GenomeNet

Database: RefSeq
Entry: NC_017171
LinkDB: NC_017171
Original site: NC_017171 
LOCUS       NC_017171            3991133 bp    DNA     circular CON 01-MAR-2015
DEFINITION  Acinetobacter baumannii MDR-ZJ06, complete genome.
ACCESSION   NC_017171
VERSION     NC_017171.1  GI:384141246
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603878
            Assembly: GCF_000226275.1
KEYWORDS    RefSeq.
SOURCE      Acinetobacter baumannii MDR-ZJ06
  ORGANISM  Acinetobacter baumannii MDR-ZJ06
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii
            complex.
REFERENCE   1  (bases 1 to 3991133)
  AUTHORS   Zhou,H., Zhang,T., Yu,D., Pi,B., Yang,Q., Zhou,J., Hu,S. and Yu,Y.
  TITLE     Genomic analysis of the multidrug-resistant Acinetobacter baumannii
            strain MDR-ZJ06 widely spread in China
  JOURNAL   Antimicrob. Agents Chemother. 55 (10), 4506-4512 (2011)
   PUBMED   21788470
REFERENCE   2  (bases 1 to 3991133)
  AUTHORS   Zhang,T. and Yu,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2010) Key Laboratory of Diagnosis and Treatment
            for Infectious Disease, The 1st Affiliated Hospital of School of
            Medicine, Zhejiang University, 79 Qingchun Road, Hangzhou, Zhejiang
            310003, China
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Acinetobacter baumannii isolates MDR-ZJ06 studied here was obtained
            from a case in a hospital in Zhejiang of China in 2006; bacteria
            are available from the Key Laboratory of Diagnosis and Treatment
            for Infectious Disease.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 02/28/2015 12:13:45
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 460460)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 3,847
            CDS                          :: 3,711
            Pseudo Genes                 :: 48
            rRNAs                        :: 18 ( 5S, 16S, 23S )
            tRNAs                        :: 69
            ncRNA                        :: 1
            Frameshifted Genes           :: 48
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3991133
                     /organism="Acinetobacter baumannii MDR-ZJ06"
                     /mol_type="genomic DNA"
                     /strain="MDR-ZJ06"
                     /db_xref="taxon:497978"
                     /country="China: Zheijiang"
                     /collection_date="2006"
     gene            complement(76..468)
                     /locus_tag="ABZJ_RS00005"
                     /old_locus_tag="ABZJ_00001"
     CDS             complement(76..468)
                     /locus_tag="ABZJ_RS00005"
                     /old_locus_tag="ABZJ_00001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000987631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B"
                     /protein_id="WP_000987632.1"
                     /db_xref="GI:446910376"
                     /translation="MMSQKILASMLISCAALVSHSAFAADLEADMKTLAKSTKAFAEA
                     KDIDNAKQQLVIMRQAALSSKLSLPHKLEGLPPENVQVKEYQAGLDQLVAEIDRVTVF
                     VDKGQLDQAKTEAINLVNIRNENHKKFR"
     gene            complement(506..2974)
                     /gene="gyrB"
                     /locus_tag="ABZJ_RS00010"
                     /old_locus_tag="ABZJ_00002"
     CDS             complement(506..2974)
                     /gene="gyrB"
                     /locus_tag="ABZJ_RS00010"
                     /old_locus_tag="ABZJ_00002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000093721.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_000093729.1"
                     /db_xref="GI:446015874"
                     /translation="MSSESQSASQTEQTNEKAYDSSSIKVLRGLDAVRKRPGMYIGDT
                     DDGTGLHHMVFEVVDNAIDEALAGHCDEIIVTIHEDESVSVSDNGRGIPTDIHPEEGV
                     SAAEVILTILHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLHLTIYRAGQIHEQEYH
                     HGDPQYPLRVIGETDNTGTTVRFWPSAETFSQTIFNVEILARRLRELSFLNAGVRIVL
                     RDERINLEHVYDYEGGLSEFVKYINEGKNHLNEIFHFTADADNGIAVEVALQWNDSYQ
                     ENVRCFTNNIPQKDGGTHLAGFRAALTRGLNQYLENENILKKEKVNVTGDDAREGLTA
                     IISVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGKIIDAA
                     RARDAARKAREMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRN
                     RKMQAILPLKGKILNVERARFDKMISSQEVGTLITALGCGIGREEYNPDKLRYHKIII
                     MTDADVDGSHIRTLLLTFFFRQMPELVERGHIYIAQPPLYKLKKGKQEQYIKDNDALE
                     TYLISNAIDELALHISADAPAITGEALAKVIQDYQVSQKSLQRLTLRYPASLLDALLE
                     VDAFKADQNHDQAYVQQWADQVREAVQRLQPSLRPEITLETFERENAQGEKSAHYWPR
                     VTVYVHNLPHAYLLDAGLLNSAEYARLLKNSKSWFKLIEDGAYLQKGDRRIQVANFHQ
                     VWQHILQDSRRGMMIQRYKGLGEMNAEQLWETTMDPENRNMLQVTIDDAIEADRMFSC
                     LMGDDVEPRRAFIEENALNADIDA"
     gene            complement(3027..4109)
                     /locus_tag="ABZJ_RS00015"
                     /old_locus_tag="ABZJ_00003"
     CDS             complement(3027..4109)
                     /locus_tag="ABZJ_RS00015"
                     /old_locus_tag="ABZJ_00003"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3M0Q6.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecF"
                     /protein_id="WP_000550809.1"
                     /db_xref="GI:446472955"
                     /translation="MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIH
                     LLATGRSFRTHIPKNYIQYEADDAIVFAQSATEKIGMQKLASGEQLMKVNGDTVATQG
                     QLAKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHVEPEFYFAWQYYSRALKQRNTL
                     LKTRRNLSLADLEPWNKMLSNYGEILHSQRLSIVEQWNVYFQNDLSQLLPDLEIELEY
                     SPGFHTEQGLMQDLLNQHQKDIERRYTECGPHRADLRLKTPFGHADDVLSRGQKKLLI
                     IALKLSQIAMLHASNKETVVLLDDLTAELDLTAQQRLIERLSQLGSQVFMTTLDHASV
                     KKHLHDLSISYQLFSVESGQVSLAAP"
     gene            complement(4124..5272)
                     /locus_tag="ABZJ_RS00020"
                     /old_locus_tag="ABZJ_00004"
     CDS             complement(4124..5272)
                     /locus_tag="ABZJ_RS00020"
                     /old_locus_tag="ABZJ_00004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004994601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_001237348.1"
                     /db_xref="GI:447160092"
                     /translation="MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTI
                     TGSDLEVELVASTALSEGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQRCIL
                     KSGNSRFVLGTLPAEDYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLT
                     GTLLEIDENQLRAVTTDGHRLALCEILASSTSSQLVQAIVPRKAVGELQRLLSIEDEQ
                     LTLLIGRELLNVTINTPSRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGH
                     DVFKQSLQRVAILSNEKLRGVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQNAPLEMS
                     FNAQYLLDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMRV"
     gene            complement(5370..6767)
                     /locus_tag="ABZJ_RS00025"
                     /old_locus_tag="ABZJ_00005"
     CDS             complement(5370..6767)
                     /locus_tag="ABZJ_RS00025"
                     /old_locus_tag="ABZJ_00005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004795570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_000964768.1"
                     /db_xref="GI:446887512"
                     /translation="MLWTDCLTRLRQELSDNVFAMWIRPLVAEEVEGILRLYAPNPYW
                     TRYIQENHLELISILAEQLSEGRVRQVEILVDSRPGSILSSSEQPATTTAALQTAPIP
                     QPAKVKREPEPVANTAVSSKSSKKKLLNPQFTFSLFVEGRSNQMAAETCRKVLTQLGA
                     SQHNPLFLYGPTGLGKTHLMQAVGNALLQAKPNARVMYMTSESFVQDFVSSLQKGKVE
                     EFKKNCRSLDLLLVDDIHLLAGKEASLVEFFYTFNALLDESKQIILTSDRYPKELTEL
                     DPRLVSRFSWGLSVGVEPPDIETRIEILLKKAENSGVDLPRNCALFIAQQVVANVREL
                     EGALNKVVAISRFKGAPIDLDVVRESLKDVLAIRARTISVENIQRVVSEYFRIPLKEL
                     VGPKRTRIYARPRQLAMGLARELTGDSFPEIGMAFGGRDHSTVMHACEKVVSLREEDP
                     IFDEDYKNLLRLLQS"
     gene            7437..7571
                     /gene="rpmH"
                     /locus_tag="ABZJ_RS00030"
                     /old_locus_tag="ABZJ_00006"
     CDS             7437..7571
                     /gene="rpmH"
                     /locus_tag="ABZJ_RS00030"
                     /old_locus_tag="ABZJ_00006"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6F6K7.1"
                     /note="in Escherichia coli transcription of this gene is
                     enhanced by polyamines; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="WP_000831329.1"
                     /db_xref="GI:446754073"
                     /translation="MKRTFQPSELKRKRVHGFRARMATKAGRQVLARRRAKGRHSLTV
                     "
     gene            7601..7994
                     /locus_tag="ABZJ_RS00035"
                     /note="ribonuclease P; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            8005..8325
                     /locus_tag="ABZJ_RS00040"
                     /old_locus_tag="ABZJ_00008"
     CDS             8005..8325
                     /locus_tag="ABZJ_RS00040"
                     /old_locus_tag="ABZJ_00008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004656856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000251652.1"
                     /db_xref="GI:446173797"
                     /translation="MVRILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAI
                     KGVWLSSKRICRCHPWGGSGYDPVPPKAIRFISFHQIDSQTHHVAVPFRDRLMKQNLS
                     NHLG"
     gene            8331..10091
                     /locus_tag="ABZJ_RS00045"
                     /old_locus_tag="ABZJ_00009"
     CDS             8331..10091
                     /locus_tag="ABZJ_RS00045"
                     /old_locus_tag="ABZJ_00009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001188090.1"
                     /note="functions to insert inner membrane proteins into
                     the IM in Escherichia coli; interacts with transmembrane
                     segments; functions in both Sec-dependent and -independent
                     membrane insertion; similar to Oxa1p in mitochondria;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="insertase"
                     /protein_id="WP_001188088.1"
                     /db_xref="GI:447110832"
                     /translation="MQQWARFAILGAMFVTAYLLILAWQKDYGNAATAPQQQAAAVSS
                     HEVSADLPNAKTATVASDVPQANIAQSQTTDATAPVNQQLISVQTDLYHLWINPKGGD
                     IVRIELLSHDKSKDSNQPFVMLENDAKRTYVAQSGLIGLNGPDSSRGGRPLYAVEKTS
                     YTLADAKGVQDQSGHSEKVLTVPMVFKTPEGVEIIKTFTFTQGQYPIVVKHQVVNRSQ
                     QNWQGQMFGQLKRDNSEDPGKSSQGIFTLGTFLGGAWGTPDAHYNKLKFANFSEEKLN
                     TEAKGGWVAMVQHYFVSAWIPGNLKLTQANGQPYVAKLESRQSADHMNIIGFTSPVIN
                     VPAGTSMEVDAKLYSGPKVQSELKDLAVGLNQTVDYGWLWPIAKLLFLGLQFFHSIVG
                     NWGWSIILLTIMVKMILWPLSSKSYRSMAKMRVIAPEMQRMKEEFGEDRMRFSQEMMA
                     LYKREQVNPLSGCLPLLLQMPIFLALYWVLMESVELRHAPWLGWIHDLSAMDPWFILP
                     LIMGATMFAQQMLNPQPADPMQAKVFRIMPIMFTVFMLFFPAGLVLYWIVNNSITILQ
                     QWFINKSVEKSRISKAESAS"
     gene            10182..11537
                     /gene="trmE"
                     /locus_tag="ABZJ_RS00050"
                     /old_locus_tag="ABZJ_00010"
                     /gene_synonym="mnmE; thdF"
     CDS             10182..11537
                     /gene="trmE"
                     /locus_tag="ABZJ_RS00050"
                     /old_locus_tag="ABZJ_00010"
                     /gene_synonym="mnmE; thdF"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000556116.1"
                     /note="in Escherichia coli this protein is involved in the
                     biosynthesis of the hypermodified nucleoside
                     5-methylaminomethyl-2-thiouridine, which is found in the
                     wobble position of some tRNAs and affects ribosomal
                     frameshifting; shows potassium-dependent dimerization and
                     GTP hydrolysis; also involved in regulation of
                     glutamate-dependent acid resistance and activation of
                     gadE; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase TrmE"
                     /protein_id="WP_000556116.1"
                     /db_xref="GI:446478262"
                     /translation="MHSQTTIAAIATPPGRGGVGVIRLSGPKAYDIAQKLTQKNLPEA
                     RLAGFRKFYDADGSIMDEGIVLCFPNPHSFTGEDVVELQGHGGPVIQNALLGRLFELG
                     AIAAKAGEFSMRAFENGKMDLVQAEAIADLIDATSQAAARSAVRSLQGAFSTKINTVL
                     EKLIHLRLHVEAAIDFPEEEIDFLADGKILALLEDVQQSVHAVQTSARQGQLLREGLQ
                     VVIAGKPNAGKSSLLNALAGVERAIVTDIAGTTRDVLHEKISLNGLPITLTDTAGLRE
                     TGDVVEKEGIRRAIKEIEQADLLLLVYDLNQGDDPLKLAQEYFAEHIEPRRLMLIGNK
                     CDLTGQSAEISDYQGFRHITVSAKQEMGVQGLVDAITAHAGFHPEEDTFIARTRHLDA
                     MKRTQLYLAEAREQLVVFNAGELVAESLRLAQNALGEITGDFSADDLLGKIFGSFCIG
                     K"
     gene            complement(11583..11846)
                     /locus_tag="ABZJ_RS00055"
                     /old_locus_tag="ABZJ_00012"
     CDS             complement(11583..11846)
                     /locus_tag="ABZJ_RS00055"
                     /old_locus_tag="ABZJ_00012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001985183.1"
                     /note="DNA-binding; binds the RcnA promotor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_000018128.1"
                     /db_xref="GI:445940273"
                     /translation="MSHIGQDKKIVNRVKRLKGQINSIENAIEQPESSCIDILQQVAA
                     IKGAINGLMSELMEQHLHHHVLKGAEVDQNELDEFLKVLKRYG"
     gene            11904..12902
                     /locus_tag="ABZJ_RS00060"
                     /old_locus_tag="ABZJ_00011"
     CDS             11904..12902
                     /locus_tag="ABZJ_RS00060"
                     /old_locus_tag="ABZJ_00011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004843778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_001154516.1"
                     /db_xref="GI:447077260"
                     /translation="MQDYSVSRHHQHQFDEGNPLAQKRILIATILTASMMVLEVFGGW
                     FFNSMALLADGWHMSSHMLALGLAYFAYRAARHYSNDHRFSFGTWKIEILAGYSSAIL
                     LMVVAIFMAFQSIQRLFNPVEIFYNEAIPIAILGLVINLICAWLLHDDGHHHHHHHHH
                     HHHHHHHHHHHHEHSHGHHHHDLNQKAAFLHVVADAVTSVFAIVALFAGKYFGWDFLD
                     ALLGILGAILVAKWSFGLMKETGKTLLDAEMDHPVVDEIREVIAEFPKHVEITDIHVW
                     KVAKGKFSCILALETDDISLNADQIRDALSIHDEIVHISVEINTLKPVYVPRETLA"
     gene            12998..13696
                     /locus_tag="ABZJ_RS00065"
                     /old_locus_tag="ABZJ_00013"
     CDS             12998..13696
                     /locus_tag="ABZJ_RS00065"
                     /old_locus_tag="ABZJ_00013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_000592158.1"
                     /db_xref="GI:446514812"
                     /translation="MIKKLGILALFSLTTSLSFANVDTVRENIKKQYPNLKISNIQKT
                     EMPGLYSANLDQQIIYLGEDGQHMFVGSIIRLKDQKNLTKDLVLGQNSIDWKQLPLKD
                     AIKTVKGNGQHVLAVFSDPNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVW
                     CAPNQSYSWKKLIEQGVKPTVASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGAR
                     SAEEIQAVWKELGL"
     gene            complement(13749..14000)
                     /locus_tag="ABZJ_RS00070"
                     /old_locus_tag="ABZJ_00014"
     CDS             complement(13749..14000)
                     /locus_tag="ABZJ_RS00070"
                     /old_locus_tag="ABZJ_00014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004884259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="WP_000269732.1"
                     /db_xref="GI:446191877"
                     /translation="MWSLIVAIVVGFFAGLIARALHPGDDKAGFIVTTLIGIAGSLLA
                     TYGGRLLGLYGENSAAGFIASVIGAVIILFIYNLIARKS"
     gene            complement(14173..14700)
                     /locus_tag="ABZJ_RS00075"
                     /old_locus_tag="ABZJ_00015"
     CDS             complement(14173..14700)
                     /locus_tag="ABZJ_RS00075"
                     /old_locus_tag="ABZJ_00015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004986218.1"
                     /note="catalyzes the formation of inosine monophosphate
                     from hypoxanthine and 5-phospho-alpha-D-ribose
                     1-diphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_000214980.1"
                     /db_xref="GI:446137125"
                     /translation="MTVAMSIMISTEEIQAKVKELGEQINSHYANSDKELVLIGLLRG
