"
                     /translation="MPFSKVFFVNVSLLVTLSYLVNLGYKYTADRFGWWTAMSARARE
                     ALVVALLVSAGWVTMLFGLQINESMLFDLRLVPVIVSIFVFRRASLPLLVGIGIGLVR
                     LTLGWNYAALAGFFNLSLLGFAATGLSLWFRQTQVGYPANFVISLLAINVLNAVNLSL
                     FGAIPSWIYVTTIMPYTLPLGTLLSALFLFILRDFYLDRKRTGELRATNRLLMRQKKE
                     LERAKAALEEQARELRMASRYKSEFLANMSHELRTPLNSIITLSQLTADGHEGRFTEE
                     EVQYLGIIRASGEELLRQINDILDLSKMEAGHLEFHHEEVSVHEIAQILEHTFSWAAG
                     QKGLTFSVTAAGDIPEIIRTDGARVHQILKNLLTNAVKFTEQGSVGLDIRKEHEGPGG
                     EAGSWVAFAVTDTGIGISRDKHALIFEAFRQADGSISRRYGGTGLGLSISLELAKRLG
                     GHLGVESEPGKGSRFTLYLPVHPEDDQRSSS"
     misc_feature    367037..367447
                     /locus_tag="PM3016_318"
                     /note="5TMR of 5TMR-LYT; Region: 5TM-5TMR_LYT; pfam07694"
                     /db_xref="CDD:254364"
     misc_feature    367244..368296
                     /locus_tag="PM3016_318"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    367478..>367618
                     /locus_tag="PM3016_318"
                     /note="Protein of unknown function (DUF1043); Region:
                     DUF1043; cl11473"
                     /db_xref="CDD:264386"
     misc_feature    367580..367771
                     /locus_tag="PM3016_318"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(367589..367591,367601..367603,367613..367615,
                     367622..367624,367634..367636,367643..367645,
                     367700..367702,367712..367714,367721..367723,
                     367733..367735,367742..367744,367754..367756)
                     /locus_tag="PM3016_318"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    367607..367609
                     /locus_tag="PM3016_318"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    367940..368269
                     /locus_tag="PM3016_318"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(367955..367957,367967..367969,367976..367978,
                     368066..368068,368072..368074,368078..368080,
                     368084..368089,368168..368179,368225..368227,
                     368231..368233,368246..368251,368255..368257)
                     /locus_tag="PM3016_318"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    367967..367969
                     /locus_tag="PM3016_318"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(368078..368080,368084..368086,368168..368170,
                     368174..368176)
                     /locus_tag="PM3016_318"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            368530..369147
                     /locus_tag="PM3016_319"
                     /db_xref="GeneID:11882313"
     CDS             368530..369147
                     /locus_tag="PM3016_319"
                     /codon_start=1
                     /transl_table=11
                     /product="putative NADH nitroreductase"
                     /protein_id="YP_005310444.1"
                     /db_xref="GI:379718313"
                     /db_xref="GeneID:11882313"
                     /translation="MSQVNQTISAEEAILSRHSVRKYERDVVIPQAELDEILSLAHSA
                     PSSWNLQHWRFLVIQEQANKDRLLPIAFNQQQVSDASVVVVVLGDLEANLIAPKIYES
                     ATPEIRDMMVGQINGAYENNPAVARDEAIRNASLAAMQLMLAARAKGYDTVPMGGYNP
                     QALIQEFKIPARYVPVMLLPIGKAASPARATERLPLDNVVINESF"
     misc_feature    368560..369126
                     /locus_tag="PM3016_319"
                     /note="Nitroreductase-like family 1. A subfamily of the
                     nitroreductase family containing uncharacterized proteins
                     that are similar to nitroreductase. Nitroreductase
                     catalyzes the reduction of nitroaromatic compounds such as
                     nitrotoluenes, nitrofurans and...; Region:
                     Nitroreductase_1; cd02137"
                     /db_xref="CDD:239052"
     misc_feature    order(368566..368571,368578..368580,368632..368634,
                     368653..368661,368674..368676,368680..368682,
                     368692..368700,368704..368718,368932..368937,
                     368944..368949,368956..368961,368968..368970,
                     369028..369033,369103..369111,369115..369126)
                     /locus_tag="PM3016_319"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239052"
     misc_feature    order(368578..368580,368584..368586,368662..368670,
                     368674..368676,368755..368757,368935..368937,
                     368986..369000)
                     /locus_tag="PM3016_319"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239052"
     gene            369453..371243
                     /locus_tag="PM3016_320"
                     /db_xref="GeneID:11882314"
     CDS             369453..371243
                     /locus_tag="PM3016_320"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_005310445.1"
                     /db_xref="GI:379718314"
                     /db_xref="GeneID:11882314"
                     /translation="MNPVTALIRWSNNINIRNKLILAFILVVFIPVMLVGGFLTYEFR
                     KTVLDHATQQTSNNVDKIKQRTLEIIRMPIEVSNKLLVDPRLSTLVNTRYDSTYEVVE
                     AYRNYAEFKEYMKLYKEIVNIRFYTTNPTLIDNWDFIQPDTKTMGSFWYRHAMSNNRD
                     TISWHYIEDETKNSQKYLSLVRRVVFHDYRTSGVLVINVNADSLNAMVRQEPFDTMLL
                     DERGYVVAAKNPAWVGRNAAELQLGPDFLNMMTGTYEAVFGGKPSKVLVEDLLPEASG
                     NGLKIVSIFTIESIVSGANRISLMGLIIILTSLSIAMVLIYFSSKLLSSRLFRLKEQL
                     VQVSTGNLNVASTIDGNDEIGMLSRQFNYMVESIRELMEEVSESNRQKSQLELQQRDI
                     KLKMMASQINPHFLFNALESIRMKAHMQGQAELAAIVRSLGKLLRKNLEIGGGRIPLT
                     EELEIVRCYLEIQTFRFEDRLTFKLELDPLARDVPLPPLMIQPLVENAIIHGLESREE
                     GGVVEVRTKLEDDHLRVEVIDNGLGIPPERMAFIERSLADSDGEGEHRIGLRNVHQRL
                     SLTYGEGYGLQITSGPDAGSRIHFMIPIGG"
     misc_feature    <370269..371234
                     /locus_tag="PM3016_320"
                     /note="Predicted signal transduction protein with a
                     C-terminal ATPase domain [Signal transduction mechanisms];
                     Region: COG2972"
                     /db_xref="CDD:225519"
     misc_feature    370419..370562
                     /locus_tag="PM3016_320"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(370419..370424,370431..370436,370440..370445,
                     370452..370457,370461..370463,370509..370514,
                     370518..370523,370530..370535,370539..370544,
                     370551..370556)
                     /locus_tag="PM3016_320"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    370629..370877
                     /locus_tag="PM3016_320"
                     /note="Histidine kinase; Region: His_kinase; pfam06580"
                     /db_xref="CDD:253806"
     misc_feature    370920..371228
                     /locus_tag="PM3016_320"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(370929..370931,370941..370943,370950..370952,
                     371031..371033,371037..371039,371043..371045,
                     371049..371054,371118..371129,371184..371186,
                     371190..371192,371205..371210,371214..371216)
                     /locus_tag="PM3016_320"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    370941..370943
                     /locus_tag="PM3016_320"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(371043..371045,371049..371051,371118..371120,
                     371124..371126)
                     /locus_tag="PM3016_320"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            371248..372855
                     /locus_tag="PM3016_321"
                     /db_xref="GeneID:11882315"
     CDS             371248..372855
                     /locus_tag="PM3016_321"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310446.1"
                     /db_xref="GI:379718315"
                     /db_xref="GeneID:11882315"
                     /translation="MKKVVIVDDELAIRKGLRTLIDWERYGFEVAGDAANGREGLRLH
                     AELAPDLMVVDIKMPGMDGLQLLGEIRKTDPVCRFLVLSGYADFQYAKQAIGCGVNGY
                     MLKPVDEEEMHRELERIAAEMEDKAQTARLSRSKRREELLRAVLHGGAAAEGVGPEEL
                     EELTGGQGRICGILLLAVSSSASAGAGGAPTAAEAYGTAKSWLTEAFDTCGCGFVFPA
                     EPYIGLLLYENPGMPKVRQRLYDELSEGLGALGLTFTAAAGPAAGSPEGLAASYAGAC
                     RLLGQRFLLGGAEIHTRLGAEVEELLAAEAEPAEKAAAAAEKSAEKLYFALDLGDKEG
                     VRDALAEAGRWMLRQDPAEQAVKTQFAQLITVVLGKLSADGTAGMPRVQEGMPVVTGI
                     YEQPSYQDLLRYVGSAFDKLIDAAGSTSSEPVLKQMLHFIQRHYSENLKLETLAELFK
                     YNSGYLGKLFKNYTGDSFHTYLDKVRIRRAIELLGEGLKVHQVAQLVGYANVDYFHSK
                     FKKYVGMPPSAYKEKPQRAEVKVGGNV"
     misc_feature    371248..372816
                     /locus_tag="PM3016_321"
                     /note="Response regulator containing CheY-like receiver
                     domain and AraC-type DNA-binding domain [Signal
                     transduction mechanisms]; Region: COG4753"
                     /db_xref="CDD:227095"
     misc_feature    371263..371607
                     /locus_tag="PM3016_321"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(371269..371274,371410..371412,371434..371436,
                     371494..371496,371551..371553,371560..371565)
                     /locus_tag="PM3016_321"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    371410..371412
                     /locus_tag="PM3016_321"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(371419..371424,371428..371436)
                     /locus_tag="PM3016_321"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    371560..371568
                     /locus_tag="PM3016_321"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    <371569..>371685
                     /locus_tag="PM3016_321"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     misc_feature    372541..372663
                     /locus_tag="PM3016_321"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    372703..372807
                     /locus_tag="PM3016_321"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            372955..373881
                     /locus_tag="PM3016_322"
                     /db_xref="GeneID:11882316"
     CDS             372955..373881
                     /locus_tag="PM3016_322"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310447.1"
                     /db_xref="GI:379718316"
                     /db_xref="GeneID:11882316"
                     /translation="MKNKGVIMVLAAAVAWGLSGIGAQLFFSHFDSTPGWLVSVRMLC
                     AGGLMILLHSLLQGVKSTFSVWSHKKDRRSLLVFGLVGMLGVQYTFFEAIDKGNAATA
                     TLLQYLGPVFIIAYVSVHRRRMPGGRELSAFALALIGIFLMTTGGSFGSLTMSVEAFV
                     WGIVTALAAAFYTLYPGRLIAAWGSVPVVGWSMIIGGTGLSILHPPWVFDWSQASLYM
                     GGLLAFIVIIGTIIPFFLFLESLRYVTAAKASILSSAEPLTSVLVGTLFLHIPMDAVQ
                     LLGSLCIILTVIVLTLPSRRKEEAAEEPAVTG"
     misc_feature    372994..373389
                     /locus_tag="PM3016_322"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    373000..373818
                     /locus_tag="PM3016_322"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:233205"
     misc_feature    373453..373830
                     /locus_tag="PM3016_322"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(373957..375147)
                     /locus_tag="PM3016_323"
                     /db_xref="GeneID:11882317"
     CDS             complement(373957..375147)
                     /locus_tag="PM3016_323"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_005310448.1"
                     /db_xref="GI:379718317"
                     /db_xref="GeneID:11882317"
                     /translation="MNRLPILMLALGAFLVGTAELVVGGVLHAMAEDLGVSIALAGQF
                     ITAYSLSFALGTPILIALTSRLGRKSLLLGSLAVFIAGSLLSWASTGYALMLVSRIIL
                     GLSAGVYTVVAVSSVTKLVPPERMGGAISMIALGFGSAMALGVPIGIAITGWWSWQAI
                     FAGLAAVSLAVTLLLLRLLPQIEGDAPVPFRQRFSVLGNPVILSGLLISLLQNGSNSV
                     LLTYLTPYLQEVLHLDASLLGAVMLTLGLVGMLGSRLGGIGVDRWGSVFMLVSTIAFA
                     AVTLGLLPLVTASLTAGLLLVVLWFSSLFMSAPALQTYFIQQAPQSSNLVLSLNLSVI
                     HLGLAAGAGAGGAAVNWASTVHYNPWIGSLAALLSLLAAFVSFSLRKRKAGGGALTRA
                     AART"
     misc_feature    complement(373996..375147)
                     /locus_tag="PM3016_323"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    complement(374188..375132)
                     /locus_tag="PM3016_323"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(374200..374202,374209..374214,
                     374224..374226,374233..374238,374245..374247,
                     374389..374391,374401..374403,374410..374412,
                     374422..374424,374434..374436,374476..374478,
                     374485..374490,374497..374502,374509..374511,
                     374725..374727,374743..374748,374755..374760,
                     374794..374796,374803..374808,374815..374820,
                     374827..374832,374968..374973,374977..374982,
                     374992..374994,375001..375006,375013..375015,
                     375064..375069,375073..375081,375088..375090))
                     /locus_tag="PM3016_323"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            375320..375658
                     /locus_tag="PM3016_324"
                     /db_xref="GeneID:11882318"
     CDS             375320..375658
                     /locus_tag="PM3016_324"
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="YP_005310449.1"
                     /db_xref="GI:379718318"
                     /db_xref="GeneID:11882318"
                     /translation="MEQSCPEVQKHSNICDVLQILGAKWAFLVIDELQKGPQRFKQLQ
                     RSVAVVKTQSLTDTLRHLEQTGIVRREVFPTVPVTVEYSLTEKGQDFHGVLKEMDRWA
                     LKWRIRDSQA"
     misc_feature    375365..375634
                     /locus_tag="PM3016_324"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1733"
                     /db_xref="CDD:224647"
     gene            complement(375850..377508)
                     /locus_tag="PM3016_325"
                     /db_xref="GeneID:11882319"
     CDS             complement(375850..377508)
                     /locus_tag="PM3016_325"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310450.1"
                     /db_xref="GI:379718319"
                     /db_xref="GeneID:11882319"
                     /translation="MSTNKPISRRHFLAYLGTGAATLVTAASGLDSLLTGSGTAKAAS
                     SLFDQETPVVTSGSLAGKPVSTDELTLPGGFQYDVIAAYGDVINTKGDTFGYDSTSAV
                     FLPENGSRVKGLLYVDHETSSPQWAHGSRSEGVYTAGQINSSLYNQGASVLEVYRGAD
                     GRWRMDTASPAARRITGLDPFELTGPARGAAAVRGAVQVQGTLGNRTGAVTLWGTVLT
                     SEGSWDGTCHDAGLDPSHYGWAAEIDPADPAFKLRKHTALGRFRHSGAPMKLTRDGRA
                     AVYMGDTAAESPLFKYISRGRFDENRGTANSDLLTDGALYAADLENGRWIELTVDAVK
                     EVLRSPGLDLPHAVKYTQEQLQALFREQADVLVHAAEAALLLGATPLGRQGDAALHPL
                     DGSLYVSLVDTSVHGQILRIVEEQGDAGASAFEFEITATGGPQSGFTSPGHLAFDRSG
                     RLWIAADVAPDRLLRSAFRRYGSNGLYVLDLKAPAGSGVTPFASAPVGAAFASPAFTP
                     GEQTLFLSVQHPGAASGEGTPQVSSWPHLPGSTAPRSALVAVRG"
     misc_feature    complement(375856..377490)
                     /locus_tag="PM3016_325"
                     /note="Predicted phosphatase [General function prediction
                     only]; Region: PhoX; COG3211"
                     /db_xref="CDD:225752"
     misc_feature    complement(375946..377325)
                     /locus_tag="PM3016_325"
                     /note="Bacterial protein of unknown function (DUF839);
                     Region: DUF839; pfam05787"
                     /db_xref="CDD:253386"
     gene            377714..378172
                     /locus_tag="PM3016_326"
                     /db_xref="GeneID:11882320"
     CDS             377714..378172
                     /locus_tag="PM3016_326"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_005310451.1"
                     /db_xref="GI:379718320"
                     /db_xref="GeneID:11882320"
                     /translation="MRMEPVRPEDEALLYSLYAGSRQEELDTWGWEPQARDLFLSMQY
                     RLQQQSYRSQYPESDHRIIVHEEQRVGHVRIDRSGDDLRLVDLSLLPAWRGRGIGTQL
                     LRELQMEAGAAGRCIRLSVLEGSPAARLYERLGFETVGQPSVYHQMRWKP"
     misc_feature    377714..378136
                     /locus_tag="PM3016_326"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    377897..378073
                     /locus_tag="PM3016_326"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(377972..377980,378008..378013)
                     /locus_tag="PM3016_326"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            378337..378861
                     /locus_tag="PM3016_327"
                     /db_xref="GeneID:11882321"
     CDS             378337..378861
                     /locus_tag="PM3016_327"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310452.1"
                     /db_xref="GI:379718321"
                     /db_xref="GeneID:11882321"
                     /translation="MSEAYIGEIRMFGGNFAPVGWAFCHGQLLPISQYDALFTLIGTT
                     YGGDGQTTFALPDLRGRAPVHQGQNPMTQSSFALGQTSGVENVTLNQGNIPSHTHPVR
                     AQKEPGTTGSPAGGLWAASAVNPYAVPGGTPSGTMHPAAVSPAGGNQPHDNMMPYLAV
                     NFIISLEGIYPSQN"
     misc_feature    378340..378858
                     /locus_tag="PM3016_327"
                     /note="Microcystin-dependent protein [Function unknown];
                     Region: MdpB; COG4675"
                     /db_xref="CDD:227020"
     misc_feature    378355..378513
                     /locus_tag="PM3016_327"
                     /note="Phage Tail Collar Domain; Region: Collar;
                     pfam07484"
                     /db_xref="CDD:254225"
     misc_feature    378541..>378654
                     /locus_tag="PM3016_327"
                     /note="Flavin-utilizing monoxygenases; Region:
                     Flavin_utilizing_monoxygenases; cl19096"
                     /db_xref="CDD:267449"
     gene            378897..379397
                     /locus_tag="PM3016_328"
                     /db_xref="GeneID:11882322"
     CDS             378897..379397
                     /locus_tag="PM3016_328"
                     /codon_start=1
                     /transl_table=11
                     /product="tail collar domain-containing protein"
                     /protein_id="YP_005310453.1"
                     /db_xref="GI:379718322"
                     /db_xref="GeneID:11882322"
                     /translation="MSEDFIGEIRAFSFGYAPRGWMPCNGQLLAINLNQALFSILGTY
                     YGGNGQTNFALPDLRGRVPVHVGTDITLGMIAGEEAHTLTLNELPSHTHQIMASSSEA
                     STNQPAGAVWAKQTAAGYDTAAPNTVMGSAALSSAGSSQPHTNMQPYGVVQFCICVEG
                     IYPSRN"
     misc_feature    378900..379394
                     /locus_tag="PM3016_328"
                     /note="Microcystin-dependent protein [Function unknown];
                     Region: MdpB; COG4675"
                     /db_xref="CDD:227020"
     misc_feature    378915..379073
                     /locus_tag="PM3016_328"
                     /note="Phage Tail Collar Domain; Region: Collar;
                     pfam07484"
                     /db_xref="CDD:254225"
     gene            379431..379952
                     /locus_tag="PM3016_329"
                     /db_xref="GeneID:11882323"
     CDS             379431..379952
                     /locus_tag="PM3016_329"
                     /codon_start=1
                     /transl_table=11
                     /product="microcystin dependent protein, MdpB"
                     /protein_id="YP_005310454.1"
                     /db_xref="GI:379718323"
                     /db_xref="GeneID:11882323"
                     /translation="MEPFLGEIRMFAGNFPPKNWAFCNGQLIPLTQNTALFSLLGTMY
                     GGDGKTTFALPNLMGRAPIGFGQGPGLTNRTQGEAGGSAAVTLLNSQMPYHTHLAAAH
                     SSSTQSSPEGAVWSKTGGRQGPAAYAAAAPDTPMSPQALGIAGGNQPHNNRQPYLGVN
                     YIIALQGIFPQRS"
     misc_feature    379431..379949
                     /locus_tag="PM3016_329"
                     /note="Microcystin-dependent protein [Function unknown];
                     Region: MdpB; COG4675"
                     /db_xref="CDD:227020"
     misc_feature    379446..379601
                     /locus_tag="PM3016_329"
                     /note="Phage Tail Collar Domain; Region: Collar;
                     pfam07484"
                     /db_xref="CDD:254225"
     gene            380025..385265
                     /locus_tag="PM3016_330"
                     /db_xref="GeneID:11882324"
     CDS             380025..385265
                     /locus_tag="PM3016_330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310455.1"
                     /db_xref="GI:379718324"
                     /db_xref="GeneID:11882324"
                     /translation="MNRTLAPNAASAASAAFRLMRWSLFCLWAVLVFLVVPDESAQAA
                     TFTVNHTADTVDAAPGNGVCADASDASGKCTLRAAIMESNALPGADTINVGPGVYTLI
                     LGGTGENGATTGDLDILGDLVLVGAGGNAEGDPAATVIQAGESSSTGIDRVIDINPNL
                     DLNTNVTIQALTVRYGRGTDEYGAGIAADSGSGTIRIYNSVITNNHNVVAGGNGAGLY
                     LSGGNPAGKLLVDKSRIDGNTSYNRGGGIFVEGVTPFIMTDTTVENNTATAGSGGGLF
                     LIGGGQRTIFSSTIAGNSAIGTAGSSLDGLGGGVYSISKLNLDNSTVSGNAAVKGGGG
                     LQLAYAGEGAYLVRNATIYGNTADSDNNASGSGGGIGVQAGTAAPLLHNTIVAGNRLG
                     SEAASDIFGSAAGGSSYNLIGTGGSGGLVTGAAGNQTGVSDLRLGALADNGGPTKTHA
                     LLAGSPALDAGTAAQAPGAADQRGTAFARTADAADADTASAVDIGAFEAHPSVEDLQD
                     VSMAMGGARQIEFHIGDADLGVDTVTAVSSDPQLIPNAAENLAVSGSGGARTLTVKPA
                     PGQSGSATITVTVSHPVGGALRSMTDTFLVTVAPQPDLAITKTHTGNFRKGQPGAYTI
                     TVTNVGSASTSGGITIEDWLPAGLTFLSVEAAGWSCEYGQEPTKCTSGKALEPGESFD
                     PIVLTVNVQEDAASTVTNRAVVSGGGDVNLDNNTALDSTVIKSSTSVSLNTSKTPSDY
                     GERVTWTANVSADTGTPIGTVTFKDGSDVLGVASLSSGKAVYSSDSLAVGSHSITAEY
                     NGSADYLGSVSPVVEQAVLSLATKTVVTALPTSSVFGQPVTFTAVVTAAAPASGTPTG
                     TVTFKDGDTDLGTASLDGAGVATLPVNGLIAGTHRITAVYSGSATFAGSVSEGLDYMV
                     ERATTTLLKSSVTESVYGEKVTLTAEVKSAGGTPTGEVILHSGSTELGRGALGADGTT
                     VISLIELVPGTYDIIASYSGDGLHAGSVSAPDLTLTVDRAATTTSVLSVSDAVYGESV
                     TLTAEVRVIEPGAGKVGGTVSFLRDGGLLGDAPLDAGGTAVLKDITLPLGTSAITAVY
                     GDGSPLYKGSISSPVEVTVRSPKLELDSYNYTLRLGENHTTVVRAVYGADDLRDVTGQ
                     SFFFSSNPSVAEVDAAGKVTAVGFGTANITVVYGSEQAVALVTVPIPNALNSNTALKS
                     LTLTEGMAVLVPGTDTYEATVGSGVGSIGIQAETEDAEALVSINGSTAVEGTASLTAD
                     LSEGLNTFDIAVTAPDGSKKQYSLKITRERSSTGGGDGGSDNGGGGDNDGGTGNSGSG
                     QPGETPKPEEPETPEVPWLIPVRPGGTVFVPLAVTVSHNGSTTVVSLSDGAVKDKLDG
                     KKGPKVFLIALPKGAQRSQIEISSGIMALIRSGHQASSVGIAADGASFDLPVRLFTPD
                     ALAKALGISAADAEKARILITVTAKAAPAGVDAASARLYDFSIVVEAGGRTYPYDQYK
                     GSYLAKAFGLKPSADVKKAAGITITGEATAYPVPFEKAEVEGSPVLVLKADHNGTFGI
                     ITQQRSFTDTDGTWAQDAIEGLSGRLVVDGYPDGSFRPEVPVSRSEFAAMLARALGWV
                     PDSSASVQYTDVDPAAWDAGYIASMSERGLISGYEDGSFRGSQRITREEAAVLLTRAL
                     AYVQTEAQSAGAGTGSTAAFADSGEVSSYAREAIAKAQAQGLLSGYEDDTFKPQGLTN
                     RAETVTLISKLLQLTGLAGS"
     misc_feature    380607..381182
                     /locus_tag="PM3016_330"
                     /note="Right handed beta helix region; Region: Beta_helix;
                     pfam13229"
                     /db_xref="CDD:257587"
     misc_feature    <381810..381986
                     /locus_tag="PM3016_330"
                     /note="Domain of unknown function DUF11; Region: DUF11;
                     pfam01345"
                     /db_xref="CDD:250549"
     misc_feature    <383469..383579
                     /locus_tag="PM3016_330"
                     /note="Bacterial Ig-like domain (group 2); Region: Big_2;
                     pfam02368"
                     /db_xref="CDD:251254"
     misc_feature    383628..383897
                     /locus_tag="PM3016_330"
                     /note="Cadherin-like beta sandwich domain; Region:
                     Cadherin-like; pfam12733"
                     /db_xref="CDD:257258"
     misc_feature    384696..384824
                     /locus_tag="PM3016_330"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    384876..385007
                     /locus_tag="PM3016_330"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    385107..385211
                     /locus_tag="PM3016_330"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            385527..386108
                     /locus_tag="PM3016_331"
                     /db_xref="GeneID:11882325"
     CDS             385527..386108
                     /locus_tag="PM3016_331"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005310456.1"
                     /db_xref="GI:379718325"
                     /db_xref="GeneID:11882325"
                     /translation="MSRPREFNIECALQQCMEVFWTKGFKATSFEDLTRRTQVKKQSL
                     YCAFDDKRALFLKTLALYREQHAAKMEQFVSQEGSPLQKLEKIRDATFTPSAEGSCRG
                     CFMVNSALEFGISDEEVTRQVEMMFREVERMIEQLIRSGQEQQMITNRHTAEALAAHL
                     TNSLLGARMMEKSGASRERIEAVLRTSFALILP"
     misc_feature    385551..385694
                     /locus_tag="PM3016_331"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    385563..386102
                     /locus_tag="PM3016_331"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     gene            386132..387175
                     /locus_tag="PM3016_332"
                     /db_xref="GeneID:11882326"
     CDS             386132..387175
                     /locus_tag="PM3016_332"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-dependent flavin oxidoreductase"
                     /protein_id="YP_005310457.1"
                     /db_xref="GI:379718326"
                     /db_xref="GeneID:11882326"
                     /translation="MMNTNASVQSLFRPFAFGNVTLSSRIVMAPMTRQYSPDGVPGPN
                     VVDYYRRRAENEVGLIVTEGTVVPHPDASNQANIPHFFGEAALNGWAKVVAAVHEAGG
                     RIIPQLWHMGAKGNVGEYTEEEVAAIVEAFAQAASEAKRIGFDGIELHGAHGYLIDQF
                     FWEQTNPRTDRYGGDVVKRTRFAVEVIEACRRAVGPEFPIVLRISQWKPTDYSAKLAG
                     TPALLEQFLAPLSAAGVDVFHCSTRRFWEPEFEGSELNLAGWTKKLTGKPTITVGSVG
                     LDGDFTNLFTNGEGAGNAKVDGLIERLEREEFDLVAVGRALLVDPAWASKLRDGRTDE
                     LTPFTPEALKTLV"
     misc_feature    386162..387172
                     /locus_tag="PM3016_332"
                     /note="Old yellow enzyme (OYE)-related FMN binding domain,
                     group 5.  Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a reducing
                     agent with oxygens, quinones, and alpha,beta-unsaturated
                     aldehydes and ketones, and can act as...; Region:
                     OYE_like_5_FMN; cd04747"
                     /db_xref="CDD:240095"
     misc_feature    order(386219..386221,386225..386227,386321..386323,
                     386450..386452,386594..386596,386750..386752,
                     387071..387076)
                     /locus_tag="PM3016_332"
                     /note="putative active site [active]"
                     /db_xref="CDD:240095"
     misc_feature    order(386219..386221,386225..386227,386321..386323,
                     386450..386452,386750..386752,387071..387076)
                     /locus_tag="PM3016_332"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240095"
     misc_feature    order(386588..386590,386594..386596)
                     /locus_tag="PM3016_332"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240095"
     misc_feature    386594..386596
                     /locus_tag="PM3016_332"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240095"
     gene            complement(387296..387730)
                     /locus_tag="PM3016_333"
                     /db_xref="GeneID:11882327"
     CDS             complement(387296..387730)
                     /locus_tag="PM3016_333"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_005310458.1"
                     /db_xref="GI:379718327"
                     /db_xref="GeneID:11882327"
                     /translation="MQRTVRLACPEDADGLVRLNREFNGVVDITAEEVSRSLRLGPEL
                     VAVAILDGVLSGFACAQSFTSFCYRERQAEITELFVMETARGQGLARELLLLLEEHLR
                     RQGVQSIKVITGGSNEAALKTYVRSGYIPKEHAVLYKELGSV"
     misc_feature    complement(387344..387589)
                     /locus_tag="PM3016_333"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:216007"
     gene            complement(387750..388391)
                     /locus_tag="PM3016_334"
                     /db_xref="GeneID:11882328"
     CDS             complement(387750..388391)
                     /locus_tag="PM3016_334"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_005310459.1"
                     /db_xref="GI:379718328"
                     /db_xref="GeneID:11882328"
                     /translation="MGTFFARHYDALMGWLEKRGFTRIRANLLREASGTVLEIGSGTG
                     LNFPLYHGCDKVVALEPSEVMRRTSMKRALIAPVPVEPVGGDAQNLPFADASFDTVVG
                     TLVLCTIPDPLRALREIRRVCKPGGTVLFFEHVRLEHAALGRLQDWLTPAWKRLCDGC
                     CLNRSTLDTLQQAGLEIKRTERYYGDIFVTVVARNPEAGSGDASASRTGAFES"
     misc_feature    complement(387981..388289)
                     /locus_tag="PM3016_334"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(388083..388085,388131..388139,
                     388209..388214,388257..388277))
                     /locus_tag="PM3016_334"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(388436..388765)
                     /locus_tag="PM3016_335"
                     /db_xref="GeneID:11882329"
     CDS             complement(388436..388765)
                     /locus_tag="PM3016_335"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310460.1"
                     /db_xref="GI:379718329"
                     /db_xref="GeneID:11882329"
                     /translation="MSDLAKTPQPPYYAVIFTSERTAGDKGYGRMADLMVELASQQPG
                     FLGVESARDAGGLGITVSYWSSLEAIRAWREHALHQTAQEKGRTDWYERYALRVSKVE
                     RDAFFEM"
     misc_feature    complement(388445..388732)
                     /locus_tag="PM3016_335"
                     /note="Uncharacterized enzyme involved in biosynthesis of
                     extracellular polysaccharides [General function prediction
                     only]; Region: COG2329"
                     /db_xref="CDD:225209"
     gene            388982..389944
                     /locus_tag="PM3016_336"
                     /db_xref="GeneID:11882330"
     CDS             388982..389944
                     /locus_tag="PM3016_336"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane lipoprotein"
                     /protein_id="YP_005310461.1"
                     /db_xref="GI:379718330"
                     /db_xref="GeneID:11882330"
                     /translation="MEPLTTRGALPMEKPRRSGGFWQTMGRQKYLYFMSVPFVIWLIV
                     FSYVPIWGWLMAFQKFRPGRSIFEQNWVGLANFAELFADERFYLVLRNTLAMSVMGLV
                     VGFTVPIIFALLMNELKGQFFKRSVQTISYLPHFVSWVVVAGLVTKMLSTEGGAVNSL
                     LLSLGVIDAPVQFMAKGEWFWSIVTASDMWKETGWNSIIYLAAMAGIDPELYEAATVD
                     GAGRFRKIWHITLPGIRPTFMVLLILSIGHLVSIGFEKQFLLGNPLVIDYSEVVDLYA
                     LNYGIGLSRYSYGTAIGIFNSVVSIVLVLTANGIYKRLTKESII"
     misc_feature    389249..389884
                     /locus_tag="PM3016_336"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(389297..389302,389309..389314,389327..389329,
                     389360..389371,389375..389404,389459..389464,
                     389468..389470,389543..389548,389558..389560,
                     389564..389566,389573..389578,389582..389584,
                     389594..389599,389606..389608,389657..389659,
                     389699..389704,389711..389713,389732..389743,
                     389750..389755,389792..389797,389834..389839,
                     389846..389851,389855..389860,389867..389872,
                     389879..389884)
                     /locus_tag="PM3016_336"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(389378..389410,389459..389470,389732..389749)
                     /locus_tag="PM3016_336"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(389468..389470,389528..389530,389750..389752,
                     389786..389788,389795..389797,389834..389836)
                     /locus_tag="PM3016_336"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(389609..389647,389663..389668,389678..389680)
                     /locus_tag="PM3016_336"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            389957..390850
                     /locus_tag="PM3016_337"
                     /db_xref="GeneID:11882331"
     CDS             389957..390850
                     /locus_tag="PM3016_337"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_005310462.1"
                     /db_xref="GI:379718331"
                     /db_xref="GeneID:11882331"
                     /translation="MTWARKSLSDRLFDLVLYAAMIFTVVVTLYPFLNVLAISLNDST
                     DTVRGGIHIWPREFTLKNYETIFQYSGLMTGFRNSVIRTLAGTLIGVISASMVAYVLS
                     REEFQARRLFSMLFALTMYFSGGLIPVYMLMRDLSLLNSFWVYLIPGLLSVWNVFIIR
                     SYINGLPYALQESAKIDGANDFTIYWRVVLPLCQPVLATVALFIAVGQWNSWFDTYLY
                     NSSNESLTTLQYELMKVLQSTQNNADAARNPNMAQNIAAVSPESIRMAITIVVTLPIL
                     LVYPFLQKYFVKGMTLGAVKS"
     misc_feature    389966..390844
                     /locus_tag="PM3016_337"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    390182..>390586
                     /locus_tag="PM3016_337"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(390230..390235,390242..390247,390260..390262,
                     390290..390301,390305..390328,390335..390340,
                     390344..390346,390410..390412,390416..390418,
                     390425..390430,390434..390436,390446..390451,