                     SVIFMADLCRTITKPHELDFMTVSSYGGGTTSSRDVKILKDLDGEIRGKDVLVVEDII
                     DSGNTLSKVVEMLQTREPNSIQLCTLVSKPSRREIDLEVKFLGFEVEDKFIVGYGLDY
                     DQKYRHLPFIGEIGL"
     gene            complement(14803..14951)
                     /locus_tag="ABZJ_RS00080"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(14914..16239)
                     /locus_tag="ABZJ_RS00085"
                     /old_locus_tag="ABZJ_00016"
     CDS             complement(14914..16239)
                     /locus_tag="ABZJ_RS00085"
                     /old_locus_tag="ABZJ_00016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017725561.1"
                     /note="Catalyzes the deamination of guanine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanine deaminase"
                     /protein_id="WP_000052269.1"
                     /db_xref="GI:445974414"
                     /translation="MSLIANTTVVRGRFLDIQQTVSEPADIPNQVRYLEDGVLISEHG
                     KIKWFGAWEDAQQHLPAGVEVQHYPEQLIVPGFIDTHIHFPQTEMVGAYGEQLLSWLN
                     TYTFPTEIQFQDKTYASEIAQFFVQELLKHGTTTALVFCTVHPVSVDALFEAAERVQM
                     RLIAGKVLMDRNAPEALCDTPETAYSDTKALIEKWHGKGRALYAITPRFAPTSTPEQL
                     ERAGQLKQEFPDVYVHTHLSENKDEIAWVKSLFPEQAGYLDVYQHYGLTGKRSVFAHC
                     VHLEDEEWQCMHDTQSAIAFCPTSNLFLGSGLFPLKKTWEKQVKVGLGTDIGAGTSFS
                     LLQTVNEAYKVQQLQGDKLSAYEALYHATLGGAKALDLQDQLGNFNVGKEADFVVLNL
                     KPTALQELRQSKSKSVEDSLFALFTLGDDRNIEATYIYGNCAYQKETAK"
     gene            complement(16296..17351)
                     /locus_tag="ABZJ_RS00090"
                     /old_locus_tag="ABZJ_00017"
     CDS             complement(16296..17351)
                     /locus_tag="ABZJ_RS00090"
                     /old_locus_tag="ABZJ_00017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001100889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000991547.1"
                     /db_xref="GI:446914291"
                     /translation="MNAIPTLTPLAMPCNSSFEAKDWEILSSHWYPVARIQDVFNAPQ
                     RVTLLDVNMALYKTKSGEIHLVRDICPHRGVPLTKGWVDGEEIVCPYHGLRYNTEGKC
                     TQIPAQPELTKISDRFSLIKFPVVQRYGLIWTSIHGRDIDKANIPVLDTWDDAEHQAI
                     LPPFVDIGGSSGRQLEGFIDVAHFAWVHHNAFANRDNPVVPKYHTERTNYGLKTVYIS
                     NVSNYPHELKHLEPEGFLWKRTFEVYPPFSAVLTVDFPESGILKILNACCPISSNKTR
                     LFVPLTRNFDQTGDLEKVYAFNAQIFAEDQDMVESQKPEELPLDLMMEAHFEADRSST
                     TYRRILAEWGLSKRYTV"
     gene            complement(17641..18801)
                     /locus_tag="ABZJ_RS00095"
                     /old_locus_tag="ABZJ_00018"
     CDS             complement(17641..18801)
                     /locus_tag="ABZJ_RS00095"
                     /old_locus_tag="ABZJ_00018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000823199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylate-amine ligase"
                     /protein_id="WP_000823200.1"
                     /db_xref="GI:446745944"
                     /translation="MKRKIFTPRPDWQVEHQNIGFDYFNLPSLDGSIYWSEGVAYEFT
                     LKQIEQLEDAANELHQMCLSVVGDLIQRGNYPTYFQIPETAINHIEHSWKQNAPMLYG
                     RFDFAYDGRNIKMLEYNADTPTGLLEASVAQWLWIEQVSGIANRDQFNSIHEDLIKHW
                     KTILPRGSHVHFAACQEAGREDWGNLEYLMDTAYQAHLQVSELSMENIGWNGQDFVDL
                     HNQPIQNIFKLYPWEWIWEEAFSQYIHPQTQWIEPCWKMLLSNKAILVELWKCYPNHP
                     LLVETHTYDSQQSLSGKWVKKPILAREGANIRVLQDGHDQGAASGSFYFDDYDKYGYV
                     VQKWVDTPLFSGQLPTLGLWMVGHQCAGMSIREDCYDIIGNDAHFAAHYFVE"
     gene            complement(18823..19188)
                     /locus_tag="ABZJ_RS00100"
                     /old_locus_tag="ABZJ_00019"
     CDS             complement(18823..19188)
                     /locus_tag="ABZJ_RS00100"
                     /old_locus_tag="ABZJ_00019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009392864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_001256727.1"
                     /db_xref="GI:447179471"
                     /translation="MRSKKINLVVVPLLLTACSHNDGPLVQDVYNNQYDCARDWNNET
                     CKQENSSSGHGSSYVGSRYLGPAYYQNNREVSYHGNTLHPYSNLSVGRPIISSTAKSA
                     SSSSPIRGGFGRSGFSFGG"
     gene            complement(19377..20333)
                     /locus_tag="ABZJ_RS00105"
                     /old_locus_tag="ABZJ_00020"
     CDS             complement(19377..20333)
                     /locus_tag="ABZJ_RS00105"
                     /old_locus_tag="ABZJ_00020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005136005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000447698.1"
                     /db_xref="GI:446369843"
                     /translation="METIGNLWLYVAFFGIVIVMLLIDFLGFKQKQGQDVSIKQAAYW
                     SVAWVSVAALFGGGLWLYLQQTVGVTLANQKTMEYFAGYLLEKSLAIDNVFVWLMIFA
                     AFAIPAALQRKILLYGVLGAIVLRTLFIFIGAWFVQEFSWVLYIFGAFLVYTGFKFLK
                     GQEEETNIEDIKLLKWLRNHMRITPQLEGDKFFVRQNGLLWATPLFLVLILVEASDVI
                     FAVDSIPAIFAVTSDPFIVLTANLMAILGLRAMFFLLAGAATKLHYLPYGLGIILLFI
                     GAKMLLLDVFHMPIWISLSFIVIVLAITAYLSLRHNKKQLQS"
     gene            complement(20652..21248)
                     /locus_tag="ABZJ_RS00110"
                     /old_locus_tag="ABZJ_00021"
     CDS             complement(20652..21248)
                     /locus_tag="ABZJ_RS00110"
                     /old_locus_tag="ABZJ_00021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004795554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000051335.1"
                     /db_xref="GI:445973480"
                     /translation="MSLETLNLSLFHVINGAQDASQFIIRLAIFFANDLLYILLFILT
                     FLWFYGDQDLKNRVIKSVFLTCVSLLVGYVISLFYHHPRPFVMGVGTTFIEHAPTASF
                     PSNHMLIFSTIALSYLFAQRKIIGIILLFLSFVVAWSRIYLGVHFPLDMLGAFIVALL
                     VNTAGYYFWNVYGTPLTAFFIHLYQIICKPLLDRGLIK"
     gene            21384..22634
                     /locus_tag="ABZJ_RS00115"
                     /old_locus_tag="ABZJ_00022"
     CDS             21384..22634
                     /locus_tag="ABZJ_RS00115"
                     /old_locus_tag="ABZJ_00022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001265995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001266118.1"
                     /db_xref="GI:447188862"
                     /translation="MRVRSVNIKVLTCWHFIRERYFMTTQEKQKKLSLRPLSPRDPEQ
                     PHRAATPLELLFDLIFVVAIATAGQQLHHAIIENHLWHALPSYLMVFFALWWAWMNFS
                     WFASAYDNDDALYRCLTFVQIVGSLVMAAGIPDVFHSQDFDIIIVGYVIMRLALVTQW
                     LRAAKHDPERRITAYRYAIGIVLVQIGWLVANFAHALSIPLFLLLVVVELFVPIYAEK
                     YSPTPWHPHHIVERYALLTIIVLGESIVGSFNAIRDALAAQSINIPAVFLMIGGLMLM
                     FAMWWAYFDRSEQHHHVKGVRPFVWGYGHYFVFVSVAAVGAALAAAVDVTTHHAHISD
                     LYMGVIVAVSVVLYTSCIWILYEFQCLSGITKWFYPITALIILCIPFICNNVGYSVFA
                     MGIVYTLRLFISNKFMENIEPKQV"
     gene            complement(22704..24077)
                     /locus_tag="ABZJ_RS00120"
                     /old_locus_tag="ABZJ_00023"
     CDS             complement(22704..24077)
                     /locus_tag="ABZJ_RS00120"
                     /old_locus_tag="ABZJ_00023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000550100.1"
                     /note="ligates
                     L-alanyl-gamma-D-glutamyl-meso-diaminopimelate to
                     UDP-N-acetylmuramic acid for reincorporation into
                     peptidoglycan; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="WP_000550105.1"
                     /db_xref="GI:446472251"
                     /translation="MHLHILGICGTFMGSLALLARDLGHKVTGSDSNVYPPMSTQLEN
                     AGIELMQGYDRSHLQPHPDLVIVGNAMKRGIDAVEYMLNEGLPYISGPQFLADHVLQG
                     KHVLGVAGTHGKTTTTTMLAWVLDQAGLNPGFLIGGVPLGFSESARLGGGKYFVVEAD
                     EYDSAFFDKRSKFVHYHPKTAILNNLEFDHADIFDDLAAIQKQFHHLVRTIPSEGRII
                     APITETHIDEVLEMGCWTPVIRTSLEANEKAALSAELISIDGSHFKVLENGNVVGEVK
                     WSMTGQHSVANALATIAAAQHVGVSLEKACEALSNFGGVKRRMELLGTINGIEVYDDF
                     AHHPTAIDTTLDGARKRLGERRLWAIIEPRSNTMRMGSHKDGLAHSARLADEVIWYQP
                     EGLDWDLQPVIEAATNHAQVSRSLDEIIERIVNEAGEGDAVVIMSNGGFGGLHQKLMS
                     ALKAKAA"
     gene            24316..24681
                     /locus_tag="ABZJ_RS00125"
                     /old_locus_tag="ABZJ_00024"
     CDS             24316..24681
                     /locus_tag="ABZJ_RS00125"
                     /old_locus_tag="ABZJ_00024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001987871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001986453.1"
                     /db_xref="GI:487912987"
                     /translation="MMKDVPLSPTVLAFVLLIISNCFMTLAWYGHLKFLHHAPFWQAI
                     LFGWTIALLEYSFMIPATRLLSDQGWTLGEMKITQEVVTLIVFVPFMVLLFKQPFKLD
                     YVWAMLCLFGCVYFVFRSQ"
     gene            24865..25377
                     /locus_tag="ABZJ_RS00130"
                     /old_locus_tag="ABZJ_00025"
     CDS             24865..25377
                     /locus_tag="ABZJ_RS00130"
                     /old_locus_tag="ABZJ_00025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007155347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /protein_id="WP_000994663.1"
                     /db_xref="GI:446917407"
                     /translation="MNAVATDTQPLVGIIMGSQSDWATLEHTANMLKQLGVPFEAEVV
                     SAHRTPDRLFEYAETARDRGIQVIIAGAGGAAHLPGMCAAKTDLPVLGVPVKSSILNG
                     VDSLLSIVQMPAGIAVGTLAIGPAGATNAAIMAAQILGLTRPEIAKNVADFRAAQTDK
                     VASNNIPGQV"
     gene            25387..26508
                     /locus_tag="ABZJ_RS00135"
                     /old_locus_tag="ABZJ_00027"
     CDS             25387..26508
                     /locus_tag="ABZJ_RS00135"
                     /old_locus_tag="ABZJ_00027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000361782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /protein_id="WP_000361785.1"
                     /db_xref="GI:446283930"
                     /translation="MDKTIGIFGGGQLGRMMAQAALPLNIQCTFFEANTDCPAGVLGQ
                     VFSSQDEQGLKQFIESADVFSLEFENTPVADVDVLTQTKTLHPPRIALATAQNRLSEK
                     ALFDELAIPVAPYRAVDSLESLKKAVAELGLPIVLKTATGGYDGKGQFVLRSEDQIDT
                     AWAELGPAKSLVAESFVKFSREVSIIAVRGQNGEVKTWPLAENHHHNGILSHSIVPAP
                     NSEALQPVAQDYITRLLNHLNYVGVLTLELFVTEQGLCANEMAPRVHNSGHWSIEGAV
                     CSQFENHIRAVAGLPLGSTDVVRPTVMINIIGQHPKTEDVLALNGAHLHLYNKSERAG
                     RKLGHITLMPVDSNELTNLCRQLAKILPEPLALTDDMII"
     gene            27137..28429
                     /locus_tag="ABZJ_RS00140"
                     /old_locus_tag="ABZJ_00028"
     CDS             27137..28429
                     /locus_tag="ABZJ_RS00140"
                     /old_locus_tag="ABZJ_00028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001252435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="WP_001252439.1"
                     /db_xref="GI:447175183"
                     /translation="MRRFSCIVGSVFLAMTQAQAELVINGSTISSNATVPVTNSDTYT
                     PNNNFQSCLANLRSQAIAAGVSGSTYDRYTQNLTPDYSVIDKLNYQPEFSTPIWDYLS
                     GLVDEERVALGKQKLAQHRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQA
                     LGTLSCEGRRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAV
                     DFDGDGRRDLVSSTADALASTANFLNKAGWQTGMPWGFEVQIPAGMSIDGEGRRSKKP
                     LSSWSARGVTRIDGSPLIQGPLSGSTPAGLMAPAGPSGPVFLVFKNFDAIYSYNAAES
                     YGLAIAHLSDRLRGAGPFVSSWPTDDPGTSRAERREIQQFLINRGYDIGAVDGLIGDK
                     TRVAIRQEQTRLGLNPTGRAGQQILRAFRQEQARKMMQ"
     gene            complement(28479..28853)
                     /locus_tag="ABZJ_RS00145"
                     /old_locus_tag="ABZJ_00029"
     CDS             complement(28479..28853)
                     /locus_tag="ABZJ_RS00145"
                     /old_locus_tag="ABZJ_00029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004711240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000122920.1"
                     /db_xref="GI:446045065"
                     /translation="MSYYHILIEVNDHISTIEQTRDIELFDIIELKPYLHSILLPYFN
                     EQEIELEDENIEYKDILHLEVKQTLLPIEHLIEEEQKQLPSDTDVTITAYEIFNDRDL
                     SQDVTSVIFDILEAVKLDQSIV"
     gene            complement(28967..29871)
                     /locus_tag="ABZJ_RS00150"
                     /old_locus_tag="ABZJ_00030"
                     /note="dual-action HEIGH metallo-peptidase; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            complement(30058..30975)
                     /locus_tag="ABZJ_RS00155"
                     /old_locus_tag="ABZJ_00031"
     CDS             complement(30058..30975)
                     /locus_tag="ABZJ_RS00155"
                     /old_locus_tag="ABZJ_00031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000714215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_000714225.1"
                     /db_xref="GI:446636879"
                     /translation="MKKFLWWGISLYFSISLQVAAFAQSNLSNISFNQPLKYRMDYID
                     PRFKLTKEQFIQIGKEAAEIWQKETGKTYFIYDSQAELTINLVLDNQQATQNERKNSI
                     NELLKQQEEWREKNKAILLFKQQIDQETSLLNKEKENLNYKFEQYQKDVSLFNQGNYG
                     QFTQSSLNKRQAELSQLSLELQTKFSQHSNKIEMLNRQIKQINQQQNLLNQSIEQFNL
                     STTSGSKTFHKGLFSQNQIQIYGFTSFDDLRLTLAHEFGHSLGLKHTDDPKSLMYPLL
                     REQDIHNFKLTNSDLDLLATLYGSNDENH"
     gene            complement(31307..33247)
                     /gene="dnaK"
                     /locus_tag="ABZJ_RS00160"
                     /old_locus_tag="ABZJ_00032"
     CDS             complement(31307..33247)
                     /gene="dnaK"
                     /locus_tag="ABZJ_RS00160"
                     /old_locus_tag="ABZJ_00032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456665.1"
                     /note="heat shock protein 70; assists in folding of
                     nascent polypeptide chains; refolding of misfolded
                     proteins; utilizes ATPase activity to help fold;
                     co-chaperones are DnaJ and GrpE; multiple copies in some
                     bacteria; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein DnaK"
                     /protein_id="WP_001062604.1"
                     /db_xref="GI:446985348"
                     /translation="MAKIIGIDLGTTNSCVAVLEGDKVKVIENAEGARTTPSIIAYKD
                     GEILVGQSAKRQAVTNPKNTLFAIKRLIGRRYEDQAVQKDIGLVPYKIIKADNGDAWV
                     EVNDKKLAPQQISAEILKKMKKTAEDYLGETVTEAVITVPAYFNDAQRQATKDAGKIA
                     GLDVKRIINEPTAAALAFGMDKKEGDRKVAVYDLGGGTFDVSIIEIADLDGDQQIEVL
                     STNGDTFLGGEDFDNALIEYLVEEFKKEQNVNLKNDPLALQRLKEAAEKAKIELSSSN
                     ATEINLPYITADATGPKHLVINVTRAKLEGLVADLVARTIEPCKIALKDAGLSTSDIS
                     DVILVGGQSRMPLVQQKVQEFFGREPRKDVNPDEAVAIGAAIQGAVLSGDKNDVLLLD
                     VTPLTLGIETMGGVLTPIIEKNTTIPAKKSQVFSTAADNQPAVDISVYQGERKMAQQN
                     KLLGNFQLGDIPPAPRGVPQIEVSFDINADGILKVSAKDKSTGKEQSIQIKANSGLSD
                     AEIEAMIKDAEANAEEDRKFEELAKARNEADALISSSNKAVKDLGDKVAEDEKTAVNT
                     AVSELEAATKENDVEAIKAKTEALQNILMPITQRAYEQAQQAGGAEGFDPNAFQGGDA
                     GQQKADDGVVDAEFTEVKDDKK"
     gene            complement(33401..33955)
                     /locus_tag="ABZJ_RS00165"
                     /old_locus_tag="ABZJ_00033"
     CDS             complement(33401..33955)
                     /locus_tag="ABZJ_RS00165"
                     /old_locus_tag="ABZJ_00033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017399660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone GrpE"
                     /protein_id="WP_001262789.1"
                     /db_xref="GI:447185533"
                     /translation="MANEQNEQAQDIQNEQVEQSNEQTQAEGVEQANDVTVESLQAQI
                     TKLEENLKLEKARTANAVYEAQKSVERIQRESEKHKETVLEKFAKELLDSVDNLERAI
                     QAAGDEETPVLEGVKLTLKSLLTTLEKFGVVEADTQNGFNADLHQAVGIDPNAKANEI
                     GTVLQKGYTLNGRLLRPAMVMVGQ"
     gene            complement(34119..35012)
                     /locus_tag="ABZJ_RS00170"
                     /old_locus_tag="ABZJ_00034"
     CDS             complement(34119..35012)
                     /locus_tag="ABZJ_RS00170"
                     /old_locus_tag="ABZJ_00034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003656002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000380238.1"
                     /db_xref="GI:446302383"
                     /translation="MDTLKAIQVFVSIAQHGNLTKAAEHLNYSRAMVSRYLEHLEHTF
                     STRLFQRNTRKISLTPAGEKALLYCENILQQQQLLQELAAPEQHNGTIRFTCGLFLFE
                     LGVAECIRQFKRQHPHIQFDVYLTESTMDLIDAQVDLALRITQKVADGLIARPVCQIE