                     390458..390460,390509..390511,390551..390556,
                     390563..390565,390584..390586)
                     /locus_tag="PM3016_337"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(390308..390328,390329..390346,390584..390586)
                     /locus_tag="PM3016_337"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(390461..390499,390515..390520,390530..390532)
                     /locus_tag="PM3016_337"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            390931..392601
                     /locus_tag="PM3016_338"
                     /db_xref="GeneID:11882332"
     CDS             390931..392601
                     /locus_tag="PM3016_338"
                     /codon_start=1
                     /transl_table=11
                     /product="family 1 extracellular solute-binding protein"
                     /protein_id="YP_005310463.1"
                     /db_xref="GI:379718332"
                     /db_xref="GeneID:11882332"
                     /translation="MMRRLTKWVSVMLAAALVTVTGCSKEPAAEPGQASGSGTDPITM
                     SVFSADPNPAWNNMQDEVGKKLTEKTGVTLKMEFPVGSSDQKIPLMVSSGEYPDMILP
                     KGDPGKLVAADALLDLTDLIEQHGPNLKKVYGKYMKRLRWSTEDPSIYILPISPVDQE
                     YFDAGGGFELQHAVVKELGYPKIRTVKDFENAIKAYKDKYPTIDGKPTIGLSLNADDW
                     HIMISVTNPAFLTTGAPDDGEYYIDPKTYEAKFHYFRPEEKEYFRWLNHMNNIGLIDP
                     ESFVQKYDQYKAKIASGRVLGLIDQDWDYQEAQNVLRKEGKFERTYGHYPVTLNESFK
                     DHSFQDTGYLAGYGIGITKSAKDPVRAIKFLDYLASDEGQVLINWGIEGVHYKVENGM
                     RVIPPDVLDKKVNDANNFAKTSGIGQYYISARYGDGVKDPTGSTYTTTTVEQKIASYS
                     EADKETLKAYGATTWKDLFPKKEEFPVKPWGAAWSIPVEPDSNVNVTYNKAKTIVWKR
                     IPEAILAKPEQFDAIYDGMLQELDKVGVKKMEQEYTELVKERVKLFNE"
     misc_feature    390934..392079
                     /locus_tag="PM3016_338"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    391111..392052
                     /locus_tag="PM3016_338"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_8; pfam13416"
                     /db_xref="CDD:257741"
     gene            392850..395174
                     /locus_tag="PM3016_339"
                     /db_xref="GeneID:11882333"
     CDS             392850..395174
                     /locus_tag="PM3016_339"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310464.1"
                     /db_xref="GI:379718333"
                     /db_xref="GeneID:11882333"
                     /translation="MKFSDGFWMTREGYQLIPAVQVFSVTAEERSVTVLVAPRDVSRR
                     SGQLDCPLLTIRYYSPQPDVIGVKIEHFAGVQQAGPDFELQRSETHEVTVERGDGVVT
                     LTAGRVSVKVREAGDWSAVFYQDGRRITGSGSKAAAHVSGPDGDVHVKEELDLGVGEL
                     IYGLGERFTPFVKNGQTVDIWNRDGGTSSEQAYKNVPFYLSNRGYGVFVNQPELVSFE
                     VASEKVSKVQFSVPGESLEYYVIGGPSGKEVLERYTTLTGKPALPPAWSFGLWLTTSF
                     TTNYDEETVNSFVDGMRERDLPLHVFHFDCFWMKAFHWTDFQWDPEVFPDPAGMLKRL
                     KEKGLHICVWINPYIAQQSRLFAEGRERGYLIKRPNGDVWQWDRWQPGQGIVDFTNPE
                     ACEWYAGYLRELVDMGVDSFKTDFGERIPTDVVYHDGSDPQRMHNYYTHLYNKVVFDV
                     LEEKLGRGQAVLFARSATAGGQQFPVHWGGDCFASYESMAESLRGGLSLGLSGFGFWS
                     HDIGGFESTSSADVYKRWTAFGLLSSHSRLHGNVSYRVPWAFDDESVDVMRFFTQWKC
                     RLMPYLFGGAVEASQKGLPLMRAMLLEFGDDPTAGYLDRQYMLGDSVLVAPVFNEEGR
                     ISFYLPQGRWTHLFTGETVEGGTWREEEHGYMSLPIYVRPGTLLPVGADASRPDYDYA
                     DGVELQLFELADGATAERVVYSTQAAEVLRVSVTRSGGSLSVRAEGESAGAWSLLLRG
                     VDSAGAEGAAAERTPLGVRLTPEAGRREWSVRLA"
     misc_feature    392850..394844
                     /locus_tag="PM3016_339"
                     /note="putative alpha-glucosidase; Provisional; Region:
                     PRK10658"
                     /db_xref="CDD:236731"
     misc_feature    393321..393503
                     /locus_tag="PM3016_339"
                     /note="Galactose mutarotase-like; Region: Gal_mutarotas_2;
                     pfam13802"
                     /db_xref="CDD:258085"
     misc_feature    393621..394553
                     /locus_tag="PM3016_339"
                     /note="YicI alpha-xylosidase is a glycosyl hydrolase
                     family 31 (GH31) enzyme that catalyzes the release of an
                     alpha-xylosyl residue from the non-reducing end of
                     alpha-xyloside substrates such as alpha-xylosyl fluoride
                     and isoprimeverose. YicI forms a...; Region:
                     GH31_xylosidase_YicI; cd06593"
                     /db_xref="CDD:133124"
     misc_feature    order(393762..393764,393879..393881,394086..394088,
                     394092..394097,394242..394244,394281..394283,
                     394290..394292,394389..394391,394464..394466)
                     /locus_tag="PM3016_339"
                     /note="active site"
                     /db_xref="CDD:133124"
     misc_feature    order(393780..393785,393900..393905,393927..393929,
                     393966..393968,393972..393974)
                     /locus_tag="PM3016_339"
                     /note="homotrimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:133124"
     misc_feature    order(394092..394094,394290..394292)
                     /locus_tag="PM3016_339"
                     /note="catalytic site [active]"
                     /db_xref="CDD:133124"
     misc_feature    order(394296..394298,394305..394307,394320..394322)
                     /locus_tag="PM3016_339"
                     /note="homohexamer (dimer of homotrimers) interface
                     [polypeptide binding]; other site"
                     /db_xref="CDD:133124"
     gene            396679..404874
                     /locus_tag="PM3016_340"
                     /db_xref="GeneID:11882334"
     CDS             396679..404874
                     /locus_tag="PM3016_340"
                     /codon_start=1
                     /transl_table=11
                     /product="WD40 domain-containing protein"
                     /protein_id="YP_005310465.1"
                     /db_xref="GI:379718334"
                     /db_xref="GeneID:11882334"
                     /translation="MKRKRSKLWKRGTALLLATTMVLGDLGAAAAVGPEEFDPASVIT
                     ADTIMDAVYGPEGGIAVPPPVPPAPQPILVPQPVAAGEPLSWNLLTKVDRSKIPSIYF
                     PEDQVLKMSADGRYIGFKRFELVTEEPAHVNKVITVYDRKTGAMDDIQSPPNHSQNDE
                     VIYFDMSSDARYVAFSYMSYTEDWKEKTKVYLFDRETRNLTPITTVEGSTDSHEGTDR
                     VAISADGRYVAFDSDAPGIVAEDTDDLRDVFVYDRESGATQRITAFPEMGEYDYGDSE
                     APTISADGRYIAFHSDSKFVEKDTYGQTNVYVYDREDSNARPQLVSIGVGGAAGEGHS
                     TLPSISADGSVIAYESTAENMVSGDFNEMKDIFVYNRNTAVTQRVSLAEGGIPFNRDS
                     MSPSISRDGRYVGFHLDYVWVEDTDDDHDNDDENDIPEEAYVAEVASQTAYPVTVPQA
                     PYRLLNPSQSPIVGDGGKLVVYLSEYFYSYTGGSEGTPFPGTFIAEKGTAPVWPAGSK
                     LEPSNRTGDSVTLSWPDAVDATGILGYHVYQDGKNIGYVEYRGTGSNTFTAEGLLPVY
                     EPEFQVEAVNSAYRESYGGPTYKLGAGGGENPAGELRVLWDVEDMRYNMAFPGSMVGL
                     SAYGEPGKQVSAELTYMAWKNETEQETRTESIPLTEGAAGTYKAQWKMEEGVSQLTSL
                     NVKLTDPAKPGTVLEKPAAGFPVQVAGAVELSFTNPSGASLTGSLLTSTSRQYGQQIA
                     LLPNSDAYVVNGLYPGKDHSFTLRSPDGRHTWGSLEQVQVEGGKRSKISMNIEQPAQL
                     RFQVVDPTGQPVSGVGLQLFGPGQSYIDASSTYGDGWTSWTDYMKAGDSVTAKVDIGD
                     RMYEQPANQEVILKPGANEQVIKLRAPGEGLVEGFVKGPDGKGVRNAYIASTQTFKGQ
                     PVVRRTRTNLEGAYRLSLLEGEAKIEVFETSYMYGTDGPVTVLVTEGGTTTLDLPVKQ
                     PSKGIVNTEVRLKYLEDTDFGPPVNMEEMTFLTRIESKRGWMSGYFQNAHQFYGLPGD
                     TVSVCVTGSVPSYMTSCTDVVLDQDGNATAKLFLEEKGARIQGKLAQTHHRWVSGGLY
                     KLKDQGYRSAASYLGDNDFEADGSFNINVPEAGTYVMELNGALPGSPLKYEYATVQFT
                     VSDRQILQVGSVSFSSKSFFSNYYGNYYNALSSRIAPGGTVTMRAGYKNSSGVDASEA
                     KLLIDIPEGTTPVKDAAGRIVVSGAQLAGDPVLDGQTLILPVGTVAQTQSGTLSFQLK
                     VDPAFNKSSAKSSARIRARMGVEQIEESIGSVLLDAPLVTLEAPERVSKPVDSSAPVI
                     KLSGVAPAGSQVNVYDGKLLLGSAAASNTGFWLMAVQELPDLGDPGVHAIRAEVDSNG
                     VKLQSPVSYVHYDNVKPQLLELAMAQAPEGRWMTLNLREGIPNQPYTVVPGNPFQFEL
                     KFDKPDEVENVEIYLEGQSGEPVKAVREGGIFRALTPTDKGALGAIYVDYDVKPKPFV
                     LDDKQPTLDELRETLPPTMRDFTAEVTAPFELKDGKYAGTVELTFPQLPGLKITEKLS
                     ISPDAKYTASPQEIELAQRSGLPMLNGSVSVTETDDGFKTVSSGYMPMKLLFPSGVPG
                     SLKSALAAKVRALAADEGPDFGTLADVSVETYVQYGEGGEDAGTVYKIKKQYEDSMEF
                     AEKINKIAYKVEVSGMDCIQELPTTVKQAGKALVAVVGGEISKVALGAWTGAMGLTGP
                     GAIAAAGASAVIEDKIDNYVDEQIDAIGTGYNQCRDEDEEKKRKRKKIARLRWIYDPS
                     GYVYEAVPANRLSSVKATVLYQEPASKEWVVWDAGPYEQVNPHDTDDQGKYGWDVPEG
                     KWKVVWEKDGYETQSSAELDVPPPHTEVNAGLVSYEAPKVQSVTGVTAAAGSYVDVEL
                     TKYVKVTDAAAAAQAVTVTGPDGSPLEGSAAFVEPADNPADAEGADLSRILRFTSKTS
                     LTPGTGYSVKVNAAFQSYAGVWMAEGHSGTFEVGTRDEEGPTAAGDEVNAEGEGSILR
                     VKFNEKLSSTVDAAKFTLNGSSDSIVSAVRALKPNPEGELTAVDGDYEQTVVLTLSES
                     LAPGTEAQLGILAGAVSDTAGNAAVPKTLKVVSAAGESSNAALASLAVEEGALAPAFD
                     PSVRSYKVEVPSAAETVNLTASLADASAQLVIDGTIAASGVRKTVRIPDTGIIAVRVT
                     AADGTTVREYSVEVVRGTTDPLGTEASLSALTVTPGTLSPVFEPAVETYDVEVAANVT
                     ELQIAATAQDSKAKSITIAGEAAVSGTAKTVAIPAGGQIEVVVTAEDGVTKRTYKVAV
                     SRKTDSGSGGDNSGGGSDSSGGGSVPPAKPALTQQEAFTGASGGKGIRVTLRRSDAIA
                     SALQTGTDGQKQLLIEVKEQADEFMLQLSADTLAKLTESQAGVLFKTTRLQASIPSAL
                     LASVQLPAGAHLSFSMGAASAAEQTAAYEAAALQSDALKPSGQAVSVKLEMIQDQKAS
                     LLTFGHPVMVELPVQGSGQEAVYRFDPADAKWAFVWKQRQVSGSRSAIEADASGTYAV
                     MAYADPFDDMKDHWASSDVGWMARRLLVSGAAPGAFHPDHSVSRAEFAALLVRALDLK
                     AVATVGYQGFSDVPEEAWYAADVRRAAEAGLLQGVADNRFAPDALITREQMAVLIWRA
                     NVYLREAAGEQAGAGHALKQFKDQGSISSWAEAAAAAALEAGLIQGTAADTFDPQGSA
                     TRAQAAVMMKRLLQLGSGQ"
     misc_feature    398188..398412
                     /locus_tag="PM3016_340"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    399340..399582
                     /locus_tag="PM3016_340"
                     /note="Carboxypeptidase regulatory-like domain; Region:
                     CarboxypepD_reg; pfam13620"
                     /db_xref="CDD:257932"
     misc_feature    403027..403299
                     /locus_tag="PM3016_340"
                     /note="Cadherin-like beta sandwich domain; Region:
                     Cadherin-like; pfam12733"
                     /db_xref="CDD:257258"
     misc_feature    403330..403602
                     /locus_tag="PM3016_340"
                     /note="Cadherin-like beta sandwich domain; Region:
                     Cadherin-like; pfam12733"
                     /db_xref="CDD:257258"
     misc_feature    404308..404436
                     /locus_tag="PM3016_340"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    404494..404622
                     /locus_tag="PM3016_340"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            complement(405300..405791)
                     /locus_tag="PM3016_341"
                     /db_xref="GeneID:11882335"
     CDS             complement(405300..405791)
                     /locus_tag="PM3016_341"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaJ domain-containing protein"
                     /protein_id="YP_005310466.1"
                     /db_xref="GI:379718335"
                     /db_xref="GeneID:11882335"
                     /translation="MLNREREERRRHGHQGEQEAAERPIIPLPKETLEDRDVILHAQL
                     EQHRLANEAYEEFVKNGGLEKLPGFGKPIEVPTGDILASIMKQARVQPPFMMLRTEIR
                     KNMELAMELLKQDPGSPEIDAALDDANKQITELNYQAPSLSLHRRKLTRENLQEQYER
                     WYR"
     misc_feature    complement(405471..405647)
                     /locus_tag="PM3016_341"
                     /note="Domain of unknown function (DUF1992); Region:
                     DUF1992; cl08096"
                     /db_xref="CDD:263527"
     gene            complement(406024..407289)
                     /locus_tag="PM3016_342"
                     /db_xref="GeneID:11882336"
     CDS             complement(406024..407289)
                     /locus_tag="PM3016_342"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="YP_005310467.1"
                     /db_xref="GI:379718336"
                     /db_xref="GeneID:11882336"
                     /translation="MTKSTERIEALRKLAVPLKEKAALDDLVKAASSARCVLLGEASH
                     GTSEFYTLRAELTKRLITEHGCRIIAVEGDWPSCFSVNRYIKGLPGAAGSAAEALAAF
                     DRWPEWMWANHEIGDLVEWLKAHNASLPPERQVGFYGLDVYSLWESMDEILQYLERTG
                     SPNVEEARAAFECFEPFGGEGQSYGISASLFGEGCEDEVVALLAKLRTERTRSEDPQE
                     EALDAEINALVAVDGERYYRAMITHDAESWNIRDRHMTEVLHRILNFHGPDAKAVVWE
                     HNTHIGDARATDMFTDGMVNVGQLAREQMAPGEVYAIGFGTHRGKVMAGTSWGSPAQV
                     MDVPQGISGSWEDLLHHAVGEDCVLLLKDAPAVLRETIGHRAIGVVYRPTHERGNYVP
                     SRLPDRYDAFVHVEVSQAVRPLAGEPVFA"
     misc_feature    complement(406072..407088)
                     /locus_tag="PM3016_342"
                     /note="Erythromycin esterase; Region: Erythro_esteras;
                     pfam05139"
                     /db_xref="CDD:253037"
     gene            407538..408116
                     /locus_tag="PM3016_343"
                     /db_xref="GeneID:11882337"
     CDS             407538..408116
                     /locus_tag="PM3016_343"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310468.1"
                     /db_xref="GI:379718337"
                     /db_xref="GeneID:11882337"
                     /translation="MQIEDKEIVEYPSTLKLAGLSIGAAIFVAGGAGLFAWGQEEEDL
                     ELVVVGAAGVLFFGGALLYLLYRLLRRRPSLMINAEGIVDHSSYTGGGRIRWEQIKDM
                     TVYELMGQRFIGLELHDPEAFLAKQTPFKRILLRMNRGLVEAAVNIPQTGVQMPLDEL
                     HAVMMERWNAASRRKEEAGLETQFGAARRQSD"
     gene            408369..409118
                     /locus_tag="PM3016_344"
                     /db_xref="GeneID:11882338"
     CDS             408369..409118
                     /locus_tag="PM3016_344"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310469.1"
                     /db_xref="GI:379718338"
                     /db_xref="GeneID:11882338"
                     /translation="MSYRIQATEKTPALILYLLDISRSMTLPMGGRRRLDIALDSLTA
                     SLKQMVFRSTKGGRLSPRYRVALIAYSDAVYDLLGGIRPIDEVARKGIPDLVPQRLTE
                     TAEAFAYAEKLLLAELPGLDGCPAPLVCHITDGTPTGADPEPVVRRIMDMTVPDGAVL
                     VENIFISEHLLAEPVGDVRSWGGIQDDTPFLDETAVRLRRMSSRIPESYLELLHDSGY
                     PLAAGSYMMLPGSSAELVGLGFQMSSATPVR"
     misc_feature    408411..>408800
                     /locus_tag="PM3016_344"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    order(408426..408428,408669..408671,408768..408770)
                     /locus_tag="PM3016_344"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            409118..409960
                     /locus_tag="PM3016_345"
                     /db_xref="GeneID:11882339"
     CDS             409118..409960
                     /locus_tag="PM3016_345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310470.1"
                     /db_xref="GI:379718339"
                     /db_xref="GeneID:11882339"
                     /translation="MNTYEYRLDPAEDVPLTTVVVGPALYRFAARRADESRLAGEPSQ
                     DDLVLRADETGASFCICDGVSLSFFGGLAARLLGDALLEWCASGIPAKAGEPQVRLSL
                     ERLLADLTHTAGEAVRSHPLPNSAAGLLREVLEDKRRLGSEAMFVFGRVDFPCTAYPA
                     GRLVLGRMGDIRIRFAAADGQWESSLTGFTEQRWSTRRGAVGGRPAVLITELPAARSG
                     LTVYTDGWAAFCDGVTTLPPEGPDPWCAARDGEELPADDDQLFFQMQWQMEPPPDHEE
                     EASS"
     gene            409957..410301
                     /locus_tag="PM3016_346"
                     /db_xref="GeneID:11882340"
     CDS             409957..410301
                     /locus_tag="PM3016_346"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310471.1"
                     /db_xref="GI:379718340"
                     /db_xref="GeneID:11882340"
                     /translation="MNRIMTLSMDRQEVDVEVPDDVPVGRLLPLLAEAAGTAVTGGER
                     LLLEASQPGEAWRILSPGRTLSDEDIRDGAFLRISLTPAAPEDTSGPEKAEAGQEDSS
                     GLPVAGWKPLFS"
     misc_feature    409990..410190
                     /locus_tag="PM3016_346"
                     /note="WXG100 protein secretion system (Wss), protein
                     YukD; Region: YukD; cl17489"
                     /db_xref="CDD:266723"
     gene            410367..414437
                     /locus_tag="PM3016_347"
                     /db_xref="GeneID:11882341"
     CDS             410367..414437
                     /locus_tag="PM3016_347"
                     /codon_start=1
                     /transl_table=11
                     /product="FtsK/SpoIIIE family protein"
                     /protein_id="YP_005310472.1"
                     /db_xref="GI:379718341"
                     /db_xref="GeneID:11882341"
                     /translation="MQRPQYFQRSPRIKKGIPYGTVEVHRPPAPPAPPKLSLISMLLP
                     AGMTAASVLLLVMLNPNQNSSYLVVQLISMSTMAVSYLVPFLTHLSNKREYKREKAER
                     ESKYEAQLESHRKELEKVRELQKSVMLDTDPPPEECVRRIREWSGEVWNRSPQEEDFL
                     HLRLGVGDQPFCIRIKAPEQDGYEKEPLIEASQKLDDDYRTVSHVPVQLPVFESKVIG
                     IVGDRQAAENMVRVLALQLAAHHAPDEVKVGAFFGEEEARRWEWMRWLPHTWDDDRKT
                     RYLAKDMSTTRQALDALYHVLHPRKLASSPGREAEMKLPAWVFFLSDIRPMEDEPLVH
                     LLLREAEALSACTFILSDRRETLPKECGMILEVTLGEGRLLETASGQSGVTGRERYFI
                     PDRITLEQADEAARLLAPYRLRKSAAGELPRVLTLYDMFGVRETGELSAAAHWSKNRY
                     PDTLPVTVGVRAGGKPVQLNIHDKIERRGHGPHGLIAGTTGSGKSEVIQSLIASLALQ
                     FHPHELAFMLIDYKGGGMSNTFALLPHLIASITNLEGKGVMDRAQVSLKAELARRQRI
                     LNAAGNLQHIDEYYRSPYRDKEPLPHLVIVIDEFAELKKEQPDFMSELISIAAIGRTL
                     GVHLILATQKPAGVVDDKIWSNARFRICLRVQDEADSRDMLRVPDAARISNPGRGYFQ
                     VGSNEVFELVQFAWSGAPYRPEAAAAAVEAEAYTVALNGTRHRCAAPAAASRAGDRLD
                     ERKQLQVFIDYLAETARAEGIEPLPGPWTPPLPAELFLGDLRDGSSGWNGAGWQPAEG
                     WLQPALGLIDDLANQVQRPLCFPLEEGHLLIYGMPGTGKTTMLQTLLLGLASEHHPED
                     VQFYVLDFGRMLKDFDPLPHTGAVIQQEEAEKVRRLFRFLAGQLDQRKQLFSEAGVKS
                     LETYRKVTGSAMPALFTVMDGYLSFKDSYPDEHDRWEALLREGASLGLYFVVTANRVS
                     DMFDKIRSNFPLAFSFELADPSDYYFAVGRPVRPLSQAPEGRGLLKGAVPPLEGQIAL
                     PAGGADEFERTRAIRETVKRMSEAWNGPRAFRIPVLPEIVSLGALLDGEYGGAADGGA
                     ADRPGAKEAVLRVPVGLETEELTLFCPDLRDGPVFVVGSRMEGGKTALLSSWVLALAG
                     ANRPEALQLVLADFRRTPSGLYALRQLPHVTGCAVDEDSLLTLLGPLREELERRKFLL
                     QSEGDGAVGASFPAIVLAIDDGEAVARQIGMSYELQGHLEWILKQARGLGVYILFGCI
                     PAEIGNCFDSWTGPVKSAQTGFLLGTTESADLNLFNLKLPYAETGKSLPSGEGFYVRR
                     RHAPFKGALPFTGGAGPEEWVRRITESVGPMTGRMS"
     misc_feature    410382..414335
                     /locus_tag="PM3016_347"
                     /note="type VII secretion protein EssC, C-terminal domain;
                     Region: T7_EssCb_Firm; TIGR03928"
                     /db_xref="CDD:234402"
     misc_feature    411684..412277
                     /locus_tag="PM3016_347"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     misc_feature    412743..413285
                     /locus_tag="PM3016_347"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     misc_feature    412839..>413039
                     /locus_tag="PM3016_347"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    412857..412880
                     /locus_tag="PM3016_347"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    412860..412883
                     /locus_tag="PM3016_347"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    413712..>414041
                     /locus_tag="PM3016_347"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     gene            414451..415401
                     /locus_tag="PM3016_348"
                     /db_xref="GeneID:11882342"
     CDS             414451..415401
                     /locus_tag="PM3016_348"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310473.1"
                     /db_xref="GI:379718342"
                     /db_xref="GeneID:11882342"
                     /translation="MRIRVSPEQLGQVALQFQQAQHQSQTSIARMRGAIGRLESQWSG
                     VTREEFYQSFQRASQIMNRYLETLQKIEGDLKQISQRFADTDKKEDSSSELLKKAIIS
                     GLSTAGKLGFVASALKVSANAKRADLVDIAVRDWVKNGKVAEVWSKLLPVKSVNTPQK
                     MAAKLGNIDHTLPGSSIKATNMAKHIRGQLKPFGLVGVALTSVGEVKPLVSSIQSDIA
                     KYDGLEAAGHVATDVAYSTTKVAATVGASYAGAVGGAQAGAFLGSFVLPPIGTAVGGI
                     AGAIIGSSLGGAVVSETIENLVPRERFKSGVQKLKGLLGL"
     misc_feature    414454..414708
                     /locus_tag="PM3016_348"
                     /note="WXG100 family type VII secretion target; Region:
                     WXG100_ESAT6; TIGR03930"
                     /db_xref="CDD:234403"
     gene            415458..416255
                     /locus_tag="PM3016_349"
                     /db_xref="GeneID:11882343"
     CDS             415458..416255
                     /locus_tag="PM3016_349"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310474.1"
                     /db_xref="GI:379718343"
                     /db_xref="GeneID:11882343"
                     /translation="MSASTIKVSLEELALLLHLNDRDEESKLMLGIAYEELTPKEVEN
                     IFVTASHSLLVRDLLLMAGDGEKLCIASTLKEALDVTGAPEGTLFFQRVDTGLQTSYT
                     GHLHRKGSSYVSYQSLDGIVHTFKDMGSREGLAEEGMSLLGLRIKGDAENGGPLAELP
                     ARLVNNLAGLTSEQAAESREALVSGGFTTELADRFLEDAQHAASIYSVMKLEEGETHE
                     LRADRGLIVIESEQTQWLLYPNGQGNGFTVSKLSDALFRAQIQGLDL"
     gene            416275..416526
                     /locus_tag="PM3016_350"
                     /db_xref="GeneID:11882344"
     CDS             416275..416526
                     /locus_tag="PM3016_350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310475.1"
                     /db_xref="GI:379718344"
                     /db_xref="GeneID:11882344"
                     /translation="MSKKSDGDFFESGFGKFLIGVAAAIGAIYTFLLAASKYFMITVM
                     VCMAGGVVYLLFLKEVFYALMLLVPLLIWYAMYRHFTSK"
     gene            416745..417017
                     /locus_tag="PM3016_351"
                     /db_xref="GeneID:11882345"
     CDS             416745..417017
                     /locus_tag="PM3016_351"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310476.1"
                     /db_xref="GI:379718345"
                     /db_xref="GeneID:11882345"
                     /translation="MAKILVSPETLQQASNTFKQGGAESQAQVQKLKATINGLQGQWE
                     GMTQQKFFADFQQAESMMKNYVELLHNISTQLDTIAQRFRQADGQG"
     misc_feature    416751..417005
                     /locus_tag="PM3016_351"
                     /note="WXG100 family type VII secretion target; Region:
                     WXG100_ESAT6; TIGR03930"
                     /db_xref="CDD:234403"
     gene            417165..419855
                     /locus_tag="PM3016_352"
                     /db_xref="GeneID:11882346"
     CDS             417165..419855
                     /locus_tag="PM3016_352"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310477.1"
                     /db_xref="GI:379718346"
                     /db_xref="GeneID:11882346"
                     /translation="MSFQPEAGEELRTAHSRYIIAEHPAAPGLPYGQEGRQGTVYRLD
                     DPEGGPSRALKVFRPRFRQPFIAEQAHRLAPYASMPGLSVCGRTVWVPGDSEGPPGQP
                     GLDYAVLMPWIDGPTWTDVLLDRQELAQETCLQLALALSKILFDLERSGMAHGDLSSA
                     NLLLPALLGTAPSRSGYPVELIDVDTMYHPDAARPEVLPQGTPGYARSGAQQTGAWSP
                     EADRFAGGVLLAEMLAWADPSVRREAYGDSYFDPVEIGTPCRRAELLEDAVRALWGEE
                     AAALWSRVWHSSREEEAPGFKAWYLLLNRIHKEPAARMEPVRQEEQPMEEMIIIGGEP
                     DEGLQTRLEAHNLGKAAVYPELGAFLSDIEQGRGPLRSCRLIVLHASSDQGRKEAERL
                     QQTLLQSGGTGSSRPALYLVISRMSLYEQFIELDELLAYDNACAVFLPGMDGGQLVRL
                     LSGEYDRDGIRHPRFSGPPQAAGGGLGRPAEAGRRQPLADTPMRTADPQPPDAGRPPE
                     GQAAARSGPQAPDAAQVQPSSGRWGAPEERELSRAAQPQAAPEAERTRREPLPEQPRE
                     PEAPPEPPKETKRGGLWGLKDKLSIRFDADERGRGPQAAPEKERLSGKSFLWSREKKV
                     KLPKHGSILVTGDRGSGVTSTAVNLAHLLSGYGTVALLDFDYKRKGVSYLFPDTVKRQ
                     TDERQSFGLYALLNNPRLFEDVMFVEHEQLSFVTMTEPYVLELYGDRRFERTIGEKPR
                     EELLQDRRFYAAVNYVKTLVDWVVIDLPAETMKIAEDLSIYSDYVLFTSHNSELALSN
                     LLFVELGSLYKTNELAFTNYLAKGSIVLTRYEKESLLDRRELTGALAEKLIRRQGDPW
                     NLKVVGAIPYTPGYAGQYSTGRMLSLGELREPFLQIIENM"
     misc_feature    417264..>417656
                     /locus_tag="PM3016_352"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     misc_feature    order(417270..417272,417282..417284,417321..417323,
                     417327..417329,417438..417440,417492..417503,
                     417630..417632,417642..417647,417651..417653)
                     /locus_tag="PM3016_352"
                     /note="active site"
                     /db_xref="CDD:240159"
     misc_feature    order(417270..417272,417630..417632)
                     /locus_tag="PM3016_352"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240159"
     misc_feature    order(417282..417284,417321..417323,417327..417329,
                     417438..417440,417492..417503,417630..417632,
                     417642..417647,417651..417653)
                     /locus_tag="PM3016_352"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240159"
     misc_feature    419079..>419684
                     /locus_tag="PM3016_352"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    419079..419555
                     /locus_tag="PM3016_352"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            419928..420806
                     /locus_tag="PM3016_353"
                     /db_xref="GeneID:11882347"
     CDS             419928..420806
                     /locus_tag="PM3016_353"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310478.1"
                     /db_xref="GI:379718347"
                     /db_xref="GeneID:11882347"
                     /translation="MFKRGSSDTRVLVNKLKSIGVYLLALGVFLASLVMILNNTSKYK
                     RDVAVAEFREDVGSGTLIKKDMIQKRTLAERDYDSKTMVPYDQAASLIEGKYTGIYIP
                     KGVTLQKTWFTDKKKERLKYLKDMKENQEFVTIPYDSRYSGGRVLLPGDYVKLYAVYQ
                     GTDPATGQLNKLADVDVIFKKIKVTDLLNAEEESVLGYLEDAQMLSREQQEALMKRKE
                     FQDSLTPKFMGLVLTNEEAEALQKFLGNGKIQIKADILTRDENVENSNKIGSLLSQLQ
                     GGTAAPAPQADGAAQP"
     gene            420822..421655
                     /locus_tag="PM3016_354"
                     /db_xref="GeneID:11882348"
     CDS             420822..421655
                     /locus_tag="PM3016_354"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310479.1"
                     /db_xref="GI:379718348"
                     /db_xref="GeneID:11882348"
                     /translation="MDFLNRTKKIIEYNVEKIQSESYFCSNFGFVSLLNGAGTSTLAA
                     NTASLLSKQEKKVLLLDANFHQPNLFYFFDGLEVPENQSLSMYFANKIEEKELNIRVP
                     GHENLWLISTSPKDRVDKILQANEDNLGRLMEYVSETFDFVIADIPFLPMSEWFIEIL
                     ERMDKSIIVWDEQNDCGYKTVQMLEFLDSHSDCVNMVKNVVINKRTKRAYELDKIKKE
                     FNCNYVCSLPHIDDMDELKAAGELIIDSGKMSRAYGKEFYHMVDYLLSNHKTGSSGGE
                     G"
     misc_feature    420903..421328
                     /locus_tag="PM3016_354"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    420927..421622
                     /locus_tag="PM3016_354"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     gene            421655..423091
                     /locus_tag="PM3016_355"
                     /db_xref="GeneID:11882349"
     CDS             421655..423091
                     /locus_tag="PM3016_355"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein E"
                     /protein_id="YP_005310480.1"
                     /db_xref="GI:379718349"
                     /db_xref="GeneID:11882349"
                     /translation="MLTPEKLKQRRARYGRASLYTKEEISFTKIVEQCSRYLHRLNRE
                     MNLSALKAKQRTRDNIDRFVNDLEVKVEGYENPDQLRKALKDEMIHYGIISELMEDPA
                     VNEIRINGYDRIFYEAGGMTKRYDKAFSSPEDARRVIERLLGEVRITENEPFKNARTL
                     EEGWRINAIHGEISHLGEYGVVIRKFRENTFRDEDFLENGVMTQDMLNFLQFMPQIYV
                     NWWTVGPTGSGKTALNEAILKKMNPSDRTIIVENPTEIRFEQRDERTGQTVNDFLQLV
                     AKNPDPENEKNPNWPTMNNLLTNALRQTPKYLGAGEIRTPEEFKTMLVAAQTGHQTFA
                     TFHADAADKALQRYLTTYLMVSPNEPPELVMSNLCDTIDLIVCVKLFPKTGKRRVTSI
                     AEVIGSEGMKPLINIIYEYEIEHVDDDGVVKSSFVRRNAISDKLVAKFKDAHIPFSRY
                     AKWTQPPAGGREVEATYYEGTQKEAVLL"
     misc_feature    421808..422905
                     /locus_tag="PM3016_355"
                     /note="Flp pilus assembly protein, ATPase CpaF
                     [Intracellular trafficking and secretion]; Region: CpaF;
                     COG4962"
                     /db_xref="CDD:227297"
     misc_feature    order(422324..422329,422339..422347)
                     /locus_tag="PM3016_355"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(422327..422329,422339..422347,422399..422401,
                     422405..422410,422585..422590)
                     /locus_tag="PM3016_355"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    422573..422587
                     /locus_tag="PM3016_355"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            423088..424089
                     /locus_tag="PM3016_356"
                     /db_xref="GeneID:11882350"
     CDS             423088..424089
                     /locus_tag="PM3016_356"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310481.1"
                     /db_xref="GI:379718350"
                     /db_xref="GeneID:11882350"
                     /translation="MIRELKLFLFSRDIFPVLLALLSLFLFTVKYWKIDLQNKSKEMG
                     SRTFTKLLAWGVENNRKRVQKERIGLKQRKVVKLYQRILGSVIEAYEIKITVENFTVF
                     FIVLWFVLVAVLYWTIENLLMAVLIATPAVAAVFAAIVTSSKSRIKARDTAVMDFLDI
                     ICPLIGRGVTATFERNIAAADPRIRGHIQTYINQRKFSTIAVERAMDELAEKLGPRFH
                     EFARKAKNYEYNAREGDAEAFMDVVEMNKLIRMFEVRSEALFERKNQDMLARILIIIL
                     LALYANYVGVSAEFMQGSGIAHIINSVVVCFCLVIFAGNQLVQITARVNDDEFTEEA"
     gene            424163..425059
                     /locus_tag="PM3016_357"
                     /db_xref="GeneID:11882351"
     CDS             424163..425059
                     /locus_tag="PM3016_357"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310482.1"
                     /db_xref="GI:379718351"
                     /db_xref="GeneID:11882351"
                     /translation="MASILFFAVIGSLALGWLGFALGKAIFRPVAKKKAVRFRVKQEK
                     KKDWDPDSVFQLLKLDLKEVFLSETAEQELNAKLRRLGLAKSARDVRKEQIVLSGVSL
                     LVGLFSYWAFAPVLGLLGLAIAAAGWIYPVETINREIRQMNEIVYKKFPSFYRRNYYS
                     YKKNINTSLSRVVESHMRVCHPAFQRELKVFLEDIESVGEFEAIQRWKNRLPLPYIIR
                     YAEIIESRLRGEDNTPVMENFKLELDKMREVQVDKDLLKLESRINGVLGLMYVPFFLL
                     LIIYFLAQMQGSGLVQFFKQLQ"
     gene            425095..425244
                     /locus_tag="PM3016_358"
                     /db_xref="GeneID:11882352"
     CDS             425095..425244
                     /locus_tag="PM3016_358"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310483.1"
                     /db_xref="GI:379718352"
                     /db_xref="GeneID:11882352"
                     /translation="MVKFAQMAAAIFIIGVVIAVLNDNMEGWINEVWTHVWGLFKGWM
                     GPGTA"
     gene            425278..425829
                     /locus_tag="PM3016_359"
                     /db_xref="GeneID:11882353"
     CDS             425278..425829
                     /locus_tag="PM3016_359"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310484.1"
                     /db_xref="GI:379718353"
                     /db_xref="GeneID:11882353"
                     /translation="MHHFFWLIVRFSMLILGVLCLFSFLTFFPYLMDVKAMANQISLQ
                     VMNDGYLDRKDVDKRLAEFRTERGFLSSATLVPGEADAGYLLPGLGSPDEVSIKAEYS
                     PGEGQAERELLPIWKEEKAARVTAAESSGTAPVGVLDRDVPIRVEIRTNYKVETIAFG
                     KRLVMYLPFSVSSAAITIADYKW"
     gene            425864..426442
                     /locus_tag="PM3016_360"
                     /db_xref="GeneID:11882354"
     CDS             425864..426442
                     /locus_tag="PM3016_360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310485.1"
                     /db_xref="GI:379718354"
                     /db_xref="GeneID:11882354"
                     /translation="MMLLLFALLVVTDLMRYFLLHSEVEAESSKGLKYMLSALGTGEG
                     SNVMGTLEEVKQRTRDAFDRYIATQYPDSAYVKESGEDGTYYFYNITPRPDRLQNTKL
                     RILSGRITVQLKLPAEVEKSDSSADLVPTYEVGLGYRRFLMSSLNLHPGVDTVWEERS
                     MMRFPVSHVELAEFRIGVSSGTIAVPSPIPTP"
     gene            426462..426827
                     /locus_tag="PM3016_361"
                     /db_xref="GeneID:11882355"
     CDS             426462..426827
                     /locus_tag="PM3016_361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310486.1"
                     /db_xref="GI:379718355"
                     /db_xref="GeneID:11882355"
                     /translation="MNKKAIGMAALLTAASLLVVSSVYGRTIITYVSEFFEPTPATAD
                     YGTVKKLTGDFRQQEISDSQTEAVWTQGSVTIKRPDGTTVKGEIPVGGFEVETKKWPQ
                     IPGVPDLEYKTFGSDTAAP"
     gene            426860..427903
                     /locus_tag="PM3016_362"
                     /db_xref="GeneID:11882356"
     CDS             426860..427903
                     /locus_tag="PM3016_362"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein"
                     /protein_id="YP_005310487.1"
                     /db_xref="GI:379718356"
                     /db_xref="GeneID:11882356"
                     /translation="MKRVLKTAWAASLLFSAFGGFGGGSTSVIAAGFNDIENHWAKET
                     ITWGQQEGLISGYPDGTFKPNAQVTEAEFVKMMVASFKTEVSEVQSPKHWADAYYYFA