                     SVFCAHPDYLKQHSPLLHPRQLIQHECIAHHSQHQFWTLFDNEQQPQNYPLNVTFKSN
                     DVNALYDMCLHAQGVAMLPTLLVEKDLKEKRLKALFKNFTAPELSLSVVYASRQHLPR
                     ITQEFIAFMIENLDFYLKPQN"
     gene            35120..35986
                     /locus_tag="ABZJ_RS00175"
                     /old_locus_tag="ABZJ_00035"
     CDS             35120..35986
                     /locus_tag="ABZJ_RS00175"
                     /old_locus_tag="ABZJ_00035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009518380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_000765234.1"
                     /db_xref="GI:446687888"
                     /translation="MKLFKLSASALATATALTMAQSALAQDLKIQSFLAKPEHFGVTS
                     TLIEGDKEVLLVNAQFSKSEALRIAANILDSGKTLKTIFVSYGDPDYYFGLDVFKQYF
                     PNVQIIATPETVKHIQDTQALKVKYWGPQMGANAPSQIIVPQAYTAKTLKLENESIEI
                     KGKKELTYLWVPSAKAVVGGIPVSSGIHLWMADTPKTKDRVEVIQSLESIKALQPKIV
                     VPAHMVEGAPQGLDAVNFSISYLNSYEKAAKATKNATELSKLMQKQYPTLQSVDSLEL
                     GAKVVKGEMQWP"
     gene            36380..36610
                     /locus_tag="ABZJ_RS00180"
                     /old_locus_tag="ABZJ_00036"
     CDS             36380..36610
                     /locus_tag="ABZJ_RS00180"
                     /old_locus_tag="ABZJ_00036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005120708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000733015.1"
                     /db_xref="GI:446655669"
                     /translation="MKKLGLISVVLAGVAFTAVGCASEAGLNASGSAQTSASPSGVQA
                     GVGVDAGVSGQAQPGQVDAGASGSVSGSATAQ"
     gene            complement(36786..37112)
                     /locus_tag="ABZJ_RS00185"
                     /old_locus_tag="ABZJ_00037"
     CDS             complement(36786..37112)
                     /locus_tag="ABZJ_RS00185"
                     /old_locus_tag="ABZJ_00037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001274775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_001274778.1"
                     /db_xref="GI:447197522"
                     /translation="MSAKLVVTLLATSLLTVGCVAYTDDPYYRGGYGYHDHDDDRYDR
                     NDGRRYSEWERKRWEERKRLYEQQRKDIREQQKDRREWEKRHREWEKKRLEDRDHDHR
                     DYRHDD"
     gene            37323..38393
                     /locus_tag="ABZJ_RS00190"
                     /old_locus_tag="ABZJ_00038"
     CDS             37323..38393
                     /locus_tag="ABZJ_RS00190"
                     /old_locus_tag="ABZJ_00038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000123586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_000123594.1"
                     /db_xref="GI:446045739"
                     /translation="MTAFNQKIQTLLDKGQGPAARALDRLPRLAQESLAKILGYSYQY
                     PDLDSFTKCMMAVQIKQGRVGFIGSDPLESRRAFDAQMQAIRQKPTDIELVEDIRLPL
                     QSGTIFARHYHPAPNKKLPLIVFYHGGGFVVGGLDTHDEVCRLLAKYAKVQVLSIDYP
                     LAPEVSPQHLIQSCEDALAWVYQNRRQLKILKSRIAVAGDSAGGNISTVVAQRSVNKA
                     YAPQAQLLIYPTVDFKSRHPSFYAYNEGLVLTNTDIDYVTQYYATHHNVELDDPIISP
                     TYGNLKKNPPAFVITAGHDVLHDEAKIYSHKLRQNGVKMHYEEFPDQTHGFINLTPIS
                     RKAKRYTIEISKNFRKFWDKNS"
     gene            38537..39094
                     /locus_tag="ABZJ_RS00195"
                     /old_locus_tag="ABZJ_00039"
     CDS             38537..39094
                     /locus_tag="ABZJ_RS00195"
                     /old_locus_tag="ABZJ_00039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002020154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_000735167.1"
                     /db_xref="GI:446657821"
                     /translation="MKKLLMLLCLGVSSHSVWANTLVEMQTNLGNIEIELYDDKAPMS
                     VNNFKGYIKSGFYKETIFHRVIPGFMAQGGGMTANMQEKTTRAPIKNEAGNGIANTRG
                     TLAMARTSNPDSATSQFFINVADNNFLNRSPGNPGYAVFGKVVKGMDVVDRIVQAPTS
                     NYGMHQNVPKQPIKIVDIKIKNSQK"
     gene            39484..41027
                     /locus_tag="ABZJ_RS00200"
                     /old_locus_tag="ABZJ_rRNA1"
     rRNA            39484..41027
                     /locus_tag="ABZJ_RS00200"
                     /old_locus_tag="ABZJ_rRNA1"
                     /product="16S ribosomal RNA"
     gene            41082..41158
                     /locus_tag="ABZJ_RS00205"
                     /old_locus_tag="ABZJ_tRNA1"
     tRNA            41082..41158
                     /locus_tag="ABZJ_RS00205"
                     /old_locus_tag="ABZJ_tRNA1"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:41116..41118,aa:Ile,seq:gat)
     gene            41214..41289
                     /locus_tag="ABZJ_RS00210"
                     /old_locus_tag="ABZJ_tRNA2"
     tRNA            41214..41289
                     /locus_tag="ABZJ_RS00210"
                     /old_locus_tag="ABZJ_tRNA2"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:41247..41249,aa:Ala,seq:tgc)
     gene            41623..44539
                     /locus_tag="ABZJ_RS00215"
                     /old_locus_tag="ABZJ_rRNA2"
     rRNA            41623..44539
                     /locus_tag="ABZJ_RS00215"
                     /old_locus_tag="ABZJ_rRNA2"
                     /product="23S ribosomal RNA"
     gene            44706..44820
                     /locus_tag="ABZJ_RS00220"
                     /old_locus_tag="ABZJ_rRNA3"
     rRNA            44706..44820
                     /locus_tag="ABZJ_RS00220"
                     /old_locus_tag="ABZJ_rRNA3"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            44942..45292
                     /locus_tag="ABZJ_RS00225"
                     /old_locus_tag="ABZJ_00040"
     CDS             44942..45292
                     /locus_tag="ABZJ_RS00225"
                     /old_locus_tag="ABZJ_00040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016654456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005124945.1"
                     /db_xref="GI:491266807"
                     /translation="MDIMRRFFIFGVPVKINSFSPIPEDDEELSLPELIYWASLGDLE
                     QVKQLLIDGEDPNQTDDEGYSALQAAAENDHLDIVKLLVEKGAHVPYKSEYTALQLAE
                     MAGNTDIVNYLKSL"
     gene            complement(45338..45880)
                     /locus_tag="ABZJ_RS00230"
                     /old_locus_tag="ABZJ_00041"
     CDS             complement(45338..45880)
                     /locus_tag="ABZJ_RS00230"
                     /old_locus_tag="ABZJ_00041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006582374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="WP_000964176.1"
                     /db_xref="GI:446886920"
                     /translation="MLVYIIVGSVREGRTAIKIANWLETTIPSFNLKDFQTEVIDLKE
                     WNLPLFSGSHPPATGIYDQPKQQEWADKIAQADAFIFISPEYNHGYSPALKNAIDYVG
                     KEWSGKPAAFIGYGSTNGSRSISQIRQVTSSLSIVDPNAVIEIRDIFKRNKDEKFEAN
                     EFEVKGLQSIVEKLQKYHLS"
     gene            complement(46015..46497)
                     /locus_tag="ABZJ_RS00235"
                     /old_locus_tag="ABZJ_00042"
     CDS             complement(46015..46497)
                     /locus_tag="ABZJ_RS00235"
                     /old_locus_tag="ABZJ_00042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002050524.1"
                     /note="rotamase; accelerates isomerization of the peptidyl
                     prolyl bond, involved in the folding of proteases; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_000136002.1"
                     /db_xref="GI:446058147"
                     /translation="MTEIIQPNEEIRITDGSKVDLHFSVAIENGVEIDNTRSREEPVS
                     LTIGDGNLLPGFEKALLGLRAGDRRTVHLPPEDAFGPWNPENIQTFDTVKFEQRPIPG
                     HMIEFEDKAKATLFGVVKSVNDDITEIDFNHPLAGKNITFEVEIFKVTPAGQQGIKIM
                     "
     gene            complement(46499..47029)
                     /locus_tag="ABZJ_RS00240"
                     /old_locus_tag="ABZJ_00043"
     CDS             complement(46499..47029)
                     /locus_tag="ABZJ_RS00240"
                     /old_locus_tag="ABZJ_00043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001133880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase A8"
                     /protein_id="WP_001133879.1"
                     /db_xref="GI:447056623"
                     /translation="MPNSQAKKGLFQFYPHNLIWLGLSVLAIVLDQWTKWIASTHLNY
                     ADPVPVLPFLNWTLLHNYGAAFSFLSDAGGWQRYFFTSLAGLVSILFVFWLLRMPKKM
                     VVLPVAIALILGGALGNLIDRITLGYVVDFIHVYYQNHHFPAFNIADSAITLGTILLL
                     IDTFFLEKQRPKNSDA"
     gene            complement(47022..49859)
                     /gene="ileS"
                     /locus_tag="ABZJ_RS00245"
                     /old_locus_tag="ABZJ_00044"
     CDS             complement(47022..49859)
                     /gene="ileS"
                     /locus_tag="ABZJ_RS00245"
                     /old_locus_tag="ABZJ_00044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017391480.1"
                     /note="IleRS; catalyzes the formation of
                     isoleucyl-tRNA(Ile) from isoleucine and tRNA(Ile); since
                     isoleucine and other amino acids such as valine are
                     similar, there are additional editing function in this
                     enzyme; one is involved in hydrolysis of activated
                     valine-AMP and the other is involved in deacylation of
                     mischarged Val-tRNA(Ile); there are two active sites, one
                     for aminoacylation and one for editing; class-I
                     aminoacyl-tRNA synthetase family type 1 subfamily; some
                     organisms carry two different copies of this enzyme;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucyl-tRNA synthetase"
                     /protein_id="WP_001281041.1"
                     /db_xref="GI:447203785"
                     /translation="MSDKQTTENAVDYKATLNLPDTQFAMKANLAVREVKWLEEWYTD
                     NIYQQIRASRIGKKKYILHDGPPYANGTIHLGHAVNKVLKDIIVKSRTLAGFDAPYVP
                     GWDCHGLPIELKVEEKVGKVGEKVDAATFRKHCREYALKQIDLQRTDFKRLGILGDWD
                     NPYLTMNYKQEADIVRALGLIQKNGHIQPGLKPVNWCMDCGSALAEAEVEYEDKKSDA
                     IDVGFGVVDLKDLSARVNVEVQDPTDIVIWTTTPWTLPANQAVALHAEIEYQLVQVTT
                     ERGKQNFILAKDLVASAIERYKLENPVVLADFTGSALENLTLQHPLLTDRQVPVILGE
                     HVIATSGTGAVHTAPGHGADDYKVGLQYNLKVENPVGGNGVYLPTAPIFAGEHIYKAN
                     PKIIEALGAVGRLWAHQPIKHSYPHCWRHKTPIIFRATPQWFISMDQKGLRDGALNAI
                     ENDIEFVPNWGKNRIESMIEGRPDWCISRQRTWGVPIPFFVHKDTNELHPRTPELIEE
                     VAKLIEKEGIDAWFNRDAKDFIGEDAEQYNAVRDTLDVWFDSGTTHYAVLEQRDELES
                     PADLYLEGSDQHRGWFQSSLLTSMAIHNRAPYKALLTHGFTVDENGRKLSKSLGNYIP
                     LEEIIKHLGADGLRLYVASSDYRYEIAASKEIFSRVSDSYRRIRNTLRFLLANLNGFK
                     PSTDALAVDDLIALDQYILQRANEVQQTIIAAYEEMNFHVVCSALTSFCINDLGGFYL
                     DIIKDRQYTTKADSQARRSAQTALYHIVQAFVRWMSPILSFTAQEAWPLIPEQTEKYV
                     FTAEWYDLPVSSKANLLSEADWQTLISVKSAVNKQIEAARNAKLVGSNLSAKVELWAN
                     ESLQTVLNQLADELRFVLITSQVVVHPFAEQGEATEMEGLRVQVSAAEGEKCARCWHV
                     LPDVNTHVDHPGLCGRCIVNVTGRGEVRKYA"
     gene            complement(49921..50922)
                     /locus_tag="ABZJ_RS00250"
                     /old_locus_tag="ABZJ_00045"
     CDS             complement(49921..50922)
                     /locus_tag="ABZJ_RS00250"
                     /old_locus_tag="ABZJ_00045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004884035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin kinase"
                     /protein_id="WP_000771825.1"
                     /db_xref="GI:446694479"
                     /translation="MKLLRLNALSPNFQLPQTAVTIGNFDGVHLGHQAMIAQLKKIAA
                     AQGLKTLVMIFEPQPLEFFKGYDAPPRINSLREKVEYLAELGVDYIAVAKFDQHFRSM
                     SASEFADLLKDKLNAQALVLGDDFHFGKDRQGNSEFLKNYGFQVTNLHTIELEGERVS
                     STRIRQVLQVGNLALAAKLLGRPYSITGRVQYGDQIGRTLDFPTINVRLNRHKPCLNG
                     IYGVEVICETTSLTQKVLQDNPEKPGIAGYHENSLYGAGHVGTRPAIQQEHPEWRLEV
                     HFPDVSANLYGLFMRVTFLHYLHGELNYPSLEALKAGIDNDVQQLRQYRNDTTQFPF"
     gene            51131..52264
                     /locus_tag="ABZJ_RS00255"
                     /old_locus_tag="ABZJ_00046"
     CDS             51131..52264
                     /locus_tag="ABZJ_RS00255"
                     /old_locus_tag="ABZJ_00046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000828380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_000828360.1"
                     /db_xref="GI:446751104"
                     /translation="MKRPFYQLNQSKDVIRHFTPNWFTATMGTGVVSMILIQLPFAKS
                     FLFMLATLLWQFNIVLFSVFSVLYLLRWFLFPHEAKQIFNHPNMSLFLGAIPMGLATI
                     LNGFLSFGIGLYGEVAVHIAQALWYIDVFLALAIAWIVPFCMFSRQNHQLHTMTAIWL
                     LPVVACEVAASSAGMLVAHLPADVHSFHLLLAGYVLWGISVLPAFAILTILMLRMALH
                     QLPEKEVAISSWLSLGPIGTGALGLLLLGEQAQRVFVNVGFPELAHVFKALGVVGSLV
                     LLGFGLWWLGLAILTTLRHAKTGIPFNLGWWGLTFPFGVFILALFNLGHQIEVVFLQY
                     VAVAFSILLLVMWSVVMKKTLAGAYSGKLFFSPCLVALQQRMQ"
     gene            52345..52911
                     /locus_tag="ABZJ_RS00260"
                     /old_locus_tag="ABZJ_00047"
     CDS             52345..52911
                     /locus_tag="ABZJ_RS00260"
                     /old_locus_tag="ABZJ_00047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001090744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleosidase"
                     /protein_id="WP_001090743.1"
                     /db_xref="GI:447013487"
                     /translation="MNTDTALIMALPNESKGLFEQAGIEVHYSGIGKINAAFKAFEVI
                     QKTGCKTLINLGTAGSSSFNRHDLVEIKTFVQRDMDVSPLGFEVGVTPLDDHLAAEIH
                     LQTHFADLPKGICGTGDSFETGQPKVACDVVDMEGYALAKVCHKLGVRLISVKYITDG
                     ADDTAHLDWEENLLLGAQKLLALYQNHF"
     gene            complement(52946..53557)
                     /locus_tag="ABZJ_RS00265"
                     /old_locus_tag="ABZJ_00048"
     CDS             complement(52946..53557)
                     /locus_tag="ABZJ_RS00265"
                     /old_locus_tag="ABZJ_00048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004706123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_002027522.1"
                     /db_xref="GI:487954056"
                     /translation="MEQKKSTQKRNQLLAAALDVFSLYGFSGASLDEIAQLADMHKSN
                     IFYYYENKESLYVEVLTTVLQKWLAPLQTLEAELEPAEALSHYLIQKIELSRSQPKAS
                     RLFALEIIQGAPHILPILKGPLKKLFKRKAKVIQTWQEQGKISPDIDPELLILNIWGL
                     TQNYADFATQMEMVTGKTLRNRSMFQRSIEHTVHMMLYGVLPR"
     gene            complement(53827..54627)
                     /gene="ssuB"
                     /locus_tag="ABZJ_RS00270"
                     /old_locus_tag="ABZJ_00049"
     CDS             complement(53827..54627)
                     /gene="ssuB"
                     /locus_tag="ABZJ_RS00270"
                     /old_locus_tag="ABZJ_00049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004795511.1"
                     /note="part of the ABC type transport system SsuABC for
                     aliphatic sulfonates; with SsuA being the periplasmic
                     substrate-binding subunit, SsuB the ATP-binding subunit
                     and SsuC the permease; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aliphatic sulfonate ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_000183286.1"
                     /db_xref="GI:446105431"
                     /translation="MTNLNLNINQNDVELIPENHPESQEPVVGAEILIEQLYKFYGEV
                     KVLEDLNLHIQPGEFLAIVGRSGCGKSTLLRLIAQLEKASFGEIKFKSARHLREGITN
                     DDIRVMFQDPRLLPWRNILQNVQLGLPKSQHALAEELLEKVGLKEKAGQWPSQLSGGQ
                     RQRTALARALSHTPRILLLDEPLGALDALTRLEMQSLIERLWKEQGFTAILVTHDVSE
                     AVQLADRIILLDKGQIAQSFQVNLPRPRKKSITFAQLEQQVLDAVLAT"
     gene            complement(54641..55438)
                     /locus_tag="ABZJ_RS00275"
                     /old_locus_tag="ABZJ_00050"
     CDS             complement(54641..55438)
                     /locus_tag="ABZJ_RS00275"
                     /old_locus_tag="ABZJ_00050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004706119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter"
                     /protein_id="WP_000031022.1"
                     /db_xref="GI:445953167"
                     /translation="MSKDINIVSRGTKQVGQRLLPWIFPIVLLVVWQIASSSGLLENR
                     ILPAPTAVVSAFWHLLISGELWQHVKVSAGRALLGLFIGGGLGLLLGLLNGSSRFAST
                     LLDTTLQMIRNIPALALIPLVILWFGIDETAKLFLVAVGVFFPIYINTYHGIRSVDPQ
                     LIEMGKSYGLSRWQLYKEIILPGAMPSILVGLRFALGLVWVLLIVAETISAQAGIGYM
                     TMNAREFLQTDVVLVGILLYALLGKLADVLAQLLERYLLRWHAGYQK"
     gene            complement(55435..56610)
                     /locus_tag="ABZJ_RS00280"
                     /old_locus_tag="ABZJ_00051"
     CDS             complement(55435..56610)
                     /locus_tag="ABZJ_RS00280"
                     /old_locus_tag="ABZJ_00051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019457892.1"
                     /note="catalyzes the release of sulfite from
                     alkanesulfonates; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="WP_000689557.1"
                     /db_xref="GI:446612211"
                     /translation="MKIFWFIPTHGDSRYLGTSKGARQVDHAYMKQIAVAVDNLGYEG
                     VLIPTGRSCEDPWITAASLIDATQHLKFLVALRPGVTTPALAARMAATFDRLSNGRVL
                     LNLVTGGDEAELRGDGLYEDHSTRYQTANEYVKIWREILTRSHTGETFTFHGERLQVD
                     DAKLLYPPVQKPYPPLWFGGSSDVAVELAAEQVDTYLTWGEPPAAVKEKIEHVRAKAE
                     AKGRKLTYGIRLHVIVRETNEQAWAAANELIQYLDDATIAAAQKKFAQMDSVGQQRMA
                     ALHGGNRDKLEVSPNLWAGIGLVRGGAGTALVGDPETVAARIQEYADLGIDTFIFSGY
                     PHLEESIRFAELVFPLLPIETRAKLAQPNLTGPFGEIIANNYVPDEKKQNSSVKEPA"
     gene            complement(56637..57620)
                     /locus_tag="ABZJ_RS00285"
                     /old_locus_tag="ABZJ_00052"
     CDS             complement(56637..57620)
                     /locus_tag="ABZJ_RS00285"
                     /old_locus_tag="ABZJ_00052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001164670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_001164666.1"
                     /db_xref="GI:447087410"
                     /translation="MQHQSLFNKSQWTQLVKRFSAVAVLGFTIAAPAWAIDPTVKELR
                     IGFQKSSINFAIAKQQKLFEQEFPNAKITWNEFPAGPQILEALAVGSLDVGVTGDTPP
                     VYAQAAGKPLYYIAYEAAKPLASAILVPKNSQLKQLKDLKGKRIALQKGSSSHYLLVQ
                     AVRKAGLKWSDITPIWLTPADARAAFQKGAVDAWAIWDPYYASAQLEDQARVLASGKG
                     LSPNYTFYLAAPNFVKQYPKAVPGLIKQFNQADKWVQSHQAETASAIGQSTGLKPATS
                     DLFIKRRPRPSSAAPLNSKVIAEQQQLADIFTQQGIIPKPISIKQAVWGAK"
     gene            complement(57692..58660)
                     /locus_tag="ABZJ_RS00290"
                     /old_locus_tag="ABZJ_00053"
     CDS             complement(57692..58660)
                     /locus_tag="ABZJ_RS00290"
                     /old_locus_tag="ABZJ_00053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005804832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_001173275.1"
                     /db_xref="GI:447096019"
                     /translation="MALFNSTSWAKYSVIAASLAGVMMLGGCAKKEEHTTTTLNIGYQ
                     KYGILPILKARGDLEKALKDQGVQVKWVEFPAGPQLLEGLNVGSVSLGEAGEAPPIFA
                     QAANPNLVYVANQPAAPKAEALLVQKDSPIQSIKDLKGKRVALNKGSNVHYLLLKVLE
                     ANHLSLSDIQPVYLPPSDARAAFEKGAVDAWVIWDPFFAAAEHQIQARVLATGENLVS
                     NHQFYLADRKFAENNPKVLNTVVQTLNQTTEWVSTHQDEAAKLLEKPTALEFDVLKTS
                     ISRMGFGVQPISDKVAQEQQYVADAFYAQKLIPNKLTIQEAILKLK"
     gene            complement(58994..60349)
                     /locus_tag="ABZJ_RS00295"
                     /old_locus_tag="ABZJ_00054"
     CDS             complement(58994..60349)
                     /locus_tag="ABZJ_RS00295"
                     /old_locus_tag="ABZJ_00054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752676.1"
                     /note="catalyzes the formation of N-acetyl-L-glutamate
                     from L-glutamate and acetyl-CoA in arginine biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate synthase"
                     /protein_id="WP_001142457.1"
                     /db_xref="GI:447065201"
                     /translation="MPTKSLEKSHNNTQHYVHWFRHSAPYINAHRDKTFVLMFGGEAV
                     RDPNFEHIIHDIALLHSLGIRLILVHGARPQINHNLKEKGIETPFYDNCRITTRESLS
                     CVMSAVGSIRLEIEALLSMGLANSPMYGARIDVVSGNFVTAKPYGIREGMDFQLTGEV
                     RSIDTDAIERHLDNNNIVLLGPTGYSTTGEVFNLRAEEVATKTATYLKADKLIFLGEQ
                     QGLPNEDGQLLRELSPHQLDYYIQQYQTTHPTLTLHLQEAKKASLSGVHRVHLISYSY
                     DGALIEELFTRDGVGTMITDAHYEEVRMAHIQDVGGLMNLLRPLEEEGILVYRSRERL
                     EQEINQFAVIERDGMILACAALYPIPTEFNETRSAEIACVAVHPSYRKSNRGSQILQF
                     LEEKAKQQGIRQLFVLTTRTAHWFLEHGFHQVSVDDLPNARQALYNYQRNSLVFKKLL
                     P"
     gene            complement(60470..60790)
                     /locus_tag="ABZJ_RS00300"
                     /old_locus_tag="ABZJ_00055"
     CDS             complement(60470..60790)
                     /locus_tag="ABZJ_RS00300"
                     /old_locus_tag="ABZJ_00055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000724537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_000724538.1"
                     /db_xref="GI:446647192"
                     /translation="MKKITTAIILSMSGLIATTAMAAPHDHYHHQGYETKTVKVIHKD
                     DHANIWRAGQVVPHQYQHPRYVIDYRSHQKLTKPGRYQKWYKVNGNYVLVNEQSHKII
                     KVIR"
     gene            complement(61013..61423)
                     /locus_tag="ABZJ_RS00305"
                     /old_locus_tag="ABZJ_00056"
     CDS             complement(61013..61423)
                     /locus_tag="ABZJ_RS00305"
                     /old_locus_tag="ABZJ_00056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005120695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_000732887.1"
                     /db_xref="GI:446655541"
                     /translation="MKKLFTILALCITVLTTSMASFADPPFDRGHGPKGPKGGPRGEW
                     NDRGHKFDRDDNGDRVRDERRMREERGFERLKQHRWQPGYVMPQHYRGNGYKVDYKDN
                     NLPKPDRNQQWYKINNDYILVDTDSNSIVSIRGF"
     gene            complement(61641..62387)
                     /locus_tag="ABZJ_RS00310"
                     /old_locus_tag="ABZJ_00057"
     CDS             complement(61641..62387)
                     /locus_tag="ABZJ_RS00310"
                     /old_locus_tag="ABZJ_00057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009387635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxoacyl-ACP reductase"
                     /protein_id="WP_000877608.1"
                     /db_xref="GI:446800352"
                     /translation="MKYSEYQPRPDLLKDRIILITGAGDGIGRAAALSYALHGATVVL
                     HGRTLNKLEVIYDEIEGLGAPQPAILPLQLSSASDRDYDFLVSTLEKQFGRLDGILHN
                     AGILGERVELAHYPAEVWDDVMAVNLRAPFALTQALLPLLQKSENASVVFTSSGVGRE
                     ARALWGAYSVSKVAIEAVSKIFAAEHTYPNIRFNCINPGATRTAMRAKAYPEEDPKTL
                     PTPESIMPAYLYLMGEDSLTLNGQSIDAQD"
     gene            complement(62453..63151)
                     /locus_tag="ABZJ_RS00315"
                     /old_locus_tag="ABZJ_00058"
     CDS             complement(62453..63151)
                     /locus_tag="ABZJ_RS00315"
                     /old_locus_tag="ABZJ_00058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000973876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphatase"
                     /protein_id="WP_020752677.1"
                     /db_xref="GI:523534347"
                     /translation="MKAVLFDLDGTLIDTAADFIRIIQQMCRDARRPVVEADLIRTQV
                     SEGARAMVKLVYPELDMTNPIFLAHRQNFLDLYGNNIVVDTDLFEGMYPLLEALEAQQ
                     IPWGIVTNKPRGLSESLLEKLNLTERCAVLVCPEDVSKTKPDPEPMYLAAKQLNIPAN
                     EIIYVGDHPRDIDAGRNADMYTILAAYGYLPIEHRDDLNAWQADSIVNTVTELHELLR
                     QKLPALQENQRMIS"
     gene            complement(63151..63864)
                     /locus_tag="ABZJ_RS00320"
                     /old_locus_tag="ABZJ_00059"
     CDS             complement(63151..63864)
                     /locus_tag="ABZJ_RS00320"
                     /old_locus_tag="ABZJ_00059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017393471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="WP_000080755.1"
                     /db_xref="GI:446002900"
                     /translation="MSQLNVDLQEIAKFEALAAKWWDQHSEFRPLHQINPLRLNWIDE
                     RAGGLAGKKVLDVGCGGGILAESMARRGADVLGIDMGEAPLAVGRLHAQQENVQNIEY
                     RQIPVEELAQEQAGQYDVVTCMEMMEHVPDPASIVKACQTLVKPGGHVFFSTINRNPK
                     SYLFAIIGAEYVLRLLPKGTHDYHKFIRPSEMAHDIRNAGLTLKEMTGLHYNPITKRY
                     WLAPNVDVNYMVHTIKTGA"
     gene            64044..64661
                     /locus_tag="ABZJ_RS00325"
                     /old_locus_tag="ABZJ_00060"
     CDS             64044..64661
                     /locus_tag="ABZJ_RS00325"
                     /old_locus_tag="ABZJ_00060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000737567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkali-inducible disulfide interchange protein"
                     /protein_id="WP_000737567.1"
                     /db_xref="GI:446660221"
                     /translation="MKKLVLGGLSAAIMAVSGSAMAADFVAGKDYTVIANPGKVEVPG
                     KIEVREFFWYGCPHCFKLEPHMQTWLKQIPSDVRFVRTPAAMNKVWEQGARTYYTSEA
                     LGVRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNSTYNSFAVTAKVAES
                     NKLAQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK"
     gene            complement(64739..65386)
                     /locus_tag="ABZJ_RS00330"
                     /old_locus_tag="ABZJ_00061"
     CDS             complement(64739..65386)
                     /locus_tag="ABZJ_RS00330"
                     /old_locus_tag="ABZJ_00061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002050537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_001047027.1"
                     /db_xref="GI:446969771"
                     /translation="MNLDRHTQFLMRKEKILSVAEKLLLENNQEITLDELVAELDIAK
                     GTLYKHFRSKNELLLELIIQNEKQILEISQKYNTDFKEYAPRYMLHHLLTPGKTILLH
                     QLEENLTMTESKLKHLFEELYEVRQQRILAIKDITESYLKSLNYDMSIRDYLSYIWSL
                     TYGASLLLNSTYYQRSIGSRQKLINLYINQALSLPTQTTNFDALNFQIEDENSQN"
     gene            complement(65523..66161)
                     /locus_tag="ABZJ_RS00335"
                     /old_locus_tag="ABZJ_00062"
     CDS             complement(65523..66161)
                     /locus_tag="ABZJ_RS00335"
                     /old_locus_tag="ABZJ_00062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002050499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_000027529.1"
                     /db_xref="GI:445949674"
                     /translation="MSIRDERKQQSRQALLDAALHLSTSGRSFSSISLREVAREVGLV
                     PTAFYRHFQDMDELGKELVDQVALHLKSVLHQLGQSYLQHKSAKTQTSIELFVQAVNH
                     SPKQWQFMIAERWGGSETVRAAIAREIEFLIEDLTTDLTKLENFKHIQNPQDLNVLST
                     ILTNMSFTWAMTWLNLAKQYQGEQLKQQQTAFIENASTQVRLLFRGIANWER"
     gene            66335..67360
                     /locus_tag="ABZJ_RS00340"
                     /old_locus_tag="ABZJ_00063"
     CDS             66335..67360
                     /locus_tag="ABZJ_RS00340"
                     /old_locus_tag="ABZJ_00063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001006253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_000994557.1"
                     /db_xref="GI:446917301"
                     /translation="MNATLNYQPHWVREDFVDFVLQKINATWAWKRVLAEVTAVQPLY
                     TDMVLIKLKPNRNFNFEQVCAGQSILLTLLIDGVYQQRSYSIIEVTTQGEIALGIKVQ
                     GLVSRAAQLLHVGECVEISQPQGDFTLHQGQQPAILIASGSGITAIYSLLQQALKQQL
                     EQIHVIYFNRAEIFHAELKALAEQHPQLQYHFFNTSEQKQHLTESLLQKLVPDFAQTA
                     TYICGHHGMMQQANEIYAQKGAQSQLHQEYFQPLQVTGTHAAQPVIFRRAQHEFLAET
                     NLLSSAEQAGLRPQHGCRMGVCNKCSCTKVSGVTQNLLTGEIEDQPNRPIKLCVSQAL
                     SPVTIDL"
     gene            67385..68533
                     /locus_tag="ABZJ_RS00345"
                     /old_locus_tag="ABZJ_00064"
     CDS             67385..68533
                     /locus_tag="ABZJ_RS00345"
                     /old_locus_tag="ABZJ_00064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001055497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="WP_001055537.1"
                     /db_xref="GI:446978281"
                     /translation="MNMALKVSTASKSAHLTPEQIEEFGRRVEQIRQDVMQSLGEQDA
                     KYIYKVRNFVRYTEIASRGMLMFGGWIPPVWLLGTGLLGISKIVENMELGHNVMHGQF
                     DWLNEPSLNGNTYDWDTIASGDDWRETHNYVHHTYTNIVGKDHDVGYGLLRVSDQQKW
                     EPRHLFNIPLGLQLMFFFEWYVGVQNLHLEDALVYKTKSWKQVWKDSAKVRKKATRQV
                     LKDYVFFPVISGPMFLPVFAGNVVANIIRNLWSSAVIFNGHFTEDAETFEPDNTDTET
                     KAEWYLRQIRGSSNFSGTEWLHFMSGNLSHQIEHHLFPDMPANRYKEVAPKIKALCAE
                     YGINYNEANFMRQFWSVWVRLAKCSLPNHTTAKVMQTLEKLKAKFKFA"
     gene            68692..69408
                     /gene="rph"
                     /locus_tag="ABZJ_RS00350"
                     /old_locus_tag="ABZJ_00065"
     CDS             68692..69408
                     /gene="rph"
                     /locus_tag="ABZJ_RS00350"
                     /old_locus_tag="ABZJ_00065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009584291.1"
                     /note="RNase PH; tRNA nucleotidyltransferase; forms
                     hexamers in Bacillus subtilis; phosphoroltic 3'-5'
                     exoribonuclease; involved in maturation of tRNA precursors
                     and removes terminal nucleotides near CCA acceptor arms of
                     mature tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="WP_001217232.1"
                     /db_xref="GI:447139976"
                     /translation="MRIDQRALDQLREVKITRNYTRYAEGSVLVEFGHTKVLCTASID
                     NSVPRFLKGQGQGWVTAEYGMLPRSTHSRCDREAARGKQTGRTQEIQRLIGRSLRAMV
                     DLKKLGENTITIDCDVIQADGGTRTASITGAAVALVDAMNVLLAQKKIKQDPLKGLVA
                     AISVGMYQDEVLLDLCYEEDSNCQTDLNVVMTQAGEFIEIQGTAEDKPFTRAQSNAML
                     EMAEKGIAELIKKQQEALGW"
     gene            69698..71866
                     /locus_tag="ABZJ_RS00355"
                     /old_locus_tag="ABZJ_00067"
     CDS             69698..71866
                     /locus_tag="ABZJ_RS00355"
                     /old_locus_tag="ABZJ_00067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001081759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase C"
                     /protein_id="WP_001081758.1"
                     /db_xref="GI:447004502"
                     /translation="MNRREFLLNSTKTMFGTAALASFPLSIQKALAIDAKVESGTIQD
                     VKHIVILTQENRSFDNYFGTLKGVRGFGDRFTIPMTEGRKVWEQYDANKKKVLPYHLD
                     SRLGNAQRVTGTNHSWSDGQGAWDNGRMSDWVAHKQPQSMGYYKKQEVEYQFALANAF
                     TICDAYHCAMHAGTNPNRKFIWTGTNGPTGAGVASVVNEFDGIGPSTEGYEWTTYPER
                     LQQAGVTWKVYQNMPDNFTDNPLAGFKQYRRANEQSGQPVSNDTLMCPAYDEKIDVTQ
                     PLYKGIANTMPDGGFLGTFKADIAQGKLPQVSWLVAPATYSEHPGPSSPVQGAWYIQE
                     VLNALTENTQVWSQTVLLVNFDENDGFFDHVPSPSAPSKDINGVVYGKTTLTDQQVSY
                     EYFNHPAVATSKSQPETDGRVYGPGVRVPMYVISPWSRGGWVNSQVFDHTSILQFLEK
                     RFGVQEPNISPYRRAVCGDLTTAFNFKTPNLLPVGELDGKKTKAEADAIRVAQELLPQ
                     VSVPSQQQFPQQEIGIRPSRALPYILHTSAKVDATQKTVKLMFSNTGKQAAVFHVYNR
                     LDLTAIPRRYMVEAGKQLDDVWNTINGQYDLWVLGPNGFHRAFKGNLSQANQTQALPE
                     IRVCVEECDANLYLKVRHDGNKSVKLTVKANAYLPNKIWMIETNSSEKELVWDMSEFG
                     GWYDFTVTLAEDATFSRRFAGRIETQEDSISDPYMGYLES"
     gene            72272..72439
                     /locus_tag="ABZJ_RS00360"
                     /old_locus_tag="ABZJ_00068"
     CDS             72272..72439
                     /locus_tag="ABZJ_RS00360"
                     /old_locus_tag="ABZJ_00068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009387451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000938939.1"
                     /db_xref="GI:446861683"
                     /translation="MLQGFIVLLAVVTFVLMAADPRDSGAQATQSAWQKTQAADMTKS
                     QKNTNNDADFI"
     gene            complement(72436..73281)
                     /locus_tag="ABZJ_RS00365"
                     /old_locus_tag="ABZJ_00069"
     CDS             complement(72436..73281)
                     /locus_tag="ABZJ_RS00365"
                     /old_locus_tag="ABZJ_00069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019457906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide pyrophosphorylase"
                     /protein_id="WP_000026927.1"
                     /db_xref="GI:445949072"
                     /translation="MSIPQSLLEQSIQINIQQALQEDIGDGDITAMLTPEDEQATATI
                     ISREDMVLAGQPWVNALISAYDNTVQVTWLKQEGDRVAANEAFLKLAGSARSLLTVER
                     PALNFIQTLSAVATKTAEYVQHLEGLNTKLLDTRKTLPGLRIAQKYAVTVGGGQNHRL
                     GLFDAFLIKENHIMAAGGIAQAIAKAHQIAPGKPVEVEVETWDELNQALEAGADIVML
                     DNFSQQQMIDAVKHVAGRCKLEASGNITIENLREVATTGVDYISMGVLTKDVKAVDLS
                     MRFNA"
     gene            73453..74022