                     ESKNYPLKGYQELADRDKPITRERVAEFVVGTVGKNYSGDQAIQYLIGFKLATGKVEG
                     EMTIASFKGQDTLTRGEAAQFIRNLKINNVNYFRTRPYEPSPASGLPLMPSPTQVGLN
                     QIMYVLNTHVMTKFPGYSVRSANHDGHFDTSTVTVIDGKNRNILVTQIEYDPKTKSIV
                     LFHLLESEKEGNVEMTAASVKALGYPVPDNFADTLHTVLKEHKDQRVRAGQWTLYLKP
                     DENLMTRMQIIVE"
     misc_feature    426956..427081
                     /locus_tag="PM3016_362"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            427936..428979
                     /locus_tag="PM3016_363"
                     /db_xref="GeneID:11882357"
     CDS             427936..428979
                     /locus_tag="PM3016_363"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein"
                     /protein_id="YP_005310488.1"
                     /db_xref="GI:379718357"
                     /db_xref="GeneID:11882357"
                     /translation="MKGRLKTALAASLLFSAFGGFGGGGTAVLAAGFNDIENHWAKET
                     ITWGQQEGLISGYPDGTFKPNAQVTEAEFVKMMVASFKTEVSEVQSPKHWADAYYYFA
                     ESKNYPLKGYQELAQRDKPITRERVAEFVVGTVGKNYSGDQAIQYLIGYKLASGKVEG
                     DMSIASFKGQDTLTRGEAAQFIRNLKLSNVNYFRTRPFEPSPVSELPQLPGPTQQGLN
                     QIMYTLNDKVITKFPAYGVRPVNHDGHFDTSFVVVYYGENKHAMVLNIEYDPKTKSII
                     RFNFIDGEKEGSVEMFAAAVQALGFPVPNDFSSTLRAVMSENKAQRVNAGQRTLLLKP
                     NELVVTRMEIFVE"
     misc_feature    428032..428157
                     /locus_tag="PM3016_363"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            428992..432285
                     /locus_tag="PM3016_364"
                     /db_xref="GeneID:11882358"
     CDS             428992..432285
                     /locus_tag="PM3016_364"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310489.1"
                     /db_xref="GI:379718358"
                     /db_xref="GeneID:11882358"
                     /translation="MKRWTAWFCIVVLLLPLWPAGNRVEAESNSSLIARFQSFMKDKD
                     INGGYTAEDFRRDNGRLKEEIDRYFDSLDIPRFINGRQGRVEINYPLAARKKIIVYGT
                     PFDDGNDPPKGDQHRYWGQTESLTVFPNFDYPPDAESHTPLKERDWIEEPWNKNIKRA
                     QKTDYMEGELWDTGSQSDQQDSHLEASPKEWLKGAVNHYNNDSNLLEDLGWSVDKLYK
                     HAVILSRPTEYSYGQIVLFHHRNGVNWYDDFMIPPLKSRYNISLRGSSLTPNDKGPEG
                     SPLRLHTEVELSAYNSEPVRIKVEFRRLNGDIINSKEIELSREHPMEKVSIDWKRPGG
                     GEKVTVEAYAVNSSGQRDEKFPEAYEEDNVDYIALSAPVDVPDGPYEGFYHVSDLNKL
                     KSQEDVRSYGGNPVFIQELSTGGKTVSGISDLPSEPVWKDNKGNDISPRSFFVNDGSR
                     TYLKLSSLASLSGAKLTSKLTAPAFRTDHESEITRTEQGACVTETECETIYHVTETFR
                     LQSMGSYYSQNLAEFEVEQSRAPQISKFAVDPQGNLRISASAFGFPAGGLKADLILDY
                     EANKEKLPEGLRSLDNPANPQGGYWRKMVLPAFASEKQPFIHELTSSDGAVITKGTEA
                     KLKGSSSDELVISQEKLQQMFAYSEQLDLFRQSEAYHKAQGTEKHRLLKYMEGIGKDR
                     PALSPGPHTLTLYVTDTFGRFDYITIRYSPVALHDGKAKPEFAYFQGKGTPTEFSHET
                     ANGRSGMNAYRDYAVHFDLTVPASIRKSGTTLERPGFLAAWATDFPAMRTGSQYKVGM
                     SKDTAGALHAADTGDFNTFDADGSVKNVSDLVPANEAKVYSKFDPRDFYNTKLIQEEK
                     NTSAQFKAFPRVIRSGQGIFTESSLEVRAVLEGPSEADNIRRMAELVSSVIEGGSGLQ
                     LSGAKDEELITSVTGPGKYGDLTNNLNETSQKLVLQSGTVQSIIEASKPVTTSQTIIE
                     DSRNRLQVQRTEFIFAVPVWLEPAKGAFGGSNLNTKSYDWTGRGYRGFMIHPNTKDGF
                     YTMRVEGSADLSKLDPSFAGRKLSLYSRLEPLVVLGSVFQDMWVDTSAPAPAQPGTVD
                     SGSDWQWTD"
     gene            complement(432472..436050)
                     /locus_tag="PM3016_365"
                     /db_xref="GeneID:11882359"
     CDS             complement(432472..436050)
                     /locus_tag="PM3016_365"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /protein_id="YP_005310490.1"
                     /db_xref="GI:379718359"
                     /db_xref="GeneID:11882359"
                     /translation="MKSRSRWLRRFSAAALALALALPSASASAEIAASHVYHNHMPNF
                     WPYYDVSKYDSTPVGSPVRYIYDGQVIDLKKNPPANYTYYLPSGAPMPHDDLVSYYTH
                     HAKTGAYLEWPWDVAATLRANHPSAQMQVTMSAAVINNVNSFMYTNNVPGYSNTNWGA
                     PWKNAYNTLKTPSGNRTMDMVHFTGHHTMGPLVGNDYMLKDLIYHNATLAQPYFLGSD
                     FKSSKGFFPTELGFSERIIPVLEKLGIQWSVIGNNHFSRTLRDYPLLNDPGKDTMVSP
                     PNRADLQNESNVGSWVSQQMFNEQQVTHNKFPFASTPHWVKYVNPTTGKESKIVGVPV
                     AQAESWEEGYQGQVTAKALKPFEGLVPQKQFFVIAHDGDNSSGRAGDKGTYLNAGAVT
                     YSDTGVKGMGIDEYLATNKPAASDVVHVQDGSWIDTRDSSSDPQWHHWKLPFGIWKGQ
                     FADFNRVMGTNYTPKKNLAGVEEGMTVSFEHGYHYLERNFALLQAAENYAKTAEQIWL
                     DEHPNHWQPATALDKEVTYAGNQLNPWMMSYPVKGDASKDYAGGANPAELSWYFLMPA
                     IDSGFGYYDENQDDSVKPTVSFNQSLHFSKPYVTPKADKDRTGPSVWWPQRWPYNPGS
                     ANVDKSEGWTLHHFDNTFGIYTYAYDLNGITDIKVKIRKHTSKQADAADNTFRVYDPA
                     ALKAQGVAGIDPAKVGEWKEYPMLRRDLKPDMNGVDWQAGSKAVLQKVPAQEIGDLYY
                     SYIKDLRDELVDYYIEAKDSKGNITRSDIQQVYVGAGTYKNVGGKIIEDPSGDIKGTY
                     PFLTDKPPVLDTTPPSVPSDIKAASASKTSIELTWTASTDDVGVTGYEIYRNGTKVGT
                     SAANRYVDTGLAALTAYTYTVKAFDAKGNTSAASAAATLSTTDQGNSATVYYKPGYTT
                     PYMHYRPAGGTWTTSPGTVMPASEIAGYHKLTVDLGAAASLEAVFNNGSGTWDNNGGK
                     NYIFPAGTSTYSGGVITSGPPPADSQAPSVPAGLQSSAKTDTSVTLGWTASTDNVKVT
                     GYDVYRGGVKVGTTAGTTYTDSGLTANTVYSYTVKAFDAAGNTSTASAALSVTTNPAA
                     GASTLTFKVTVPSNTPAGDSLYVAGSFNSWNAADPASKLVKQADGTYTVTLPIAEGTA
                     VQYKITRGSWETVEVSSTGTDIANRTYTKGAGAQTVSLTVVRWKGL"
     misc_feature    complement(434704..435792)
                     /locus_tag="PM3016_365"
                     /note="putative catalytic domain of glycoside hydrolase
                     family 119 (GH119); Region: GH119_BcIgtZ-like; cd11663"
                     /db_xref="CDD:212128"
     misc_feature    complement(order(434710..434712,434776..434778,
                     434938..434940,435364..435366,435772..435774,
                     435778..435780))
                     /locus_tag="PM3016_365"
                     /note="putative active site [active]"
                     /db_xref="CDD:212128"
     misc_feature    complement(order(434938..434940,435364..435366))
                     /locus_tag="PM3016_365"
                     /note="catalytic site [active]"
                     /db_xref="CDD:212128"
     misc_feature    complement(433399..433614)
                     /locus_tag="PM3016_365"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(433399..433401,433444..433446,
                     433612..433614))
                     /locus_tag="PM3016_365"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(433114..433350)
                     /locus_tag="PM3016_365"
                     /note="Carbohydrate binding domain (family 25); Region:
                     CBM_25; pfam03423"
                     /db_xref="CDD:251943"
     misc_feature    complement(432550..433059)
                     /locus_tag="PM3016_365"
                     /note="Uncharacterized protein contain chitin-binding
                     domain type 3 [General function prediction only]; Region:
                     COG3979"
                     /db_xref="CDD:226487"
     misc_feature    complement(432799..433053)
                     /locus_tag="PM3016_365"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(432838..432840,432883..432885,
                     433051..433053))
                     /locus_tag="PM3016_365"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(order(432820..432825,432829..432834))
                     /locus_tag="PM3016_365"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    complement(432529..432780)
                     /locus_tag="PM3016_365"
                     /note="Starch binding domain; Region: CBM_2; smart01065"
                     /db_xref="CDD:215006"
     gene            436627..436872
                     /locus_tag="PM3016_366"
                     /db_xref="GeneID:11882360"
     CDS             436627..436872
                     /locus_tag="PM3016_366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310491.1"
                     /db_xref="GI:379718360"
                     /db_xref="GeneID:11882360"
                     /translation="MAEWSPDWPALLLLLGMTSLVWGPWMLAKGVFIAEGAGQRKDVV
                     PLPPEPQEDLRPSGTRRFAVRLLRPPRAGTDDRDEED"
     gene            436978..437676
                     /locus_tag="PM3016_367"
                     /db_xref="GeneID:11882361"
     CDS             436978..437676
                     /locus_tag="PM3016_367"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310492.1"
                     /db_xref="GI:379718361"
                     /db_xref="GeneID:11882361"
                     /translation="MYTLVQPLIDFLAYLLAMLYEWTQDWGLALLLLTFGVRLLLVRF
                     NLNAGRQQVRTAAAQPELAKLRDTHGSDLAELVRHTSEVNRKYGIRPLAPFAAALLQA
                     PLLMAMYGLFLTHGSTMTTVLLPWMAGLGTADPLHLLPLAAGLLSAAAGLIPLADVPS
                     LGSAFTATGARLVLGSLLLLVPLAVTWTAPAAVALYWTAGSAFALLERLFYRTAPGRR
                     LLHRGLPAAVRPLT"
     misc_feature    437047..437613
                     /locus_tag="PM3016_367"
                     /note="60Kd inner membrane protein; Region: 60KD_IMP;
                     cl00489"
                     /db_xref="CDD:260457"
     gene            complement(437768..438517)
                     /locus_tag="PM3016_368"
                     /db_xref="GeneID:11882362"
     CDS             complement(437768..438517)
                     /locus_tag="PM3016_368"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310493.1"
                     /db_xref="GI:379718362"
                     /db_xref="GeneID:11882362"
                     /translation="MKRTASFFLLLTVTVLCVWGALASGAGANRDLERLLPLSLDVID
                     GPVRVVVKHISPYKPHAGEAAFLETGRRLSERLGLPPAELRSGGDHILYKASGPDSGG
                     IRRTLLWVMFPDGSTELIVSAETPESGDTGTGGEAASRMEEAQTKLSRVLEGMGVTPN
                     WNVIVQGKLKADYASPDKLNGWLQAELRAEAVESYDDGRSVSVSYASPLLEASVQSGG
                     RMLNLQAAVHRSSETGESRLTLGTPVITTEY"
     misc_feature    complement(437771..>437992)
                     /locus_tag="PM3016_368"
                     /note="Protein of unknown function (DUF1779); Region:
                     DUF1779; pfam08680"
                     /db_xref="CDD:254970"
     gene            438723..439226
                     /locus_tag="PM3016_369"
                     /db_xref="GeneID:11882363"
     CDS             438723..439226
                     /locus_tag="PM3016_369"
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite AtP-independent periplasmic
                     transporter subunit DctQ"
                     /protein_id="YP_005310494.1"
                     /db_xref="GI:379718363"
                     /db_xref="GeneID:11882363"
                     /translation="MQQLKRIALWFDSLLENLAQIALLSMILIVTVQVLTRKLFNYVL
                     PWSEEVTLLLLVWFAFIGIAIGFRERLHLAIDSFTAKLPPLANKVLDKVIYAVTLAFG
                     FYLVVSGTEFTQLMHESRLAATGLPNSIIYVIMPITGVLVCIYSFLQLIGMDTVRHKG
                     MDEGGGH"
     misc_feature    438732..439175
                     /locus_tag="PM3016_369"
                     /note="TRAP-type C4-dicarboxylate transport system, small
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctM; COG3090"
                     /db_xref="CDD:225632"
     gene            439228..440532
                     /locus_tag="PM3016_370"
                     /db_xref="GeneID:11882364"
     CDS             439228..440532
                     /locus_tag="PM3016_370"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter subunit DctM"
                     /protein_id="YP_005310495.1"
                     /db_xref="GI:379718364"
                     /db_xref="GeneID:11882364"
                     /translation="MEETTIAVLVLSISFVVMLLLRFPVSLTLAVSTLLTVMYLEIPL
                     AVVGQRMIQGMSSYSLLTIPFFILAGHIMSEGNLALRIVNLAQLFVGRVRGGLAMVNS
                     VACMFFGNISGSAVADVSSIGSVMIPMMKKKGYDTDYSVGVTVSSAIQGVVVPPSHNL
                     VLYSLAAGGGISITSLFLAGIVPGIILCLSLMLTSYVFAVKRGYAKGDPIDRKDVPKI
                     LLDGFMSILTAVIILGGIFSGWFTATESGALACLYAFILTFVIYKDIPYSRMWLILKK
                     TFRTVSMVLFLIAASDAFSWLLAFLKIPAMVTDAMISISDSPFVILLIINLLLLLLGA
                     PMDMAPLILIMTPILLPVVTHLGMDPVHFGIIMMLNLGIGLLTPPVGTVLFVGCAIGK
                     ISISEGTKAMMPFFYVLCVVLLVLTYLPGLVMWLPNLVQGTG"
     misc_feature    439264..440493
                     /locus_tag="PM3016_370"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     misc_feature    439378..440520
                     /locus_tag="PM3016_370"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; COG1593"
                     /db_xref="CDD:224509"
     gene            440606..441634
                     /locus_tag="PM3016_371"
                     /db_xref="GeneID:11882365"
     CDS             440606..441634
                     /locus_tag="PM3016_371"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter subunit DctP"
                     /protein_id="YP_005310496.1"
                     /db_xref="GI:379718365"
                     /db_xref="GeneID:11882365"
                     /translation="MKTLKKTVTVLSALAIAGGLLAGCGAKETAGGTEGEKKAEGKKY
                     TFRLADTHPADYPTVIGDKKFAELVNERTNGRIKIDVFPGAQLGEEKAVLEQVQLGAI
                     EFTRVSSGPLGEFSKGFGVFSLPYVFDSDQHLWKFLESEAGNKMLDSLEGAKMKGLAY
                     YSSGARSFYSRKPIASLADLKGQKIRVIQNKINIDLVAALGGSATPMPYGEVFSSLQT
                     GVIDAAENNFPSYQSSNHFEVAKNMILDGHQRVPEVLLISQTAWNKLGEEDRKILKQA
                     ALDSVKTQREAWDKYEKEAEAKVRAAGATITEVKDLKPWQDAVKPVIEKYRADYKEAL
                     DAIDAARK"
     misc_feature    440615..441631
                     /locus_tag="PM3016_371"
                     /note="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component [Carbohydrate transport and
                     metabolism]; Region: DctP; COG1638"
                     /db_xref="CDD:224553"
     gene            441999..443933
                     /locus_tag="PM3016_372"
                     /db_xref="GeneID:11882366"
     CDS             441999..443933
                     /locus_tag="PM3016_372"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_005310497.1"
                     /db_xref="GI:379718366"
                     /db_xref="GeneID:11882366"
                     /translation="MSMRIGQWMDRIQRYGLLRDKPLTLRLFVFSALLVAVPLVLVGL
                     ISYQRSADVLESEGRESSLQIIEQVKSHIEYYVRDFEITTLGIVNHPDVTRLLRMRTA
                     EEIQQSGIRPAVVQMLKNASYSRSDISNITLVLDGRQTFDTAGVRSPYPADELRKEYW
                     YADVPLQGTPKLISRVIRWPDGRQEQVFSIVRRLMSPQTLEPAGMLIMDVNFKRIQEI
                     SEMVSIGRTGFLYMVDAQNHYVYHPDLSLVGTPAEPGHTGQMTEESGALITGDKPSLF
                     LTYSLSPYLGWRLVTVLPYKELTDGTDYIGRTILWTLIIALTAAYLLGIGFAASLVGP
                     IRRLQAYMRRVEVGDFSVKLEVRSKDEIGLLTHGFNKMVERLESLLEEIYFSRLKETE
                     ASLRQKESELKVLQSQLNPHFLYNSLETIRGMALDQDMDDIASMSGALAKLLRYNLKN
                     DRPVVTLREELLFCRMYLRVQQYRFEDRLDSEFDVPDWALELPVVKFALQPIVENSII
                     HGMEPGAAPMRIRISARRDGDASFLVAVEDTGVGMPVEVLSRIRLDLEQKDVLAGGDH
                     IGVANVHRRIVYVYGEAYGGRIDSREGGGTTVTLRFPAEARRQADTDEGLSPLRKAGL
                     PLSSPEQKGGSDSVQRAVGG"
     misc_feature    <442608..442748
                     /locus_tag="PM3016_372"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:251508"
     misc_feature    442821..443831
                     /locus_tag="PM3016_372"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    442989..443129
                     /locus_tag="PM3016_372"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(442989..442994,443001..443006,443010..443015,
                     443022..443027,443031..443033,443079..443084,
                     443088..443093,443100..443105,443109..443114,
                     443121..443126)
                     /locus_tag="PM3016_372"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    443199..443447
                     /locus_tag="PM3016_372"
                     /note="Histidine kinase; Region: His_kinase; pfam06580"
                     /db_xref="CDD:253806"
     misc_feature    443490..443804
                     /locus_tag="PM3016_372"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(443499..443501,443511..443513,443520..443522,
                     443604..443606,443610..443612,443616..443618,
                     443622..443627,443694..443705,443766..443768,
                     443781..443786,443790..443792)
                     /locus_tag="PM3016_372"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    443511..443513
                     /locus_tag="PM3016_372"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(443616..443618,443622..443624,443694..443696,
                     443700..443702)
                     /locus_tag="PM3016_372"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            443908..444648
                     /locus_tag="PM3016_373"
                     /db_xref="GeneID:11882367"
     CDS             443908..444648
                     /locus_tag="PM3016_373"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005310498.1"
                     /db_xref="GI:379718367"
                     /db_xref="GeneID:11882367"
                     /translation="MYSVLLVDDEKWVRTSLRKVIERTGLPFEVAREASHGLEALDIL
                     KEAPVDMVLTDVRMPVMNGMSFVQQLRQTAREQSVIVVSGYDDFAYVQGALRLGVTDY
                     LLKPVEVEEMRACLEGWLQARAGGQAAGAPKASCDPADRSPVEQVLGYIREHLGGELT
                     LTEAAARVHLNPSYLSQLFKQQLGRGFVEHIVEMRMEEAKRLLAATSLRVSEVAQRVG
                     YTDVAYFSNTFKRSAGCTPTEYRRCPPA"
     misc_feature    443911..>444261
                     /locus_tag="PM3016_373"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    443920..444267
                     /locus_tag="PM3016_373"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(443929..443934,444070..444072,444094..444096,
                     444154..444156,444211..444213,444220..444225)
                     /locus_tag="PM3016_373"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    444070..444072
                     /locus_tag="PM3016_373"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(444079..444084,444088..444096)
                     /locus_tag="PM3016_373"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    444220..444228
                     /locus_tag="PM3016_373"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    444358..444480
                     /locus_tag="PM3016_373"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    444379..444630
                     /locus_tag="PM3016_373"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    444520..444633
                     /locus_tag="PM3016_373"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            444913..445329
                     /locus_tag="PM3016_374"
                     /db_xref="GeneID:11882368"
     CDS             444913..445329
                     /locus_tag="PM3016_374"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sensor/response regulator hybrid"
                     /protein_id="YP_005310499.1"
                     /db_xref="GI:379718368"
                     /db_xref="GeneID:11882368"
                     /translation="MHAGYTARRAKAPAACEVLIVEDDNISRRVLHTILAQLGFGHID
                     MEDNGEAAVSAAAAKRYDLIFMDLRLPVLDGLSAARRIMADCEGQRPVMIAVTTNTLP
                     EIKQQCMAAGMADYIIKPYYKATLVEVLDHYFPVVL"
     misc_feature    444967..445314
                     /locus_tag="PM3016_374"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(444976..444981,445111..445113,445135..445137,
                     445201..445203,445258..445260,445267..445272)
                     /locus_tag="PM3016_374"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    445111..445113
                     /locus_tag="PM3016_374"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(445120..445125,445129..445137)
                     /locus_tag="PM3016_374"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    445267..445275
                     /locus_tag="PM3016_374"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            445394..446461
                     /locus_tag="PM3016_375"
                     /db_xref="GeneID:11882369"
     CDS             445394..446461
                     /locus_tag="PM3016_375"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin B12-binding domain-containing protein"
                     /protein_id="YP_005310500.1"
                     /db_xref="GI:379718369"
                     /db_xref="GeneID:11882369"
                     /translation="MPAHTEAGVLLLDMAEQLADQVTERQYSLQPDLIQRFGPAGRER
                     TKQDTVFSLKYLAESLMMDSPSLFVHYITWLKALLEGYKVGVKEIEVNLACLREEVCL
                     SIGGEHQEHVTRFLDIGLHQLALPADVPPFIAADAPYGAEAAEYLRILLEGRRQEASR
                     LIMELVEAQTPLADIYLHIFQPVQYEIGRLWQTGGINVAQEHYCTAATQLIMSQLYPY
                     LFGSERKDRRLVATCVGDEIHEVGLRMVADLFEAEGWDTYYLGANVPARSIIQTVISQ
                     QAHMVAISATMTYHVHLVKKLIEQIRASEGCRGVKIIVGGLPFNIDPQLWIQVGADGC
                     SRNAGEAVRMAAGLLREIPAS"
     misc_feature    445814..446044
                     /locus_tag="PM3016_375"
                     /note="B12 binding domain; Region: B12-binding_2;
                     pfam02607"
                     /db_xref="CDD:251412"
     misc_feature    445820..446446
                     /locus_tag="PM3016_375"
                     /note="Predicted cobalamin binding protein [General
                     function prediction only]; Region: COG5012"
                     /db_xref="CDD:227345"
     misc_feature    446072..446428
                     /locus_tag="PM3016_375"
                     /note="B12 binding domain; Region: B12-binding; pfam02310"
                     /db_xref="CDD:251215"
     misc_feature    order(446237..446245,446249..446257,446342..446344,
                     446396..446398,446405..446407,446414..446416)
                     /locus_tag="PM3016_375"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239016"
     gene            446478..448193
                     /locus_tag="PM3016_376"
                     /db_xref="GeneID:11882370"
     CDS             446478..448193
                     /locus_tag="PM3016_376"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310501.1"
                     /db_xref="GI:379718370"
                     /db_xref="GeneID:11882370"
                     /translation="MTTIGEPEEAQRLRETIARLSDELIRSKQREDAALTEFSVMNNE
                     LITLQRLLAKTNAQLKTAKEEAERANAAKSDLLAMISHEIRTPLSGIMGMSELLGLSG
                     KAAEARQELALIRSSAALLLTIAHDLLDLSRMEAGKLTLVSRPFRLREVLLHVVELLT
                     PSAVSNGTALLQQVEERIAPVLVGDADRIRQVLINLAGNAIKFTPGGTVTIRVDLLGG
                     GAGEQRIAMEIRDTGRGIPQEKLSELFQPYYQAHDASSADMPKGTGLGLSITKRIVEL
                     MGGTIAVQSVLGEGSTFRVELPLPVGENSGRADEPDSGPADLPQRAAVKREIAVLLAE
                     DDAISRQVILMQLQKLGLSRITTAGSGTEAVEACARGTFDIILMDHHMPGMNGSEAVR
                     AIRLQEAAAGRPRIPILSLSGSTLGRAGESRVLGSELDDALMKPFTLKALREALEKWV
                     PAFRPEPQPELLEQEVLAELLELDPSRALLRQLVADYLADTPGRLQRLKEAADRGSHE
                     EIARLAHSLKSGSVTLGLRPLSDLLHTLEEEAREGQPSGKLACLVSGVLAEYERADTV
                     LRQLV"
     misc_feature    446685..446876
                     /locus_tag="PM3016_376"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(446703..446705,446715..446717,446727..446729,
                     446736..446738,446748..446750,446757..446759,
                     446817..446819,446826..446828,446838..446840,
                     446847..446849,446859..446861)
                     /locus_tag="PM3016_376"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    446721..446723
                     /locus_tag="PM3016_376"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    447042..447368
                     /locus_tag="PM3016_376"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(447060..447062,447072..447074,447081..447083,
                     447162..447164,447168..447170,447174..447176,
                     447180..447185,447267..447278,447324..447326,
                     447330..447332,447345..447350,447354..447356)
                     /locus_tag="PM3016_376"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    447072..447074
                     /locus_tag="PM3016_376"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(447174..447176,447180..447182,447267..447269,
                     447273..447275)
                     /locus_tag="PM3016_376"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    447468..447824
                     /locus_tag="PM3016_376"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(447477..447482,447612..447614,447636..447638,
                     447711..447713,447771..447773,447780..447785)
                     /locus_tag="PM3016_376"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    447612..447614
                     /locus_tag="PM3016_376"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(447621..447626,447630..447638)
                     /locus_tag="PM3016_376"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    447780..447788
                     /locus_tag="PM3016_376"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    447918..448181
                     /locus_tag="PM3016_376"
                     /note="Histidine Phosphotransfer domain, involved in
                     signalling through a two part component systems in which
                     an autophosphorylating histidine protein kinase serves as
                     a phosphoryl donor to a response regulator protein; the
                     response regulator protein is...; Region: HPT; cd00088"
                     /db_xref="CDD:238041"
     misc_feature    order(448020..448022,448029..448034,448077..448079,
                     448086..448088)
                     /locus_tag="PM3016_376"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    448020..448022
                     /locus_tag="PM3016_376"
                     /note="active site"
                     /db_xref="CDD:238041"
     gene            complement(448249..448530)
                     /locus_tag="PM3016_377"
                     /db_xref="GeneID:11882371"
     CDS             complement(448249..448530)
                     /locus_tag="PM3016_377"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310502.1"
                     /db_xref="GI:379718371"
                     /db_xref="GeneID:11882371"
                     /translation="MTLAGKALGLLAIFIIFRTLLAWTIRFLDKRCRLRPSTLHFILA
                     AAGTVPLVHLVQSAVQGRAAMSLTVMPALLILYTVIKGLWVRKQEESAL"
     gene            complement(448795..449469)
                     /locus_tag="PM3016_378"
                     /db_xref="GeneID:11882372"
     CDS             complement(448795..449469)
                     /locus_tag="PM3016_378"
                     /codon_start=1
                     /transl_table=11
                     /product="PelA protein"
                     /protein_id="YP_005310503.1"
                     /db_xref="GI:379718372"
                     /db_xref="GeneID:11882372"
                     /translation="MKMKKVASMMLSVGLVSSVFAALPAQAATITVNSTIVVAAGQTF
                     DGAGNTYVANASTLGDGSQAEGQKPVFRVEAGGTLKNVNLGAPAADGVHCYGSCNITN
                     VNWQDVGEDALTLKSSGTVNITGGSAYKAYDKVFQANAAGTFNIKNFRANDIGKLVRQ
                     NGGTTFKVVMNVDSSDISNVKDSILRTDSPVSTGSITNTRYSSVPTLFKGFASGNTYQ
                     SGNTKY"
     misc_feature    complement(448801..449367)
                     /locus_tag="PM3016_378"
                     /note="Pectate lyase; Region: Pectate_lyase; pfam03211"
                     /db_xref="CDD:251801"
     gene            450241..450459
                     /locus_tag="PM3016_379"
                     /db_xref="GeneID:11882373"
     CDS             450241..450459
                     /locus_tag="PM3016_379"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310504.1"
                     /db_xref="GI:379718373"
                     /db_xref="GeneID:11882373"
                     /translation="METPKNTERMRQRVNRDHPEQYPTDKPSLFDLYESEQTVDAIPV
                     EDLTLEQQEEKNGEETKHRSSSERKYHP"
     gene            450892..451422
                     /locus_tag="PM3016_380"
                     /db_xref="GeneID:11882374"
     CDS             450892..451422
                     /locus_tag="PM3016_380"
                     /codon_start=1
                     /transl_table=11
                     /product="DoxX family protein"
                     /protein_id="YP_005310505.1"
                     /db_xref="GI:379718374"
                     /db_xref="GeneID:11882374"
                     /translation="MLTRFLRDNVYAAGLLMVLRLYLGYQWFTAGLHKLTGGFDAAGF
                     LKGAIAKPVLDKATNELVYPTFTAFLQHFALPNVKLINFLIPVGETLVGLGLILGALT
                     TAAAFFGLMMNFMFLFAGTVSTNPWLILLGVIVLMAGTNAGRFGVDHYLMPFLRKLRR
                     QGGHEAGRGNGTAAKV"
     misc_feature    450892..451344
                     /locus_tag="PM3016_380"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            complement(451525..452211)
                     /locus_tag="PM3016_381"
                     /db_xref="GeneID:11882375"
     CDS             complement(451525..452211)
                     /locus_tag="PM3016_381"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein TerC"
                     /protein_id="YP_005310506.1"
                     /db_xref="GI:379718375"
                     /db_xref="GeneID:11882375"
                     /translation="MDLFSPEFWSALGAIIIIDLILAGDNAIVIGMASKDLPKEHQKK
                     AIYWGTAGAIIIRIIFTLVAVWLLQVPGLLLIGGLALVWIAYKLLADDKGHDNIKATT
                     SLKEAIRTIIIADAVMGIDNVLAVAGAAHGSFLLVVLGLIISVPIVVWGSTIILKLIE
                     RFPVIVYIGTAVLAMTAGKMITDEPLLKGFIGENDVLKWGIIIAIIAVVLLAGYAAKK
                     KQGGHHPQTG"
     misc_feature    complement(451660..452139)
                     /locus_tag="PM3016_381"
                     /note="integral membrane protein, YjbE family; Region:
                     R_switched_YjbE; TIGR03717"
                     /db_xref="CDD:163429"
     gene            complement(452731..454155)
                     /locus_tag="PM3016_382"
                     /db_xref="GeneID:11882376"
     CDS             complement(452731..454155)
                     /locus_tag="PM3016_382"
                     /codon_start=1
                     /transl_table=11
                     /product="Ricin B lectin"
                     /protein_id="YP_005310507.1"
                     /db_xref="GI:379718376"
                     /db_xref="GeneID:11882376"
                     /translation="MKSKSLLKVLTAASLIVSAMPLMSASAADPALVPYNLTGFSAGN
                     TGGGSIPETDTARYKKVYNAADLAAALKRGSGVKVVEIMNDLNLGWNELPAEAKISPF
                     TAHSTPLTHPVLKTTGVSKLTVDGFNGLTIFSANGAKIKHGAFVFKRSSNVIIRNLEF
                     DELWEWDEYTKGDYDKNDWDYVTLEENSKVWIDHCKFNKAYDGLVDVKKGTNGVTISW
                     STFKGDDGSAGSWVRKQIDAMEANPSAYPMYAYLRSSAIGLTKEDIIAVAASQKKGHL
                     VGATEFDSLNPNLQVTLHHNYYKDIQDRMPRLRGGNAHAYNIVMDSAAAYAAKKKITT
                     AMETALKSKGYKFGVTSNGAISTEGGAVLVEKSEIIDVASPVRNNQTDPADSSYTGKI
                     RVLDTLYSLNGTSFRGGSDTSGSPLAPVPAPVIAFSWNGFSTLPYSYTAEDPATLKAR
                     LTASNGAGAGKLIWSKDNWLKTSY"
     misc_feature    complement(452767..454131)
                     /locus_tag="PM3016_382"
                     /note="Pectate lyase [Carbohydrate transport and
                     metabolism]; Region: PelB; COG3866"
                     /db_xref="CDD:226384"
     misc_feature    complement(453205..453798)
                     /locus_tag="PM3016_382"
                     /note="Pectate lyase; Region: Pec_lyase_C; cl01593"
                     /db_xref="CDD:261009"
     gene            454643..455897
                     /locus_tag="PM3016_383"
                     /note="pectate lyase H"
                     /pseudo
                     /db_xref="GeneID:11882377"
     gene            456181..457482
                     /locus_tag="PM3016_385"
                     /db_xref="GeneID:11882378"
     CDS             456181..457482
                     /locus_tag="PM3016_385"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310508.1"
                     /db_xref="GI:379718377"
                     /db_xref="GeneID:11882378"
                     /translation="MLRIILFYVPMGTSALLAALTHVIINGVLARSANPDVTISSYAV
                     ALSLSFLIDLPMNIIRQTSSKYSRDRISFKSVARLTAIVSGALVAISAAIGWTPAGEL
                     LFRYVFGVKESLLEPTIGVYQVLAFMYVFTALRSLFQGVIINQLRTGWMTVGMAVRVA
                     VMFAMSWFFIREGMTHDGRIGAWIFVVGLIIECIVAVWEGMALRRGLPPAREEQTVGK
                     VGQLLPFYLPLLYSSMVLVLLNPSIQAALNKSMDPTLAVAAYAVAIQLANMVAWFCAS
                     VHQIVIQFYEDERRSVLLVVTCLSILSPALLLGVSSPLGGPLLEGLLGLHGPLLAEVR
                     HLLLFLSVQALLFPWIDFVAGKCMMLGRTKAIMASKMVSVGLSLGLLLLLVYTAPGLN
                     GLLAGLVTALAAPLELLVIWLWLKRLERRPAPPVLQETKPA"
     gene            457686..458735
                     /locus_tag="PM3016_386"
                     /db_xref="GeneID:11882379"
     CDS             457686..458735
                     /locus_tag="PM3016_386"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310509.1"
                     /db_xref="GI:379718378"
                     /db_xref="GeneID:11882379"
                     /translation="MSEQEAKSLLSLLFAHDGYSAEMHESLKKSLLEMSKKRTEVDYV
                     KIRHIHIALGDSPGGSLKIALKAPEGRKPEHRVLVLRDALPFSVGPLWKLEEEEGREE
                     RRRWCMLHINMDDRDEYLLQGEEQFLEMRSRLEGIPESLPVTIWAGSNAHEQAGLRFA
                     VYLLRDKENPVFLMDTTSAYASLHQTDPSYGRRRTGEMNPEELRGIWEMKACCRKLSP
                     EQRQSLESEWLELSGRKTGLRIWRDGRIVEVREDYYDSTLTAVVEQLHRERNNQEWIR
                     SARVVGEMIGHLEQDIGDEYVEYRLRHLIYHGVLEIQGVPRGMRYDDVRMKQPLTGLE
                     QRGGTEDHEEYVENL"
     misc_feature    457830..458219
                     /locus_tag="PM3016_386"
                     /note="Domain of unknown function (DUF1835); Region:
                     DUF1835; pfam08874"
                     /db_xref="CDD:255083"