                     /locus_tag="ABZJ_RS00370"
                     /old_locus_tag="ABZJ_00070"
     CDS             73453..74022
                     /locus_tag="ABZJ_RS00370"
                     /old_locus_tag="ABZJ_00070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004706091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-anhydromuranmyl-L-alanine amidase"
                     /protein_id="WP_000809997.1"
                     /db_xref="GI:446732741"
                     /translation="MKQITPYEVIDGQLKGARQIPSPNFNQRPAGSEIQMIVVHNISL
                     PPSQFGGGYIEQFFQNKLDWSVHPYFQTIEGMQVSTHLLILRTGEVLQFVNFNDRAWH
                     AGRSSYLAKVECNDYSIGIELEGSDDLPFEEVQYSVLTDVVAAIRQVYPEIKNHIAGH
                     SDIAPGRKTDPGPYFKWQHFRQLLAQKKT"
     gene            74104..75645
                     /locus_tag="ABZJ_RS00375"
                     /old_locus_tag="ABZJ_00071"
     CDS             74104..75645
                     /locus_tag="ABZJ_RS00375"
                     /old_locus_tag="ABZJ_00071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004843727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001240163.1"
                     /db_xref="GI:447162907"
                     /translation="MALWRSTFIVSAMTMLSRVLGLVRDVVLLNVFGAGKDFDTFVVA
                     FRIPNFFRRLFAEGAFSQAFIPVLTEYKTGRAHAEVQILISRVFGCLLTVMTLLTFVA
                     MVLAPAIIYMYAPGFHNDPEKFDLAVSMFRLTIPYLMFMSLTAFASSILNSYGSFASP
                     AFSPVLLNVAMIAGAWWLTPYMAEPIKALGWSVVAAGILQLAIQIPELWRKNLLIPPK
                     VDFKHEGVERILKLMLPALFGVSVTQINLLLNTIWASFMQDGSVSWLYSAERMTELPL
                     GLIGVAIGTVILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQ
                     ALFQRGEFDLRDTQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVA
                     ANAILNVVFIGFFKLINWHAEHMALALASSGSALVNAGLLYFYLHKRNIFRFGAHWKK
                     LALQYGLANLAMIAALWFGLNWYNGELSQWIRVAEVVGLCVIGVIAYLIGLLLTGFRP
                     RDLKH"
     gene            complement(75691..76386)
                     /locus_tag="ABZJ_RS00380"
                     /old_locus_tag="ABZJ_00072"
     CDS             complement(75691..76386)
                     /locus_tag="ABZJ_RS00380"
                     /old_locus_tag="ABZJ_00072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005141142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_000724222.1"
                     /db_xref="GI:446646876"
                     /translation="MKKISLVIAASTMSLSVFAAAPITNKSPAKDQFSYSYGYLMGRN
                     NTDALTDLNLDIFYQGLQEGAQNKTARLTDEEMAKAINDYKKTLEAKQLVEFQKQGQQ
                     NAQAGAAFLAENTKKSGVITTKSGLQYQVLKEGTGKTPKATSRVKVNYEGRLLDGTVF
                     DSSIARNHPFDFQLNQVIAGWTEGLQTMKEGGKTRFFIPAKLAYGEVGAGDSIGPNST
                     LIFDIELLQVLPK"
     gene            complement(76435..77157)
                     /locus_tag="ABZJ_RS00385"
                     /old_locus_tag="ABZJ_00073"
     CDS             complement(76435..77157)
                     /locus_tag="ABZJ_RS00385"
                     /old_locus_tag="ABZJ_00073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000030394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_000030402.1"
                     /db_xref="GI:445952547"
                     /translation="MSKALPIAVAVVLGGAALVPVYYATQHPTTEVGRKADKNASPIQ
                     KISYVLGYEVAQQTPPELDTKAFVQGIHDARNKQPSAYTQEDLKAAVAAYEKELQQKM
                     QHQDKPEQAGTATDSADAQFLAENKTKAGVKTTASGLQYIITKEGTGKQPTAQSIVKV
                     HYEGRLINGQVFDSSYKRGQPVEFPLNQVIPGWTEGLQLMKEGGKATFFIPSNLAYGP
                     QELPGIPANSTLIFDVELISVK"
     gene            77611..78585
                     /locus_tag="ABZJ_RS00390"
                     /old_locus_tag="ABZJ_00074"
     CDS             77611..78585
                     /locus_tag="ABZJ_RS00390"
                     /old_locus_tag="ABZJ_00074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000651325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000651325.1"
                     /db_xref="GI:446573979"
                     /translation="MKDFKVQAGNLWAFIAGILVFLISLYIEPKYLYGDQEHYREFFN
                     YCFYDGYSHTMQLFCYQNTLGSTEPGYFYLSKIAHLFLEKDIYISFANSILVFLLIKL
                     VFKWYENIWHRYFFIFLVLTNYYLIVLMFAAERLKFSFIFLVLALLVAKQWKRIIIFG
                     LALFTHVQSALLIATFFISKVLDKNTKLWVKIIISLICIIGFTGAFLLMQEHIVNKLG
                     AYSEGTEEDGNGFISMIKTGVFIFLAGISTFRILPVISGIPLVLLSYFLGSERIGMLA
                     FILYVCAVIYYKKKADLLLFLVMLYFTIKTPSFILNILNYGVGYISNS"
     gene            complement(78776..80958)
                     /locus_tag="ABZJ_RS00395"
                     /note="tyrosine protein kinase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(80977..81405)
                     /locus_tag="ABZJ_RS00400"
                     /old_locus_tag="ABZJ_00075"
     CDS             complement(80977..81405)
                     /locus_tag="ABZJ_RS00400"
                     /old_locus_tag="ABZJ_00075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005308960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-tyrosine-phosphatase"
                     /protein_id="WP_014466000.1"
                     /db_xref="GI:504278898"
                     /translation="MQFKNILVVCIGNICRSPMAEYFLKQQYPQLNIESAGISGLIGH
                     QADEKAQLCMQRLGIDMRSHIARKLNAEHIKKADLILVMSQNQQKHIEQTWPFAKGKT
                     YRLGHWQNKNVPDPYQLDQAVFDETCQLIQQCVADWKPYI"
     gene            complement(81411..82511)
                     /locus_tag="ABZJ_RS00405"
                     /old_locus_tag="ABZJ_00076"
     CDS             complement(81411..82511)
                     /locus_tag="ABZJ_RS00405"
                     /old_locus_tag="ABZJ_00076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019457913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000872579.1"
                     /db_xref="GI:446795323"
                     /translation="MKYCQFFSVLALSLSAASCAVTSGLQTSDIPNEGVYKTDLGTTV
                     NVVKISQETLPAIQPAQIDYQRDYATLFKTQQPIYRLSPGDVLSIQLWAYPEITPPVN
                     SISNEQSVQANGYPIDQSGYIQFPLVGRYKASGKTLAQVNRELHSQLARFLKNPDVIV
                     RVLSYEGQRFSVQGSVTKGGQFYLSDQPVSIYTALGMAGGVTTTGDNTYIQLIRNGRT
                     YNLNTIDLEKAGYSLHKLLVQPNDTIYVSTRENQKIYVMGEAGKNQALPMRDQGMTLS
                     DALGESQGLNPLSASASRIYVLRTNPNDRTTELYHLNLMSLGDFGLANQFRLRSNDII
                     YVDATGLTRWQRVVNQIIPFSSALYNLDRLGQ"
     gene            82867..84141
                     /locus_tag="ABZJ_RS00410"
                     /old_locus_tag="ABZJ_00077"
     CDS             82867..84141
                     /locus_tag="ABZJ_RS00410"
                     /old_locus_tag="ABZJ_00077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001165093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Vi polysaccharide biosynthesis protein
                     vipA/tviB"
                     /protein_id="WP_001165098.1"
                     /db_xref="GI:447087842"
                     /translation="MQIAKLKIAIIGLGYVGLPLAVEFGKKVPVVGFDIYQKRIEELK
                     NGQDHTLEVSPEELKQAVHLNYTAHLDDLQDSNFFIVTVPTPIDDFKQPDLTPLIKAS
                     TSIGQVLKKGDVVVYESTVYPGATEEVCIPVLEKVSGLKFNQDFFAGYSPERINPGDK
                     QHRVTNILKITSGSTPEVADYIDEVYNLIIEAGTHKAPNIKVAEAAKVIENTQRDVNI
                     ALINELALIFNKLDIDTEDVLKAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQSIG
                     LHPEIILAARRLNDRMGEHVATQLIKEMVKQRIQVVGARILVMGLSFKENCPDIRNTK
                     IVDFIKALKEYDLDLDIYDPWVDDTEVQHEYGLAPIKELQQGLYDAIVIAVAHNQFKS
                     MSVEEFHALGKEKHVLYDLKYVLDKESSNIRL"
     gene            84155..85351
                     /locus_tag="ABZJ_RS00415"
                     /old_locus_tag="ABZJ_00078"
     CDS             84155..85351
                     /locus_tag="ABZJ_RS00415"
                     /old_locus_tag="ABZJ_00078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000102100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 4,6-dehydratase"
                     /protein_id="WP_000102101.1"
                     /db_xref="GI:446024246"
                     /translation="MSTDIQLNLIGRTQELFVEDIQHWNNKLIEIVSSSKFLVLGGAG
                     SIGQAVVKEIFKRNPKKLHVVDISENNLTEVVRDIRSSFGYIDGDFQTFALDIGSAEY
                     DAYIENDGDFDYVLNLSALKHVRSEKDPFTLMRMIHVNILNTEKTIQQSIAKGVKKYF
                     CVSTDKAANPVNMMGGSKRIMEMFLMRQSQYIDISTARFANVAFSDGSLLHGFNQRIQ
                     KNQPIAAPNDIRRYFVTPKESGELCLMSCLLGENRDIFFPKLSEHLHLITFADIAVKY
                     LNNLGYEPYLCESEDEARSLIQTLPKQGKWPCLFTGSTTTGEKDFEEFFTDNETLDMQ
                     RFNNLGVIKNELNIEEDKLQVFEEKINSMLLSKHWNKEEIVDLFNYMMPNFGHKETGL
                     YLDGKM"
     gene            85351..86499
                     /locus_tag="ABZJ_RS00420"
                     /old_locus_tag="ABZJ_00079"
     CDS             85351..86499
                     /locus_tag="ABZJ_RS00420"
                     /old_locus_tag="ABZJ_00079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019457916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase DegT"
                     /protein_id="WP_000381246.1"
                     /db_xref="GI:446303391"
                     /translation="MDTSKFNQFVRDIYQTNNFIPLHEPRFLGNEKKYVLDTIDSTFV
                     SSVGAYVNDFESKIQHFTGCAKAIATVNGTAALHIALLLAGVKRDDIVITQALTFVAT
                     CNALSYIGAEPLFIDVSLKTMGLCPKALDTYLQENAFLDDQGVCKHTATNKRISAIVP
                     MHTFGHPVEIDELQEVVTKWNIALVEDAAESLGSYYKGKHTGIFGLVSALSFNGNKVI
                     TTGGGGMVLCQDEELGVRAKHITTTAKIPHPYEFYHDENGFNYRLPNLNAALGCAQME
                     SLEGFLSKKRDLAHQYQNFFKDTDISFFVEPENCQSNYWLNAIICKDKTQRDLILDET
                     NSNKVMTRPIWTLMTRLPMYENALQGDLTNSLWLEERVVNIPSSVPLE"
     gene            86505..87641
                     /locus_tag="ABZJ_RS00425"
                     /old_locus_tag="ABZJ_00080"
     CDS             86505..87641
                     /locus_tag="ABZJ_RS00425"
                     /old_locus_tag="ABZJ_00080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001986074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="WP_000717544.1"
                     /db_xref="GI:446640198"
                     /translation="MKKIAVFTGTRAEYGLLYWLMRDIQQDPELELQILATAMHYSPE
                     HGETWKTIVKDGFEITESVEMLLSSDTSSAVVKSMGVGLLGFADALKRMQPDVLVVLG
                     DRFEALAVTQAALIMHVPVAHLHGGEITEGAYDESIRHAITKMSNIHFAAAEEYKKRI
                     IQLGEQPERVFNVGALGLDHIQRTTFKSISELSELYDFDFSKPYFLITYHPETNLLEE
                     NVAPLFDALKQINDVNFVFSYPNADNGNTNIVKAMLDLKAQLPDRVLLVKSFGIQNYL
                     SVLKNALAMVGNSSSGLSEAPALQVPTVNIGDRQKGRLRCESILDVRLDEKEIVEALQ
                     KAINFPKDQLSQVVPPLGLGNTSQKIIEVIKTTDFKKKAPFYDL"
     gene            87631..88725
                     /locus_tag="ABZJ_RS00430"
                     /old_locus_tag="ABZJ_00081"
     CDS             87631..88725
                     /locus_tag="ABZJ_RS00430"
                     /old_locus_tag="ABZJ_00081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002133311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="WP_000576423.1"
                     /db_xref="GI:446498569"
                     /translation="MIFKQDEIYVIAEIGVNHNGSVDLAKELILKAKESGANAVKFQT
                     FKAEEVLSDQADMAAYQKTNTGKDSSQLEMVKKLELSFEDTKILRDFSENNGITFIST
                     PFDNDSLDFLSNDLDVPFLKVSSADISNLPFLYKVALTGKPVILSTGTASLGDIEKAL
                     SVFTYVTEYGKTELPTVEKLRLSYAKQTNRQALKNKIVILHCVTQYPATIEGSNLLAI
                     STIQNAFGLNVGYSDHTLNEYTAIAAVALGATVFEKHITLDKKMDGPDHAASMEIDDF
                     TRYVSTLRKIKLGLGDGIKFMQEQEKDNFSLVRRSLVARKDIQQGEIFTEQNIVAKRA
                     GKVQLLPEQLWELLGTAATKNYKVNELIEK"
     gene            88727..89373
                     /locus_tag="ABZJ_RS00435"
                     /note="sugar O-acyltransferase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            89366..90427
                     /locus_tag="ABZJ_RS00440"
                     /old_locus_tag="ABZJ_00082"
     CDS             89366..90427
                     /locus_tag="ABZJ_RS00440"
                     /old_locus_tag="ABZJ_00082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000617449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_000617450.1"
                     /db_xref="GI:446540104"
                     /translation="MIRDVNKIVLHKNDTVLKALELLDLYALRIVLVVDDRNQLIGSI
                     TDGDIRRGLLKGQDLHASVDTIMHTNPYSIEEGSLNNRQIFEIMREKSYLALPVIKNN
                     QLVNIITLDDLIRKKRKENPVFIMAGGFGTRLRPLTDTCPKPMLPVGGKPLLETIISS
                     FKNQGFYKFYISTHYLPEVINEYFGNGEKLGVQIQYVHETDPLGTGGALSLLPASEIK
                     LPFIVINGDVLTNMNFEKLLDFHEQRQAIATMCVREFQYQIPYGVVNSEDNVIQSMTE
                     KPSYFFDINTGIYVISPELLAQVNAQFIGMPTILEQQMEKQNKVLSYPLHEYWLDIGH
                     MEDYNRAQRDIINLDFGKF"
     gene            90427..91134
                     /locus_tag="ABZJ_RS00445"
                     /old_locus_tag="ABZJ_00083"
     CDS             90427..91134
                     /locus_tag="ABZJ_RS00445"
                     /old_locus_tag="ABZJ_00083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000580205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CMP-N-acetlyneuraminic acid synthetase"
                     /protein_id="WP_000580205.1"
                     /db_xref="GI:446502351"
                     /translation="MIGQYRVTALIPARGGSKRLPRKNVKLLGDKPLIAWSIETAKAS
                     KYIDRVVVSTDDEEIKQVSEQYGAEVPFLRPEHLSNDHASSFDVIKHAIGFLHLDQTN
                     ELIVLLQPTSPLRLVSELDTALEFFITKNAKGIVSISETEHSPMWSNTLPENGCMSDF
                     IRPEVQGKRSQDLPKFFRLNGSIYIYETLSLLEQAKIFFDENVYGFETSLKTAVDIDT
                     ELDFLVAETIMKHRATE"
     gene            91131..92327
                     /locus_tag="ABZJ_RS00450"
                     /old_locus_tag="ABZJ_00084"
     CDS             91131..92327
                     /locus_tag="ABZJ_RS00450"
                     /old_locus_tag="ABZJ_00084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000866167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lsg locus protein 1"
                     /protein_id="WP_000866167.1"
                     /db_xref="GI:446788911"
                     /translation="MKVLKDSFIYLIGELFAKSLPFLMLPYLTRKLGPDGFGELSYYL
                     TMLSLFGIFVGLSQDGAVTRYFYFYGKKALNTVVKAGYLFNIAISIVLLLSCWWLKAE
                     IMAYVVLATMFQSFVNVQLALRQCQKQPLKYITIQIILSLTNVLFTVGALEYFNQDLV
                     AYRILAIVVANFTTFVIASLILGDLFRDSYRFTWQRLRLGLFYIFSFGFPLILHQSSI
                     FIKGQLDRIFIYQHYTKSELGIYSAGVQIALVLPIIFMALNKAIVPHYYQALKSNSLT
                     IVQIKKYTLLSLPLSILPAVVGWLMPEQLYQLFLGKGYETSKYFTVVFLVGYGLTMPY
                     LILVNYLFYHAKNRIISLITFSSSLLYIGSLYIFSQLKLEWIPFALILSNLFMLVALW
                     NIVKKV"
     gene            92330..92521
                     /locus_tag="ABZJ_RS00455"
     CDS             92330..92521
                     /locus_tag="ABZJ_RS00455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005762252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043957126.1"
                     /db_xref="GI:763075646"
                     /translation="MCVTPLQILIAEKIIQSRPTEDFDVIIFALENNPKFNYYAEKLK
                     NMLKLIGTHILFIKTQFII"
     gene            92707..93273
                     /locus_tag="ABZJ_RS00460"
     CDS             92707..93273
                     /locus_tag="ABZJ_RS00460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002069840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000789942.1"
                     /db_xref="GI:446712598"
                     /translation="MKNINDEKKNKLFKILGIKYFQDDIKDMSKLHYTIYPEFKNIIE
                     NIKEVKLFNTIETSCQRDKEKNIFLGQPYEQLDKGLTIDKVERLMIDLNIDFYFPHPR
                     EKYSPSNIEIIKTEKIFEDYIVNYLRNNKDICVNIYTFMSSAALNVIAVEGVQVFFIQ
                     NKNLLNKYPDLFNILKDHKINFLKFKDI"
     gene            93381..93917
                     /locus_tag="ABZJ_RS00465"
     CDS             93381..93917
                     /locus_tag="ABZJ_RS00465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015741773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000697504.1"
                     /db_xref="GI:446620158"
                     /translation="MKILIDSSIVSKGGGVQVALSIIENIANDKDFEVICVVNSEIDK
                     QLSLNAKNNIKHYYVENIEPIYKKFIQGKRISLIEQKHKPDFVFVVFGPAYWKPKAKT
                     VQGFALGKMLYEKELGVDFKEKILNLIKKKIFQWSQSYLLVETELVKAKLANYLGYSK
                     EKIFVIGNSYSPNFKKMY"
     gene            93965..94543
                     /locus_tag="ABZJ_RS00470"
     CDS             93965..94543
                     /locus_tag="ABZJ_RS00470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001339017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043957128.1"
                     /db_xref="GI:763075648"
                     /translation="MPGSYYPHKNLERIILSLIELRSSSHLKSKIKVLFTIPEKSSDW
                     SNLLALAKKHNVDDLITTVGFVQNSQFAELYLQSNAIICASLVESSTAVFPEAFLANR
                     PLLVSERPFAKELCEDAAIYFEPLDEKSIANAILELVNNEELQHLLVENGKKVLLKNY
                     PSADQKWNLQKNLITHLYSKSLYTIKIDNSLK"
     gene            94577..95146
                     /locus_tag="ABZJ_RS00475"
                     /old_locus_tag="ABZJ_00085"
     CDS             94577..95146
                     /locus_tag="ABZJ_RS00475"
                     /old_locus_tag="ABZJ_00085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004758990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000149353.1"
                     /db_xref="GI:446071498"
                     /translation="MTHLNELYLILNKYLKWNKSHLKCFALIMLVIILKQTCNLSSAS
                     KALPIKCLPQSFYRRMQRFFAGQYFDYRQISQLIFNMFSFDQVQLTLDRTNWKWGKRN
                     INILMLAIVYRGIAIPILWTLLNKRGNSDTKERIALIQRFIAIFGKDRIVNVFADREF
                     IGEQWFTWLIEQDINFCIRVKKTSLSPII"
     gene            95233..95667
                     /locus_tag="ABZJ_RS00480"
                     /old_locus_tag="ABZJ_00086"
     CDS             95233..95667
                     /locus_tag="ABZJ_RS00480"
                     /old_locus_tag="ABZJ_00086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000780882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000780881.1"
                     /db_xref="GI:446703535"
                     /translation="MKLYISALQLENGELLLVVSPQFNANAIQDYALRWEIETLFSCL
                     KGRGFNLENTRLTDPRRVKKLIAVLAISFCWCYLTGEWQHDQKKAIKIKKHGRLSMSL
                     FRYGLDYVQMAIQRLIGFGKKEEFKEILAILRRQNPDRIRVL"
     gene            95705..96739
                     /locus_tag="ABZJ_RS00485"
                     /old_locus_tag="ABZJ_00087"
     CDS             95705..96739
                     /locus_tag="ABZJ_RS00485"
                     /old_locus_tag="ABZJ_00087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000471755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="WP_000471756.1"
                     /db_xref="GI:446393901"
                     /translation="MFKDKVLLITGGTGSFGNAVLKRFLETDIKEIRIFSRDEKKQDD
                     MRKKYHSAKLKFYIGDVRDYNSILNATRGVDYIYHAAALKQVPSCEFHPMEAVKTNVL
                     GTENVLEAAIQNHVKRVVCLSTDKAVYPINAMGISKAMMEKVMVAKSRNLEGLNTVIC
                     GTRYGNVMASRGSVIPLFVDQIRQGKPLTITDPNMTRFMMTLEDAVDLVLYAFEHGEN
                     GDIFVQKAPAATIAVLAEALKQLLNVEDHPISIMGTRHGEKAFEALLSREEMVHAFDQ
                     GDYFRVPADQRDLNYEKYVEDGDLKITEFEDYNSHNTTRLDVEGMKQLLLKLDFVRAL
                     TRGEYISPEA"
     gene            96742..97851
                     /locus_tag="ABZJ_RS00490"
                     /old_locus_tag="ABZJ_00088"
     CDS             96742..97851
                     /locus_tag="ABZJ_RS00490"
                     /old_locus_tag="ABZJ_00088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004795453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-2-acetamido-2,6-dideoxy-beta-L-talose
                     4-dehydrogenase"
                     /protein_id="WP_000866951.1"
                     /db_xref="GI:446789695"
                     /translation="MKVLVTGSNGFIAKNFIQFLSEKPEVEILKAHRETTDQEFEQVV
                     LAADWIVHLAGVNRPLNEEEFAEGNTTLTEKISQILQQANKKTPVILSSSIQVERDNP
                     YGKSKLGGEQALVTLHQAQGNPVYICRLANVFGKWSRPNYNSAVATFCHNVANDLPLQ
                     IHDENAVIRLVYVDDVVETFWNILNGQQVEQFFQVEPEYQITVGDLAKVLNGFKASRG
                     TLITDRVGTGLTRALYSTYLSFLKPEQFDYSVPKYGDARGVFVEMLKTPDAGQFSYFT
                     AHPGITRGGHYHHTKTEKFLVIKGKALFKFKHVVTGEFYELETHGDEPRIVETVPGWT
                     HDITNIGDEEMVVMLWANEIFDRNKPDTYAMPITN"
     gene            97864..98994
                     /locus_tag="ABZJ_RS00495"
                     /old_locus_tag="ABZJ_00089"
     CDS             97864..98994
                     /locus_tag="ABZJ_RS00495"
                     /old_locus_tag="ABZJ_00089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000734323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="WP_000734323.1"
                     /db_xref="GI:446656977"
                     /translation="MKKLKLMTVVGTRPEIIRLSRVMAACDEYFDHILVHTGQNYDYE
                     LNEIFFTDLGIRKPDHFLNAAGATGAETIGNVIIAVDKILEEVQPEALLVLGDTNSCM
                     AVLPAKRRKIPTFHMEAGNRCFDMRVPEEINRRIVDHTADINLTYSTIARDYLLAEGL
                     PADLVIKTGSPMFEVLHHYKAKIEASDVLERLNLKEHEYFIVSAHREENINSDQNFLD
                     LVEMLNAVADKYKYPVIVSTHPRTRKRIEELNVEFHPLIQLLKPLGFSDYNKLQLSAK
                     AALSDSGTINEESSILNFPALNLRQAHERPEGMEEAAVMMVGLKAERILQGLAILEGQ
                     TRGENRLLRLVEDYSMPNVSEKVVRIIMSYTDYVNRVIWKKY"
     gene            99005..100192
                     /locus_tag="ABZJ_RS00500"
                     /old_locus_tag="ABZJ_00090"
     CDS             99005..100192
                     /locus_tag="ABZJ_RS00500"
                     /old_locus_tag="ABZJ_00090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002020522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_002020522.1"
                     /db_xref="GI:487947056"
                     /translation="MKKKVYLITEYYHPYQNTTGYLLGKLYDTLNVQSDIDLVLIAKE
                     DMNCPQHANAHFIKAKKPNKASLFKRFLYELIIAFSFLMKTLKVVKKDSIVFTGTTPI
                     LLLFVLFIIKKFLNFKWILLVHDVFPENLAAAKILKKDHFLFKILKSLFDRIYASADE
                     VIVIGKDMKELVHQKTHQSNNITVVQNWIDSSDIGTEPKTNNRILQELNWLDSETTIF
                     QFFGNIGRVQGVENILHAIQKMKYAHLAKFIFIGDGAYVARLKEQIQSLGSQNILYYG
                     SLDQKEKTTGLNACDVALITLADGMLGLGVPSKSYFSMAADKPLLAIMDSESEVADMI
                     NTHHIGWVVPPNNEEALAKQLDEIVLAKHCYAFNSSREVLNEFYSEKVAMSKILNIIR
                     KFT"
     gene            100209..101144
                     /locus_tag="ABZJ_RS00505"
                     /old_locus_tag="ABZJ_00091"
     CDS             100209..101144
                     /locus_tag="ABZJ_RS00505"
                     /old_locus_tag="ABZJ_00091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001023247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="WP_001023245.1"
                     /db_xref="GI:446945989"
                     /translation="MNILITGSSGFVGSYLCEYFTTMPEHSVLAQTRKNTQKLCNNIK
                     TITFDINDDLTSLDLSSVDVIVHCAGRAHIMKEVESDPLSIYRKVNVEGTLNLAKKAA
                     KAGVKRFIFMSSIKVNGEVSDQVPFTPHDNIINIKDLYGLSKYEAEQSLLNLAQNSMM
                     EVVIIRPALIYGPNVKANFKSMINLAAKGIPLPVGCLDNKRSMVSIYNLSDFINICLS
                     HPLAKNQVFLISDQDDITVKELFTKLAKVQGRNLIAVPIPKVLINFLAKLLNKSAVAS
                     RLCSVLIVDTSKNIELLGWRAPFSFDESLKLMFKK"
     gene            101155..102164
                     /locus_tag="ABZJ_RS00510"
                     /note="glycosyl transferase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            102581..103201
                     /locus_tag="ABZJ_RS00515"
                     /old_locus_tag="ABZJ_00092"
     CDS             102581..103201
                     /locus_tag="ABZJ_RS00515"
                     /old_locus_tag="ABZJ_00092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000977704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-galactose phosphate transferase"
                     /protein_id="WP_000977704.1"
                     /db_xref="GI:446900448"
                     /translation="MMKRIVDIVISLTALIILSPIFIWVAYKVRKNLGSPVFFYQERP
                     GKDGKLFKMIKFRSMKDAFDAQGNPLPDEERITPFGHKLRSTTLDEMPQLINVLKGDM
                     SIVGPRPQLADFLEHYTSRQMRRHEVRPGMTGLAQVSGRNNLSWEEKFELDIEYVETH
                     NLSLDFKIMMKTVLVMLKKEGINAPDQLVGASRFSGSARDEDKASL"
     gene            103220..104095
                     /locus_tag="ABZJ_RS00520"
                     /old_locus_tag="ABZJ_00093"
     CDS             103220..104095
                     /locus_tag="ABZJ_RS00520"
                     /old_locus_tag="ABZJ_00093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005037627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase
                     subunit GalU"
                     /protein_id="WP_000591431.1"
                     /db_xref="GI:446514085"
                     /translation="MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAV
                     EAGIEQIILVTHSSKASIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSVISVR
                     QPQPLGLGHAVLCAKSVVGEDDFAVLLPDVLVKDGSGQNDLSRMISRYNSSQAAQIMV
                     EAVPDHLVDQYGIVDVKHSPNVGESIAMQGIVEKPAVGAAPSNLSVVGRYVLPTKIMQ
                     LLENTPKGAGNEIQLTDAIAMLQDTDTVEAYRMQGQTFDCGSKLGYLKAVLHYGLEHP
                     KLGMEFKQLIQELKL"
     gene            104213..105475
                     /locus_tag="ABZJ_RS00525"
                     /old_locus_tag="ABZJ_00094"
     CDS             104213..105475
                     /locus_tag="ABZJ_RS00525"
                     /old_locus_tag="ABZJ_00094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000686131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="WP_000686121.1"
                     /db_xref="GI:446608775"
                     /translation="MKIAVFGTTLHAGVMAALLAEYGNQIYWCTCVSCEENISVLSYQ
                     DQEVNHYLNKQRKAGFLKESPFSEIPLDIEVYLFCFSPTQIELALKTVEKLSERPIIH
                     PKLMINGSTFGLHGTEKLKQHLPKDEWVYFPDVIQEGNAINSVLDVKHVIVGVESRDA
                     SEIMQELLRPFFQFSYQYLFMPILDAEFTKLSISGMLATRISYMNDLAMVAEKLGIDI
                     ANVKHGIAADTRIGAAYLSPGVGFGGENFSHDILTLSSTVLETGTKSRLLEQVWAINE
                     QQKEILFRKLWNYYHCDLSGKTVAIWGASFKENTSNIHNSPIHILLAALWAQGVKVRL
                     HDPQALDEIASIYGSREDLILCSDQYEAAQNAHALCLVTAWKQYWSPDFKRLQQLMKH
                     PLILDGRNIYDPAYVKARGFAYEGVGRL"
     gene            105472..107142
                     /locus_tag="ABZJ_RS00530"
                     /old_locus_tag="ABZJ_00095"
     CDS             105472..107142
                     /locus_tag="ABZJ_RS00530"
                     /old_locus_tag="ABZJ_00095"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B0V6J2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_000045516.1"
                     /db_xref="GI:445967661"
                     /translation="MSKSIEQFPKDLSSPLIQLKSSVEKNSKLHIKELFALEPERFQN
                     YSVKFDQLFFDYSKQRITKNILEQLVALANNKQLTQWINRLFSQDKINCTEQREAMHW
                     ALRLPSEYSKFPELTKQVHIQLQRMYTLVEKIHAGQYRGATGEVIQDVVNIGVGGSDL
                     GPHMVTHALADFKVKTAKPLNVHFVSTMDGSQLSDLLHQLRPETTLFIISSKSFGTID
                     TLSNAQTVRQWLEKALGKHDRVVKSHFIGVSTKAEKMTEWGIAPENQLLLWDWVGGRY
                     SLWSCIGFPIALTIGIEGFQQLLAGAHAVDEHFQNTSFEQNIPVLMALLGIWNNNFLN
                     IQTHAVLPYDGRLKYFASYLQQLEMESNGKSIQRDGQKVELDTCPIVWGEVGPNAQHA
                     FYQLLHQGTQAVSCDFIAPIQRYNADHFTYVENAEALIEQHHLALSNCLAQSRLLAFG
                     NEALDAAELKNLPIYKQYEGNQPSSTLLLDELNPYNLGMLIALYEHKVFVQSVIWNIN
                     PFDQWGVEKGKQIADQLLPILNGVQNDFSKLDASTRGLIKILLGKVDG"
     gene            107135..108151
                     /locus_tag="ABZJ_RS00535"
                     /old_locus_tag="ABZJ_00096"
     CDS             107135..108151
                     /locus_tag="ABZJ_RS00535"
                     /old_locus_tag="ABZJ_00096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004836397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-galactose-4-epimerase"
                     /protein_id="WP_001062904.1"
                     /db_xref="GI:446985648"
                     /translation="MAKILVTGGAGYIGSHTCVELLEAGHEVIVFDNLSNSSEESLNR
                     VQEITQKSLTFIEGDIRNSDELDRVFREHTIDAVIHFAGLKAVGESQEKPLIYFDNNI
                     AGSIQLVKSMEKAGVYTLVFSSSATVYDEANISPLNEEMPTGMPSNNYGYTKLIVEQL
                     LQKLSVADSKWSIALLRYFNPVGAHKSGRIGEDPQGIPNNLMPYVTQVAVGRREKLSI
                     YGNDYDTVDGTGVRDYIHVVDLANAHLCALNNRLQAQGCRAWNIGTGNGSSVLQVKNT
                     FEQVNGVPVAFEFAPRRAGDVATSFADNARAVAELGWKPQYGLEDMLKDSWNWQKQNP
                     NGYN"
     gene            complement(108196..109566)
                     /locus_tag="ABZJ_RS00540"
                     /old_locus_tag="ABZJ_00097"
     CDS             complement(108196..109566)
                     /locus_tag="ABZJ_RS00540"
                     /old_locus_tag="ABZJ_00097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004728836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000209956.1"
                     /db_xref="GI:446132101"
                     /translation="MTTLTCFKAYDIRGKLGTELNEEIAYKIGRAYGQIYKPKTVVVG
                     CDIRLSSEALKQATIRGLNDAGVNVLDLGMTGTEEVYFAAFHLDVQGGIEVTASHNPM
                     DYNGMKLVRENARPISADTGLKEIQALAETNNFEEVSQKGTTQSYNILPEFVDHLLTY
                     IEPAKIRPLKLVVNAGNGAAGHVIDAIEEKFKALNVPVEFIKIHHEADGTFPNGIPNP
                     ILIENRDSTRNAVLEHKADMGIAWDGDFDRCFLFDEKGQFIEGYYIVGLLAQAFLIKQ
                     SGEKIVHDPRLVWNTFDIVDEYKGVAVQSKSGHAFIKDVMREHNAVYGGEMSAHHYFR
                     DFAYCDSGMIPWLLTIALLSETGQSLSTLVENMIAKFPCSGEINFKVADTQTTIQKIF
                     DFYANQNPQIDRTDGVSLDFGTWRFNVRASNTEPLLRLNIESRADRQAQPMQHYVDEL
                     TGLIQN"
     gene            109941..111602
                     /locus_tag="ABZJ_RS00545"
                     /old_locus_tag="ABZJ_00099"
     CDS             109941..111602
                     /locus_tag="ABZJ_RS00545"
                     /old_locus_tag="ABZJ_00099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000933682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate permease"
                     /protein_id="WP_000933693.1"
                     /db_xref="GI:446856437"
                     /translation="MLNMWQQLYDPLNNIWLSSAVALIPIIFFFLALAVFRLKGSIAG
                     TGTVIIALLIALFFYQMPGQMAFASIIYGFFYGLWPISWIIIGAVFLYKISVKTGQFE
                     VIRSSILSITEDQRLQMLLVGFAFGTFLEGAAGFGAPVAITAALLVGLGFKPLYAAGL
                     CLIVNTAPVAFGAMGIPIIVAGQVSGVDTMEISQMVGRQLPFLTIIVLFWIMAIMDGW
                     RGVKETWPAVLVGGGAFAIAQYLTSNFIGPELPDITAAIASLVSLTLLFRVWKPKHIF
                     RFEPEAGQTLTQQPTTVQRYSIGKIAKAWSPFAILTVMVTIWSVKPFKALFAKDGALE
                     HWIFKLEVPYLHKLVEKMPPIVSEIKPYEAIYKFDWFSATGTAIFIAAIITVIFLKMK
                     ASEAVTTFGETLNELKTPIYSIGMVLAFAFIANYSGLSATLALALSHTGHAFTFFSPF
                     LGWLGVFLTGSDTSSNALFSALQATTAQQIGIPEVLLVAANTSGGVTGKMISPQSIAI
                     ACAAVGLVGKESDLFRFTVKHSIIFTVFVGIIITVQAYLVPWMIP"
     gene            111622..112374
                     /locus_tag="ABZJ_RS00550"
                     /old_locus_tag="ABZJ_00100"
     CDS             111622..112374
                     /locus_tag="ABZJ_RS00550"
                     /old_locus_tag="ABZJ_00100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007116527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_001222772.1"
                     /db_xref="GI:447145516"
                     /translation="MRISDQVVMKLQALIEERHMKKGDRLPAERQLATSLGVSRPSLR
                     EAIQQLNSQGVLISRRGDGTYIQQLPEQWPQQLIVNPISNLIEEDPLYRFDVQEARLV
                     LEGGTAWYAALRSTPEDRAKIHHYFNEISRHQNAGDSAQAAVADAEFHLAIAEASHNV
                     VLIQMMRSLFDLLQYNVLLGRKKVYNDPVNGDLLSEQHFQVMDAIDRKDPEAARQAVC
                     GHIEFVINHVRSLDEDEARQKRANRLNRVDSK"
     gene            112371..113522
                     /gene="lldD"
                     /locus_tag="ABZJ_RS00555"
                     /old_locus_tag="ABZJ_00101"
     CDS             112371..113522
                     /gene="lldD"
                     /locus_tag="ABZJ_RS00555"
                     /old_locus_tag="ABZJ_00101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002047679.1"
                     /note="flavin mononucleotide-dependent dehydrogenase;
                     functions in aerobic respiration and also has a role in
                     anaerobic nitrate respiration; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate dehydrogenase"
                     /protein_id="WP_000587282.1"
                     /db_xref="GI:446509755"
                     /translation="MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSE
                     IALRQRVLNDMSALSLETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIP
                     FTLSTVSVCPIEEVAPAINRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPV
                     PGARYRDAHSGMSGPNAAMRRYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLE
                     DYIGWLGSNFDPSISWKDLEWIREFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHG
                     GRQLDGVMSSARALPAIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVY
                     ALAAAGGQGVSNLLDLIDKEMRVAMTLTGAKSISDINADCLVQAIKQGL"
     gene            113814..115520
                     /locus_tag="ABZJ_RS00560"
                     /old_locus_tag="ABZJ_00102"
     CDS             113814..115520
                     /locus_tag="ABZJ_RS00560"
                     /old_locus_tag="ABZJ_00102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002050574.1"
                     /note="component of the membrane-bound D-lactate oxidase,