     misc_feature    458325..458657
                     /locus_tag="PM3016_386"
                     /note="Protein of unknown function; Region: DUF3658;
                     pfam12395"
                     /db_xref="CDD:257022"
     gene            458710..459747
                     /locus_tag="PM3016_387"
                     /db_xref="GeneID:11882380"
     CDS             458710..459747
                     /locus_tag="PM3016_387"
                     /codon_start=1
                     /transl_table=11
                     /product="Leucine-rich repeat protein-like protein"
                     /protein_id="YP_005310510.1"
                     /db_xref="GI:379718379"
                     /db_xref="GeneID:11882380"
                     /translation="MKNMLKIYNDPKGDAYRKLIDYAMKRAAVFALADREIGAEEAPA
                     PGGGRAGALLRRLQPYLIRTCTMGEVRQRNNIGYSPKGTVYVYQCCPEAAEVLKKAAS
                     SMHAWQYPDLPEDLSFWDAEEEDWLVNVAHEEMLYIRLSEEEGRALAEEIPGVFVMGE
                     FNRGLDAFLEDALRHGAEKLELMGWGLEEVPEKLTRMTRLRELQLFEQDIRRLPPALF
                     GLRNLESLTVYTADLEEIPGEIGRLENLVQLSVYCCSYDRPHQAEKLIGIDEVTLSML
                     PPEIGELSKLEILRINATGLKRVPPELAKLKNLRVLDLGRNKLEAVPQELLEQLPNLV
                     HTSFEGNPFGE"
     misc_feature    459559..459738
                     /locus_tag="PM3016_387"
                     /note="Leucine rich repeat; Region: LRR_8; pfam13855"
                     /db_xref="CDD:258126"
     misc_feature    459562..459681
                     /locus_tag="PM3016_387"
                     /note="Leucine Rich repeats (2 copies); Region: LRR_4;
                     pfam12799"
                     /db_xref="CDD:257306"
     misc_feature    459628..>459738
                     /locus_tag="PM3016_387"
                     /note="Leucine Rich repeats (2 copies); Region: LRR_4;
                     pfam12799"
                     /db_xref="CDD:257306"
     gene            459807..460865
                     /locus_tag="PM3016_388"
                     /db_xref="GeneID:11882381"
     CDS             459807..460865
                     /locus_tag="PM3016_388"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310511.1"
                     /db_xref="GI:379718380"
                     /db_xref="GeneID:11882381"
                     /translation="MVKLKLSRPALFLFLAALILLLDSAAARWNPGASEDRLIAYAVL
                     FDLMLVVPLLYWFLVARPAGKPFLRILPFAALGTFVSWLVLPAALKETAWTVYWPLEL
                     LLIAAEAVILFYEGRLLYRAARRFRELVGEEPDTAERLRRAVREVLGEGVVSSVLLHD
                     ALMLYYVFYTWTKKADVTPSDSKKYSYTYHRNNNQILYAAMLTKILLLETAALHLIVQ
                     TWSTVAAWLLTAADLWLLTLIWADCRASVLQPVRLSAGGLRLRYGLRIQADLPWHRIA
                     SVEGVEWDVRRPEERRAAVLPLFGTPNVRIRLRSPARVQGLLLLPCEVTAIYLSLDEP
                     ERFIREWGLMAQDQGDRL"
     gene            complement(460973..461884)
                     /locus_tag="PM3016_389"
                     /db_xref="GeneID:11882382"
     CDS             complement(460973..461884)
                     /locus_tag="PM3016_389"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-70 subunit"
                     /protein_id="YP_005310512.1"
                     /db_xref="GI:379718381"
                     /db_xref="GeneID:11882382"
                     /translation="MENGTVAEQAYTTYKPLLFSLAYRMLGSVMDAEDIVQDAFLSLD
                     AAGPEPIRNLKAYLCRVVTNRCIDRLRSAQKQREVYVGPWLPEPLLTDGDPSGNPPEQ
                     YMLQESVSTAYLLLLQQLSSTERAVFLLREVLLYDYEEIASIVGKSQANCRQIFHRAK
                     RSIGGSASFDSGGDVCLAAPRPAAGQEARQLIEGFLTALATGDVPKLLSSLSEDASLF
                     SDGGGRVTAAVRPILGADRIIRFLTGLLEKSPPGFSYRPALVGGDPGLVTYIHGEPSS
                     VMSFEVAGGQIRAIYIVVNPEKLQHVR"
     misc_feature    complement(460976..461860)
                     /locus_tag="PM3016_389"
                     /note="RNA polymerase sigma-70 factor, TIGR02957 family;
                     Region: SigX4"
                     /db_xref="CDD:132002"
     misc_feature    complement(461657..461854)
                     /locus_tag="PM3016_389"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(461396..>461515)
                     /locus_tag="PM3016_389"
                     /note="Sigma-70, region 4; Region: Sigma70_r4_2;
                     pfam08281"
                     /db_xref="CDD:203898"
     misc_feature    complement(order(461405..461407,461411..461416,
                     461420..461428,461432..461437,461441..461443,
                     461471..461476,461492..461494))
                     /locus_tag="PM3016_389"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     misc_feature    complement(461015..461311)
                     /locus_tag="PM3016_389"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            complement(461965..463278)
                     /locus_tag="PM3016_390"
                     /db_xref="GeneID:11882383"
     CDS             complement(461965..463278)
                     /locus_tag="PM3016_390"
                     /codon_start=1
                     /transl_table=11
                     /product="phytoene dehydrogenase enzyme"
                     /protein_id="YP_005310513.1"
                     /db_xref="GI:379718382"
                     /db_xref="GeneID:11882383"
                     /translation="MNPMEKNTYETAVIGGGLAGLLAAVMLGKAGQKVVLLEQSPRLG
                     GRAMTVERGGALFNLGGHALYRDGEAYAMLQELGLRLPGGSPPASGFAIWQGRVVPLP
                     GDPLKLLSSRLLSWSGKMEFGRLMLGLSKIDTTSLPRISLREWAEREVRDPMVRHIFY
                     ALCRTSTYSRDIDHQPAGPVLLQLQRSMKGGVLYLDGGWQTIVDQLRELAVKAGVTFA
                     EGQAVEEILHDDGQVSGIRLKGGGTLRVSAVLAAVSPASLFHLVRGAEETVLRRWKDE
                     ARPVKAACLDLALKRLPSPGRHFALGLDQPVFFSHHSRVAKLSRNGTLVVHMIKYGGG
                     DSDPQADEKLLEQTMSLLHPGWQNETAARQFLPNITVVHDAVHLGHSGPYPGPEVPGL
                     AGLYAAGDWASHGEMLADAAAASAGRAVRKLLQDSRHGVRLEALV"
     misc_feature    complement(462055..463221)
                     /locus_tag="PM3016_390"
                     /note="Phytoene dehydrogenase and related proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG1233"
                     /db_xref="CDD:224154"
     misc_feature    complement(463048..463221)
                     /locus_tag="PM3016_390"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     gene            463619..464086
                     /locus_tag="PM3016_391"
                     /db_xref="GeneID:11882384"
     CDS             463619..464086
                     /locus_tag="PM3016_391"
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="YP_005310514.1"
                     /db_xref="GI:379718383"
                     /db_xref="GeneID:11882384"
                     /translation="MIREAAGGDADRLAGFYRELAPSSRNVNVLPERVEQIRRDPNNF
                     LFIYEEEGIPLGTVFLTLCMDPAYEFRPYGVIEYMFVAESARGRGIGSALLEHAERLC
                     AAKHCTRVSLMSGSERTEAHRFYESRGYKGSASKAFKKYIRVTPVNWPEQPPS"
     misc_feature    463643..464008
                     /locus_tag="PM3016_391"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    463751..463954
                     /locus_tag="PM3016_391"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(463853..463861,463889..463894)
                     /locus_tag="PM3016_391"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(464280..464957)
                     /locus_tag="PM3016_392"
                     /db_xref="GeneID:11882385"
     CDS             complement(464280..464957)
                     /locus_tag="PM3016_392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310515.1"
                     /db_xref="GI:379718384"
                     /db_xref="GeneID:11882385"
                     /translation="MTTQADLKHEILKAYEFRHACKEFDAGRQIPDEDFEFILETGRL
                     SPSSFGFEPWKFVVVQSPELRAKLLPVSWGAQGQLSTASHFVLLLSRTKEDLLAGSAY
                     LQNLMENIHHMPDNVVEMLSGFYKNFQENTYKLLDDDRYLQDWAGKQAYIALGNMLTA
                     AAQIGIDSCPIEGFDPEGVSKILEEEGILENGRYALTVMAAFGYRKNEPRPKTRQSLD
                     SVVQWIR"
     misc_feature    complement(464298..464930)
                     /locus_tag="PM3016_392"
                     /note="NAD(P)H:FMN oxidoreductase family. This domain
                     catalyzes the reduction of flavin, nitrocompound, quinones
                     and azo compounds using NADH or NADPH as an electron
                     donor. The enzyme is a homodimer, and each monomer binds a
                     FMN as co-factor. This family...; Region:
                     NfsB_like_nitroreductase; cd02149"
                     /db_xref="CDD:239062"
     misc_feature    complement(order(464298..464303,464307..464321,
                     464325..464327,464442..464444,464466..464468,
                     464481..464483,464490..464495,464502..464507,
                     464511..464516,464523..464528,464778..464795,
                     464802..464804,464808..464810,464814..464816,
                     464823..464831,464841..464843,464922..464927))
                     /locus_tag="PM3016_392"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239062"
     misc_feature    complement(order(464316..464318,464322..464324,
                     464439..464444,464448..464450,464724..464726,
                     464892..464894,464898..464906))
                     /locus_tag="PM3016_392"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239062"
     gene            465209..465883
                     /locus_tag="PM3016_393"
                     /db_xref="GeneID:11882386"
     CDS             465209..465883
                     /locus_tag="PM3016_393"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310516.1"
                     /db_xref="GI:379718385"
                     /db_xref="GeneID:11882386"
                     /translation="MQYHQITEINDKHFRAMHELMGRVFPPEEVLEYDLWAEPLQDPG
                     IRVFVAVLDGEVVGATEYRYYEDLGVAMTDFTIIGRDAIGVGPFLAGQRMEDLRKVVA
                     ASGGTLQGMFAEIYNPYLSEKLEFGGVKAMNPFVRREVLAHLGYRKLDFDYVHPSWHN
                     DGEAVHGLDLCFMPIADAKQADVPAELVSTFLERYYAVLPQKPQAWYTMVEGLKGRER
                     VGLKAI"
     gene            complement(466029..466691)
                     /locus_tag="PM3016_394"
                     /db_xref="GeneID:11882387"
     CDS             complement(466029..466691)
                     /locus_tag="PM3016_394"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310517.1"
                     /db_xref="GI:379718386"
                     /db_xref="GeneID:11882387"
                     /translation="MPSRKKELLVSFDPPAAAGPSGAAGGDAATAAESAAPKKSAAAR
                     HRRSASALKAEAAARAVAASEEPAETALLAAAAGITAAEAEAAADSGTVAETAETAAQ
                     DDPPAVPEAPEAQRAAFAVAASDAPAETAALIASAGGVDAVPETVLQALETRLKKKER
                     KETHEKDRVYLRKDLRERLEALAENRGKGFKTLLLNYGLERALDELEAAEARRRSGTE
                     EE"
     gene            complement(466660..467475)
                     /locus_tag="PM3016_395"
                     /db_xref="GeneID:11882388"
     CDS             complement(466660..467475)
                     /locus_tag="PM3016_395"
                     /codon_start=1
                     /transl_table=11
                     /product="putative partition protein/ATPase"
                     /protein_id="YP_005310518.1"
                     /db_xref="GI:379718387"
                     /db_xref="GeneID:11882388"
                     /translation="MGNVIAVCMNKGGVGKTTLVTHLAAVLASGADPAKVLVVDIDPQ
                     GNAAVVFGRDPDRLERGSTADVLLRGTPLADITVPVSDHLDLAPASDELNGSEVQVLG
                     QPGRYARPLHLLKEAVGRVKKEYDWILIDCPPSLGLLTANAVKAADGVLVPFVPEAFS
                     VKGLQRVVQAIEGLRDEGSPSPRIVGVAATMVDSRSTLHGELLASARAYCAAQGFPML
                     ETVIPRSIRYANAAAYEGRPAVWSDRSHPAVAPYFELTKEVLAHAVPKKRTAR"
     misc_feature    complement(466690..467475)
                     /locus_tag="PM3016_395"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(466906..467466)
                     /locus_tag="PM3016_395"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(467425..467445)
                     /locus_tag="PM3016_395"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(<467128..467439)
                     /locus_tag="PM3016_395"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     misc_feature    complement(order(467083..467085,467425..467427))
                     /locus_tag="PM3016_395"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            467672..468409
                     /locus_tag="PM3016_396"
                     /db_xref="GeneID:11882389"
     CDS             467672..468409
                     /locus_tag="PM3016_396"
                     /codon_start=1
                     /transl_table=11
                     /product="WecB/TagA/CpsF family glycosyl transferase"
                     /protein_id="YP_005310519.1"
                     /db_xref="GI:379718388"
                     /db_xref="GeneID:11882389"
                     /translation="MKQTAKVMGVTFSKDTLAGTVKTIIGHLDKKDADYMHIITCNPE
                     IVMASAHDEELRNILGDAGLVTADGIGIVLASRWLGDPLPERVTGFDILMGLLEEGGR
                     KGYSFYLFGADPETNAKAAEVISAKYPGLRIAGRQHGYYKPEEEGRIIGEIAAAKPDI
                     LVVALGAPRAERWLYRNRAKLPVRAAMGVGGSLDVIAGKVKRAPVIWQKMNLEWLYRL
                     LSEPSRWRRQLVLPKFAVRALFSRGRS"
     misc_feature    467852..468355
                     /locus_tag="PM3016_396"
                     /note="The glycosyltransferase WecG/TagA superfamily
                     contains Escherichia coli WecG, Bacillus subtilis TagA and
                     related proteins. E. coli WecG is believed to be a
                     UDP-N-acetyl-D-mannosaminuronic acid transferase, and is
                     involved in enterobacterial common...; Region:
                     Glyco_transf_WecG_TagA; cd06533"
                     /db_xref="CDD:119439"
     gene            complement(468564..469223)
                     /locus_tag="PM3016_397"
                     /db_xref="GeneID:11882390"
     CDS             complement(468564..469223)
                     /locus_tag="PM3016_397"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310520.1"
                     /db_xref="GI:379718389"
                     /db_xref="GeneID:11882390"
                     /translation="MYDMIAAGGGSLWSYAAMLLLAAVPWVDVFVVIPLGIAWGMNPA
                     GTAVSAFIGNWIPLLLLALFFREFSAWRARRKARKAGRRAAQAEAGLPQAETAGAGEA
                     LPAEAPHGGGSEAPHAVPPPPVQDGAGNGEAVLGTSKKYARAKRIWEKYGVPGLALVA
                     PVLLGTDLAALVALTFGSSRRWVMLWMTVSLVLWTVLLTVGSVYGLGYMGLFRPEAGP
                     T"
     gene            469487..471572
                     /locus_tag="PM3016_398"
                     /note="putative ATP-dependent DNA helicase"
                     /pseudo
                     /db_xref="GeneID:11882391"
     gene            471624..472304
                     /locus_tag="PM3016_400"
                     /db_xref="GeneID:11882392"
     CDS             471624..472304
                     /locus_tag="PM3016_400"
                     /codon_start=1
                     /transl_table=11
                     /product="protein RnhA"
                     /protein_id="YP_005310521.1"
                     /db_xref="GI:379718390"
                     /db_xref="GeneID:11882392"
                     /translation="MTKSKWYVVWEGRQPGVYKTWAECQAQTSGFPQAKFKAYESEAE
                     AKAMLAAGWKKAFSAAQKAGVSGGAGTAGSRGGGARAAADAARASGTEADLDSLSVDV
                     GCSGNPGIVEYKGVHTRTGEVLFEHAPISKGTNNMGEFLAIVHGLAYLKQKGSSMTIY
                     SDSMTAIAWVRNKKVASTLVRDASTKEIWTLVDRAEEWIRQNTWPNKILKWNTKAWGE
                     IKADYGRK"
     misc_feature    471633..472301
                     /locus_tag="PM3016_400"
                     /note="Predicted double-stranded RNA/RNA-DNA hybrid
                     binding protein [General function prediction only];
                     Region: COG3341"
                     /db_xref="CDD:225878"
     misc_feature    471639..471764
                     /locus_tag="PM3016_400"
                     /note="Caulimovirus viroplasmin; Region: Cauli_VI;
                     pfam01693"
                     /db_xref="CDD:250800"
     misc_feature    471909..472301
                     /locus_tag="PM3016_400"
                     /note="Ribonuclease H-like superfamily, including RNase H,
                     HI, HII, HIII, and RNase-like domain IV of spliceosomal
                     protein Prp8; Region: RNase_H_like; cl14782"
                     /db_xref="CDD:265450"
     misc_feature    order(471924..471935,472026..472031,472038..472040,
                     472107..472109,472251..472253,472299..472301)
                     /locus_tag="PM3016_400"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:259998"
     misc_feature    order(471924..471926,472107..472109)
                     /locus_tag="PM3016_400"
                     /note="active site"
                     /db_xref="CDD:259998"
     gene            472451..472684
                     /locus_tag="PM3016_401"
                     /db_xref="GeneID:11882393"
     CDS             472451..472684
                     /locus_tag="PM3016_401"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310522.1"
                     /db_xref="GI:379718391"
                     /db_xref="GeneID:11882393"
                     /translation="MNPYLGTWIQRASSATDHLPWGRWFLYFLIRGGTELETLKIEEI
                     IRQLGIAEERFAKWCEELEMERPDSSEDGQAET"
     gene            complement(472797..473408)
                     /locus_tag="PM3016_402"
                     /db_xref="GeneID:11882394"
     CDS             complement(472797..473408)
                     /locus_tag="PM3016_402"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310523.1"
                     /db_xref="GI:379718392"
                     /db_xref="GeneID:11882394"
                     /translation="MISIDPQQQSDRENYKLLIGSIVPRPIALVTTLSQEGVLNAAPF
                     SYFNIVASQPPLVSVSVQRKQGERKDTARNAADTGSFVIHITDESIVEKANKTAAALP
                     PGESEVERAGLTPVASDAIPVPGLQEARIRMECVLEQAIELGGTGGVPACDLLIGRVV
                     RFHLDEELYDRGHIDPEKLQPVARMAGNFYSRLGTLFELERPE"
     misc_feature    complement(472836..473378)
                     /locus_tag="PM3016_402"
                     /note="Conserved protein/domain typically associated with
                     flavoprotein oxygenases, DIM6/NTAB family [General
                     function prediction only]; Region: COG1853"
                     /db_xref="CDD:224766"
     gene            complement(473405..474028)
                     /locus_tag="PM3016_403"
                     /db_xref="GeneID:11882395"
     CDS             complement(473405..474028)
                     /locus_tag="PM3016_403"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MhqD"
                     /protein_id="YP_005310524.1"
                     /db_xref="GI:379718393"
                     /db_xref="GeneID:11882395"
                     /translation="MKHIYQQGSRPEAPTLVLFHGTGGTEHDLLGLAGRIAPGAAVLS
                     LRGNVLENGMPRFFRRLAEGVFDEEDLIFRTKEVYDFLDEAAAKYGFDRNHLVAVGYS
                     NGANIIGSLLFHYARAFRGAILHHPMVPRRGIELPDASGLPVFIGAGKNDPICTPQET
                     EDLQALLSGAGADVTVHWESYGHQLTPSEAAAASSWFAEHFGGGDSR"
     misc_feature    complement(473429..474013)
                     /locus_tag="PM3016_403"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     misc_feature    complement(473432..473998)
                     /locus_tag="PM3016_403"
                     /note="Predicted esterase [General function prediction
                     only]; Region: COG0400"
                     /db_xref="CDD:223477"
     gene            complement(474025..474969)
                     /locus_tag="PM3016_404"
                     /db_xref="GeneID:11882396"
     CDS             complement(474025..474969)
                     /locus_tag="PM3016_404"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MhqO"
                     /protein_id="YP_005310525.1"
                     /db_xref="GI:379718394"
                     /db_xref="GeneID:11882396"
                     /translation="MKTAGIHHITAFARDPQQNVDFYAGVLGLRLVKKTINFDAPEVY
                     HLYFGNEAGSPGTIITFFPWPNSRRGRIGGGQVGITSYAVPAGSLAFWEERLARFGIQ
                     TEKVTRFSETSLQFSDNEGLRLEIVERVEGANSRWSFGGIPGQHAIKGFAGAVLFSTN
                     PARTKDALEQLLGFVKEAEDAGYTRFRSEAGIGNVIDVPHAAMERGSDGAGTVHHIAW
                     RAEDFEHHEAWRTAVQAYGYQPTPVVDRQYFNALYFREAGGILFEIATDPPGFAKDEA
                     PEALGEKVMLPEWYEPHRAQIEANLLPIEVRVLEGDQS"
     misc_feature    complement(474589..474957)
                     /locus_tag="PM3016_404"
                     /note="N-terminal domain of Sphingobium chlorophenolicum
                     2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and
                     similar proteins; Region: PcpA_N_like; cd08346"
                     /db_xref="CDD:211356"
     misc_feature    complement(order(474940..474942,474946..474948))
                     /locus_tag="PM3016_404"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:211356"
     misc_feature    complement(474058..474522)
                     /locus_tag="PM3016_404"
                     /note="C-terminal domain of Sphingobium chlorophenolicum
                     2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and
                     similar proteins; Region: PcpA_C_like; cd08347"
                     /db_xref="CDD:176695"
     misc_feature    complement(order(474181..474183,474325..474327))
                     /locus_tag="PM3016_404"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:176695"
     gene            complement(475097..475504)
                     /locus_tag="PM3016_405"
                     /db_xref="GeneID:11882397"
     CDS             complement(475097..475504)
                     /locus_tag="PM3016_405"
                     /codon_start=1
                     /transl_table=11
                     /product="DoxX family protein"
                     /protein_id="YP_005310526.1"
                     /db_xref="GI:379718395"
                     /db_xref="GeneID:11882397"
                     /translation="MVTLTALGLFLIRLVVGVLFIGHGAQKLFGWFGGYGPKGTGGWM
                     DSIGIKPGVLMAVLAGLMELAGGLLFTLGLLTPLAAVLLAATMLGAIVKVHGANGLWS
                     TSNGYEYPLVLLVVVIGIALTGAGALSLDALLS"
     misc_feature    complement(475100..475504)
                     /locus_tag="PM3016_405"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            complement(475584..476033)
                     /locus_tag="PM3016_406"
                     /db_xref="GeneID:11882398"
     CDS             complement(475584..476033)
                     /locus_tag="PM3016_406"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_005310527.1"
                     /db_xref="GI:379718396"
                     /db_xref="GeneID:11882398"
                     /translation="MPHSVSDAHAASLKLLVVLSKAYKTVMDRAVKDMKQYELSPSEF
                     TILEVLYTKGRIPLQQIGEKILITSGTITYNIDKLEKKGLLKRVPCQEDRRVIYAEMT
                     PAGNELFDRIFPDHADTIHGLMQGLTPEEKETAVELLKKLGKGAEDR"
     misc_feature    complement(475602..475940)
                     /locus_tag="PM3016_406"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(475638..475940)
                     /locus_tag="PM3016_406"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     gene            complement(476259..477251)
                     /locus_tag="PM3016_407"
                     /db_xref="GeneID:11882399"
     CDS             complement(476259..477251)
                     /locus_tag="PM3016_407"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix type 11 domain-containing
                     protein"
                     /protein_id="YP_005310528.1"
                     /db_xref="GI:379718397"
                     /db_xref="GeneID:11882399"
                     /translation="MVSWKKRRHKEGSKLKLDRLLAITMLLLNRRRVSAKELSERFEV
                     SLRTIYRDLEAINGAGIPVASYAGASGGYEIMETYRIERQYLSLEELQSIIVALRGIQ
                     TTLAEPDIDIGSLLDKVGSLVARTASGGTADLRLEMILDLNPWQGGQAEKAKLHLLKQ
                     AIRAQQLISFGYTSSQGEDSARTCEPMGVVLKGYIWYLYGFCRLRTDFRIFRLSRIMD
                     LTLLGETFERRAGELEELRFGWNADYHAKRALLGLVLQFSPRAKAKVQDGFEESEIET
                     RPDGSLLVRCQRPDEPWLYSMLMSYGTDVRVLEPSSVADMLRQKAQEIVRMYGR"
     misc_feature    complement(476265..477206)
                     /locus_tag="PM3016_407"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2378"
                     /db_xref="CDD:225253"
     misc_feature    complement(477033..477185)
                     /locus_tag="PM3016_407"
                     /note="HTH domain; Region: HTH_11; pfam08279"
                     /db_xref="CDD:254705"
     misc_feature    complement(476277..476795)
                     /locus_tag="PM3016_407"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            complement(477402..478634)
                     /locus_tag="PM3016_408"
                     /db_xref="GeneID:11882400"
     CDS             complement(477402..478634)
                     /locus_tag="PM3016_408"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AmpS"
                     /protein_id="YP_005310529.1"
                     /db_xref="GI:379718398"
                     /db_xref="GeneID:11882400"
                     /translation="MSNFQELLSRYAELIVKTGVKIQKGQKLVVNSTIDAAELVRLIT
                     KHAYEEGAYLVKVNWTDDTITRLRYDMAPEESFLEEPKWYAGEMLELAENGAAVVSIT
                     SSDPDLLKGVPQSRIMNHQKTYGKAMHQFRQYMQSDKFSWCVAAAPSKAWAAKVFPGL
                     SEEEQVAKLWEAILRTVRVDREDPVAAWEEHIRHLNAKSDFLNEKKFKKLHYTAPGTD
                     LTIELPEGHLWVAADSINEKGISFLANMPTEEVFTAPRYDGVNGTVSSTKPLSYGGNL
                     IDNFKLTFENGKIVDVSAEQGEDTLRTLIDMDEGARYLGEVALVPHESPISQSGLLFY
                     NTLFDENASNHLAIGSAYAFNLEGGKGLSQEELKARGLNTSITHVDFMIGSAEMDIDG
                     ITADGTTVPLFRKGNWAI"
     misc_feature    complement(477411..478628)
                     /locus_tag="PM3016_408"
                     /note="Thermophilic metalloprotease (M29); Region:
                     Peptidase_M29; pfam02073"
                     /db_xref="CDD:145308"
     gene            complement(478788..480158)
                     /locus_tag="PM3016_409"
                     /db_xref="GeneID:11882401"
     CDS             complement(478788..480158)
                     /locus_tag="PM3016_409"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:neurotransmitter symporter"
                     /protein_id="YP_005310530.1"
                     /db_xref="GI:379718399"
                     /db_xref="GeneID:11882401"
                     /translation="MAQSKLDPNERSLTEQFSRSGFILTAIGSAVGLGNMWKFPYITG
                     KYGGAAFFLLFTICLLVVGLPVLLAELSIGRGGRGNAYSSFVKLSGSKRWGALGFLSV
                     IAAFLIMTFYSVVAGWTLHYAAMSFSGSLFSSTDYTKQFLDFAGGFWPVFWQTVVVLL
                     NIWIVARGISGGIEKFNKILIPGLLILLIILMARSLTLPGAMQGVEFFLKPDFSKLSA
                     ESALVALGHAFFSLSLGMGIMITYGSYIDKRQSLGAATMAVGAGDLLYALVAGLIIFP
                     TSFSFGIEPSQGAGLVFMALPAAFAAMPLGAFFGGLFFILLAIAALTSSVSILEVPVA
                     YAMDKWNWTRSKATWIVALATFVLGVPSALSVGGVLGDVTIIDGKNIMDSADFLASNI
                     LLPLGGLIVTLFVGYKWSAAVQEAGMTPMWLRLWIIVLRYVAPVLVVAILLYTAGALK
                     WIGIGE"
     misc_feature    complement(478827..480110)
                     /locus_tag="PM3016_409"
                     /note="solute carrier 6 subfamily, Fusobacterium nucleatum
                     Tyt1-like; solute-binding domain; Region:
                     SLC6sbd_Tyt1-Like; cd10336"
                     /db_xref="CDD:212043"
     misc_feature    complement(order(479187..479192,479199..479201,
                     480066..480068,480075..480077))
                     /locus_tag="PM3016_409"
                     /note="Na2 binding site [ion binding]; other site"
                     /db_xref="CDD:212043"
     misc_feature    complement(order(479175..479180,479187..479189,
                     479445..479447,479451..479453,479466..479471,
                     479823..479825,480054..480065,480069..480074))
                     /locus_tag="PM3016_409"
                     /note="putative substrate binding site 1 [chemical
                     binding]; other site"
                     /db_xref="CDD:212043"
     misc_feature    complement(order(479370..479372,479466..479468,
                     480054..480056,480069..480071))
                     /locus_tag="PM3016_409"
                     /note="Na binding site 1 [ion binding]; other site"
                     /db_xref="CDD:212043"
     misc_feature    complement(order(479280..479282,479292..479294,
                     479805..479807,479814..479816,479826..479828,
                     480045..480050))
                     /locus_tag="PM3016_409"
                     /note="putative substrate binding site 2 [chemical
                     binding]; other site"
                     /db_xref="CDD:212043"
     gene            480494..482632
                     /locus_tag="PM3016_410"
                     /db_xref="GeneID:11882402"
     CDS             480494..482632
                     /locus_tag="PM3016_410"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor-containing diguanylate
                     cyclase/phosphodiesterase"
                     /protein_id="YP_005310531.1"
                     /db_xref="GI:379718400"
                     /db_xref="GeneID:11882402"
                     /translation="MGHETGREPWEIERSQWLQRVRELEQRERELLQQLRTQENLNSK
                     ILDALPMDIFMEDAEGRTIYANQATYKRNRLTEEELLGRTLYDFFPYEVAERFRRENL
                     EVWRTGRLITSEGTSLVGGDEIYLYTGKTLICPDEQTGEKLLLGFALDITDRVLAEKS
                     LRESEERFRKLVDQAADSFFLMDGSGQFLDVNRQACLSLGYTEEELLTMQAGQISSFP
                     AGELLRLHERVVEEGMIQLEDEFRRKDGTRLPVDIRLGLVQVGDKQMVLALCRDMTER
                     KKAAEKIEHMAYHDALTGLPNRWFVHKRVMECTAGKKGQAKPLAVVMFDLDHFKVIND
                     SLGHKAGDRLLQQVAERLRRELAFADTIARLGGDEFLLLVPGVDTEEEALRAGRSVTG
                     LLKEPFELSGQKISVTASVGIALYPRDGGTMDSLVRSADIAMYRSKELGRNACRLFAP
                     SMKDEAKERLRMEVLLREAIVEKQLVLHYQPKLDLRSGRVYGVEALVRWNSPEQGLVY
                     PGAFIGIAEETGLIVPMGEWIVREACRQCREWLDAGLGPLTVSVNLSARQFAKADLGR
                     KIAAILGETGLPPNLLELELTESTVMGNPEEAARMLQSLKELGVCISIDDFGTGFSSL
                     SYLTRFPIDTLKIDKSFISRLEEEQANGAIAAGIVSLAHSLHLKVVAEGVETQRQLDF
                     LAAKGCDAVQGFHISRGLDPCALEAFLQQR"
     misc_feature    480629..480958
                     /locus_tag="PM3016_410"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    480638..480946
                     /locus_tag="PM3016_410"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(480686..480688,480701..480703,480716..480718,
                     480755..480766,480854..480856)
                     /locus_tag="PM3016_410"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(480746..480748,480758..480760,480782..480784,
                     480803..480808,480875..480877,480881..480883)
                     /locus_tag="PM3016_410"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    480983..481342
                     /locus_tag="PM3016_410"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    481016..481303
                     /locus_tag="PM3016_410"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(481064..481066,481076..481078,481094..481096,
                     481133..481141,481214..481216,481229..481231)
                     /locus_tag="PM3016_410"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(481124..481126,481133..481135,481157..481159,
                     481166..481171,481250..481252,481256..481258)
                     /locus_tag="PM3016_410"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    481355..481831
                     /locus_tag="PM3016_410"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(481466..481468,481595..481597)
                     /locus_tag="PM3016_410"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(481481..481483,481490..481495,481505..481507,
                     481517..481519,481583..481585,481589..481600)
                     /locus_tag="PM3016_410"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(481571..481573,481658..481660)
                     /locus_tag="PM3016_410"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    481889..482587
                     /locus_tag="PM3016_410"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            482989..484812
                     /locus_tag="PM3016_411"
                     /db_xref="GeneID:11882403"
     CDS             482989..484812
                     /locus_tag="PM3016_411"
                     /codon_start=1
                     /transl_table=11
                     /product="protein ThiC"
                     /protein_id="YP_005310532.1"
                     /db_xref="GI:379718401"
                     /db_xref="GeneID:11882403"
                     /translation="MTSENRIENGNAPAAEAVQGEGAAAKIAGAFPGSRKVYVEGSRP
                     DLKVAMREIELSPSTGRYGEEPNAPVRVYDTSGPYTDAGAKTDIRQGLQPSRLPWILS
                     REDVESYEGREVKPEDNGYLHAESVKEELLFPGLKRRPLRAKAGSNVTQLHYARKGII
                     TPEMEYIAIRENVDPEFVRSEVARGRAIIPSNINHPESEPMIIGRNFLVKVNANIGNS
                     AVASSIDEEVEKMTWAIRWGADNIMDLSTGKNIHMTREWIIRNSPVPVGTVPIYQALE
                     KVNGKAEDLTWEVYRDTLIEQAEQGVDYFTIHAGVLLRYIPMTAKRVTGIVSRGGSIM
                     AAWCLAHHQENFLYTHFDEICEIMKTYDVAFSLGDGLRPGSIADANDEAQFAELDTLG
                     ELTHRAWKHDVQVMIEGPGHVPMHLIKENVDRQLEVCDEAPFYTLGPLTTDIAPGYDH
                     ITSAIGAAMIGWFGTAMLCYVTPKEHLGLPNKNDVREGVIAYKIAAHAADLAKGHPGA
                     QERDNALSKARFEFRWRDQFHLALDPERAMEYHDETLPAEGAKTAHFCSMCGPKFCSM
                     RITQDIREYAREHGLGEAEALRAGMEEKSKEYAETGSGVYR"
     misc_feature    483073..484809
                     /locus_tag="PM3016_411"
                     /note="thiamine biosynthesis protein ThiC; Provisional;
                     Region: PRK09284"
                     /db_xref="CDD:236451"
     misc_feature    483073..483309
                     /locus_tag="PM3016_411"
                     /note="ThiC-associated domain; Region: ThiC-associated;
                     pfam13667"
                     /db_xref="CDD:257973"
     misc_feature    483436..484707
                     /locus_tag="PM3016_411"
                     /note="ThiC family; Region: ThiC; pfam01964"
                     /db_xref="CDD:250998"
     gene            485092..486015
                     /locus_tag="PM3016_412"
                     /db_xref="GeneID:11882404"
     CDS             485092..486015
                     /locus_tag="PM3016_412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310533.1"
                     /db_xref="GI:379718402"
                     /db_xref="GeneID:11882404"
                     /translation="MNMGLKKNGKVWKTAVPLALGGVLLVSSGMSAMAGTSGYEAYKA
                     ALKQQHTVQSVTADVKMVLKDNSQPLWQAAQHVKLDKAGHRASGEVELQEGAETERVA
                     FFAGAEEDLVFKNSTEETYYVVSEDERAGRKHHRESGKEGGPTAEELEGIVDALAGGL
                     KQQMTLETKPDGGSQVELQLSAAQIPPAVQALGALALKYAGDGEHRHAPGKEGLPAWF
                     GGTEPDLPALTQDIRIESFRLTADIAPDGMLQGQVVELKVDGKDAAGAEHELALTAQV
                     ALSGHNATAADTVELDGKQVRTLDLHGDGRK"
     gene            486120..486857
                     /locus_tag="PM3016_413"
                     /db_xref="GeneID:11882405"
     CDS             486120..486857
                     /locus_tag="PM3016_413"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005310534.1"
                     /db_xref="GI:379718403"
                     /db_xref="GeneID:11882405"
                     /translation="MMNDPVLEVSGLTKLFRSGRGIQEMNLTVGEGEIYGLFGPNGAG
                     KTTLLKLVTGLIPAAGGQVRWFGHSLEDEYEEAMKRVGCVLEAGSTYGYLTAREQLEQ
                     VRRHYPGLAAARMDEVLELTGLRPYAGEKTRGFSLGMKQRLALAAALLPRPAFVLLDE
                     PTNGLDIEGILEIRRVIRQLAAEEGVTFLISSHLIGEMEQVCSRAGVLLGGRLVLEGT
                     VPDLLREYGSLEAMYLAAAGRPLREGA"
     misc_feature    486138..486776
                     /locus_tag="PM3016_413"
                     /note="gallidermin-class lantibiotic protection ABC
                     transporter, ATP-binding subunit; Region: galliderm_ABC;
                     TIGR03740"
                     /db_xref="CDD:163452"
     misc_feature    486138..486770
                     /locus_tag="PM3016_413"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    486234..486257
                     /locus_tag="PM3016_413"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(486243..486248,486252..486260,486375..486377,
                     486594..486599,486696..486698)
                     /locus_tag="PM3016_413"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    486366..486377
                     /locus_tag="PM3016_413"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    486522..486551
                     /locus_tag="PM3016_413"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    486582..486599
                     /locus_tag="PM3016_413"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    486606..486617
                     /locus_tag="PM3016_413"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    486684..486704
                     /locus_tag="PM3016_413"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            486861..487613
                     /locus_tag="PM3016_414"
                     /db_xref="GeneID:11882406"
     CDS             486861..487613
                     /locus_tag="PM3016_414"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310535.1"
                     /db_xref="GI:379718404"
                     /db_xref="GeneID:11882406"
                     /translation="MHAFYASLRNELARLAAQPKTRWFLAASLLLPLGLSLLSSRLQG
                     GGGLSALLSGDPYLALLGGYTAFVLPLFLFMTAADQFPGEREEGTMVLTLLRPVSRAK
                     IYGAKVAAAAVYTGLQLLLLAVVSLLCSLLLPGSAPAVLDPLSFFRAAVAAWAAMLAV
                     GAVGAALVQLTGRATTGLALCLVLYGALKLLPLLLPGLSVWSLFSYTGWHALWLGDGV
                     PAVRLWNLSLLLLAYSIIAYTGGLAIFNKKSF"
     misc_feature    486996..>487202
                     /locus_tag="PM3016_414"
                     /note="Acyltransferase family; Region: Acyl_transf_3;
                     cl19154"
                     /db_xref="CDD:267507"
     gene            487637..489133
                     /locus_tag="PM3016_415"
                     /db_xref="GeneID:11882407"
     CDS             487637..489133
                     /locus_tag="PM3016_415"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="YP_005310536.1"
                     /db_xref="GI:379718405"
                     /db_xref="GeneID:11882407"
                     /translation="MSIRMKLILSNIAMVVVPVLLFALTTVLVAALVMNNAFGLKSLV
                     LPGIGLEENAVEEHFDSKSEWYTVLQYFAREEPERFRDPDFLQQTGEKLASLESGIVV
                     LQEGKVTFASQAIGRVDDPSALLALPDVSGRERHEHEIVLGGVAYYVFSHELRFGDGG
                     TGVLVMLEDQRPLGMVTRRVFPIVLGILLLVLAVTNGGLTYLVSRSIIRPLRELKAAA
                     ERIKDGRLEEALELRRRDEIGEVGAAFEEMRQRLLDSIRTQLQYEDNRKELLTNISHD
                     LKTPITAIQSCAEGLRDGIADTPEKQAKYVGMIHSKALHLNRLIDELFLFSKLDLKRL
                     PFHFEPLELRAYLMDYAEELKVDPRMREMQVRFEAVETGPRVWVQADREKLGRVLMNI
                     VDNAVKHAREPQAQLQIALRTEDGEAELTLEDNGPGIEPQALPWVFDRFYRADLSRRT
                     DTGGSGLGLAIVKGIVEEHGGRVRAESGPDRGTAIVITLPLLAEVPEP"
     misc_feature    488117..489130
                     /locus_tag="PM3016_415"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    488255..488398
                     /locus_tag="PM3016_415"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(488255..488260,488267..488272,488276..488281,
                     488288..488293,488297..488299,488345..488350,
                     488354..488359,488366..488371,488375..488380,
                     488387..488392)
                     /locus_tag="PM3016_415"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    488423..488620
                     /locus_tag="PM3016_415"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(488441..488443,488453..488455,488465..488467,
                     488474..488476,488486..488488,488495..488497,
                     488549..488551,488561..488563,488570..488572,
                     488582..488584,488591..488593,488603..488605)
                     /locus_tag="PM3016_415"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    488459..488461
                     /locus_tag="PM3016_415"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    488789..489103
                     /locus_tag="PM3016_415"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(488807..488809,488819..488821,488828..488830,
                     488900..488902,488906..488908,488912..488914,
                     488918..488923,489002..489013,489059..489061,
                     489065..489067,489080..489085,489089..489091)
                     /locus_tag="PM3016_415"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    488819..488821
                     /locus_tag="PM3016_415"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(488912..488914,488918..488920,489002..489004,
                     489008..489010)
                     /locus_tag="PM3016_415"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            489185..489886
                     /locus_tag="PM3016_416"
                     /db_xref="GeneID:11882408"
     CDS             489185..489886
                     /locus_tag="PM3016_416"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="YP_005310537.1"
                     /db_xref="GI:379718406"
                     /db_xref="GeneID:11882408"
                     /translation="MKRILIIEDESVIAEVQKDYLEVSGYAVEIAATGEAGLQKALLE
                     PYDLILLDLMLPGVDGYEICRQVRAAKNIPILMVSARREEIDKIRGLGLGADDYIMKP
                     FSVGELVARVKAHLARFERLTGGGGSGESRGRDSLQVGGLIIDTLSRKVHVNGREVAF
                     TSKEYDLLVFLVQHPNRVFGKEQIFERIWGLDAMGDNATVTVHISKLREKIESDPSKP
                     QYIETIWGVGYRFNV"
     misc_feature    489188..489877
                     /locus_tag="PM3016_416"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    489197..489532
                     /locus_tag="PM3016_416"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(489206..489211,489338..489340,489362..489364,
                     489419..489421,489476..489478,489485..489490)
                     /locus_tag="PM3016_416"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    489338..489340
                     /locus_tag="PM3016_416"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(489347..489352,489356..489364)
                     /locus_tag="PM3016_416"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    489485..489493
                     /locus_tag="PM3016_416"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    489593..489877
                     /locus_tag="PM3016_416"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(489665..489667,489722..489727,489779..489781,
                     489788..489790,489812..489817,489851..489853,
                     489866..489868)
                     /locus_tag="PM3016_416"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(490168..491019)
                     /locus_tag="PM3016_417"
                     /db_xref="GeneID:11882409"
     CDS             complement(490168..491019)
                     /locus_tag="PM3016_417"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005310538.1"
                     /db_xref="GI:379718407"
                     /db_xref="GeneID:11882409"
                     /translation="MLQIENIRRDAGTMPWFEEVEREADSWSFILMGYGKCVYWVQGE
                     KMLLEKGDVLLLPPGVTYYGKSIPSLTHEKYVTTFSSGAGGASPLPLLASDQPLRWRC
                     AAWELLLARAQTMAQEWAEGAPYAGVLCSALLLESLTRLNREYDKGPHTALLHRQGEL
                     MTAYLRNHYREKVTKEDLAAVIGRSPGHAAVLFREATGQTISEYTHGLRMKTAVYLLR
                     HSDLTVADIAEQLGYCDPSFFTAPSSVLPACLLRITSRSGKPRFVSPCLFHYPPAAHL
                     PAEFTGS"
     misc_feature    complement(<490840..>490917)
                     /locus_tag="PM3016_417"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     misc_feature    complement(490297..490608)
                     /locus_tag="PM3016_417"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(490402..490527)
                     /locus_tag="PM3016_417"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            491179..492597
                     /locus_tag="PM3016_418"
                     /db_xref="GeneID:11882410"
     CDS             491179..492597
                     /locus_tag="PM3016_418"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310539.1"
                     /db_xref="GI:379718408"
                     /db_xref="GeneID:11882410"
                     /translation="MRKTKIICTLGPACDNLEVLKEMIRAGMNVARLNMAHGDLDEQR
                     TRIRRVRQAASELGAAVAVLLDIKGPEVRIGKLKDSSYELKTDGKLTLTTEIIEGTAE
                     RISVSYAQLPQDLHPGSRILIDDGLIELRVEEVEGTEIHCRIVNGGVIKPRKGVNLPG
                     VKTSLPGVTERDVQHIHFAAEEDLDIIAVSFVRRAADILEVRELLEQLGAGHIQIISK
                     IENEEGVDELDAILEVSDGLMVARGDLGVEIPVEDVPILQKLMIRKCNQAGKPVITAT
                     HMLDSMQVNPRPTRAEASDVANAVLDGTDVLMLSGESAAGKYPVESVQTMAAIAERTE
                     ATLPYWDNYVKRAAEQTPNVTEVISQAVVGSSLELNAKAILTPTETGFTARMVSKYRP
                     KAPIVAIAPDERIRRRMSLIWGVTPVLGEPVTSTDAMFLSAVDGGKKSGLVEAGDLVI
                     VSAGVPIGGAGSTNLIKIMNAE"
     misc_feature    491179..492588
                     /locus_tag="PM3016_418"
                     /note="Pyruvate kinase [Carbohydrate transport and
                     metabolism]; Region: PykF; COG0469"
                     /db_xref="CDD:223545"
     misc_feature    491179..492582
                     /locus_tag="PM3016_418"
                     /note="Pyruvate kinase (PK):  Large allosteric enzyme that
                     regulates glycolysis through binding of the substrate,
                     phosphoenolpyruvate, and one or more allosteric effectors.
                     Like other allosteric enzymes, PK has a high substrate
                     affinity R state and a low...; Region: Pyruvate_Kinase;
                     cd00288"
                     /db_xref="CDD:238178"
     misc_feature    order(491185..491190,491356..491358,491362..491364,
                     491386..491397,491644..491649,491665..491667,
                     491674..491688,491731..491733,491755..491757,
                     491776..491778,491812..491814,491920..491922,
                     491974..491979,491989..491991,492085..492087,
                     492091..492093,492178..492180,492184..492189,
                     492343..492345,492349..492351,492355..492357,
                     492388..492390,492397..492402,492406..492408,
                     492412..492420)
                     /locus_tag="PM3016_418"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238178"
     misc_feature    order(491272..491274,491278..491280,491374..491376,
                     491749..491751,491830..491832,491836..491838,
                     491908..491910,492004..492006)
                     /locus_tag="PM3016_418"
                     /note="active site"
                     /db_xref="CDD:238178"
     gene            complement(492685..492960)
                     /locus_tag="PM3016_419"
                     /db_xref="GeneID:11882411"
     CDS             complement(492685..492960)
                     /locus_tag="PM3016_419"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310540.1"
                     /db_xref="GI:379718409"
                     /db_xref="GeneID:11882411"
                     /translation="MANDKSMNPMSGEEVETDGIYTNEWGREEKLKRGDEFPADPVLG
                     NTEWELTSLPLESQEEEFYKDTTANTKKRSHYDNDFGADPLGKAGKS"
     gene            493075..493842
                     /locus_tag="PM3016_420"
                     /db_xref="GeneID:11882412"
     CDS             493075..493842
                     /locus_tag="PM3016_420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310541.1"
                     /db_xref="GI:379718410"
                     /db_xref="GeneID:11882412"
                     /translation="MTEALWGTGVNAAAIVAGGLAGLLLQRMSDGMRRTVMQGIGLAL
                     IALGVSMALKSDQFLLMAACLTLGGITGELAGVEQGLERLGKLLEQAVNALTRRLRRG
                     KDTGSQEGRLAAGFVNATLVFCIGAMAVLGPLDSGLRGDHVVLYTKALLDGFLSIIFA
                     STMGVGVAFSALAVFLYQGVIALAASWIASGLDEVLLGEIIRQVTAVGGVLIVGVGIN
                     LLELRRIHVANLLPALVFAALAVPVTGWLTAWWAGLG"
     misc_feature    493087..493803
                     /locus_tag="PM3016_420"
                     /note="Protein of unknown function (DUF554); Region:
                     DUF554; pfam04474"
                     /db_xref="CDD:252619"
     gene            complement(494029..495315)
                     /locus_tag="PM3016_421"
                     /db_xref="GeneID:11882413"
     CDS             complement(494029..495315)
                     /locus_tag="PM3016_421"
                     /codon_start=1
                     /transl_table=11
                     /product="seryl-tRNA synthetase"
                     /protein_id="YP_005310542.1"
                     /db_xref="GI:379718411"
                     /db_xref="GeneID:11882413"
                     /translation="MLDIHWIRENQTKVQEAARLKGIPLSVEELLACDDRWRGLLQQV
                     EELRRIRNRHSQAIPGWLREGRRAEAEDAKREVRRVNGELARLEAELDGAERQRADLL
                     LRVPNVPSADTPPGRSDADNVETGRWGEPPQFGFEPLSHTALGELHRIIDLPRGVKPA
                     GSRGYYLRGAGALLHRAVQQLAVDLLLAEGFTLLEVPLALRPEAFRHAGFFPLGEDQV
                     YRLEGEDRYLAGTSEIPLLHYYSGETVDVTRPIRLAAVSSCFRSEAGSAGRDTHGLYR
                     VHQFAKVEQVVLCEADPGAAESLLQEITGHARRLLRLLELPHRTVAVCTGDMSQKTFK
                     QYDIETWMPSRAAYGETHSSSHLLDFQARRAGIRYKDGDGRLRYCYTLNNTAVASPRI
                     LIPLLENHQQEDGTVRIPEALRPYMGGLDRLVPPRD"
     misc_feature    complement(494038..495315)
                     /locus_tag="PM3016_421"
                     /note="seryl-tRNA synthetase; Provisional; Region:
                     PRK05431"
                     /db_xref="CDD:235461"
     misc_feature    complement(494989..495315)
                     /locus_tag="PM3016_421"
                     /note="Seryl-tRNA synthetase N-terminal domain; Region:
                     Seryl_tRNA_N; pfam02403"
                     /db_xref="CDD:251274"
     misc_feature    complement(494065..494955)
                     /locus_tag="PM3016_421"
                     /note="Class II tRNA amino-acyl synthetase-like catalytic
                     core domain. Class II amino acyl-tRNA synthetases (aaRS)
                     share a common fold and generally attach an amino acid to
                     the 3' OH of ribose of the appropriate tRNA.   PheRS is an
                     exception in that it...; Region: class_II_aaRS-like_core;
                     cl00268"
                     /db_xref="CDD:260313"
     misc_feature    complement(494731..494745)
                     /locus_tag="PM3016_421"
                     /note="motif 1; other site"
                     /db_xref="CDD:238391"
     misc_feature    complement(order(494392..494394,494530..494532,
                     494536..494538,494599..494604,494731..494733,
                     494737..494742))
                     /locus_tag="PM3016_421"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238391"
     misc_feature    complement(order(494143..494145,494152..494157,
                     494164..494169,494251..494253,494263..494268,
                     494458..494466,494470..494472,494476..494478,
                     494533..494535,494617..494619,494623..494625))
                     /locus_tag="PM3016_421"
                     /note="active site"
                     /db_xref="CDD:238391"
     misc_feature    complement(494530..494538)
                     /locus_tag="PM3016_421"
                     /note="motif 2; other site"
                     /db_xref="CDD:238391"
     misc_feature    complement(order(494143..494145,494152..494154))
                     /locus_tag="PM3016_421"
                     /note="motif 3; other site"
                     /db_xref="CDD:238391"
     gene            495807..497552
                     /locus_tag="PM3016_422"
                     /db_xref="GeneID:11882414"
     CDS             495807..497552
                     /locus_tag="PM3016_422"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein/permease"
                     /protein_id="YP_005310543.1"
                     /db_xref="GI:379718412"
                     /db_xref="GeneID:11882414"
                     /translation="MTFVNRLAWFFRERWVWYLGAVLLMALVNVLGIVPPRMIGSVID
                     EIRTGALTGDQLQRHVLLLAGLAVFMYIITYIWITTLFGNSLLLERMLRSRLVSHFMR
                     MSPSFFHRNSTGELMALATNDIPSIGQTAGYGVMTLVNTIVGTSVVLITMISLISWKL
                     MLAALIPLPLLTLLISVLGKQTRSRFIAAQAAFGRMNDQALESISGMRVIRSYVQEEH
                     DLASFDRVTRDVMNLNIRVAAIQALFHPAISLIVGMSFIIGIGYGANLVFHHEITLGQ
                     LVSFNIYLGMLIWPMIAFGEFINVLQRGTASVDRVTASFAQTPEVQDPEEPVKVDRPE
                     SIELRDLTFRYPGASQDSLRGVSVRLESGQTLGLVGRTGSGKSTLLKQLLRYYPVEPG
                     TVLFSGVGIENLSVSEIRSWIGYVPQEHLLLSKSVRDNIALARPDASGEEIARAIAMA
                     SFTADIEMLPQGLETIVGENGVMLSGGQKQRISIARALLADPEILILDDSLSAVDART
                     ESAILEALRAERAGRTTLIATHRLSAVMHADRILVLEDGRISEDGTHEELMRRGGWYK
                     EQFERQQLEANLLET"
     misc_feature    495858..496679
                     /locus_tag="PM3016_422"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    495870..497540
                     /locus_tag="PM3016_422"
                     /note="putative multidrug transporter membrane\ATP-binding
                     components; Provisional; Region: PRK10789"
                     /db_xref="CDD:182732"
     misc_feature    496812..497522
                     /locus_tag="PM3016_422"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    496914..496937
                     /locus_tag="PM3016_422"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(496923..496928,496932..496940,497058..497060,
                     497298..497303,497394..497396)
                     /locus_tag="PM3016_422"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    497049..497060
                     /locus_tag="PM3016_422"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    497226..497255
                     /locus_tag="PM3016_422"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    497286..497303
                     /locus_tag="PM3016_422"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    497310..497321
                     /locus_tag="PM3016_422"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    497382..497402
                     /locus_tag="PM3016_422"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            497583..499706
                     /locus_tag="PM3016_423"
                     /db_xref="GeneID:11882415"
     CDS             497583..499706
                     /locus_tag="PM3016_423"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein/permease"
                     /protein_id="YP_005310544.1"
                     /db_xref="GI:379718413"
                     /db_xref="GeneID:11882415"
                     /translation="MEPQSNAGEARVPVFRRLLAYALLFKYRIAAALLVLCCAVGAEL
                     AGPFIAKTIIDRHIGGIAQPWYEWNVKDVSLPADTRNVELDGVLYVRKDWLDAGAAPG
                     SGPAERPALWREARILQLDSGMYLVRGAGEMTGGSWSAAGEGADAPVLTWKAESGETR
                     QVPARKLTTAETVAFYKYDIPEVIRWLAVFFGLLVLGSALHYIQGFTLQTTALRIIQR
                     MRMDLMNHIQRMPIRYFDSTPIGQVVSRIANDTEAVRDLFMSFMATFVVSSINIVGIY
                     IALFLLDYRLALVTLVFMPLFTVVMYVHLKYSKKYISVMRARLSDMNAMLNESINVMP
                     ILQAFRQEKNRMREFNALNEDRYRANIKQIRLFSLSSRNFTGLVGSLFTAGAIWYFGG
                     QSLQSAISFGVFYAFIDYTGRFFQPIIGIFDQLMNAQRAVVSAEKVFGLMDIEGTEVA
                     RADEVPRPQGHVKFDNVTFAYKEGEPVLRGITFEAKKGETVALVGHTGSGKSSIMNLL
                     LGFYEPSDGRILIDGQEIRSISKQALRKHMGIVLQDPFLFTGDIKFNVSLYNERIGPQ
                     QVRKALADVGAAGFVEALPGGYDERVVERGSTLSAGQRQLISFARALAFDPAILILDE
                     ATASIDSETEGLIQEALRVVSAGRTTFVIAHRLSTIREADQILVLHRGEIVERGNHET
                     LMELKGRYYRMYQLQSGGTVQTTTA"
     misc_feature    498114..499682
                     /locus_tag="PM3016_423"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    498132..498836
                     /locus_tag="PM3016_423"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    498960..499646
                     /locus_tag="PM3016_423"
                     /note="ATP-binding cassette domain of glucan transporter
                     and related proteins, subfamily C; Region:
                     ABCC_Glucan_exporter_like; cd03254"
                     /db_xref="CDD:213221"
     misc_feature    499065..499088
                     /locus_tag="PM3016_423"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213221"
     misc_feature    order(499074..499079,499083..499091,499209..499211,
                     499449..499454,499545..499547)
                     /locus_tag="PM3016_423"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213221"
     misc_feature    499200..499211
                     /locus_tag="PM3016_423"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213221"
     misc_feature    499377..499406
                     /locus_tag="PM3016_423"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213221"
     misc_feature    499437..499454
                     /locus_tag="PM3016_423"
                     /note="Walker B; other site"
                     /db_xref="CDD:213221"
     misc_feature    499461..499472
                     /locus_tag="PM3016_423"
                     /note="D-loop; other site"
                     /db_xref="CDD:213221"
     misc_feature    499533..499553
                     /locus_tag="PM3016_423"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213221"
     gene            complement(499842..500522)
                     /locus_tag="PM3016_424"
                     /db_xref="GeneID:11882416"
     CDS             complement(499842..500522)
                     /locus_tag="PM3016_424"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphokinase"
                     /protein_id="YP_005310545.1"
                     /db_xref="GI:379718414"
                     /db_xref="GeneID:11882416"
                     /translation="MMSAAARYVIFSGGTLGSWALRLLQPGDKLIGADRGALFLAEHG
                     LRPDIALGDFDSVTAMELERVRDSSARFLTCDPVMKDLTDTEMAFNWAHEQGAREIVM
                     AGVLGSRWDHSLANVHLLRRGLLAGVPCRIADEYNELQLIGAGTPLKLQKSPHTHVSL
                     LPLTLDVHGITLEGFQYPLHEASLTIGQSLGISNVLVDEAGTVQVREGLLLVIRSRDP
                     EPEAPSLL"
     misc_feature    complement(499878..500501)
                     /locus_tag="PM3016_424"
                     /note="Thiamine pyrophosphokinase; Region: TPK; cd07995"
                     /db_xref="CDD:153431"
     misc_feature    complement(499884..500498)
                     /locus_tag="PM3016_424"
                     /note="thiamine pyrophosphokinase; Region: thi_PPkinase;
                     TIGR01378"
                     /db_xref="CDD:233386"
     misc_feature    complement(order(499941..499952,499986..499988,
                     499992..499994,500175..500177,500187..500189,
                     500196..500204,500208..500210,500268..500285,
                     500355..500360,500364..500366,500418..500426,
                     500481..500489))
                     /locus_tag="PM3016_424"
                     /note="active site"
                     /db_xref="CDD:153431"
     misc_feature    complement(order(499884..499886,499944..499949,
                     499953..499955,500031..500036,500040..500042,
                     500046..500048,500052..500054,500106..500108,
                     500112..500114,500169..500174,500178..500201,
                     500205..500207,500265..500267,500277..500285,
                     500397..500399,500406..500408,500418..500420))
                     /locus_tag="PM3016_424"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153431"
     misc_feature    complement(order(499941..499952,499986..499988,
                     499992..499994,500274..500285,500364..500366))
                     /locus_tag="PM3016_424"
                     /note="thiamine binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153431"
     gene            500733..501707
                     /locus_tag="PM3016_425"
                     /db_xref="GeneID:11882417"
     CDS             500733..501707
                     /locus_tag="PM3016_425"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310546.1"
                     /db_xref="GI:379718415"
                     /db_xref="GeneID:11882417"
                     /translation="MKINGRYENMDGIRLRKKLPFIQKWRKERKKIKLKDWSYTVPQC
                     GEKQIEFLKSNHTEPTMTWIGHSSFLLQMEGKNLLTDPVWAQRMGLEKRLAPPGLMPS
                     DLPRIDAVLLSHSHYDHMDMPSLRTVHQRNPGVQMLVPVGLGKKLKSSGFQKVTEVNW
                     WDTVRLDGLELHFVPAQHWTRRTLFDTNASHWGGWVLRPVTHHGERLAVYFVGDSAYF
                     GGFKTIGERFRIGWALMPIGAYDPEWYTGKQHVNPEEAVQAFIDCGADVCVPMHYGTF
                     RLADDTPREALDRLHAAWERHGLAPERLRILTFGETVRPLAETVGARG"
     misc_feature    500892..501671
                     /locus_tag="PM3016_425"
                     /note="Predicted Zn-dependent hydrolases of the
                     beta-lactamase fold [General function prediction only];
                     Region: COG2220"
                     /db_xref="CDD:225130"
     gene            complement(501718..502911)
                     /locus_tag="PM3016_426"
                     /db_xref="GeneID:11882418"
     CDS             complement(501718..502911)
                     /locus_tag="PM3016_426"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodopsin-like GPCR superfamily protein"
                     /protein_id="YP_005310547.1"
                     /db_xref="GI:379718416"
                     /db_xref="GeneID:11882418"
                     /translation="MPIVSIEPTPSPNTMKINMSESLPSGVRETYTREQAAEAPTPEL
                     QRLLSIEGVKAFYRAADFIAVDRMPKGDWGRILAEVREVLGVTESAHPQGSSHPAAEG
                     PDAGNGEGTTADASFGEVHVFLQHFRGIPLQVRVSSGDEEQRAALPSRFSDTAVRAAS
                     ASPNLIKERTLEEWDTRYGSLQEVLEDVVQELDAAYSDAQLEELAAQAAAGAGTGDAQ
                     QRAEKTRRELSYAEAEALLRSPEWKERYAALRRIQPSAETLPLLLIALDDEQAAVRRL
                     ASVYLGDLKDPVVLPHLYRALQDPSPSVRRTAGDTLSDLGDPAAQEAMIAALSDPNKL
                     VRWRAARFLYELGDETALPALKAAEDEPEFEVRLQIRMALERIEGGEEAAGSVWQQMS
                     RRDRS"
     misc_feature    complement(502657..502902)
                     /locus_tag="PM3016_426"
                     /note="Scaffold protein Nfu/NifU N terminal; Region:
                     Nfu_N; smart00932"
                     /db_xref="CDD:214919"
     misc_feature    complement(502318..502539)
                     /locus_tag="PM3016_426"
                     /note="Virulence factor; Region: Virulence_fact;
                     pfam13769"
                     /db_xref="CDD:258055"
     misc_feature    complement(502153..>502266)
                     /locus_tag="PM3016_426"
                     /note="Domain of Unknown Function (DUF349); Region:
                     DUF349; pfam03993"
                     /db_xref="CDD:202846"
     misc_feature    complement(501988..502212)
                     /locus_tag="PM3016_426"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    complement(501967..502047)
                     /locus_tag="PM3016_426"
                     /note="HEAT repeat; Region: HEAT; pfam02985"
                     /db_xref="CDD:251659"
     misc_feature    complement(501790..502044)
                     /locus_tag="PM3016_426"
                     /note="HEAT repeats; Region: HEAT_2; pfam13646"
                     /db_xref="CDD:257956"
     misc_feature    complement(501829..501912)
                     /locus_tag="PM3016_426"
                     /note="E-Z type HEAT repeats; Region: EZ_HEAT; smart00567"
                     /db_xref="CDD:128837"
     gene            complement(502932..503447)
                     /locus_tag="PM3016_427"
                     /db_xref="GeneID:11882419"
     CDS             complement(502932..503447)
                     /locus_tag="PM3016_427"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310548.1"
                     /db_xref="GI:379718417"
                     /db_xref="GeneID:11882419"
                     /translation="MTLAKPEQTEYNAFYAGYIAQVPEGDVTAHLKEQLQKTAGLVAG
                     LTEAQALHRYAEDKWSIKEVLGHIADTERVMSYRLLRVARGDTTPLPGFDQDLFIRGT
                     AFDEWPLQRLADELAVVRQATLSLFAGLSPADWLREGSASGYPITARALAYIIAGHEL
                     HHLRIIQERYI"
     misc_feature    complement(502950..503360)
                     /locus_tag="PM3016_427"
                     /note="DinB superfamily; Region: DinB_2; pfam12867"
                     /db_xref="CDD:257360"
     gene            complement(503562..504152)
                     /locus_tag="PM3016_428"
                     /db_xref="GeneID:11882420"
     CDS             complement(503562..504152)
                     /locus_tag="PM3016_428"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_005310549.1"
                     /db_xref="GI:379718418"
                     /db_xref="GeneID:11882420"
                     /translation="MYELKDKEIIFVFTGPNGAGRRTVAQMSGSTLGVKQVISYTTRP
                     PRSSEVDGQDYHFVSREEFKAAEEKQEFIEVIEIDGNCYGIKEADVAAQLQKFGAVYL
                     VLNRFGAEALKKVYGDKVVRIFIYADRETVLKREQERGDTPELIERYMSHYEEEMAYK
                     DSCEHVFENLDLAHTVFDLTKALDDTYLHRNLLDLD"
     misc_feature    complement(503598..504125)
                     /locus_tag="PM3016_428"
                     /note="Guanylate kinase; Region: Guanylate_kin; pfam00625"
                     /db_xref="CDD:250008"
     misc_feature    complement(503616..504125)
                     /locus_tag="PM3016_428"
                     /note="Guanylate kinase [Nucleotide transport and
                     metabolism]; Region: Gmk; COG0194"
                     /db_xref="CDD:223272"
     misc_feature    complement(order(504084..504095,504108..504110))
                     /locus_tag="PM3016_428"
                     /note="active site"
                     /db_xref="CDD:238977"
     gene            complement(504455..506191)
                     /locus_tag="PM3016_429"
                     /db_xref="GeneID:11882421"
     CDS             complement(504455..506191)
                     /locus_tag="PM3016_429"
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="YP_005310550.1"
                     /db_xref="GI:379718419"
                     /db_xref="GeneID:11882421"
                     /translation="MKKNEFQALGISQELAEALHKHGYNEPTPIQREAIPSVLGGHDV
                     IAQAQTGTGKTLAFVLPILESIDPNRSHVQALIVTPTRELAIQITEEVARWAPLKGIR
                     VLSAYGGQDVERQIRKLEGAIHIIVATPGRLLDHLRRETVQLFKLSTLVLDEADQMLH
                     MGFLPEVVEIISATPTRRQTLLFSATMPERVRQLAKEYMKPPVEIEVKAKRVTLDEIE
                     QIVVQTTDRGKLDALCKAMEEDPPFLGMIFCRTKLRATKLRDELDERGYAVDELHGDL
                     TQAKREQVMKRFRDAKIQFLVATDIAARGLDVEGITHVYNYDIPHDAESYIHRIGRTG
                     RAGMTGKAITFTAPRDAFYLEAIEKGIKMQLVKRPGRGGAEARTDERSERGGRQGGRR
                     GEARTAGGRGARGAAGRGAAAPGGRGRAAAPAPRGGESAERWGAAASGGRDSAARGAG
                     RGTAGGRGGAGARGEGALPWSGTQGGTRDSAAPRGGRGAAAAGTRGGGGGGAPGRGDG
                     AERWSSGPRPGGERGARTAGARSGGAGARGGSAGARGRSGGGGAPERGGAGRGPKPAG
                     RGGAAGGRRRGR"
     misc_feature    complement(505085..506176)
                     /locus_tag="PM3016_429"
                     /note="helicase 45; Provisional; Region: PTZ00424"
                     /db_xref="CDD:185609"
     misc_feature    complement(505574..506176)
                     /locus_tag="PM3016_429"
                     /note="DEAD-box helicases. A diverse family of proteins
                     involved in ATP-dependent RNA unwinding, needed in a
                     variety of cellular processes including splicing, ribosome
                     biogenesis and RNA degradation. The name derives from the
                     sequence of the Walker  B motif; Region: DEADc; cd00268"