                     FAD-binding, NADH independent; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-lactate dehydrogenase"
                     /protein_id="WP_001193028.1"
                     /db_xref="GI:447115772"
                     /translation="MQTFSPQAVIERLQNIVGRSYVLTDDQSTRQYRQGRRFGEGKVL
                     AVVVPGTLLEQWQVLQAAIEADCIVIMQAANTGLTGGSTPYGDDYDRPVLVMSTRRLK
                     GIQVIHDGKQVICLPGATLDNLEQILKGYNREPHSVIGSSCIGASVLGGVCNNSGGAL
                     VRRGPAYTELALYAQVNAAGQLELVNHLGVNLGSTPEEILTRLEKQQYQAVDILDDNE
                     KQASDHRYAHDVTQVDEDTPARFNADPSRLFEASGSAGKVCVFAVRLDTYEKVESSVF
                     YIGSNDADDLTAIRRYLLTSLPSLPIAGEYIHRDAYLIGEKYGKDTFLFIEKFGTANV
                     PKAFAMKDKVDGFLEKFKIKGLTDQILQAITFFLPSHLPKRMTEYRDRYEHHLVLRVE
                     NNSKAQTEQFLKEYFAVHQSGNYFVCSEEEGRKAFLHRFAIAGAAIRYRDTHRSEVED
                     IVALDIALRRNDREWVEQLPAEMEKKIIHKLYYGHFFCHVFHQDYILKKGNDPLEMEH
                     QMWKLLDARRAEYPAEHNVGHLYIAKPALANFYQKLDPTNSFNVGIGHTSKLKYWGKA
                     KS"
     gene            complement(115569..116783)
                     /locus_tag="ABZJ_RS00565"
                     /old_locus_tag="ABZJ_00103"
     CDS             complement(115569..116783)
                     /locus_tag="ABZJ_RS00565"
                     /old_locus_tag="ABZJ_00103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000486243.1"
                     /note="catalyzes the formation of L-glutamate and an
                     aromatic oxo acid from an aromatic amino acid and
                     2-oxoglutarate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid aminotransferase"
                     /protein_id="WP_000486254.1"
                     /db_xref="GI:446408399"
                     /translation="MFQHIPPYAGDPILSLMEQFNADTRSEKVNLSIGLYYNEDSIVP
                     QLETIIEAQKRIEPKNGKTKLYLPMEGFKPYREAIQALLFGVNSPAVKAGRAVTIQTL
                     GGSGALKVGADFLKTYFPNSDVWVSQPTWDNHVAIFNGAGIKTHFYPYFDAETRGVDF
                     DGMLSTLKTLPEQSIVLLHPCCHNPTGADLNPAQWDQVIAVLKDRNLIPFLDIAYQGF
                     GDGMEEDAYAIRALDQAGLNFIVSNSFSKIFSLYGERVGGLTFVCDDAEAAQCTFGQL
                     KATVRRIYSSPPTTGAWLVDEVLNDAELNQQWQGEVKEMRERIIKMRSILKDELTKAL
                     PDRDFSYLVNQKGMFSYTGLTAEQVDILREEYAIYLVRSGRICVAGLNMNNVYTVAKA
                     MAEVLAKSVEAA"
     gene            117299..118009
                     /locus_tag="ABZJ_RS00570"
                     /old_locus_tag="ABZJ_00104"
     CDS             117299..118009
                     /locus_tag="ABZJ_RS00570"
                     /old_locus_tag="ABZJ_00104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005137682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_001153625.1"
                     /db_xref="GI:447076369"
                     /translation="MQDLTFAPEPLQSQGRTLTEHVFKQIQTAIVLGQIPAGSKISEP
                     ELARTYGISRGPLREAIHRLEGQRLVERTAHVGARVVSLSLQQFKELYQIRASLEGLA
                     CKLAAQHIDKKQILALRDVLRMHAEDENFKAGKGYYLQEGQDDFHYCIIKSSGNKTLE
                     KMLCDELYHLIRMYRIQFSNTPDRPSKAWDEHIRILDAIAEGDGELAELLMHRHINAS
                     YKIIEQTLLQAQGEHNNG"
     gene            118002..118886
                     /gene="prpB"
                     /locus_tag="ABZJ_RS00575"
                     /old_locus_tag="ABZJ_00105"
     CDS             118002..118886
                     /gene="prpB"
                     /locus_tag="ABZJ_RS00575"
                     /old_locus_tag="ABZJ_00105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016142557.1"
                     /note="catalyzes the formation of pyruvate and succinate
                     from 2-methylisocitrate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylisocitrate lyase"
                     /protein_id="WP_001118924.1"
                     /db_xref="GI:447041668"
                     /translation="MAKQSAGQLFRDAVAQEKPLQVVGTINANHALLAKRAGYKAIYL
                     SGGGVAAGSLGLPDLGISNLDDVLTDVRRITDVCDLPLLVDADTGFGASAFNIARTTK
                     SLIKFGAAAMHIEDQVGAKRCGHRPNKAIVTQEEMVDRIKAAVDARGDDSFVIMARTD
                     ALAVEGLQAAIDRAGAYIEAGADMLFPEAITELDMYKQFAQKTGVPILANITEFGSTP
                     LFTTEELASADVSLALYPLSAFRAMNKAAETVYETLRKEGTQKNVVDIMQTRKELYER
                     INYYAFEDYLDNAFAKKK"
     gene            119146..120303
                     /locus_tag="ABZJ_RS00580"
                     /old_locus_tag="ABZJ_00106"
     CDS             119146..120303
                     /locus_tag="ABZJ_RS00580"
                     /old_locus_tag="ABZJ_00106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004740987.1"
                     /note="catalyzes the synthesis of 2-methylcitrate from
                     propionyl-CoA and oxaloacetate; also catalyzes the
                     condensation of oxaloacetate with acetyl-CoA but with a
                     lower specificity; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylcitrate synthase"
                     /protein_id="WP_000097515.1"
                     /db_xref="GI:446019660"
                     /translation="MSSNETTTGFKPKKSVALSGQVAGNTALCTVGRSGNDLHYRGYD
                     ILDLAAGSEFEEVAHLLVHGKLPNKAELKAYKAKLKALRGLPAALKTALEQLPPSAHP
                     MDVMRTGVSVLGCLTPEHEDHNEAGAKDIADKLMASLGSMLLYWYHFSNNGRRIEVET
                     DDDSIAAHFLHLLHGEKPCEEWIQAMHTSLILYAEHEFNASTFTSRVVAGTGSDMYSA
                     ITGGIGALRGPKHGGANEVAFVIQQRYDNPDEAEADIRKRVENKEVVIGFGHPVYTVS
                     DPRNEVIKKVAHDLAQAQENTKMYLIAERLEAVMKEVKNMFPNLDWFSAVSYHLMGVP
                     TAMFTPLFVIARTAGWSAHVIEQRQDGKIIRPSANYTGPENLEFKPLAERG"
     gene            120303..122909
                     /locus_tag="ABZJ_RS00585"
                     /old_locus_tag="ABZJ_00107"
     CDS             120303..122909
                     /locus_tag="ABZJ_RS00585"
                     /old_locus_tag="ABZJ_00107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001093597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="WP_001093595.1"
                     /db_xref="GI:447016339"
                     /translation="MNTKYRKPLAGTQLEYYDVRQAVEDIQPGAYEKLPYTSKVLAEQ
                     LVRRADAENLTAYLTQLIERRQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKG
                     GDPSKVNPVVPTQLIVDHSLAVEYGGADPDAFAKNRAVEDRRNEDRFHFIEWTKTAFK
                     NVDVIPAGNGIMHQINLEKMSPVIQARDGVAFPDTCVGTDSHTPHTDALGVISVGVGG
                     LEAENVMLGRASWMRLPDIIGVELVGQRQAGITATDIVLALTEFLRKERVVGAYLEFF
                     GEGADSMSVGDRATISNMTPEYGATAAMFYIDQNTIDYLRLTGREDAQVALVEQYAKE
                     IGLWASEMTKAEYPRVLRFDLSTVTRNIAGPSNPHARVSTSDLKEKGIAGVVENRSDG
                     LMPDGAIIIAAITSCTNTSNPRNTVAAGLLARKANELGLTRKPWVKTSFAPGSKAAAL
                     YLEEAGVLKDLEQLGFGIVAYACTTCNGMSGALDPVIQQEIIDRDLYATAVLSGNRNF
                     DGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIEKDALGHDKEGNPIYLKDIWPSDAEI
                     DALVKEAVKPEQFRKVYIPMFDLGEVEQAKSPLYDWRPQSTYIRRPPYWEGALAAPRT
                     LANMRPLAILGDNITTDHLSPSNAILMDSAAGEYLHKMGVPEEDFNSYATHRGDHLTA
                     QRATFANPKLYNEMVRRSDGTIKQGSKARVEPEGEVMRMWEAIETYMNRKQPLIIIAG
                     ADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFKPGVNRKTLKL
                     DGTELYSVIGNIAPRSTLTLVIERATADGKEEILEVPVTCRLDTEEEVSVYEAGGVLQ
                     RFAQDFLEGQVA"
     gene            123068..123334
                     /locus_tag="ABZJ_RS00590"
                     /old_locus_tag="ABZJ_00108"
     CDS             123068..123334
                     /locus_tag="ABZJ_RS00590"
                     /old_locus_tag="ABZJ_00108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000450433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000450433.1"
                     /db_xref="GI:446372578"
                     /translation="METTNKLDNQAERKLPVKAHLLCGWPLVLMLVGGAIGGALGASA
                     YGINIKIYKSNLSNIAKVLLNLLTGLTAIILMLIAANLIRMYFL"
     gene            123924..124499
                     /locus_tag="ABZJ_RS00595"
                     /old_locus_tag="ABZJ_00109"
     CDS             123924..124499
                     /locus_tag="ABZJ_RS00595"
                     /old_locus_tag="ABZJ_00109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004843686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000447800.1"
                     /db_xref="GI:446369945"
                     /translation="METILGLCIGVGLSAACGFRVFVPLLVMSIATMMGWFEPSKGFE
                     WLALPSVCLALGVATVCEVAAYYIPWVDNALDTVATPAAMIAGTLATMAVSSGEMSQF
                     ASWAAAIIVGGGTAGVVQMSTVAARGVSTATTGGLGNFIVATGEWIGAILLSVSAMLV
                     PALVAIVVLIAVIWVVRWIRHKKQEQAHTPL"
     gene            124894..125403
                     /locus_tag="ABZJ_RS00600"
                     /old_locus_tag="ABZJ_00110"
     CDS             124894..125403
                     /locus_tag="ABZJ_RS00600"
                     /old_locus_tag="ABZJ_00110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005049167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_000217635.1"
                     /db_xref="GI:446139780"
                     /translation="MTVMLVKPHLKFKESYNNYINELADEDRHPLTTEFDHTDFESFL
                     NKLRDYEKGEFLEEGHVPNITYWLVEGNEIIGASNLRLKLNEQIEYCGGHIGLGIRPS
                     KRGQNFGSKLLELTIQEAWKLGLTELHIHCYKSNLASAKTIQANNGRLHSEITLNQVV
                     QRYVVYKTL"
     gene            125747..126166
                     /locus_tag="ABZJ_RS00605"
                     /old_locus_tag="ABZJ_00111"
     CDS             125747..126166
                     /locus_tag="ABZJ_RS00605"
                     /old_locus_tag="ABZJ_00111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000606108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_000172534.1"
                     /db_xref="GI:446094679"
                     /translation="MTLIEKVVPGVFRKINNNLEILVFRHPLAGIQIVKGTVEHQEQL
                     EYAALRELYEESGIKRAQIHSYLGKHIPSEAGPDWHVFVCSTHEALKDKWSHFCEDDN
                     GLTFEFLWHSFLSPPTEEWHPLFKELFEFIKSKYKLN"
     gene            127223..128452
                     /locus_tag="ABZJ_RS00610"
                     /old_locus_tag="ABZJ_00113"
     CDS             127223..128452
                     /locus_tag="ABZJ_RS00610"
                     /old_locus_tag="ABZJ_00113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000442892.1"
                     /note="FabB, beta-Ketoacyl-ACP synthase I, KASI; catalyzes
                     a condensation reaction in fatty acid biosynthesis:
                     addition of an acyl acceptor of two carbons from
                     malonyl-ACP; required for the elongation of short-chain
                     unsaturated acyl-ACP; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_000442894.1"
                     /db_xref="GI:446365039"
                     /translation="MERVVITGMGINSCIGNTLEKVTESLKAGRSGIRYNEVYAKLNF
                     RSHVSATAEMNFENIDPELKKHMGVCAMYAYNSALDALQHAKLDVTDIANNPKYGVIG
                     GTGGTSTASIIDMLHTLKEKGVSEVSPDLAPRYLTSTISSNLSRAFNLKGVSQSVASA
                     CATSADAIGYAYHLIAAGKQDLMLAGGGEEDHWSQTAIFDAMGALCSKYNDAPETASR
                     PYSVDNDGFVIAGGGGMVVLESLSHAQKRGAKILAEVVGYAANSDGVDMVAPSGEGAT
                     RCIKLALAEAKQNGSDTIDYINTHGTSTPAGDIPELLAIERAFGGEEVPPLSSTKSMT
                     GHSLGAAGVHEAIYSILMLQNSFIAPSINITELREEAKKFDIVQTSRETELKTVMSNS
                     FGFGGVNTCLVFRKWEG"
     gene            complement(128546..129247)
                     /locus_tag="ABZJ_RS00615"
                     /old_locus_tag="ABZJ_00114"
     CDS             complement(128546..129247)
                     /locus_tag="ABZJ_RS00615"
                     /old_locus_tag="ABZJ_00114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009500625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_001063521.1"
                     /db_xref="GI:446986265"
                     /translation="MNNNIIIFGYGTGISKAVAHKFGKEGYKIGLVARNAQKLEKAIL
                     ELKAQGIEAYAFACDLAVLEDIPNLIKRIKDQLGEIKNIHWNAFHDIEGNILETPPLE
                     LTKSFHIRVSSYIATVQACLGDLEKNHGSILSTNGIFAFDAVGIDLVAKEYSSLATTA
                     AAQYKTTNLLAHSLADTNVYVSQVIVNGFVDGRPEAKDKTYAVHPETVAEQFWYLHQH
                     KQETVSLCGEAIQAA"
     gene            129496..130080
                     /locus_tag="ABZJ_RS00620"
                     /old_locus_tag="ABZJ_00115"
     CDS             129496..130080
                     /locus_tag="ABZJ_RS00620"
                     /old_locus_tag="ABZJ_00115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_001259280.1"
                     /db_xref="GI:447182024"
                     /translation="MRTKEFETDEIAEAAMQVFWRRGYAATSVQDLVDGTGLSRSSLY
                     STFQNKQGLYQKALLRYELLTTLNNVKLLSGSGSAKALIRQLLMRVVEDELNDSEHKG
                     CLVANACLELAGHDEEVSQFVVSNLQKLQHALESLLIKAQQSGEIASTQNPRALASFF
                     LNTMQGLRVLGKGSPHEQRKQCLMDVVEVALNVL"
     gene            130278..131012
                     /locus_tag="ABZJ_RS00625"
                     /old_locus_tag="ABZJ_00116"
     CDS             130278..131012
                     /locus_tag="ABZJ_RS00625"
                     /old_locus_tag="ABZJ_00116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001093475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_001093475.1"
                     /db_xref="GI:447016219"
                     /translation="MNTKSNETSHQLTDEFSTQLPIWKLLAFTVAGFLTIMTETMPAG
                     LLTQISQGLRISEAYAGQLIAVYALGSVLAAIPLISLTRSWNRRPLLLSTGHSYKVET
                     ILFIFGISSIVGILITGMFIDRSLRKITLLSLFIFAIATALLGVYSSSSFVVLTGVVL
                     WGITFGGAPTLLQTALANTAGHEADVAQSMLVTVFNLAIAFGGMIGGGLLESFGAASF
                     PWFMLAFALIALCTVYQARKHGFISL"
     gene            131692..132393
                     /locus_tag="ABZJ_RS00630"
                     /old_locus_tag="ABZJ_00117"
     CDS             131692..132393
                     /locus_tag="ABZJ_RS00630"
                     /old_locus_tag="ABZJ_00117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005129934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000428559.1"
                     /db_xref="GI:446350704"
                     /translation="MENKNQCRQCAVCGKSFPLKDLVSGEVIRNVISDEILKDHPDWS
                     YLSFICRADLADYRIKYVQSLLRSEKGELSNLENEVIGSMQRHELISRNTESDFDQNW
                     TFGEKLADKIASFGGSWAFLICFALFLTGWIVLNTVVMVVRPVDPYPFILLNLVLSCL
                     AAIQAPIIMMSQNRQEAKDRLRSQHDYQINLKAELEIRHLHEKMDHLLSHQWERLAHI
                     QEIQLDLLAEMNKKR"
     gene            132504..133169
                     /locus_tag="ABZJ_RS00635"
                     /old_locus_tag="ABZJ_00118"
     CDS             132504..133169
                     /locus_tag="ABZJ_RS00635"
                     /old_locus_tag="ABZJ_00118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001130506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="WP_001130511.1"
                     /db_xref="GI:447053255"
                     /translation="MPLNDNFVYAPPQDPLSILFEDDDLIVVDKPAGLLSVMGRLPEH
                     HDSAYLRVLEKFPLAKVTHRLDMATSGLLMFAKHRDAEVAVSKMFQARTVKKHYIALV
                     QGQVKQEGSVEVPLITDWENRPRQIVHFELGKHAKTLFQPLVYDETTDQSRVLLEPVT
                     GRSHQLRVHMMHIGHPIMGDKLYHPEPKRFHLNRMALHAAYLAFQHPLKGTDVVIESQ
                     VPF"
     gene            133280..133654
                     /locus_tag="ABZJ_RS00640"
                     /old_locus_tag="ABZJ_00119"
     CDS             133280..133654
                     /locus_tag="ABZJ_RS00640"
                     /old_locus_tag="ABZJ_00119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001078193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001078193.1"
                     /db_xref="GI:447000937"
                     /translation="MNRDYEQFPDDDNGNVLWQMVEDGDDLTELHEIEFSIAFQDQQN
                     AEQCAMHLLYQEQKISLFQDDSVEPNEWIITIFVTMEPEYSDIVDLEQWFSTIAEQFN
                     GEYDGWGCMAYVFDEEEDDILQ"
     gene            133683..134063
                     /locus_tag="ABZJ_RS00645"
                     /old_locus_tag="ABZJ_00120"
     CDS             133683..134063
                     /locus_tag="ABZJ_RS00645"
                     /old_locus_tag="ABZJ_00120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016803528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide cyclase"
                     /protein_id="WP_000059266.1"
                     /db_xref="GI:445981411"
                     /translation="MSLSQKEIAVRFLELAAAGEVDEAYGNYTAPNFKHHNPYYAGDK
                     ISLKEGMRESAIETPNKVLEVQHVIEDGALVAVHSKLEMQMNNKLTILAVVHICRFEN
                     EKIAEFWDIGQIQPDPLVNENGMF"
     gene            complement(134108..136198)
                     /locus_tag="ABZJ_RS00650"
                     /old_locus_tag="ABZJ_00121"
     CDS             complement(134108..136198)
                     /locus_tag="ABZJ_RS00650"