                     /db_xref="CDD:238167"
     misc_feature    complement(506027..506041)
                     /locus_tag="PM3016_429"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(505724..505735)
                     /locus_tag="PM3016_429"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(505634..505642)
                     /locus_tag="PM3016_429"
                     /note="motif III; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(505157..505546)
                     /locus_tag="PM3016_429"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(505289..505297,505370..505375,
                     505433..505444))
                     /locus_tag="PM3016_429"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(505187..505189,505196..505198,
                     505208..505210,505271..505273))
                     /locus_tag="PM3016_429"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            complement(506423..507136)
                     /locus_tag="PM3016_430"
                     /db_xref="GeneID:11882422"
     CDS             complement(506423..507136)
                     /locus_tag="PM3016_430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310551.1"
                     /db_xref="GI:379718420"
                     /db_xref="GeneID:11882422"
                     /translation="MARALRLVGLISLLFTFAVAAGCYSWYDYNSASNYGSKRDLPRQ
                     DTSRAYQTQQQYAPVSHKVTKLEMNQNLSDQVAAMYGVNSAIVLVGDNVAYTAITMDS
                     TASGTHGGDKMALDSNKDGRARGENPAGDFQSLHVDPTQLIDGVSGAQTEPHHEHISH
                     LFKQKIAEKIRSLEPTIQDVYISANPNIIDQFTKLAIESWHGRSLSPYIPEFTRTMER
                     TFGTDPTIPNQAEANGREY"
     misc_feature    complement(506477..507112)
                     /locus_tag="PM3016_430"
                     /note="sporulation lipoprotein, YhcN/YlaJ family; Region:
                     spore_YhcN_YlaJ; TIGR02898"
                     /db_xref="CDD:131944"
     misc_feature    complement(506477..>507004)
                     /locus_tag="PM3016_430"
                     /note="Sporulation lipoprotein YhcN/YlaJ
                     (Spore_YhcN_YlaJ); Region: Spore_YhcN_YlaJ; pfam09580"
                     /db_xref="CDD:255432"
     gene            507501..508544
                     /locus_tag="PM3016_431"
                     /db_xref="GeneID:11882423"
     CDS             507501..508544
                     /locus_tag="PM3016_431"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome caa3-type oxidase II"
                     /protein_id="YP_005310552.1"
                     /db_xref="GI:379718421"
                     /db_xref="GeneID:11882423"
                     /translation="MIRWQNLWRFIPLFGLMMLLLTGCGDETISALRPRGPVARDQLF
                     LMKLSFGIMLLVVVVVFVIYLYVLVRFRKKKGDKDIIPKQVEGSHTLEIIWTVVPIIL
                     LLILAVPTVKYTFQLLEDHRDNKDALPVKVTAHAFWWQFEYPTLGISTAQDLVIPTGK
                     KIAFELTASDVKHSFWVPSLGGKMDTNPGLTNVYYLQADEIDTFKGKCAELCGASHSL
                     MDFKVKSLDAAAFDQWVADMKTPSTVPADAKAGETLFKDNCLSCHAVNAQGLGAGPNL
                     NGFASRELVAGILPHNEQSLRDWIKDPQSIKPGAKMPAFGENPLEPIPGSKPLQEQQI
                     NDIIKYLNTLTVK"
     misc_feature    507600..508208
                     /locus_tag="PM3016_431"
                     /note="cytochrome c oxidase, subunit II; Region: CoxB;
                     TIGR02866"
                     /db_xref="CDD:234039"
     misc_feature    <507762..507836
                     /locus_tag="PM3016_431"
                     /note="Cytochrome C oxidase subunit II, transmembrane
                     domain; Region: COX2_TM; pfam02790"
                     /db_xref="CDD:202397"
     misc_feature    507879..508178
                     /locus_tag="PM3016_431"
                     /note="The cupredoxin domain of Caa3 type Cytochrome c
                     oxidase subunit II; Region: CuRO_CcO_Caa3_II; cd04213"
                     /db_xref="CDD:259875"
     misc_feature    order(508008..508016,508026..508028,508032..508034,
                     508041..508055,508059..508070,508074..508076,
                     508113..508115,508119..508142,508146..508154,
                     508158..508160)
                     /locus_tag="PM3016_431"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259875"
     misc_feature    order(508017..508019,508122..508124,508134..508136,
                     508146..508148,508155..508157)
                     /locus_tag="PM3016_431"
                     /note="CuA binuclear center [ion binding]; other site"
                     /db_xref="CDD:259875"
     misc_feature    <508185..508532
                     /locus_tag="PM3016_431"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    508203..508541
                     /locus_tag="PM3016_431"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            508577..510433
                     /locus_tag="PM3016_432"
                     /db_xref="GeneID:11882424"
     CDS             508577..510433
                     /locus_tag="PM3016_432"
                     /codon_start=1
                     /transl_table=11
                     /product="protein CtaD"
                     /protein_id="YP_005310553.1"
                     /db_xref="GI:379718422"
                     /db_xref="GeneID:11882424"
                     /translation="MAHAHTVKRHTGLMDWLTTVDHKKIGILYLLAGGIFFLMGGLEA
                     ILIRIQLLYPDQKIFIGDTFNALTTMHGTTMIFLAAMPVIFAFMNAIVPLQIGARDVA
                     FPFVNALGFWLFFFGGLLLNTSWIIGSVPAAGWTAYPPLSNLTHGEAGTFQGGMDFYV
                     LGLQIAGLGTLIGGINFLVTIINMRAPGMTYMRMPMFTWTAFITSLLILFAFPAITVG
                     LVELMFDRIFGTGFFDVSKGGNPVLWEHIFWIFGHPEVYILILPAFGIISDIVSTFSR
                     KRLFGYSSMVFATALIGFLGFMVWAHHMFTTGIGPVGDAIFGVATMAIAVPTGVKIFN
                     WLFTLWGGQIRFTTANVFATAFIPTFVMGGVTGVMLAVPAADFQYHDTYFVVAHFHYV
                     IVGGLVLGLFAASYYWWPKMFGRLLNETLGKIHFWTFFIGFHMTFFPQHFLGLMGMPR
                     RVFTYQPGVGLETGNYISTLGAFLMGIGTIVFFINIIATASKPANAPADPWDGRTLEW
                     AIPSPPPEYNFKQTPLVRGFDAFWKEKMAGNKEMTPAEPVGSIHMPSPSILPFVMSVG
                     LFISGYGFMYHNYLLSIGGLIITFICMFLRSVYDDAGFHIEPEELNDKGVKA"
     misc_feature    508598..510295
                     /locus_tag="PM3016_432"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 1 [Energy production and conversion]; Region:
                     CyoB; COG0843"
                     /db_xref="CDD:223913"
     misc_feature    508622..510133
                     /locus_tag="PM3016_432"
                     /note="Ubiquinol oxidase subunit I.  Ubiquinol oxidase,
                     the terminal oxidase in the respiratory chains of aerobic
                     bacteria, is a multi-chain transmembrane protein located
                     in the cell membrane.  It catalyzes the reduction of O2
                     and simultaneously pumps protons...; Region:
                     Ubiquinol_Oxidase_I; cd01662"
                     /db_xref="CDD:238832"
     misc_feature    order(508661..508663,508844..508846,508874..508876,
                     508895..508897,508904..508906,509081..509086,
                     509102..509104,509114..509116)
                     /locus_tag="PM3016_432"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238832"
     misc_feature    order(508691..508693,508703..508705,508712..508717,
                     508763..508765,508772..508780)
                     /locus_tag="PM3016_432"
                     /note="Putative ubiquinol binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238832"
     misc_feature    order(508787..508789,509744..509746,509756..509758,
                     509882..509884,509999..510001)
                     /locus_tag="PM3016_432"
                     /note="Low-spin heme (heme b) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238832"
     misc_feature    order(509294..509296,509309..509314,509702..509704,
                     509714..509719,509924..509926)
                     /locus_tag="PM3016_432"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238832"
     misc_feature    order(509333..509335,509480..509485,509738..509740)
                     /locus_tag="PM3016_432"
                     /note="Binuclear center (heme o3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238832"
     misc_feature    order(509333..509335,509345..509347,509378..509380,
                     509480..509485,509558..509560,509567..509569)
                     /locus_tag="PM3016_432"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238832"
     misc_feature    order(509483..509485,509714..509719,509924..509929)
                     /locus_tag="PM3016_432"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238832"
     gene            510430..511053
                     /locus_tag="PM3016_433"
                     /db_xref="GeneID:11882425"
     CDS             510430..511053
                     /locus_tag="PM3016_433"
                     /codon_start=1
                     /transl_table=11
                     /product="protein CtaE"
                     /protein_id="YP_005310554.1"
                     /db_xref="GI:379718423"
                     /db_xref="GeneID:11882425"
                     /translation="MSAAHHEVGGALPPHAETATLEGKNKVLGFWLFLGGECVLFGTL
                     FASFIALRNQVPDGPTGQHLFALDLVALSTFILLTSSLTSVFGTMALHRGDLKKLQLW
                     MAITVLLGLSFLGLEIYEFVHYVHEGHTFTKSAFSSSFYTLVGFHGAHVAFGVLWIAL
                     LIIQSFKKGLTVVTAPKFYVAGLYWHFIDVVWVFIFTVVYLMGKVGP"
     misc_feature    510487..511038
                     /locus_tag="PM3016_433"
                     /note="Ubiquinol oxidase subunit III subfamily. Ubiquinol
                     oxidase, the terminal oxidase in the respiratory chains of
                     aerobic bacteria, is a multi-chain transmembrane protein
                     located in the cell membrane.  It catalyzes the reduction
                     of O2 and simultaneously...; Region:
                     Ubiquinol_oxidase_III; cd02863"
                     /db_xref="CDD:239214"
     misc_feature    order(510499..510504,510514..510516,510523..510525,
                     510544..510549,510556..510561,510568..510570)
                     /locus_tag="PM3016_433"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239214"
     misc_feature    order(510520..510522,510544..510546,510655..510657,
                     510664..510666,510676..510681,510964..510966,
                     510985..510987)
                     /locus_tag="PM3016_433"
                     /note="Subunit III/IV interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239214"
     gene            511054..511368
                     /locus_tag="PM3016_434"
                     /db_xref="GeneID:11882426"
     CDS             511054..511368
                     /locus_tag="PM3016_434"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310555.1"
                     /db_xref="GI:379718424"
                     /db_xref="GeneID:11882426"
                     /translation="MSSQHHTSAPTERHRLEGPRNHYLSYLISIILTMIAFAVVLYGG
                     LDRSFIIFFIVGIGVVQVIFQLAYWMHMKDRGHMFPIVGLAFGTFVALSAVAAAVYWV
                     WW"
     misc_feature    <511111..511365
                     /locus_tag="PM3016_434"
                     /note="Prokaryotic Cytochrome C oxidase subunit IV;
                     Region: COX4_pro; cl01204"
                     /db_xref="CDD:260832"
     gene            511486..512361
                     /locus_tag="PM3016_435"
                     /db_xref="GeneID:11882427"
     CDS             511486..512361
                     /locus_tag="PM3016_435"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310556.1"
                     /db_xref="GI:379718425"
                     /db_xref="GeneID:11882427"
                     /translation="MPANVSHAGHGAESTFAALWSPGLLLLLTVVGILYTLAVGRWRK
                     EIPDSEPVPLKQRIWFWTALVLWYAAEGSPLSYYGHHYYFSVHMFQQSILYLIMPPIL
                     LLGLPAWLLRAAIRTERVKRIVWWLTSPVFALFFFNFIFSMYHIPMVMDWLMARPAAL
                     SAYKAIFLFSAFQLWFPVFCPLPEYSRMSELKKMGYIFLNGVLLTPACALIIFAGKPM
                     YEMYAAVPPELLYLPMVDDQQLGGVIMKIVQEIVYGWALWYTFIRWYRRERKQDEEEE
                     FRESSYLTSSTMNRA"
     misc_feature    511531..512289
                     /locus_tag="PM3016_435"
                     /note="Cytochrome c oxidase caa3 assembly factor
                     (Caa3_CtaG); Region: Caa3_CtaG; cl09173"
                     /db_xref="CDD:263735"
     gene            512416..512877
                     /locus_tag="PM3016_436"
                     /db_xref="GeneID:11882428"
     CDS             512416..512877
                     /locus_tag="PM3016_436"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310557.1"
                     /db_xref="GI:379718426"
                     /db_xref="GeneID:11882428"
                     /translation="MNVPILPTISTLFIVISAIFVGFGWYQIMRGNRQTHEKLMLWGA
                     FFALAFFLVYASRTIFSGNTSFGGPEELKLAYHLFLFFHILLATAAAVFGIITLLHAF
                     NKRFAKHKKLGRWTAVIWLLTAPTGVVVYVLLYVLYPGGATKPMIDAILGT"
     misc_feature    512422..512796
                     /locus_tag="PM3016_436"
                     /note="Protein of unknown function (DUF420); Region:
                     DUF420; pfam04238"
                     /db_xref="CDD:146725"
     gene            complement(512959..513675)
                     /locus_tag="PM3016_437"
                     /db_xref="GeneID:11882429"
     CDS             complement(512959..513675)
                     /locus_tag="PM3016_437"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_005310558.1"
                     /db_xref="GI:379718427"
                     /db_xref="GeneID:11882429"
                     /translation="MPDHEHIYRMKAHLYHRLIAAQPDLSNIMEELYPGGDLDILDLG
                     AGSGRLTLSLLPRARSLSASDLSPAMLEELVRNVPLSCHSRLMTIAADHRNLPLPDHS
                     FDLIVSGWSLCYLAGSDEPEWEANLKQMMSEIDRLLRPGGTVILFETMGTGYTAPQPP
                     PFLLEYYNQLERQYEFGHRWIRTDYTFRSPQEAEELTRFFFGDALADEVRQKGLPIVP
                     ECAGVWWKRKSKESGKVHPA"
     misc_feature    complement(513238..513561)
                     /locus_tag="PM3016_437"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(513349..513351,513400..513405,
                     513478..513483,513529..513549))
                     /locus_tag="PM3016_437"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(513734..514629)
                     /locus_tag="PM3016_438"
                     /note="xylose isomerase domain-containing protein"
                     /pseudo
                     /db_xref="GeneID:11882430"
     gene            complement(514863..515639)
                     /locus_tag="PM3016_440"
                     /db_xref="GeneID:11882431"
     CDS             complement(514863..515639)
                     /locus_tag="PM3016_440"
                     /codon_start=1
                     /transl_table=11
                     /product="NLP/P60 family protein"
                     /protein_id="YP_005310559.1"
                     /db_xref="GI:379718428"
                     /db_xref="GeneID:11882431"
                     /translation="MKKQWTMMLLATTITLGSTTFIPEEAQAASAVIVSSVNLRSEPN
                     TSAASYGYVSTGETVEILSKVNSYWYKVRTSSGKVGYISTSSRYVSTTSTVPVSTSTT
                     ASSSGTVTYSSTAVSKVIAAGKAYLGTPYEYGSDRSTTYTFDCSDFVRQAFKDALGVT
                     LPSSSRTQGDYVKSIGKTSTNWHDLKPGDLMFFMSYKGGSASNYPSNKAGQTITHVGI
                     YLGDGKILHTYSKDSGGVRIDSIAGRHWEHRFIFGGSALR"
     misc_feature    complement(515385..515537)
                     /locus_tag="PM3016_440"
                     /note="Bacterial SH3 domain; Region: SH3_3; pfam08239"
                     /db_xref="CDD:254683"
     misc_feature    complement(514890..>515309)
                     /locus_tag="PM3016_440"
                     /note="Cell wall-associated hydrolases
                     (invasion-associated proteins) [Cell envelope biogenesis,
                     outer membrane]; Region: Spr; COG0791"
                     /db_xref="CDD:223862"
     misc_feature    complement(514887..515258)
                     /locus_tag="PM3016_440"
                     /note="NlpC/P60 family; Region: NLPC_P60; pfam00877"
                     /db_xref="CDD:189752"
     gene            515777..516817
                     /locus_tag="PM3016_441"
                     /db_xref="GeneID:11882432"
     CDS             515777..516817
                     /locus_tag="PM3016_441"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310560.1"
                     /db_xref="GI:379718429"
                     /db_xref="GeneID:11882432"
                     /translation="METWVLGPLVISQYLLVLFLSAAAGYGVLRLRLRGSGIGRPMGE
                     SVQTALLLWVLVWKLSILLWEPQSILDDPVSLLYFNGGEKGVWLASIVSGLYILYAAE
                     RRQLDRILYSDSLLLALLGGYAAYAALILLLDPREFGSRLPSVIVVLAAAALWLRYRP
                     GGTLQSPLRRAALLVTAFALVSTVTGHLADRTTGTDAVLAEVGVGLKTGQLAPDFELG
                     TLGGESVKLSSYRGRTVIVNFWATWCPPCRTEMPHMQAYHAAQPEGGPLILAVNATST
                     EVSEPVVSSWSETWKLTFPVPLDKEGKVTELFGIHSYPTTYVIDKDGIIRYKQAGPMT
                     FEMLEDAAAKAE"
     misc_feature    516287..>516538
                     /locus_tag="PM3016_441"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     misc_feature    516416..516769
                     /locus_tag="PM3016_441"
                     /note="TlpA-like family; composed of  TlpA, ResA, DsbE and
                     similar proteins. TlpA, ResA and DsbE are bacterial
                     protein disulfide reductases with important roles in
                     cytochrome maturation. They are membrane-anchored proteins
                     with a soluble TRX domain containing a...; Region:
                     TlpA_like_family; cd02966"
                     /db_xref="CDD:239264"
     misc_feature    order(516506..516508,516515..516517)
                     /locus_tag="PM3016_441"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239264"
     gene            517054..518457
                     /locus_tag="PM3016_442"
                     /db_xref="GeneID:11882433"
     CDS             517054..518457
                     /locus_tag="PM3016_442"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent malic enzyme"
                     /protein_id="YP_005310561.1"
                     /db_xref="GI:379718430"
                     /db_xref="GeneID:11882433"
                     /translation="MAQTSIILRIELDHNHITFGDVAATIGKAGGDITSIDVIRPGKD
                     SSVRDITVDIAESAEAAVVEALKSHVGIKLINVSDRTFLAHLGGKINIQPTLPIKNRD
                     DLSRVYTPGVARVCTSIHEDPKKAYSLTIKRNTVAVVTDGTAVLGLGDIGPHAAAPVM
                     EGKAMLFKQLAGVDAFPICLDTKDTEEIIRTVKSISPIFGGINLEDISSPRCFEIETR
                     LAEELDIPVFHDDQHGTAVVVVAGLLNALKVVGKKIDSVRIVVNGIGAAGVSICKMLL
                     AAGVTRLVPVDREGAIVRGGSYEHPMWQWLAEQPQVEAEKGTLKEVLRDADVFIGVSR
                     GGLLNADDIQTMAPDRIVFAMANPVPEIDPEEALPHVRVLGTGRSDYPNQINNVLVFP
                     GIFRGALDCRARRINEPMKLAAARAIASVVTESELNEHYIIPSIFNEQVVSKVRRAVI
                     EAAILTGTARRTPKDFR"
     misc_feature    517072..517290
                     /locus_tag="PM3016_442"
                     /note="ACT domains are commonly involved in specifically
                     binding an amino acid or other small ligand leading to
                     regulation of the enzyme; Region: ACT; cl09141"
                     /db_xref="CDD:263730"
     misc_feature    517312..518451
                     /locus_tag="PM3016_442"
                     /note="Malic enzyme [Energy production and conversion];
                     Region: SfcA; COG0281"
                     /db_xref="CDD:223358"
     misc_feature    517312..517710
                     /locus_tag="PM3016_442"
                     /note="Malic enzyme, N-terminal domain; Region: malic;
                     pfam00390"
                     /db_xref="CDD:249824"
     misc_feature    517747..518412
                     /locus_tag="PM3016_442"
                     /note="NAD(P) binding domain of malic enzyme (ME),
                     subgroup 2; Region: NAD_bind_2_malic_enz; cd05311"
                     /db_xref="CDD:133453"
     misc_feature    order(517843..517854,517912..517917,518047..518052,
                     518062..518064,518116..518124,518182..518184,
                     518206..518208,518212..518214)
                     /locus_tag="PM3016_442"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:133453"
     gene            complement(518607..518921)
                     /locus_tag="PM3016_443"
                     /db_xref="GeneID:11882434"
     CDS             complement(518607..518921)
                     /locus_tag="PM3016_443"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310562.1"
                     /db_xref="GI:379718431"
                     /db_xref="GeneID:11882434"
                     /translation="MEQFSLCPRVERGMKLLSKRWAALIMYQLLSGPQRFCTMESALP
                     ISGRLLSERLKDLEAEGIVKRDVFPETPVRIEYSLTDKGRALEPVLKGMEQWSQAWVD
                     PE"
     misc_feature    complement(518640..518879)
                     /locus_tag="PM3016_443"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(518643..518651,518655..518663,
                     518667..518672,518739..518741,518829..518831,
                     518838..518843,518850..518855,518862..518864,
                     518871..518873,518877..518879))
                     /locus_tag="PM3016_443"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(518691..518699,518712..518714,
                     518724..518729,518745..518750,518754..518759,
                     518766..518771,518775..518786,518811..518819,
                     518856..518864,518874..518879))
                     /locus_tag="PM3016_443"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(518670..518672,518808..518810,
                     518817..518819))
                     /locus_tag="PM3016_443"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(519009..519839)
                     /locus_tag="PM3016_444"
                     /db_xref="GeneID:11882435"
     CDS             complement(519009..519839)
                     /locus_tag="PM3016_444"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="YP_005310563.1"
                     /db_xref="GI:379718432"
                     /db_xref="GeneID:11882435"
                     /translation="MKPSITITSSVPSRLLNPASGYLKGYTHTLNPYGGCTFACSYCY
                     VREMPVGKFRGEAWGSWVHIKLEAAERLERELRLAGRKGPLQIFMSSSTDPYQPVEYR
                     TGLTRSLLEVMAASDNPAFLLVQTRSPLVTRDLDLLRSLGSRVRVSLTIETDLEPVRR
                     AFTPSAPPLAARLKALKELVAAGIPAQAAVSPVLPSSPRLADVLASTGVTRLCVDDVF
                     MGDGSQGKRTQRLGLHKLYEALQLEEWNRPDAYLRVIETLKTRFPEESIRISQEGFLP
                     "
     misc_feature    complement(<519255..519752)
                     /locus_tag="PM3016_444"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(519255..519752)
                     /locus_tag="PM3016_444"
                     /note="Radical SAM superfamily; Region: Radical_SAM;
                     pfam04055"
                     /db_xref="CDD:252342"
     misc_feature    complement(order(519267..519269,519396..519398,
                     519459..519467,519558..519560,519564..519566,
                     519570..519572,519708..519716,519720..519722,
                     519726..519728,519732..519734))
                     /locus_tag="PM3016_444"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(519939..520487)
                     /locus_tag="PM3016_445"
                     /db_xref="GeneID:11882436"
     CDS             complement(519939..520487)
                     /locus_tag="PM3016_445"
                     /codon_start=1
                     /transl_table=11
                     /product="MOSC domain-containing protein"
                     /protein_id="YP_005310564.1"
                     /db_xref="GI:379718433"
                     /db_xref="GeneID:11882436"
                     /translation="MARTCYEARVAAVLAARQPKSFVTSREPELAIELGGIPGDRHYG
                     LFRKADSRQSFYPRGTLIANRRQISIVSAEECDLIAGAMGIPEVRPEWLGANLLLEGY
                     PQLTSLPVGSRLLFPEACGLIGEGENPPCKGPGKEIAEALQLPDLAGRFVKAAKHRRG
                     IVCSVEREGRIREGDTVRIFLP"
     misc_feature    complement(519951..520301)
                     /locus_tag="PM3016_445"
                     /note="MOSC domain; Region: MOSC; pfam03473"
                     /db_xref="CDD:251984"
     gene            complement(520638..521600)
                     /locus_tag="PM3016_446"
                     /db_xref="GeneID:11882437"
     CDS             complement(520638..521600)
                     /locus_tag="PM3016_446"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxyltransferase"
                     /protein_id="YP_005310565.1"
                     /db_xref="GI:379718434"
                     /db_xref="GeneID:11882437"
                     /translation="MTRDHHKILDCTIRDGGLVNNWDFSVQFVKDMYYGLSEAGVEYM
                     EIGYKNSAKLLKGAEAGPWRFLNEDFLKEVLPQKTDTKLSALVDIGRVDEKDILPREQ
                     SLLDLIRVACYIKDVDKALDLVQKFHDFGYETTINIMALSHVMENDLNEAFEEIAKSP
                     VDVVYIVDSYGSMDYKDVDYLVSKFQRLLPNKKLGLHMHNNQQLAFSNTIMGAAKGVE
                     FLDTSVYGMGRAAGNCPTELLVSHLKNPKYDLRPVLGIIEKHMVSMREKWEWGYIIPY
                     MIAGVLNDHPRAAMAARAGEDKDKYTEFYDKLTSPEVMPAGAAD"
     misc_feature    complement(520788..521579)
                     /locus_tag="PM3016_446"
                     /note="4-hydroxy-2-oxovalerate aldolase-like, N-terminal
                     catalytic TIM barrel domain; Region: DRE_TIM_HOA_like;
                     cd07944"
                     /db_xref="CDD:163682"
     misc_feature    complement(order(521004..521006,521010..521012,
                     521100..521102,521184..521186,521337..521339,
                     521343..521345,521466..521468,521547..521549,
                     521556..521561))
                     /locus_tag="PM3016_446"
                     /note="active site"
                     /db_xref="CDD:163682"
     misc_feature    complement(order(521466..521468,521556..521561))
                     /locus_tag="PM3016_446"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163682"
     misc_feature    complement(order(521004..521006,521010..521012,
                     521100..521102,521556..521558))
                     /locus_tag="PM3016_446"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163682"
     gene            521953..522447
                     /locus_tag="PM3016_447"
                     /db_xref="GeneID:11882438"
     CDS             521953..522447
                     /locus_tag="PM3016_447"
                     /codon_start=1
                     /transl_table=11
                     /product="MutT/Nudix family hydrolase"
                     /protein_id="YP_005310566.1"
                     /db_xref="GI:379718435"
                     /db_xref="GeneID:11882438"
                     /translation="MLEYNVAFLRRGDLLLMLNRSKPPLLGLWNGVGGKLEPGESPLE
                     SVLREIGEETGLALKEDAIRFGGIVTWEIDGRMAGGMYAYTADAGSGDLGGLPRETAD
                     GILAWKPAAWVLNPENRGVAGHVQYFLPPMLEKSPAAEYRCLFREGQLLTCECLPLDL
                     SLYT"
     misc_feature    521959..522357
                     /locus_tag="PM3016_447"
                     /note="MutT homolog-1 (MTH1) is a member of the Nudix
                     hydrolase superfamily. MTH1, the mammalian counterpart of
                     MutT, hydrolyzes oxidized purine nucleoside triphosphates,
                     such as 8-oxo-dGTP and 2-hydroxy-ATP, to monophosphates,
                     thereby preventing the...; Region: MTH1; cd03427"
                     /db_xref="CDD:239519"
     misc_feature    order(521962..521964,521968..521970,522040..522042,
                     522055..522057,522094..522099,522106..522111,
                     522163..522165,522187..522189,522193..522195,
                     522253..522258,522304..522306,522310..522312)
                     /locus_tag="PM3016_447"
                     /note="putative active site [active]"
                     /db_xref="CDD:239519"
     misc_feature    order(521962..521964,521968..521970,522040..522042,
                     522055..522057,522094..522099,522106..522111,
                     522163..522165,522187..522189,522193..522195,
                     522304..522306,522310..522312)
                     /locus_tag="PM3016_447"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239519"
     misc_feature    522052..522120
                     /locus_tag="PM3016_447"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239519"
     misc_feature    522253..522258
                     /locus_tag="PM3016_447"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239519"
     gene            522570..523958
                     /locus_tag="PM3016_448"
                     /db_xref="GeneID:11882439"
     CDS             522570..523958
                     /locus_tag="PM3016_448"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="YP_005310567.1"
                     /db_xref="GI:379718436"
                     /db_xref="GeneID:11882439"
                     /translation="MRRIASLTLTSLLMLSLSPLLAHGAEPAKPKGSASPAVSVLTDT
                     YGGVRMEVQPGEVKKETPKDGRPENKVILDRTKLKEAFGRLKDQAAGQPAVTAVIPST
                     ESTVKIHIADAVLDEARQTVPGAYLLLQLPEVSYKLPVGFSAKAAEELKVPPANVTVI
                     VTIKSMPDSALGTARERLKAAGASEILPAPVDFKITGQRTNGQTVDLTRVGSAYVQRV
                     LTLPASVDPSTVTAVTYANGEISFVPALFNYNQATVLSPGGGWFTIVSSSKEFTDTAG
                     HWAEADIRLLASKLLVKGTSASEFSPDKPVTRAEFAAMLTRALGLPDNRGASAKYSDV
                     GKYTWFAGPVGAASAAGLVDGYDDGTFKPNARISREQMAVMLTKARAYGSGLQGLPKT
                     VDLSAVSIPVFEDGAKIASWASEPVTEVLAVGLMEGVTPEKFAPKENATRAQAVVLLK
                     RLLVSLKLVNPV"
     misc_feature    523380..523505
                     /locus_tag="PM3016_448"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    523557..523688
                     /locus_tag="PM3016_448"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    523776..523907
                     /locus_tag="PM3016_448"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            complement(524051..524365)
                     /locus_tag="PM3016_449"
                     /db_xref="GeneID:11882440"
     CDS             complement(524051..524365)
                     /locus_tag="PM3016_449"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310568.1"
                     /db_xref="GI:379718437"
                     /db_xref="GeneID:11882440"
                     /translation="MPSPHPDDVQANKWIAAASYLLFFLPLLAARDSRYAMYHANQGL
                     LLLLTAIGANLVLGLIPLLGLLLLPVANLALLVLMLIGILNAINGLTKPLPLIGGATL
                     LR"
     gene            524437..524982
                     /locus_tag="PM3016_450"
                     /db_xref="GeneID:11882441"
     CDS             524437..524982
                     /locus_tag="PM3016_450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310569.1"
                     /db_xref="GI:379718438"
                     /db_xref="GeneID:11882441"
                     /translation="MVYTILCQRKARYVCRTGISFLPQGKAIWETIPDQVSGKEAMGM
                     NSAPITFEFESRKAALLAMDTMEELGYRTALHDEPQKPLLHVIVDKGDITSALEIAEA
                     HGGRLIETADFPNEPAVFAMAYDPDGGIIIPAHLVGPDEVDISAAAYGGGPGSAYTNE
                     DDDTFDPSREDYNGFDAGIHL"
     gene            525286..526182
                     /locus_tag="PM3016_451"
                     /db_xref="GeneID:11882442"
     CDS             525286..526182
                     /locus_tag="PM3016_451"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310570.1"
                     /db_xref="GI:379718439"
                     /db_xref="GeneID:11882442"
                     /translation="METYDSLKEGERGAWVSIAAYILLSIFKISMGYMTGSEALTADG
                     INNTTDIIVSVAVLAGLRISRKPPDEDHRYGHMRAETIASLVASFIMALAGLQVMIQA
                     GRSFLNGQHEAPDLLAAWIALGCAAIMWGVYTYNRRLAKRINNQSLMAAAYDNRSDAL
                     VSVGAAAGIIGARFGFPVLDAVAALAVGVVILKTAWEVFSDASHALTDGFDDQKLEVF
                     QQTVESTPGVKRIKDIRARVHGSHVLLDVVVEVSAELSVGESHDISDEIERRMADEHH
                     ISNVHVHIEPYSDSERERQQMT"
     misc_feature    525286..526170
                     /locus_tag="PM3016_451"
                     /note="Predicted Co/Zn/Cd cation transporters [Inorganic
                     ion transport and metabolism]; Region: MMT1; COG0053"
                     /db_xref="CDD:223131"
     gene            526449..532313
                     /locus_tag="PM3016_452"
                     /db_xref="GeneID:11882443"
     CDS             526449..532313
                     /locus_tag="PM3016_452"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310571.1"
                     /db_xref="GI:379718440"
                     /db_xref="GeneID:11882443"
                     /translation="MTNSTKSTQVDMAARMYRNFRQSTAMVSKTVVTCMLGTTLLTAA
                     LGAADSAYAALPAEGAALPLSGAVYGSGGQGAASPLTDLDGSYAKKEILALAEAGVVS
                     GYEDGTFAPTQGMTRAEMAKIIAKAMGLAEDPSYAEKFTDIAADSWYKGYVGALLKAG
                     ITQGTSETAFSPDSSVTREELVVFFVRAFGLEKAAEAYDGPSVFTDQASISPWALPHV
                     HLAYGMGFIGGVASSDGTLRFDPRVQAERQALARLAYEYIGKKQDYVAKAKELVAAGQ
                     QPGKDAPKAEDPAPVSTASAGGSAAAGGGGGGGGSSSSKKTERALEQALASLAIGFAS
                     GDSEQNVRNPIALPATVVYKENGSKDKTVPVSWTSSNQDIVGADGMVNRPAAGQPDVQ
                     VVLTASVQKGSSKASRNYELTVKALTSPVPDPDPQPDPDPKPDPQPTGLIRSISGVHT
                     EETRAAEGLQLVEFQVELSKQVEEASEIPHTIMLGDDTFQVLVWQEGEQRQQIPISFL
                     DVYNREGTSVIVRLHEENNVGPAVQYGQKYTVELRAGNGEVAGSKFFQIGLQPTEVKV
                     EDHDETPGVDGRDFSVTWSPSAWEEAELQQVYILPVETELDRSKHRAVAEFRDRTSHS
                     WTGSVNTADSAGQALALKEYAIVVVSSTADAESSEAVTFVPDGIITAQPAVETKVYNN
                     GGELLGRGEPNTFVYLKDNRGRLVGDAKADGSGRFKILLPTFFMGEEGAVLTVSAKSA
                     GKLESTGVSVPVVAGTKSVISGLQAQIYEDGGAIHIPREFRGSVRVSAGDGTVLAEEF
                     IYDYEYSPFTIMLNQPWQTAKLNAGERIAVRVQEYRKSPSDPVYFEVKPLEGVTNKPV
                     VTGTVYNALSRIELEVEDYSAAISLRRSNGSLLWHGFRGGYDSLSINGLLLIPGEHIS
                     LTADEFGKAESEPVILEVMTGERTKLDSVTGIVYEDGGTFTGSFSSDSEVTYRVKKWD
                     GTFVTAVTNVSGPDTSSANFKGTYTVGEQVFVTARSKGQQASKELALIVQKGSDTKTA
                     VPVVDNVYGTAYEVSGMAEPNAYVKVTRPDGTIFEGFASIHGYFYIPLNDALAVAGET
                     LKVTADAPGKLESDIQEITVLNALQTPVPTVTVSVYNGVVSKLHVVSKPNAFVWVIDE
                     NGSQVAGNMADGNGISDIVLGEYPSGNKLYVKALYYGWEESAPYVVDRGVTTPSSKPS
                     VTGVVYTDGYLLEGTAGPNSWTQLFSGGTSIGETISDQEGRFELGHNGNDWLYAGEVV
                     QVTSQEPYRSVSPPVEFVVQPEQGKTEAPTVIGDVYENTNWLSVQTVRGALVILRDNE
                     GKVISQNYADFEGRADLRFYPWIRQGNTFKLTSDAIGRTVSDAVVVNVIPPPPTTKPY
                     AVTSAVYVDGGEVRGYTEAYAAVELKRTDGSVIARGSASYDGSFFLRTQPLQLANGEI
                     LALIAKAWDKSVSEAYSVTVQGIVYGQTAQPSVSGAVYETVGNLRIEAGPRQWVRAYS
                     ESEGQLFWEWTGDYPYWYRYINLTNQKVGTKVYVYADAFGQTESEPVVYTVQPSPQTA
                     KPSVIGSVYATSNSITVSLSDYPGDSTYIRIKRADGQLVASNWAYSSTAQLSPWHTLI
                     EGEILYVTAQDTFKKESDPFLVTVQAAPMTVTPSVYGSVYEDGGVITGTAAKYASVRV
                     FTGDNSYITTGYADYWGSYRIDLTSYTFNPGAVLWVEAQASGYKPSYRVYLNVLPVAG
                     QTAAPTVNGTVYQSDSYALSGYAAPYSKITVTREDGASFTAWSGEYGNFWAYYPSSYN
                     WLHGASELKITADTYGKLVSEPLIVPVVSKKTPAPGVAVSVYGSTYTLSGYMHQLTIL
                     RISDGYGLDLTSVEVGSFTWDIPAYMIQGNRLMLTGQWNNYSVSDVVYLTLPYNSSAV
                     GGNVYGGGSSVSGSVYGFSTGGSTASSTSSPAPADAAYQAFAAAAAVLPQRRAA"
     misc_feature    526683..526811
                     /locus_tag="PM3016_452"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    526863..526994
                     /locus_tag="PM3016_452"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            complement(532409..533605)
                     /locus_tag="PM3016_453"
                     /db_xref="GeneID:11882444"
     CDS             complement(532409..533605)
                     /locus_tag="PM3016_453"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310572.1"
                     /db_xref="GI:379718441"
                     /db_xref="GeneID:11882444"
                     /translation="MNRISSSVSRSLRSLYVSQFLSAFADNAVFFVILGVLSARGSAN
                     PEEGMLGVQLGFLLAYVVLAPFVGTFADKNRKSRVLLIGNLLKTAGTLLLFTSFPPAA
                     AYALVGVGAVVFSPAKYGVLTDITGEDKAQLYRANGNLESYTILAILLGTVAGGWLAS
                     LAPALGITVCVLLYLASSVLTPLISCREGNPELRYGASAASFFREVRILFAEPKSRFS
                     LVGTSAFWMTSSVLRITFLIWIAQYLGVQNQLLQSGIIGATGVGIVIGALLTPRLVRI
                     EKFYRAYLFGFLMLAAILLALLPVHLVLTIILLLLIGILGGLFIIPMNTVLQDQGKNL
                     VGSGKTIAIQNFSENLFMIGGVGLAKLLIAGGLNVSLTTAGIALVFGALVWYLKGMVP
                     RLKQAV"
     misc_feature    complement(532442..533560)
                     /locus_tag="PM3016_453"
                     /note="lysophospholipid transporter LplT; Provisional;
                     Region: PRK11195; cl19150"
                     /db_xref="CDD:267503"
     gene            complement(533611..535767)
                     /locus_tag="PM3016_454"
                     /db_xref="GeneID:11882445"
     CDS             complement(533611..535767)
                     /locus_tag="PM3016_454"
                     /codon_start=1
                     /transl_table=11
                     /product="AAS bifunctional protein"
                     /protein_id="YP_005310573.1"
                     /db_xref="GI:379718442"
                     /db_xref="GeneID:11882445"
                     /translation="MPVILWILKWCLTAAFRLKVKGLEKLDFSGPAILMPNHLSLLDA
                     VLLALYLPKEVTFVVNTRIAARFAPFIRLRRHITVDPLNPYSVRRMVKVVAGGTPLLL
                     FPEGRITTTGGLMKIYSGVGYIALRTGAALYPIALNGLERSKASYLGRKLRTVWFPAV
                     SIDVGEPLRIEWDRSQSMRRQKEAAADRIGRALQEQLLRSRLKPEANLFDEVLEAGRR
                     HGLGAAACEDPSGVLSYRKLLTGAYALSRGLAPLLQGQKTAAVLLPNASAGAVTLLAL
                     FRLGRTPALLNFSAGRQAVLDACETAEVRTVLTSRTFIEKAGLEAMAADLSSRVRVIY
                     LEDLKASLGAVVKLGALLDLFLGRKAASGAGLPTVILFTSGSESKPKGVVLSHGNLYA
                     NVQQARASIDFTSSDSVFNALPLFHSFGLTAGTLLPLLTGMRVYLYPSPLHYKVIPEL
                     VYDRNATILFGTSTFLAAYGRTAHPYDFHALRYVVAGAEKLKDEVRTLWNDKFGIRIL
                     EGYGATETAPVLSLNTPLHYRKGTVGRFLPGIEYKLESVPGVPGGSLYVKGPNVMQGY
                     LLHGKGFTPCPEWYGTGDIVELDGDGFVSIVARLKRFAKIGGEMISLNAVEQAAADCF
                     GDETAAAVALPDPRKGERIVLFHTRPGAERARLSAYLADKGITSLLLPERLVCVASLP
                     LLGSGKTDYASLQRMAAELARPGASGPQTHIPPKEA"
     misc_feature    complement(533668..535758)
                     /locus_tag="PM3016_454"
                     /note="bifunctional acyl-[acyl carrier protein]
                     synthetase/2-acylglycerophosphoethanolamine
                     acyltransferase; Validated; Region: PRK08043"
                     /db_xref="CDD:181207"
     misc_feature    complement(535177..535740)
                     /locus_tag="PM3016_454"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    complement(order(535444..535452,535582..535593,
                     535639..535641,535645..535647,535654..535656))
                     /locus_tag="PM3016_454"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     misc_feature    complement(533674..535080)
                     /locus_tag="PM3016_454"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(order(534625..534630,534634..534651,
                     534658..534660))
                     /locus_tag="PM3016_454"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(533704..533706,533938..533940,
                     533971..533973,533980..533982,534016..534018,
                     534226..534243,534304..534309,534649..534651))
                     /locus_tag="PM3016_454"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(533761..533763,533938..533949,
                     533971..533973,533980..533982,534016..534018,
                     534226..534243,534304..534309,534364..534366,
                     534373..534378,534382..534384,534526..534531,
                     534649..534651))
                     /locus_tag="PM3016_454"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(533761..533763,533782..533784,
                     533941..533949,534307..534309,534364..534366,
                     534373..534378,534529..534531))
                     /locus_tag="PM3016_454"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            complement(536100..537365)
                     /locus_tag="PM3016_455"
                     /db_xref="GeneID:11882446"
     CDS             complement(536100..537365)
                     /locus_tag="PM3016_455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310574.1"
                     /db_xref="GI:379718443"
                     /db_xref="GeneID:11882446"
                     /translation="MSYDVIIIGGGPSGLMAAIAASRHGARTLLIDKGDKLGRKLGIS
                     GGGRCNVTNAKDPEEIIKHIPGNGRFLYSAFATFSNRDIIAFFEDLGIALKEEDRGRM
                     FPVSDRAKTVVDALVGQVRRQGVTIRVNTPVKRVMYRDGAVAGVELRGGERIESRAVI
                     IATGGKSVPQTGSTGDGYPWAEEGGHTITELYPTEVPLTSRESFIKSRELQGLSLRDI
                     TLSVWNPKGKKLIEHEGDLLFTHFGLSGPVALRCSQFVVKTKKQFNVPTVRVTIDMFP
                     DRSADELYTETLRLAEQEPKKAVKNVLKGTLPERMIPLILTKAGLKEETTFANIPKQP
                     WLEMAKLLKAFPVEVNGTLSIEEAFVTGGGVNLKEVDPRTMESKLTGGLFFCGEVLDI
                     HGYTGGYNITAAFTTGYTAGKSAAENCGS"
     misc_feature    complement(<537264..537365)
                     /locus_tag="PM3016_455"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(536124..537359)
                     /locus_tag="PM3016_455"
                     /note="HI0933-like protein; Region: HI0933_like;
                     pfam03486"
                     /db_xref="CDD:251995"
     misc_feature    complement(536118..537293)
                     /locus_tag="PM3016_455"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            537561..537797
                     /locus_tag="PM3016_456"
                     /db_xref="GeneID:11882447"
     CDS             537561..537797
                     /locus_tag="PM3016_456"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310575.1"
                     /db_xref="GI:379718444"
                     /db_xref="GeneID:11882447"
                     /translation="MTLTSVESPDWQYQQRDCMLLDAMEQRIVRLTQKNTTLLGVVTQ
                     NTEALELTKVAVTSNKNRLRQLWRQLSELRIHNH"
     misc_feature    <537615..>537779
                     /locus_tag="PM3016_456"
                     /note="Site-specific recombinase; Region: SpecificRecomb;
                     cl15411"
                     /db_xref="CDD:265691"
     gene            538005..539744
                     /locus_tag="PM3016_457"
                     /db_xref="GeneID:11882448"
     CDS             538005..539744
                     /locus_tag="PM3016_457"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyl-accepting chemotaxis protein"
                     /protein_id="YP_005310576.1"
                     /db_xref="GI:379718445"
                     /db_xref="GeneID:11882448"
                     /translation="MKMTVGKKIFGGFALLLVLLLVVGLFGVNQMNRLYKQAEEMNVS
                     WMPGVSTSKEIESVTQEIVSKMFLVVVESDVQRATELTKQIDEHFKQIDTEMAAYEAT
                     ILDELYPEDRHNFEELKKEISGLKSAIEESKKLAADVNLEAGVGSRIGEVNNMIKSLT
                     DRLRASNEILDKVTKFNDDGAVRLAKLAAETNESARGVIFTVIAAAILIGLVMAYLIA
                     RNISRPMIQASEALGRVAAGDLTVEPLKVKSRDEIGQLAEAFNRMTADMNAMVSQIKV
                     SSEMVAASAEQLLASAEQSSKAAESVADGSQEASDYTEKQMQSVEELFNALSEVSAGM
                     QQISGNGEIMLTMVRETNELSDRGGRAVQAIAEQMNEINQTSEESSRMIRMLGEQSKQ
                     IGNIVTLITGIANQTNLLALNAAIEAARAGEHGKGFAVVAGEVRKLAEQSVQSAAQIT
                     SLVESIQRDTDKVILSVERGTDKVYEGIRKAEDVRDAFTEIKESIQTVSVKVEEVTHS
                     VEDMTASSEEMTATIETVSTASEQIATASQTNAAASQQQLASMQEISASSQSLAHLAE
                     ELNEVLARFKTNK"
     misc_feature    538095..>538397
                     /locus_tag="PM3016_457"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    538458..539735
                     /locus_tag="PM3016_457"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    538665..538793
                     /locus_tag="PM3016_457"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(538665..538670,538677..538682,538686..538691,
                     538698..538703,538707..538709,538758..538763,
                     538767..538772,538779..538784,538788..538793)
                     /locus_tag="PM3016_457"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    538989..539585
                     /locus_tag="PM3016_457"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(539010..539015,539022..539027,539034..539036,
                     539043..539048,539052..539057,539064..539066,
                     539073..539078,539085..539087,539094..539099,
                     539106..539111,539118..539120,539127..539132,
                     539136..539141,539151..539153,539157..539162,
                     539169..539171,539178..539183,539190..539195,
                     539202..539204,539211..539213,539220..539225,
                     539232..539234,539244..539246,539253..539255,
                     539274..539276,539286..539288,539295..539297,
                     539304..539309,539316..539318,539325..539330,
                     539337..539342,539346..539351,539358..539363,
                     539400..539405,539412..539414,539421..539426,
                     539433..539435,539442..539447,539451..539456,
                     539463..539468,539475..539477,539484..539489,
                     539496..539498,539505..539510,539514..539519,
                     539526..539531,539535..539540,539547..539549,
                     539556..539561,539568..539570,539577..539582)
                     /locus_tag="PM3016_457"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    539220..539321
                     /locus_tag="PM3016_457"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(539953..541281)
                     /locus_tag="PM3016_458"
                     /db_xref="GeneID:11882449"
     CDS             complement(539953..541281)
                     /locus_tag="PM3016_458"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310577.1"
                     /db_xref="GI:379718446"
                     /db_xref="GeneID:11882449"
                     /translation="MSSDPLPLLLNVVLIVVLVLLNGFFVAAEFAMVKVRNSRIDVLA
                     QSGNLSARLAQKIMANLNAYLSACQLGITLASLGLGWVGEPVIADALEPVLKGWLGLS
                     DTVVHTVSFLVAFSLITTLHITLGEQFPKTYAIRQSENVTLWAAMPLVVMYKVMYPFI
                     WILNGISNWMLKRVGIEPATEHESAHTDEEIRVLVKESHKSGFIDNTELTLFDNIFEF
                     SETNAREIMIPRTEMGCLYANLSFQENLDIALNEMRTRYPVCDPDKDNIIGFVHIKDL
                     LKAQGKVDDIRSIARPITKVPESMPISTLLKLMQKKKGQIALLIDEYGGTSGLVTIED
                     ILEEIVGEIQDEFDPDPRPSVEIRDDDSYSIDGRLLIDEVNEQFGLEIESEDYDTIGG
                     WIYSQVEIPPKQGQSIRYGDTYEFVIEETDDLRIARLTVKRLEAQQTQSA"
     misc_feature    complement(539977..541215)
                     /locus_tag="PM3016_458"
                     /note="Hemolysins and related proteins containing CBS
                     domains [General function prediction only]; Region: TlyC;
                     COG1253"
                     /db_xref="CDD:224173"
     misc_feature    complement(540658..541215)
                     /locus_tag="PM3016_458"
                     /note="Domain of unknown function DUF21; Region: DUF21;
                     pfam01595"
                     /db_xref="CDD:250731"
     misc_feature    complement(540268..540591)
                     /locus_tag="PM3016_458"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    complement(539980..540210)
                     /locus_tag="PM3016_458"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     smart01091"
                     /db_xref="CDD:215020"
     gene            541643..542626
                     /locus_tag="PM3016_459"
                     /db_xref="GeneID:11882450"
     CDS             541643..542626
                     /locus_tag="PM3016_459"
                     /codon_start=1
                     /transl_table=11
                     /product="cation diffusion facilitator family transporter"
                     /protein_id="YP_005310578.1"
                     /db_xref="GI:379718447"
                     /db_xref="GeneID:11882450"
                     /translation="MPNLWQAIRKGNTSSGIAALGNAGLAVLKGVAAFFSGSGAMFAS
                     AMHSIADAVNQGFVFAGSVLAERKPTKRFPAGFGRVINIFCMIAVIVVTVMAYETVKE
                     GFHLLQHPAESEGFWLSFVILLAAIAVDGGVLIKAMHEILKETRVEAHGMDVIPAAFR
                     NVGRAAPPTRLVFYEDIVATTGAVLALAAVVIAEFTPLKVFDGIATILIGLLMVIVAF
                     KVGFDNMAGLIGVAAPVEVETKVSELILGDPDVRDINTLRIIQEGRFYHVDGYIELRR
                     GLALAEADDIKFRVRDKLLADIDIADVTLGIIEDNGIQTWNLEELRGESRG"
     misc_feature    541712..542578
                     /locus_tag="PM3016_459"
                     /note="Cation efflux family; Region: Cation_efflux;
                     pfam01545"
                     /db_xref="CDD:250696"
     gene            543210..543341
                     /locus_tag="PM3016_460"
                     /db_xref="GeneID:11882451"
     CDS             543210..543341
                     /locus_tag="PM3016_460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310579.1"
                     /db_xref="GI:379718448"
                     /db_xref="GeneID:11882451"
                     /translation="MAKNKKNRSNNSKEQEMHENSNGQANAAGVMDKRLSGPNRPAE"
     gene            543355..543792
                     /locus_tag="PM3016_461"
                     /db_xref="GeneID:11882452"
     CDS             543355..543792
                     /locus_tag="PM3016_461"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310580.1"
                     /db_xref="GI:379718449"
                     /db_xref="GeneID:11882452"
                     /translation="MTTPNRPGGHDPEGYDHVNTDIEYNAKNDPALDPFEIEFKPEYQ
                     SGRGPREAFVNEHGVLIGDHDYTSANSPLEQWSKDTDPSIMSGDEWVHPYKDVGFQTA
                     ENRDIFERGIPPKADRFMHPDKDVAYDAFQPGEADPQRSEDGR"
     misc_feature    543439..543678
                     /locus_tag="PM3016_461"
                     /note="Protein of unknown function (DUF3905); Region:
                     DUF3905; pfam13045"
                     /db_xref="CDD:205226"
     gene            543920..544354
                     /locus_tag="PM3016_462"
                     /db_xref="GeneID:11882453"
     CDS             543920..544354
                     /locus_tag="PM3016_462"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310581.1"
                     /db_xref="GI:379718450"
                     /db_xref="GeneID:11882453"
                     /translation="MSMSFERYMMDMVQPMRDELTRIGIQELRTPEEVTEALENMKGT
                     ALVVVNSVCGCAAGQCRPGVTKALQHEVKPDHLYTVFAGQDKEATAKAREFFAPYPPS
                     SPSIALMKDGELVHFIQRHQVEDRSAEMIANDLIGAFETYCK"
     misc_feature    543941..544348
                     /locus_tag="PM3016_462"
                     /note="bacillithiol system oxidoreductase, YphP/YqiW
                     family; Region: YphP_YqiW; TIGR04191"
                     /db_xref="CDD:234494"
     gene            544595..545404
                     /locus_tag="PM3016_463"
                     /db_xref="GeneID:11882454"
     CDS             544595..545404
                     /locus_tag="PM3016_463"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD+ synthetase"
                     /protein_id="YP_005310582.1"
                     /db_xref="GI:379718451"
                     /db_xref="GeneID:11882454"
                     /translation="MSLQQEIIAKLGVKPEINVQEEIRKRVDFLKEYVLKAGVDGLLI
                     AISGGIDSAVATGLCKRATDELTEEKGREYKTLGVFQPYGTQEDIADSYATAEAFNLK
                     YKVETNIEEAVNEMALETEHALKSIGVHQHVSRGGKGNIKARTRMVVQYALAFDLNLL
                     VVGTDHASEAITGFFTKWGDGAVDITPLRTLNKRQVRALARELGVPKSVLDKAPTAGL
                     WEGQTDEKELGITYEDNSDYLEGKQIADEVREKLEKHYLRTEHKRTDIPGI"
     misc_feature    544643..545383
                     /locus_tag="PM3016_463"
                     /note="NAD+ synthase is a homodimer, which catalyzes the
                     final step in de novo nicotinamide adenine dinucleotide
                     (NAD+) biosynthesis, an amide transfer from either ammonia
                     or glutamine to nicotinic acid adenine dinucleotide
                     (NaAD). The conversion of NaAD to NAD...; Region:
                     NAD_synthase; cd00553"
                     /db_xref="CDD:238309"
     misc_feature    order(544667..544672,544679..544681,544688..544693,
                     544898..544909,544919..544924,544931..544936,
                     545003..545005,545015..545017,545024..545029,
                     545033..545041,545045..545053,545057..545062,
                     545123..545128,545135..545152,545159..545164,
                     545375..545377,545381..545383)
                     /locus_tag="PM3016_463"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238309"
     misc_feature    order(544724..544735,544748..544750,544829..544837,
                     545000..545002,545012..545014,545021..545026,
                     545030..545032,545084..545086,545099..545101,
                     545114..545125,545132..545134,545237..545242,
                     545246..545248,545273..545275,545375..545380)
                     /locus_tag="PM3016_463"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:238309"
     misc_feature    order(544727..544735,544745..544750,544832..544837,
                     545030..545032,545084..545086,545171..545173,
                     545234..545239)
                     /locus_tag="PM3016_463"
                     /note="ATP binding pocket [chemical binding]; other site"
                     /db_xref="CDD:238309"
     misc_feature    order(544733..544735,544745..544747,545099..545101,
                     545237..545239)
                     /locus_tag="PM3016_463"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:238309"
     misc_feature    order(545225..545248,545255..545278)
                     /locus_tag="PM3016_463"
                     /note="active-site loop [active]"
                     /db_xref="CDD:238309"
     gene            complement(545514..546422)
                     /locus_tag="PM3016_464"
                     /db_xref="GeneID:11882455"
     CDS             complement(545514..546422)
                     /locus_tag="PM3016_464"
                     /codon_start=1
                     /transl_table=11
                     /product="manganese catalase"
                     /protein_id="YP_005310583.1"
                     /db_xref="GI:379718452"
                     /db_xref="GeneID:11882455"
                     /translation="MITRHNKLQIELPKSPYSDPNAASAVQELLGGKFGEMSTLNNYM
                     FQSHNFRGKKKLKPFYDLVASITAEEFGHVELVSHTINMVLTGERRDTYPGDPDIGPM
                     RNAKDKRYSLHFIPNAQTAYVADSQGRPWVGDNVFNSGNLVLDLLHNFFLECGARTHK
                     MRVYEMTDHPTARHMIGYLLVRGGVHIIAYAKALEVATGVDVTKMLPIPSLENKYFDE
                     ARKFEAIGEHRKLYTFSPDDYRDIALIWKGQHPEDGSPLETVFGSPPGAPIPDLPEVP
                     EEFAPGISAEDFLQIAKRLQSNAGMK"
     misc_feature    complement(545838..546422)
                     /locus_tag="PM3016_464"
                     /note="Manganese catalase, ferritin-like diiron-binding
                     domain; Region: Mn_catalase; cd01051"
                     /db_xref="CDD:153110"
     misc_feature    complement(order(545865..545867,545964..545966,
                     546204..546206,546213..546215,546315..546317))
                     /locus_tag="PM3016_464"
                     /note="dimanganese center [ion binding]; other site"
                     /db_xref="CDD:153110"
     gene            complement(546532..547884)
                     /locus_tag="PM3016_465"
                     /db_xref="GeneID:11882456"
     CDS             complement(546532..547884)
                     /locus_tag="PM3016_465"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="YP_005310584.1"
                     /db_xref="GI:379718453"
                     /db_xref="GeneID:11882456"
                     /translation="MEHRDKVRLLEADRRYVWHPFTQMKDYAERDPVLIERAEGVFLY
                     DADGKAYYDTNSSWWVNVHGHAHPRIREAVNRQMAKMDHVMFAGLTHAPGIELAERLT
                     ALTPDGLTKVFYSDNGSTAVEVALKMSFQYWQQTGCPDKTTFAYVEHSYHGDTIGAVS
                     VGGVDQYHSVFRPLLFGAHKVPSPDPRGRQDGDAEAAAAQALEAVRHLFEASAGEIAA
                     LIVEPMIQAAGGMILHPASYVRGLRELCTQYGVHLIADEVAVGFGRTGRMFACEHAGI
                     SPDFLCLSKGLTAGMLPLSVTMTTAGIYDAFYDDYAKLKTFTHGHSFTGNPLACAVAL
                     ESLRIFEEEGVLEQAAAAASHLQQAAARLAADPGVAHLRGLGMVAAFDLYRDRDSGER
                     YPWEERIGFRVYEEGLQQGLFLRPLGDTIYFWLPLCTTAAQIDDILGRTEKVLQRMSR
                     "
     misc_feature    complement(546544..547863)
                     /locus_tag="PM3016_465"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    complement(546550..547860)
                     /locus_tag="PM3016_465"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(547030..547032,547108..547113,
                     547117..547119,547219..547221,547423..547425,
                     547429..547434,547528..547536))
                     /locus_tag="PM3016_465"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(547030..547032,547108..547110,
                     547117..547119,547219..547221,547429..547434,
                     547528..547533))
                     /locus_tag="PM3016_465"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    complement(547030..547032)
                     /locus_tag="PM3016_465"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            547980..548381
                     /locus_tag="PM3016_466"
                     /db_xref="GeneID:11882457"
     CDS             547980..548381
                     /locus_tag="PM3016_466"
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="YP_005310585.1"
                     /db_xref="GI:379718454"
                     /db_xref="GeneID:11882457"
                     /translation="MIIGIGTDLLDIARVQAILKQPSGERFLQRVLTPAERELAAGRG
                     GRLAEFTAGRFAAKEAVVKALGCGIGREVGFGDIEVLPDAKGKPHCRLSEASLGRLAA
                     GGTDVRGLIVHLSITHSDTAAMAYAMAELRA"
     misc_feature    547980..548369
                     /locus_tag="PM3016_466"
                     /note="4'-phosphopantetheinyl transferase; Provisional;
                     Region: acpS; PRK00070"
                     /db_xref="CDD:234610"
     gene            complement(548529..548912)
                     /locus_tag="PM3016_467"
                     /db_xref="GeneID:11882458"
     CDS             complement(548529..548912)
                     /locus_tag="PM3016_467"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c class I"
                     /protein_id="YP_005310586.1"
                     /db_xref="GI:379718455"
                     /db_xref="GeneID:11882458"
                     /translation="MIIKKTIQIVLLIGAAAAMLAACGPKNSPEPFGGGKNAADTAAA
                     AKAMEGASEPVQALYKQRCLSCHGGALEGKVGPSTNLQQVGGRFTKEQIAAQIARGGG
                     GMPGFQDKLSAEEIEGLSAWLAGKK"
     misc_feature    complement(548544..548747)
                     /locus_tag="PM3016_467"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     gene            complement(548909..549517)
                     /locus_tag="PM3016_468"
                     /db_xref="GeneID:11882459"
     CDS             complement(548909..549517)
                     /locus_tag="PM3016_468"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310587.1"
                     /db_xref="GI:379718456"
                     /db_xref="GeneID:11882459"
                     /translation="MKQGDLIARSASGPALRSALRDRHRLAAASYAPWLLVWGAERAV
                     NAGLRFAEPWREAGRLPAGLFLAALLVSLSLLLWEKLRRRAPAGVPARLLPATLVRSL
                     AVVLGLSALYLAGSRMSLWGLTPYDSALLPGFVLASAYLVLGRRLGWPLTVLGVWMLA
                     LTAVTAWKYLGFAPILVSGLGGLSLMAVAGLLRLWTRGMRYQ"
     gene            complement(549607..550461)
                     /locus_tag="PM3016_469"
                     /db_xref="GeneID:11882460"
     CDS             complement(549607..550461)
                     /locus_tag="PM3016_469"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005310588.1"
                     /db_xref="GI:379718457"
                     /db_xref="GeneID:11882460"
                     /translation="MLTPGELAARLNKLVVSILLVGHQKCESHWHQKSRSIKYHSVWL
                     IIKGRGTFTIGGTHYPAEPGKLFCFTPGMVVERTTDPEQPLEYYFLRFHYTECYEEKE
                     QWIYRNAAESKFPLEGMYTVTNTPQLIYQMEQLDLLWKRRGHMTAMRRKIVLQDFFLT
                     LVADFRAQKIAGDTTAAIELTQDYMIGHYREPLTLETLAQMAGLSVSHYSRLFKKYIG
                     YSPIDYLTHLRVDRAKELLVLSDYRLKSIAGSVGYTDEFYFSRIFKKVTGESPREYAK
                     KHRFFPTS"
     misc_feature    complement(<550183..550377)
                     /locus_tag="PM3016_469"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:145456"
     misc_feature    complement(549625..549993)
                     /locus_tag="PM3016_469"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(549784..549909)
                     /locus_tag="PM3016_469"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(549640..549744)
                     /locus_tag="PM3016_469"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            550539..551690
                     /locus_tag="PM3016_470"
                     /db_xref="GeneID:11882461"
     CDS             550539..551690
                     /locus_tag="PM3016_470"
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific adenine glycosylase"
                     /protein_id="YP_005310589.1"
                     /db_xref="GI:379718458"
                     /db_xref="GeneID:11882461"
                     /translation="MYSTEQKQYFSEKLLSWYRRHKRDLPWRRSRNPYHIWISEIMLQ
                     QTRVETVIPYFHRFVDKFPTVEALAEAPEDEVLKAWEGLGYYSRARNLQSAVREVQER
                     YGGVVPDTKEEVFALKGVGPYTAGAILSIAYNKPEPAVDGNVMRVLSRYFLIEEDIMK
                     GSTRVLMEKLAKELIPEGAAGDFNQGLMELGAMVCTPKSPHCLTCPVMLHCSGRAAGM
                     EAELPVKKKAKPPRPESRYVALLEGTGGQAGRVLIRQRPAEGLLARMWELPHALAPGT
                     GTDGRDTAQGPDPAPAHEALAEHLDADGLGLGELRWFMPAEHTFSHIHWELDVFLGTV
                     DNPSLLPESSAPLPSHYRWITREEMEQYAFPNVFLRILKAYFKEREGAS"
     misc_feature    550539..551663
                     /locus_tag="PM3016_470"
                     /note="A/G-specific DNA glycosylase [DNA replication,
                     recombination, and repair]; Region: MutY; COG1194"
                     /db_xref="CDD:224115"
     misc_feature    550638..551111
                     /locus_tag="PM3016_470"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    order(550671..550679,550686..550688,550800..550802)
                     /locus_tag="PM3016_470"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    550887..550910
                     /locus_tag="PM3016_470"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    order(550917..550919,551088..551090,551100..551102)
                     /locus_tag="PM3016_470"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    550959..550961
                     /locus_tag="PM3016_470"
                     /note="active site"
                     /db_xref="CDD:238013"
     misc_feature    551283..551663
                     /locus_tag="PM3016_470"
                     /note="DNA glycosylase (MutY in bacteria and hMYH in
                     humans) is responsible for repairing misread  A*oxoG
                     residues to C*G by removing the inappropriately paired
                     adenine base from the DNA backbone. It belongs to the
                     Nudix hydrolase superfamily and is important...; Region:
                     DNA_Glycosylase_C; cd03431"
                     /db_xref="CDD:239523"
     misc_feature    order(551316..551324,551490..551492,551499..551504)
                     /locus_tag="PM3016_470"
                     /note="DNA binding and oxoG recognition site [nucleotide
                     binding]"
                     /db_xref="CDD:239523"
     gene            complement(551776..552459)
                     /locus_tag="PM3016_471"
                     /db_xref="GeneID:11882462"
     CDS             complement(551776..552459)
                     /locus_tag="PM3016_471"
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="YP_005310590.1"
                     /db_xref="GI:379718459"
                     /db_xref="GeneID:11882462"
                     /translation="MSNLISLLQNVPLFQDLSVTELESIAPLFQERKYKKGTILFLEG
                     DLGEEFYLIGSGVVKIYRIDNYKEIILSLFRQGDFFGEMSLIQKGLQRSAAAETLEAC
                     SIYTLMRSDFASFMENSPKLCMRLLEVTMERLRKANEQIYNLTFLDVRTRTIKVISQL
                     AEEHGLQRSSGYLINMKLTHQQLANMVGTVRESVTKVLQELQEDDIITIDKKYIMVKD
                     PERMAKLIY"
     misc_feature    complement(551800..552441)
                     /locus_tag="PM3016_471"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(552079..552423)
                     /locus_tag="PM3016_471"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(552178..552186,552214..552219))
                     /locus_tag="PM3016_471"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(552094..552102,552112..552120))
                     /locus_tag="PM3016_471"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(551785..551958)
                     /locus_tag="PM3016_471"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     misc_feature    complement(order(551890..551892,551917..551925,
                     551929..551931))
                     /locus_tag="PM3016_471"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(551872..551892)
                     /locus_tag="PM3016_471"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(551872..551874,551884..551889))
                     /locus_tag="PM3016_471"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(551884..551889)
                     /locus_tag="PM3016_471"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            552619..553242
                     /locus_tag="PM3016_472"
                     /db_xref="GeneID:11882463"
     CDS             552619..553242
                     /locus_tag="PM3016_472"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310591.1"
                     /db_xref="GI:379718460"
                     /db_xref="GeneID:11882463"
                     /translation="MDPVLLLSFTAVAVLLTLAPGPDLLFVIAQSLTNGRKAGVITGL
                     GLSTGVVAHTFAAAVGLSALLYNSLILFQLVKYAGAAYLLYLAWMAWKEGSGAAGLAS
                     PPAQAAGALYRRGILMNVLNPKVSLFFLALLPQFVSAQGGEPAVQMIVLGAVFMVQAM
                     LIFTLVSLCAGWLAGRLTGGKGMPPWIHKAKAVLYAAIGLRLVFSER"
     misc_feature    552619..553233
                     /locus_tag="PM3016_472"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            complement(553373..553987)
                     /locus_tag="PM3016_473"
                     /db_xref="GeneID:11882464"
     CDS             complement(553373..553987)
                     /locus_tag="PM3016_473"
                     /codon_start=1
                     /transl_table=11
                     /product="SodA protein"
                     /protein_id="YP_005310592.1"
                     /db_xref="GI:379718461"
                     /db_xref="GeneID:11882464"
                     /translation="MAHQLPALPYANNALEPHIDEMTMMIHHDRHHNTYVTNLNAALE
                     AHADLQSKSVEELISNLDALPEGIRTAVRNNGGGHANHSLFWETIGPNGGGAPSGKLA
                     DAINAELGGFDKFKEDFAKAATTRFGSGWAFLSVTKDGKLKVASLPNQDSPIMEGETP
                     VLGLDVWEHAYYLKYQNKRPDYIAAFWNVVNWEEVGKRYEAAAK"
     misc_feature    complement(553376..553987)
                     /locus_tag="PM3016_473"
                     /note="Superoxide dismutase [Inorganic ion transport and
                     metabolism]; Region: SodA; COG0605"
                     /db_xref="CDD:223678"
     misc_feature    complement(553727..553984)
                     /locus_tag="PM3016_473"
                     /note="Iron/manganese superoxide dismutases, alpha-hairpin
                     domain; Region: Sod_Fe_N; pfam00081"
                     /db_xref="CDD:249570"
     misc_feature    complement(553391..553705)
                     /locus_tag="PM3016_473"
                     /note="Iron/manganese superoxide dismutases, C-terminal
                     domain; Region: Sod_Fe_C; pfam02777"
                     /db_xref="CDD:251524"
     gene            complement(554111..554290)
                     /locus_tag="PM3016_474"
                     /db_xref="GeneID:11882465"
     CDS             complement(554111..554290)
                     /locus_tag="PM3016_474"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310593.1"
                     /db_xref="GI:379718462"
                     /db_xref="GeneID:11882465"
                     /translation="MTDDIRRIHELNDRKTEEWTSEELHYHQRVMADLSPWLNAQGTA
                     MLGQIIHEIERRSGY"
     gene            complement(554640..555191)
                     /locus_tag="PM3016_475"
                     /db_xref="GeneID:11882466"
     CDS             complement(554640..555191)
                     /locus_tag="PM3016_475"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310594.1"
                     /db_xref="GI:379718463"
                     /db_xref="GeneID:11882466"
                     /translation="MKPALSSLNARRPSKLMPLFAAAALTAAAGCSPGPAGSAPPPAY
                     SSTAGSRPPAATASSAQVPPEDFCADADQDRSFDDCSGFIDAAENAAFYGGAVPYYRR
                     SSGGLAGRSPAASQPSKTAPGSTVENKAPGARCTRSRNDQTCRNVYQKRGWRRGNGFR
                     HDGRCSRCGGRGRHVAPCTSGSE"
     gene            555438..558602
                     /locus_tag="PM3016_476"
                     /db_xref="GeneID:11882467"
     CDS             555438..558602
                     /locus_tag="PM3016_476"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310595.1"
                     /db_xref="GI:379718464"
                     /db_xref="GeneID:11882467"
                     /translation="MDWPKQRLACAGLAAALVLSPFLSCAADAAAEMGTAEPEPVQES
                     EPIPAASAPEVVPGKVLVKYKKTAEAPSGARMLKASGKVSTTVTVQTQEQESVPDAVK
                     RLMENPDVEYAEPVYRFHYTDLDYRPALPVEKGSLLGAGKGSGKSLKTVASNDPYLDY
                     QWGLSVTELTYGWERVQGNTDRQPVTIAVIDSGVRADHEDLAGVLLRGYDVKNRDWNP
                     EDENGHGTMVAGLAAALTDNGVGIAGAAGPGPVRILPVKVGGSGRTDIESSDVAEGIY
                     WAADNGADVINLSLGMSGEVQAVKDAIEYAFSKKIVVVAAAGNDSNHWTGDEAGNVLR
                     EEEETEGEELPRRAYRTLFPASMPGVVSVGSVTRAEGGGLTIADFSNIGRVTVVAPGT
                     SMYSTLHTGPDAVGIGNGTSFSAPLAAGLAALLKMQDPDLTSADVERILSHTARRLEP
                     PAAKGSGSYSASAYYGGGLLDGTAAFTRPRLSLTALRTTAGSAGQSLLQAKLRAEDDT
                     GREAGAEVSPGTAVRVSITSRTGESKTVTREVYLGRTLEERLNAEDVYHLEVQAKLPE
                     DLEGRYVPPGPVVLLKRPGAPETSPAAGSYTGKQTVELKTVTAGAKLVYGFAGSTTVY
                     DYTGPITLTESRTLVVYAVKNGIASEPRSYKYTIGAGSSNSGGGSSSGTGVSQPAAGE
                     GGSPGAAPPPVTVAPPKEELKERITSAKGAPVTVDVPDKGAGGWVFELAGEVWNLAKT
                     TGTKLIIQGDGLSFTVPPGAFDVADDTAVKLSALSAAEAPGRPAYAEPASPVYKLRLE
                     AGGQEITAFEKPVLLTVDFDGGKITDLNRSGVYRYEEETGNWAYAGGSPEQNQYRIEL
                     KGFGRFTVMQWNRHFADLEGHWAREAVERMASKGVADGMTDTEFAPDAEVTRAQFTAL
                     LARTLQLPQSAGELPFGDVPEDAWYRQALVNALAAGLISGVSDTQFAPDELITREQMA
                     LMLVNAGNYAAGPGNGAVLASAEPVSFRDGGRISAWAAEAVKKAAGLGLLKGMPDGTF
                     GPANPASRGQAVTVLCRLLDPDAP"
     misc_feature    555897..556781
                     /locus_tag="PM3016_476"
                     /note="Peptidase domain in the S8 and S53 families;
                     Region: Peptidases_S8_S53; cl10459"
                     /db_xref="CDD:263972"
     misc_feature    555993..556790
                     /locus_tag="PM3016_476"
                     /note="Subtilase family; Region: Peptidase_S8; pfam00082"
                     /db_xref="CDD:249571"
     misc_feature    order(556107..556109,556305..556307,556671..556673)
                     /locus_tag="PM3016_476"
                     /note="active site"
                     /db_xref="CDD:173787"
     misc_feature    order(556107..556109,556671..556673)
                     /locus_tag="PM3016_476"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173787"
     misc_feature    557190..557375
                     /locus_tag="PM3016_476"
                     /note="Chitobiase/beta-hexosaminidase C-terminal domain;
                     Region: CHB_HEX_C; pfam03174"
                     /db_xref="CDD:251777"
     misc_feature    558048..558170
                     /locus_tag="PM3016_476"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    558222..558353
                     /locus_tag="PM3016_476"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    558453..558563
                     /locus_tag="PM3016_476"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            558835..559272
                     /locus_tag="PM3016_477"
                     /db_xref="GeneID:11882468"
     CDS             558835..559272
                     /locus_tag="PM3016_477"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_005310596.1"
                     /db_xref="GI:379718465"
                     /db_xref="GeneID:11882468"
                     /translation="MLVGSYQVRSFQLSDYVAVTCLLESVLTEDCYEETMEAFARQLS
                     WDSELVLVAEQEGEIVGIIVGTIDNHNGYYYRIAVEAEHQRRGIGQSLIESLRQRFIG
                     RKVRRILVTVDAHNEVVLPVYEKAGYQAADFSRAPHRLSIVNG"
     misc_feature    558982..559167
                     /locus_tag="PM3016_477"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(559063..559071,559099..559104)
                     /locus_tag="PM3016_477"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            559574..560146
                     /locus_tag="PM3016_478"
                     /db_xref="GeneID:11882469"
     CDS             559574..560146
                     /locus_tag="PM3016_478"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310597.1"
                     /db_xref="GI:379718466"
                     /db_xref="GeneID:11882469"
                     /translation="MQKGRHLMGAFHPYLIKSFKHDGHLHRMWLKNWLVPDDLLHESH
                     RAESMLVLINSQTKIVEADGKEWVSRIPGISFFIPKMWFNVVALIEEHGVRYYCNVAS
                     PPYVNNRIITYIDYDLDVIRMPAGDIHVVDQDEYEQHKILYHYSSIVDGKVKQGLNAL
                     LARVRAGGAPFQDDLVMFYYERWKEYGAEG"
     misc_feature    559619..560131
                     /locus_tag="PM3016_478"
                     /note="Protein of unknown function (DUF402); Region:
                     DUF402; cl00979"
                     /db_xref="CDD:260729"
     gene            560148..560738
                     /locus_tag="PM3016_479"
                     /db_xref="GeneID:11882470"
     CDS             560148..560738
                     /locus_tag="PM3016_479"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="YP_005310598.1"
                     /db_xref="GI:379718467"
                     /db_xref="GeneID:11882470"
                     /translation="MGLLPAKGMQEQEEQKASASPEGSLREIWKWMKLTAAGLLLVVF
                     IHQYFFHFSTVRGISMEPTLVEGEWLFINKTIRLAGMPQRGDVIVIKRNSEEERKPVF
                     LVKRVVAVGGDEVHIRRGRLYVNGEAVSEPYTGTPIEDGGFEPYTIEEGHLFVMGDNR
                     HRYASHDSRSFGAVPLEEVVGRAEWIIWPLDKWRRL"
     misc_feature    560262..560720
                     /locus_tag="PM3016_479"
                     /note="signal peptidase I, bacterial type; Region:
                     sigpep_I_bact; TIGR02227"
                     /db_xref="CDD:233790"
     misc_feature    560301..560696
                     /locus_tag="PM3016_479"
                     /note="The S26 Type I signal peptidase (SPase; LepB;
                     leader peptidase B; leader peptidase I; EC 3.4.21.89)
                     family members are essential membrane-bound serine
                     proteases that function to cleave the amino-terminal
                     signal peptide extension from proteins that are...;
                     Region: S26_SPase_I; cd06530"
                     /db_xref="CDD:119398"
     misc_feature    order(560322..560324,560460..560462)
                     /locus_tag="PM3016_479"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119398"
     misc_feature    <560454..560696
                     /locus_tag="PM3016_479"
                     /note="The S24, S26 LexA/signal peptidase superfamily
                     contains LexA-related and type I signal peptidase
                     families. The S24 LexA protein domains include: the lambda
                     repressor CI/C2 family and related bacterial prophage
                     repressor proteins; LexA (EC 3.4.21.88), the...; Region:
                     Peptidase_S24_S26; cl10465"
                     /db_xref="CDD:263975"
     gene            560760..562016
                     /locus_tag="PM3016_480"
                     /db_xref="GeneID:11882471"
     CDS             560760..562016
                     /locus_tag="PM3016_480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310599.1"
                     /db_xref="GI:379718468"
                     /db_xref="GeneID:11882471"
                     /translation="MEDRHPDHDTELPAGLASLPDVPAGAWKRLKDKLRSAAPDLGID
                     KIGFASAEPFTELRDILERHREKGYESGFEERDIAKRVDPALTMERPRSILSIAVAYP
                     SKLPNPPRSEPGRYRGILSRSAWGTDYHHVLRDRLQKLENWIRAEVPGARTVSMVDTG
                     VLVDRAVAERAGIGWIGKNCSVITPEWGSWVYLGEMVTNVPFPPDVPVLQDCGDCTLC
                     IDACPTGALVGPGQLNAQRCVSYLTQTKGIIEDDELKRKIGNRLYGCDTCQIVCPKNK
                     GIHADHHPELQPDPEQVKPLLVPLLQMTNREFKEKFGTSSASWRGRKPIQRNAILALG
                     NFRDREALPELLRVLRTDERPEIRATAAWAVGRIGGAAAEAALREALERETDEAARRE
                     IVKAQGLAQEQEQTAAQEQHTRETGA"
     misc_feature    560859..561863
                     /locus_tag="PM3016_480"
                     /note="epoxyqueuosine reductase; Region: TIGR00276"
                     /db_xref="CDD:213520"
     misc_feature    561000..561236
                     /locus_tag="PM3016_480"
                     /note="Domain of unknown function (DUF1730); Region:
                     DUF1730; pfam08331"
                     /db_xref="CDD:254735"
     misc_feature    561393..561584
                     /locus_tag="PM3016_480"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     misc_feature    561642..>561863
                     /locus_tag="PM3016_480"
                     /note="Armadillo/beta-catenin-like repeats. An
                     approximately 40 amino acid long tandemly repeated
                     sequence motif first identified in the Drosophila segment
                     polarity gene armadillo; these repeats were also found in
                     the mammalian armadillo homolog beta-catenin; Region: ARM;
                     cd00020"
                     /db_xref="CDD:237987"
     misc_feature    order(561738..561740,561750..561752,561762..561764,
                     561825..561827,561837..561839,561846..561848,
                     561858..561860)
                     /locus_tag="PM3016_480"
                     /note="protein binding surface [polypeptide binding];
                     other site"
                     /db_xref="CDD:237987"
     gene            562013..562558
                     /locus_tag="PM3016_481"
                     /db_xref="GeneID:11882472"
     CDS             562013..562558
                     /locus_tag="PM3016_481"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster binding protein"
                     /protein_id="YP_005310600.1"
                     /db_xref="GI:379718469"
                     /db_xref="GeneID:11882472"
                     /translation="MSTIRYHEMDSPIGVLTLGISDRDGLCQIEFGSFEEHEDRLRSW
                     SGRFFGTDIWGSDPAALAPFEDQLRRYFAGELRVFTLPLDLRGTPFQVGVWQALIGIP
                     YGEARSYKDVAEAIGSPKAVRAVGGANNRNPVPIVVPCHRVIGAAGAMVGYGGGLSIK
                     TFLLGLEGYEGRASAAGGGRI"
     misc_feature    562019..562516
                     /locus_tag="PM3016_481"
                     /note="Methylated DNA-protein cysteine methyltransferase
                     [DNA replication, recombination, and repair]; Region: Ada;
                     COG0350"
                     /db_xref="CDD:223427"
     misc_feature    562019..562267
                     /locus_tag="PM3016_481"
                     /note="6-O-methylguanine DNA methyltransferase,
                     ribonuclease-like domain; Region: Methyltransf_1N;
                     pfam02870"
                     /db_xref="CDD:251580"
     misc_feature    562280..562516
                     /locus_tag="PM3016_481"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    order(562280..562285,562337..562342,562364..562366,
                     562373..562375,562379..562384,562388..562390,
                     562397..562402,562406..562408,562430..562432,
                     562445..562447,562466..562468)
                     /locus_tag="PM3016_481"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     misc_feature    order(562337..562339,562430..562435,562439..562441,
                     562511..562513)
                     /locus_tag="PM3016_481"
                     /note="active site"
                     /db_xref="CDD:119438"
     gene            562555..563580
                     /locus_tag="PM3016_482"
                     /db_xref="GeneID:11882473"
     CDS             562555..563580
                     /locus_tag="PM3016_482"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310601.1"
                     /db_xref="GI:379718470"
                     /db_xref="GeneID:11882473"
                     /translation="MRYVHIDSVESGQYLGRTIFTANGSILLSEGVQLTVFMINQLMR
                     IGVTMIYIKDQEFEDLEIPELVSEETKRAVMKRMTDTFNSIRSGKDFNTKSLNLSIDS
                     LLEEVMQNKEVMVQLTDIRTEDNAMYVHALNVCMMSVLIGINLGLPASQLRELAIGAL
                     LHDVGKLELITDDEHSDKRRHHTWRGFEVLKNKRELSLLIAHVAFQHHETMDGEGLPR
                     QIPGEEIHLYARIVAVANTYDNLLFEKEGKRMLPHDACERMMVLAGSKLDRDIVIQFL
                     RTVSIYPTGASVRLTTRETGVVVGQHRGLPGRPVVRVVKGSGDDLEIKEVDLAKHTTV
                     FVESVLM"
     misc_feature    <562756..563490
                     /locus_tag="PM3016_482"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    562936..563277
                     /locus_tag="PM3016_482"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(562942..562944,563038..563043,563260..563262)
                     /locus_tag="PM3016_482"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    563041..563043
                     /locus_tag="PM3016_482"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            563613..563873
                     /locus_tag="PM3016_483"
                     /db_xref="GeneID:11882474"
     CDS             563613..563873
                     /locus_tag="PM3016_483"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310602.1"
                     /db_xref="GI:379718471"
                     /db_xref="GeneID:11882474"
                     /translation="MIKKSKLSVEVNEPIMWGYVVTAVVALLVGGAAGFYIGVMYLRR
                     QMEKMQSNPEMLQQMAKQMGYNLNKQQMAKMQQMMKKQKFRP"
     gene            563944..564534
                     /locus_tag="PM3016_484"
                     /db_xref="GeneID:11882475"
     CDS             563944..564534
                     /locus_tag="PM3016_484"
                     /codon_start=1
                     /transl_table=11
                     /product="protein FolE"
                     /protein_id="YP_005310603.1"
                     /db_xref="GI:379718472"
                     /db_xref="GeneID:11882475"
                     /translation="MPAKEYRNNRVIENREQIEHHVREILRLIGEDVDREGLHDTPAR
                     VTRMYEEIFAGYEADVKDILGVAFDEKHEELVIVKDIVYYSQCEHHMAPFFGRIHIGY
                     IPSGKIAGLSKFARLVEAVTRRLQVQERITSELADIIEGELEPHGCMVVVEGEHLCMC
                     ARGVKKPGSKTISSAVRGVFRTDASSRAEFLSLIKD"
     misc_feature    563980..564528
                     /locus_tag="PM3016_484"
                     /note="GTP cyclohydrolase I; Provisional; Region: folE;
                     PRK09347"
                     /db_xref="CDD:236472"
     misc_feature    order(564223..564225,564229..564231,564397..564399,
                     564466..564468)
                     /locus_tag="PM3016_484"
                     /note="active site"
                     /db_xref="CDD:238351"
     gene            complement(564643..565920)
                     /locus_tag="PM3016_485"
                     /db_xref="GeneID:11882476"
     CDS             complement(564643..565920)
                     /locus_tag="PM3016_485"
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="YP_005310604.1"
                     /db_xref="GI:379718473"
                     /db_xref="GeneID:11882476"
                     /translation="MQYAYGALTPLRLLEETRFWKGQEREHTVVIRELAPALEPDYKR
                     LLQEWEVVLARAETSAGRWIEALLRRPAPASPALRQEVRRFLEASAVQSQAFVRQLHL
                     LMERSRTIRTQPPLRAILLHLIRESEYFLGVLQAAAGGPGAYEEGLSGGSFAPDDAQT
                     GQEGQGGSDGHPLSAHDTGGDPSEAQPPEEPYDSSGATATQEGVWTMGIRPVPAYAKP
                     VPIGGHRLPPLPYPYDALEPHIDKETMRLHHTKHHLSYVEGLNKAELALARAREIGDY
                     ALVKHWERETAFHGAGHYLHTLFWQVMKPGGGGPPTGTIAADLKKSFGGFSPFRKQFS
                     AAAEKVEGGGWALLVWSPRSHRLEILQAEKHQNLSQWDVIPLLVLDVWEHAYYVRYRN
                     DRARYIEAWWNTIHWEHVNERLEAARGLKWPPF"
     misc_feature    complement(565516..565893)
                     /locus_tag="PM3016_485"
                     /note="Domain of unknown function (DUF2935); Region:
                     DUF2935; pfam11155"
                     /db_xref="CDD:192714"
     misc_feature    complement(564667..565251)
                     /locus_tag="PM3016_485"
                     /note="Superoxide dismutase [Inorganic ion transport and
                     metabolism]; Region: SodA; COG0605"
                     /db_xref="CDD:223678"
     misc_feature    complement(565009..565251)
                     /locus_tag="PM3016_485"
                     /note="Iron/manganese superoxide dismutases, alpha-hairpin
                     domain; Region: Sod_Fe_N; pfam00081"
                     /db_xref="CDD:249570"
     misc_feature    complement(564679..564975)
                     /locus_tag="PM3016_485"
                     /note="Iron/manganese superoxide dismutases, C-terminal
                     domain; Region: Sod_Fe_C; pfam02777"
                     /db_xref="CDD:251524"
     gene            complement(566019..567047)
                     /locus_tag="PM3016_486"
                     /db_xref="GeneID:11882477"
     CDS             complement(566019..567047)
                     /locus_tag="PM3016_486"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310605.1"
                     /db_xref="GI:379718474"
                     /db_xref="GeneID:11882477"
                     /translation="METNSSSSYSSVPINPTTVETAVRRTFVRRHKGLLIGLLSVLLL
                     LFSLLMAFHAYIAWTLARPHIDPLRSNPALSIGTAYEDITFPSLNGSSTLSGWYIPSE
                     MESANSRKTVVFSHGYGGNREEIWVPIYDLAKAAHKMGFNVVMFDYGYVQPDWNVTGG
                     LRESQELLGAVQYAKDRGADRVYVWGFSMGAGTALQAALLTKDIDGMILDSTFVLEPE
                     TLYHNMKQVANLPKFSQGLVHMFFPLLNGVSLNQVPYQTVKETKYDIPIFFIHGKEDL
                     KAPWNMVESIYQLQKDQSGSQLWLLEKDGHELIYRAHKKTYLQMTTGFLQTLSTGSPE
                     VVKHGQSR"
     misc_feature    complement(<566475..566726)
                     /locus_tag="PM3016_486"
                     /note="Lipase.  Lipases are esterases that can hydrolyze
                     long-chain acyl-triglycerides into di- and monoglycerides,
                     glycerol, and free fatty acids at a water/lipid interface.
                     A typical feature of lipases is 'interfacial activation',
                     the process of...; Region: Lipase; cl14883"
                     /db_xref="CDD:265473"
     misc_feature    complement(566115..566723)
                     /locus_tag="PM3016_486"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     misc_feature    complement(566130..566717)
                     /locus_tag="PM3016_486"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     misc_feature    complement(566478..566492)
                     /locus_tag="PM3016_486"
                     /note="nucleophilic elbow; other site"
                     /db_xref="CDD:238382"
     misc_feature    complement(566484..566486)
                     /locus_tag="PM3016_486"
                     /note="catalytic triad; other site"
                     /db_xref="CDD:238382"
     gene            567663..568406
                     /locus_tag="PM3016_487"
                     /db_xref="GeneID:11882478"
     CDS             567663..568406
                     /locus_tag="PM3016_487"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein IclR"
                     /protein_id="YP_005310606.1"
                     /db_xref="GI:379718475"
                     /db_xref="GeneID:11882478"
                     /translation="MEDGKLTVRAVERALDILLCFTEAEDLSLTEISARVGLHKSTVH
                     RLLASLEGKGFIIRHPATERYRLGFRIWELSANLTHSDDPAVILLPELERLRDQLGET
                     VSLYVRDGLERVRVQAVQSNQAIRRVAPIGARLPLYVGASSKVLVAFADPAEQQALLA
                     DPAWPPASDPAAYEQQLAEVRSLGYATSVEEREPGAAAVSVPVFDRAEKLVAALAVSG
                     PSNRLTVELMKEHAPLLMDAARRMGKMLR"
     misc_feature    567684..567953
                     /locus_tag="PM3016_487"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    567687..568403
                     /locus_tag="PM3016_487"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    568029..568382
                     /locus_tag="PM3016_487"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            complement(568603..571309)
                     /locus_tag="PM3016_488"
                     /note="Acn"
                     /pseudo
                     /db_xref="GeneID:11882479"
     gene            571554..572579
                     /locus_tag="PM3016_490"
                     /db_xref="GeneID:11882480"
     CDS             571554..572579
                     /locus_tag="PM3016_490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310607.1"
                     /db_xref="GI:379718476"
                     /db_xref="GeneID:11882480"
                     /translation="MSWRTTLYDYVHHRNRMDIEHSVEPMLPFVSDEAYLSAERSRLA
                     RRLDSDRERGLLPVKTETRLSIRQTVPYKNGIAADCVLKRIAVGQIGLEAYEEQRVEQ
                     ERICLAPSPDGEAWTIQRVEPLLGEQRLRLKTAHPGALLEADDEFEHVGLMRAPSVPL
                     LGPGVAPLAGTASRRSYNRGEAVRYADKWWDGNNPAYIAFEVDCTSYISQCLFAGGAP
                     MNYTDRRDAGWWYKGRLGGQELWSFSWAVAESLQFYLRTSRSGLRGQEVVSAGELEPG
                     DVIAYDWDGDGRFQHSTIVTAKDANGMPLVNAHTVSSRRRYWDYRDSHAWTTRTQYRF
                     IHISDAL"
     misc_feature    572079..572558
                     /locus_tag="PM3016_490"
                     /note="Putative amidase domain; Region: Amidase_6;
                     pfam12671"
                     /db_xref="CDD:257209"
     gene            572700..573848
                     /locus_tag="PM3016_491"
                     /db_xref="GeneID:11882481"
     CDS             572700..573848
                     /locus_tag="PM3016_491"
                     /codon_start=1
                     /transl_table=11
                     /product="protein DdlB"
                     /protein_id="YP_005310608.1"
                     /db_xref="GI:379718477"
                     /db_xref="GeneID:11882481"
                     /translation="MSKIRVGLIYGGKSGEHEVSLQTALAVTKALDLSKYEVQPFYIT
                     KEGDWRSGPQLTAPADSVDALTFGSASSSNETGTFALQPLFGSSAAAKASGNPAVSGS
                     ESGAAAGPLDVVLPLLHGTFGEDGTVQGLLEMANIAYVGTGVLASAVGMDKVMMKKVF
                     AQEGLPQCVFRHFTKSQWEKDNAFFIMEIEVAIGYPCFVKPANLGSSVGINKARNRDE
                     LLSAIAEAFRYDRKVIVEEFIDARELEVAVLGNDEPQASVVGEIVSSGEFYDYKAKYI
                     DGKSSMIIPAEIDSEQASRIRDLAVRAFQSIDGTGLSRVDFFLRKDNGEIYINEINTM
                     PGFTPFSMYPLLWRESGKPYSELLDDLVRLAIQRHEEKQRLQYSFDLT"
     misc_feature    572700..573797
                     /locus_tag="PM3016_491"
                     /note="D-alanyl-alanine synthetase A; Reviewed; Region:
                     ddl; PRK01966"
                     /db_xref="CDD:234993"
     misc_feature    572709..573122
                     /locus_tag="PM3016_491"
                     /note="D-ala D-ala ligase N-terminus; Region:
                     Dala_Dala_lig_N; pfam01820"
                     /db_xref="CDD:250892"
     misc_feature    573174..573785
                     /locus_tag="PM3016_491"
                     /note="D-ala D-ala ligase C-terminus; Region:
                     Dala_Dala_lig_C; pfam07478"
                     /db_xref="CDD:254223"
     gene            573952..574269
                     /locus_tag="PM3016_492"
                     /db_xref="GeneID:11882482"
     CDS             573952..574269
                     /locus_tag="PM3016_492"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005310609.1"
                     /db_xref="GI:379718478"
                     /db_xref="GeneID:11882482"
                     /translation="MGFQTEFNSVCKFKSEQELYELLEYGRGKMVKSGFRVFPAGQKV
                     IAYTPGNQAIAIVKILASIAEINFQGEEVTQVEMELVRRLTEEEARIQTALAHEMFFG
                     EQE"
     gene            574416..575093
                     /locus_tag="PM3016_493"
                     /db_xref="GeneID:11882483"
     CDS             574416..575093
                     /locus_tag="PM3016_493"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_005310610.1"
                     /db_xref="GI:379718479"
                     /db_xref="GeneID:11882483"
                     /translation="MSKEKYCATEKLAILEEVSSGKIGFIAATKRYGMNKTTLMKWQR
                     RYKLYGYEGLERSTRNRSYSAELKLQAVKDYVEGGLSKYRIIDKYRISSTTQLSNWIK
                     KYNGHSSLKAYKGEAQAMTKGRSTTWDERIDIVHYCLAHQHDYHKTAGQFQVSYQQVY
                     QWVKKFEAGGADALKDGRGRKKAPEEMTEADRQKLEMKKMEYEMERLRAENAFLKKLR
                     EIQRRRS"
     misc_feature    574443..574601
                     /locus_tag="PM3016_493"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     misc_feature    574581..574937
                     /locus_tag="PM3016_493"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    574590..>574733
                     /locus_tag="PM3016_493"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    574803..574961
                     /locus_tag="PM3016_493"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     misc_feature    574887..>575084
                     /locus_tag="PM3016_493"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     gene            575264..575971
                     /locus_tag="PM3016_494"
                     /db_xref="GeneID:11882484"
     CDS             575264..575971
                     /locus_tag="PM3016_494"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_005310611.1"
                     /db_xref="GI:379718480"
                     /db_xref="GeneID:11882484"
                     /translation="MMMSIYEKVEKTFGYRQLTLHMRKETGQTINHKRVYRLMKVKGI
                     QSVIRRKRKKYPHSTPQHVAENVLNRNFQAAEPNEKWVTDVTEFKYGNGQKAYLSAIL
                     DLHDKSIVSRVVGHSNNNPLVFETLKQALQAAPGSKPMLHSDRGFQYTSLDFKKLLDD
                     NELTQSMSRVGRCIDNGPMESFWGTLKCEKYYLHTYQTFEELERDILAYIDFYNNERL
                     QAKLNGLSPMEYRTKAA"
     misc_feature    575270..575962
                     /locus_tag="PM3016_494"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: Tra5;
                     COG2801"
                     /db_xref="CDD:225361"
     misc_feature    575276..575419
                     /locus_tag="PM3016_494"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    575480..575824
                     /locus_tag="PM3016_494"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    575801..575965
                     /locus_tag="PM3016_494"
                     /note="Integrase core domain; Region: rve_2; pfam13333"
                     /db_xref="CDD:257663"
     gene            576147..577139
                     /locus_tag="PM3016_495"
                     /db_xref="GeneID:11882485"
     CDS             576147..577139
                     /locus_tag="PM3016_495"
                     /codon_start=1
                     /transl_table=11
                     /product="putative UV damage endonuclease"
                     /protein_id="YP_005310612.1"
                     /db_xref="GI:379718481"
                     /db_xref="GeneID:11882485"
                     /translation="MIVRLGYVAMSVMVKNASPSKTMTYTHFEKLGDREAAIRKLERI
                     ASENIRNTQRLLKHNRAYDIEMYRISSKLIPLLGHEGLGDWDPIERLSGDFAELGQYA
                     KDNRMRLSFHPDHFTVFSTPREDVLRSSRADLDRHVRMLEAMGLDASAKCNIHVGGTY
                     GNKDSARARFLEQFGALPERIRERMTLENDDKTFNALETLEICEEAGVPMVLDIHHDA
                     VNPGEVPAAELWPRILQTWKGQKEQEDGSGSPRDLPPKIHVSSPKSESDPRGHADYIE
                     TGVFMDFVRAVAPLTPRLDVMLEAKMKDGSLIQLAEDLKKEPNITMLSQASFEI"
     misc_feature    576147..577094
                     /locus_tag="PM3016_495"
                     /note="putative UV damage endonuclease; Provisional;
                     Region: uvsE; PRK02308"
                     /db_xref="CDD:235029"
     gene            577258..578025
                     /locus_tag="PM3016_496"
                     /db_xref="GeneID:11882486"
     CDS             577258..578025
                     /locus_tag="PM3016_496"
                     /codon_start=1
                     /transl_table=11
                     /product="protein FabI"
                     /protein_id="YP_005310613.1"
                     /db_xref="GI:379718482"
                     /db_xref="GeneID:11882486"
                     /translation="MSLVAGKNIVVMGVANDRSIAWAIAQSLAAQGARLVFTYENERV
                     EERVRKLAGTIEGASILPCNVTDDADIDRLAENLREQFGVLHGIVHSIAFARTEELEG
                     MFVNTSRDGFALAHDISAYSLVAVAQKLYPLMTEGGSVMTMTYLGAERALKNYNVMGV
                     AKAALEASVRYLANDLGQFNIRVNAISAGPIRTLAAKGIKDFNSILKTVEEKAPLRRT
                     TEAAEVGDTALFLMSNLSRGITGEVIYVDSGYHIIGV"
     misc_feature    577258..578022
                     /locus_tag="PM3016_496"
                     /note="Enoyl-[acyl-carrier-protein]; Region: FabI;
                     COG0623"
                     /db_xref="CDD:223696"
     misc_feature    577273..578019
                     /locus_tag="PM3016_496"
                     /note="Enoyl acyl carrier protein (ACP) reductase (ENR),
                     divergent SDR; Region: ENR_SDR; cd05372"
                     /db_xref="CDD:187630"
     misc_feature    order(577294..577302,577312..577317,577375..577377,
                     577444..577452,577528..577539,577609..577611,
                     577684..577692,577720..577722,577741..577743,
                     577819..577830,577834..577845)
                     /locus_tag="PM3016_496"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187630"
     misc_feature    order(577345..577347,577450..577461,577468..577470,
                     577564..577584,577591..577596,577603..577608,
                     577615..577620,577627..577629,577639..577641,
                     577648..577650,577696..577701,577705..577716,
                     577720..577725,577732..577737,577744..577749,
                     577756..577761,577765..577782,577786..577791,
                     577870..577872,577879..577881,577897..577908,
                     577924..577926,577933..577938,577945..577947,
                     577960..577962,577966..578004,578008..578019)
                     /locus_tag="PM3016_496"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(577450..577461,577564..577584,577591..577596,
                     577603..577608,577615..577620,577627..577629,
                     577636..577641,577648..577650,577696..577701,
                     577705..577713,577720..577725,577732..577737,
                     577744..577749,577756..577761,577765..577773,
                     577777..577785)
                     /locus_tag="PM3016_496"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(577534..577536,577540..577542,577690..577692,
                     577720..577722,577729..577731,577741..577743,
                     577840..577845,577852..577854,577861..577863)
                     /locus_tag="PM3016_496"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(577612..577614,577690..577692,577729..577731,
                     577741..577743)
                     /locus_tag="PM3016_496"
                     /note="active site"
                     /db_xref="CDD:187630"
     gene            578195..579055
                     /locus_tag="PM3016_497"
                     /db_xref="GeneID:11882487"
     CDS             578195..579055
                     /locus_tag="PM3016_497"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="YP_005310614.1"
                     /db_xref="GI:379718483"
                     /db_xref="GeneID:11882487"
                     /translation="MSTSNIPAFAVGSKSFTAVAINTASKAGEWIQSKVGDFSSLHTK
                     YSAQDLVTEVDKGAEKMIRNLILTHFPGHSILGEEGVEPGPEASQRALEEASSAEYLW
                     IVDPLDGTTNFVHGFPFFSVSIALAYKGEVIVGVVYNPIHNELYVAEKGKGAYLKGRK
                     MEVSPEKTLGESLIATGFPADRDGTLPANLRGVQALSPKVRNMRVAGSAALHMAYVAA
                     GRLSGFYEIGLNSWDMAAGALLIEESGGKVTDTLGNPYHLGVRHVVASNGHIHDELQK
                     ELAAASATGY"
     misc_feature    578240..578995
                     /locus_tag="PM3016_497"
                     /note="IMPase, inositol monophosphatase and related
                     domains. A family of Mg++ dependent phosphatases,
                     inhibited by lithium, many of which may act on inositol
                     monophosphate substrate. They dephosphorylate inositol
                     phosphate to generate inositol, which may be...; Region:
                     IMPase; cd01639"
                     /db_xref="CDD:238817"
     misc_feature    order(578324..578326,578339..578341,578357..578359,
                     578426..578431,578507..578524,578888..578893)
                     /locus_tag="PM3016_49