                     /old_locus_tag="ABZJ_00121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001216135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel protein"
                     /protein_id="WP_001216154.1"
                     /db_xref="GI:447138898"
                     /translation="MRHKLGLLSSLGLSFISTLTWGEETSTVLETIRVQAESTREDVS
                     QNSSATKFTHDVLDVPFNRAYLSKQIMEQQDVQRIDDALTLVSGVFHQNSFGGGFWDN
                     YSFRGFSTDPNLGAAMIRNGLSVNRGISAPKDVVNIESLEFLKGPMAALYGRGETGGL
                     LNLNSKKPQWESESELNLRANTQEQYRISLEHTAPINDELAYRLAVAHEDNQSFRDHV
                     SSERWFFSPQLTWKISDQTQLDFDSEFTEHKGTFDRGVSTVNHQFVMDPKTFTGEPDD
                     GDLKIKDYFYQLRLSHEFNPDWKLNSAVSYKDAQMVGFATEPRRMQADGRTLERQRRY
                     RDYTSEDVLAQTELLGKIDTSWARHEILLSTELGQLDYKQNQLRRNHSTDSPNTIDIY
                     QPKYGKYLPNLTPFTDTKERQRYFALNVQDQIFFNDQWSVLFGNRFDQVEQDFKNHIK
                     QTEDNQTLHQNSPRFGVNFKASEQWAFYSNYGRSFAMNSGMNRNGQTFAPEKGESYEV
                     GTKYKINDQSVLSLALFKMKKRNVLTTDPIDSNFQTAAGEVSSKGVEFDLNSQINDRW
                     FVNANYSYTDAQIEKDQGLAKGARLSNVPKHQGSVSTNYEFLQDGARKAGVGANLTYV
                     GERSGHNLDNGFNLPSYTLVNLNGYYAPSGRLRYQLNVNNLFDKTYYVSSYSDLWVQP
                     GEPLNASISAQWKF"
     gene            136274..137419
                     /locus_tag="ABZJ_RS00655"
                     /old_locus_tag="ABZJ_00122"
     CDS             136274..137419
                     /locus_tag="ABZJ_RS00655"
                     /old_locus_tag="ABZJ_00122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016142537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000051104.1"
                     /db_xref="GI:445973249"
                     /translation="MSLEKNIERLQSIDALRGLVIIIMLLDHVRETFYLHKQVTDPMD
                     VTVTEPALFGSRLLAHICAPVFVLLTGISAFLFQSKKQDLQQTRAFLLKRGLFLIVLE
                     LTLVNFAWTATFPPEVIYLQVIWAIGISMVVLACCVSLPLPILAGVALVIIFGHNLLD
                     SVHFSQGILQNIWFVLHERGWLEFAGIKLRTSYPVLPWIGVILLGYVLGQFFSSKYSA
                     KQRSRALLSLGLASIGLFVLLRLINIYGDQPWQHFESLQLTLMSFFNLTKYPPSLLFI
                     LLNVGIGLLVLVAFERMQQYSFLKPLVVFGSVPMFFYLLHLYVLKLMYVFALSVWGAN
                     YGNYLSVNHVWMLWLITIVLSFVLYPAVKWFSKFKHQNKHISILKYF"
     gene            complement(137460..137927)
                     /locus_tag="ABZJ_RS00660"
                     /old_locus_tag="ABZJ_00123"
     CDS             complement(137460..137927)
                     /locus_tag="ABZJ_RS00660"
                     /old_locus_tag="ABZJ_00123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002118087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_001247568.1"
                     /db_xref="GI:447170312"
                     /translation="MRPLDRIDRMILDILQREGRIAISELASRVNLSTTPCSERVKRL
                     ERDGIIMGYYARLNPAYVDRNLLVFLEIKLSAKSGDVFDQVARDLVEIPEVLECHLIS
                     GEFDYLVKARLKEMSAYRRLLGDLLKKLPASASSHSYVVMEEVKETLYLDVSK"
     gene            138064..139329
                     /locus_tag="ABZJ_RS00665"
                     /old_locus_tag="ABZJ_00124"
     CDS             138064..139329
                     /locus_tag="ABZJ_RS00665"
                     /old_locus_tag="ABZJ_00124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017393432.1"
                     /note="catalyzes the oxidative deamination of D-amino
                     acids; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase small subunit"
                     /protein_id="WP_001263981.1"
                     /db_xref="GI:447186725"
                     /translation="MRVIVLGSGVIGVASAYYLARQGAEVTVLDRQSGPAEETSFGNA
                     GQISPGYSTPWAAPGIPFKAVKWMFQHHAPLAINLDGSMWQLQWMAQMLKNCNPQSYA
                     VNKERMMRVAEYSRDCLRELRKDTGIHYENRAKGTLQLFRKEAQMEAVQRDISVLEEC
                     GVSYELLNGNELGRVEPALANAQDKLVGGLHLPNDETGDCYLFTNALAQIAKELGVNF
                     QFNQNVEKLIVEGDQIKGVQVNGKVLTADRYVLAFGSYSRDFLKPLDLQLPVYPVKGY
                     SLTIPIVDPAFAPQSTVLDETYKIAITRFDQRIRVGGMAELSGFNLGLNEDRRATLQM
                     VTQDLFPGGDMEQASFWTGLRPMTPDSTPIIGATRFKNLFLNTGHGTLGWTMACGSGK
                     LISDIVLNHKTDISTDGLSIQRYSHAHAA"
     gene            139350..140453
                     /locus_tag="ABZJ_RS00670"
                     /old_locus_tag="ABZJ_00125"
     CDS             139350..140453
                     /locus_tag="ABZJ_RS00670"
                     /old_locus_tag="ABZJ_00125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001137862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_001137862.1"
                     /db_xref="GI:447060606"
                     /translation="MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIE
                     RVYEAFKAADGFALLDIEEAKRIRALGWTGPILLLEGVFSPQDLFDCVQYQLSFTIHS
                     EAQIEWVEQHPYPAQFDVFLKMNSGMNRLGFKPQHYVQAWERLNNLANVAKITHMMHF
                     SDADGDRFGQQGIDYQITAFEEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLY
                     GSSPDYPTHSIADWGLQPTMSLRSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACG
                     YADGYQRISPTGTPVLVDSVRTRTVGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTG
                     VILPIDDVAVSSGTVGYELMCAVTARVQFINQV"
     gene            140464..140823
                     /locus_tag="ABZJ_RS00675"
                     /old_locus_tag="ABZJ_00126"
     CDS             140464..140823
                     /locus_tag="ABZJ_RS00675"
                     /old_locus_tag="ABZJ_00126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016142534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacrylate peracid reductase"
                     /protein_id="WP_000071350.1"
                     /db_xref="GI:445993495"
                     /translation="MSNSDIQKINTNEVMSAVTVFNKVVYLSGQVPKNTEQDVAGQTR
                     EILATIEELLALANTDKSRLLSAQLYLKNLSDFSTVNAIWVDWLKGCVAPSRATIQAD
                     LVNPDWLIEIAVTAAQK"
     gene            140985..142424
                     /locus_tag="ABZJ_RS00680"
                     /old_locus_tag="ABZJ_00127"
     CDS             140985..142424
                     /locus_tag="ABZJ_RS00680"
                     /old_locus_tag="ABZJ_00127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004748580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine glycine permease"
                     /protein_id="WP_000205436.1"
                     /db_xref="GI:446127581"
                     /translation="MTTARHSDTENSPDHLQRKLSNRHLQLIAIGGAIGTGLFMGSGK
                     TISLAGPSILFIYMIIGGMFFFLMRAMGELLLANLHYKSFVDMAHDLIGPWAGYYLGW
                     TYWLGWVLVGIADLSAVINYLSFWLPDGASFSPIQQAMISAGCVLFVMGLNLLTVRLF
                     GEIEFWFALIKILAIIGLIGVGGYMIFSHFQAPQGAVASISNVWSHGGLFPKGTEGFL
                     AGFQIAVFAFVGVELVGTTAAETKDPQKNLPKAINAIPVRIILFYVLALFIVMSVTPW
                     DHIRADKSPFVELFLNAGIPVSAIIMNLVVLSSVMSSMNSGVFSTSRMLFGLSKDGQA
                     PGAFGRLSKRAVPSNGLIFSCTFIMGGAVLQYFVPNTMEAFTLASSLCVILFISVWSL
                     IMVCYLRYRKLRPELHEKSTFKMPGGIWMSYVVLAFMLFTLVILALEPDTLKALYVSP
                     VWLIILGVTYHVLYKPRMKRLGRELVNDH"
     gene            142795..>143313
                     /locus_tag="ABZJ_RS00685"
     CDS             142795..>143313
                     /locus_tag="ABZJ_RS00685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016142533.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="WP_038349647.1"
                     /db_xref="GI:740522236"
                     /translation="MTMVHHSDEASSPDHLQRKLSNRHLQLIAIGGAIGTGLFMGSGK
                     TISLAGPSILVIYMLIGGMFFFLMRALGELLLANLHYKSFVDMAYDLIGPWAGYYIGW
                     TYWLGWVLVGIADLSAVINYLSFWLPEGASFSPMQQAMISAGCVLFVLGLNLLTVKLF
                     GEVEFWFALIKIL"
     gene            complement(143332..143766)
                     /locus_tag="ABZJ_RS00690"
                     /old_locus_tag="ABZJ_00128"
     CDS             complement(143332..143766)
                     /locus_tag="ABZJ_RS00690"
                     /old_locus_tag="ABZJ_00128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000780882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000780881.1"
                     /db_xref="GI:446703535"
                     /translation="MKLYISALQLENGELLLVVSPQFNANAIQDYALRWEIETLFSCL
                     KGRGFNLENTRLTDPRRVKKLIAVLAISFCWCYLTGEWQHDQKKAIKIKKHGRLSMSL
                     FRYGLDYVQMAIQRLIGFGKKEEFKEILAILRRQNPDRIRVL"
     gene            complement(143853..144422)
                     /locus_tag="ABZJ_RS00695"
                     /old_locus_tag="ABZJ_00129"
     CDS             complement(143853..144422)
                     /locus_tag="ABZJ_RS00695"
                     /old_locus_tag="ABZJ_00129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004758990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002009885.1"
                     /db_xref="GI:487936419"
                     /translation="MTHLNELYLILNKSLKWNKSHLKCFALIMLVIILKQTCNLSSAS
                     KALPIKCLPQSFYRRMQRFFAGQYFDYRQISQLIFNMFSFDQVQLTLDRTNWKWGKRN
                     INILMLAIVYRGIAIPILWTLLNKRGNSDTKERIALIQRFIAIFGKDRIVNVFADREF
                     IGEQWFTWLIEQDINFCIRVKKTSLSPII"
     gene            <144494..145414
                     /locus_tag="ABZJ_RS00700"
     CDS             <144494..145414
                     /locus_tag="ABZJ_RS00700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002000469.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="WP_038349643.1"
                     /db_xref="GI:740522229"
                     /translation="KILAIIGLIGVGGYMILTHFQAPHGDVVSISNVWSHGGLFPKGV
                     SGFLAGFQIAVFAFIGVELIGTTAAETKDPQTNLPKAINAIPVRIILFYVLALFVVMS
                     VTPWNHIRADKSPFVELFLNAGIPISAIIMNLVVLSSVMSSMNSGVFSTSRMLFGLSK
                     DGQAPSVLGRLSKRAVPSNGLIFSCIFIMGGAVLQYFVPNTMEAFTLASSLCVILFIS
                     VWILIMACYLRYRKIRPELHAASTFKMPGGVLMAYAVIAFFLFTLVILALEPDTLKAL
                     YVSPVWLVVLSVTYYAFYKPRMRKLGQEIF"
     gene            complement(145472..146353)
                     /locus_tag="ABZJ_RS00705"
                     /old_locus_tag="ABZJ_00130"
     CDS             complement(145472..146353)
                     /locus_tag="ABZJ_RS00705"
                     /old_locus_tag="ABZJ_00130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000861798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000861797.1"
                     /db_xref="GI:446784541"
                     /translation="MKVDWDHLQFFLVLARTKTLTNAARIIGVEHSTVARRIQALELA
                     LGTTLFKREATGYELTLEGLALVPRVEQMEQAFLQIEKPHQPLQGRVRIGTPEGFGTA
                     FLARLLAEFSIQYPLLTIDLIPVPKMIKLSHREADIVVSIERPTSGPYIITRLSDYCL
                     KIYGSQNYLAQNPPIRRLEDLTQHRFVNYIDDLVYSPELYCLERLPLKLNANFRSSSI
                     LAQQIAVSAGAGLAILPKFLADDKPELEEVLEQQVRFTHTFWMLTFVDLQHEPRIKLV
                     WDYLRKQADKYQHLLVD"
     gene            146519..148036
                     /locus_tag="ABZJ_RS00710"
                     /old_locus_tag="ABZJ_00131"
     CDS             146519..148036
                     /locus_tag="ABZJ_RS00710"
                     /old_locus_tag="ABZJ_00131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009387407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="WP_001092387.1"
                     /db_xref="GI:447015131"
                     /translation="MNTIQKIELDTAKLLINGQFIESKTQEWQDIVNPATQEVIGRVP
                     FATVEEVDAAIQAAQDAFASWRQTPIQARMRIMLKLQDLIRANMKEIAQVLTAEQGKT
                     LADAEGDIQRGLEVVEHACSVGTLQMGEYVEGVARGVDTYTLQQPLGVCAGITPFNFP
                     AMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMMLVELAIQAGIPAGVLNVVHGGKEVVD
                     HLCTHKDIKAISFVGSTAVGTHVYNLAGQHGKRVQAMMGAKNHVVVMPDANKEQTLNA
                     LVGAAFGAAGQRCMALSVAVMVGDSKQWIQELVEKAKTLKVNAGHEPNTDIGPVISKR
                     AKARVIDLINSGVEQGAELLLDGRNVQVQGYESGNFVGATIFSGVNTDMRIYKEEIFG
                     PVLSIICVDTLDEAIALINANPFGNGVGLFTQSGAIARTFQNLIDIGQVGINIPIPVP
                     VPFFSFTGSRGSKLGDLGPYGKQAVQFYTQTKTITSRWFEDSHEVGGVNTTISLR"
     gene            148048..148938
                     /locus_tag="ABZJ_RS00715"
                     /old_locus_tag="ABZJ_00132"
     CDS             148048..148938
                     /locus_tag="ABZJ_RS00715"
                     /old_locus_tag="ABZJ_00132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001017301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyisobutyrate dehydrogenase"
                     /protein_id="WP_001017294.1"
                     /db_xref="GI:446940038"
                     /translation="MNIAFIGLGNMGGRMAQNLLKAGLKVYGYDLSEVAIQHFAEAGG
                     IVCDSPQNAAKQADVVITMLPAAKHVKEVYLGENGVLEVLKAGSLCIDSSTIDPQTIK
                     DIAAVAQSKNIKICDAPVSGGTIGAQAGTLTFMVGADEQTFNELKPVLSHMGKNIVHC
                     GDVGAGQIAKICNNLILGISMAAVAEGMALGVKLGIDPQALAGVINTSSGRCWSSDVC
                     NPWPYINENAPASRGYQDGFATQLMLKDLGLAVEAAGQVKQPVLLGGMVQQLYQQMCM
                     RGNAHLDFSSIIQQYLPQEA"
     gene            149020..150669
                     /locus_tag="ABZJ_RS00720"
                     /old_locus_tag="ABZJ_00133"
     CDS             149020..150669
                     /locus_tag="ABZJ_RS00720"
                     /old_locus_tag="ABZJ_00133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002065011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-binding protein"
                     /protein_id="WP_000969574.1"
                     /db_xref="GI:446892318"
                     /translation="MMDYQNAVQAFDLESTAKQMLSGSLDALNACYECCDRHADGDKI
                     ALYWQGKDGRKEQYTFRELKEWSSQFANFLKSQGVKAGDRISGLLPRTPELIVTILAA
                     WRIGAVYQPLFTAFGPKAIEHRIQLAQSKLVVTDMGNRSKLDEIEKCPAIMTVADAQG
                     TPLKAGDFNFWNEVKQQSDQCDLVMRNIQDPFLLMFTSGTTGPAKPLEVPLKALIAFG
                     RYMQDAIGLTEEDSFWNIADPGWAYGLYYAITGPLFLGHATLFYEGGFSTDSLCQIVK
                     DYKVNNLAGAPTAYRMMMAADPAQMAPLKGQFRVVSSAGEPLNPEVIRWFKQVLDAPI
                     YDHYGQTEVGMVVCNHHGLKHEIHAGSAGFPSPGYRVAIVNEQGEELPPDTPGILAVD
                     ISQSPMMWFGGYKESRKSPFISHYYLTGDTAELHADGSMSFVGRSDDVITTSGYRIGP
                     FDVESALLEHDAVIEAAVIGVPDPDRTEVVKAFVILAAGVQPSDALAEELSQFVKRRL
                     SAHAYPRLVEFVSELPKTPSGKIQRFLLRNQEIAKQQAKAG"
     gene            150681..151808
                     /locus_tag="ABZJ_RS00725"
                     /old_locus_tag="ABZJ_00134"
     CDS             150681..151808
                     /locus_tag="ABZJ_RS00725"
                     /old_locus_tag="ABZJ_00134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016144017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_001160766.1"
                     /db_xref="GI:447083510"
                     /translation="MQFTEEQLLIRDMAKSFAQEQIKPNASDWDRDGTFPKETLTQMG
                     QLGFMGMLVSEEWGGSDTGNLAYVLALEEVAAADGATSTIMSVHNSVGCVPILKFGTD
                     EQKERFLKPLAQGEMIGAFALTEPHTGSDAAAIKTRAVKDGDDYILNGAKQFITSGNN
                     AGVIIVFAVTDPSAGKKGISAFLVPRETPGYEVIRVEEKLGLHASDTCQIALTDVRIH
                     KSLMLGKEGEGLKIALANLEGGRIGIAAQAVGLARAALEEATRYAKERITFGKPIFEH
                     QTIAFRLASMATEIEAARQLVHYAARLKEAGQPCLNEASMAKLFASEMTERVCSSALQ
                     VFGGYGYLRDFPIERIYRDARICQIYEGTSDIQRLVIARSL"
     gene            151830..152603
                     /locus_tag="ABZJ_RS00730"
                     /old_locus_tag="ABZJ_00135"
     CDS             151830..152603
                     /locus_tag="ABZJ_RS00730"
                     /old_locus_tag="ABZJ_00135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004843647.1"
                     /note="Catalyzes the reversible hydration of unsaturated
                     fatty acyl-CoA to beta-hydroxyacyl-CoA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_001198681.1"
                     /db_xref="GI:447121425"
                     /translation="MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLE
                     KDCEIGCIVLAGSEKAFAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVS
                     GYALGGGCELALMCDFIYCADNAKFGLPEVTLGVIPGIGGTQRLTHAIGKAKAMEMCL
                     TARQMGAVEAEQSGLVARVFSKEELLEQTLQAAEKIAARSLTANMMLKETINRAFEVN
                     LTEGLRFERRMFHSIFATADQKEGMQAFVEKRQANFKNQ"
     gene            152616..153641
                     /locus_tag="ABZJ_RS00735"
                     /old_locus_tag="ABZJ_00136"
     CDS             152616..153641
                     /locus_tag="ABZJ_RS00735"
                     /old_locus_tag="ABZJ_00136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001091041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoly-CoA hydratase"
                     /protein_id="WP_001091038.1"
                     /db_xref="GI:447013782"
                     /translation="MNTENHLMIERQGKLGVITLDRVTHLNALSLDMIEGIGAQLELW
                     RNDAAVQAILIKSNSPKAFCAGGDIRYLYDSYKNGTADYKGYFSAEYKMLNTLREYEK
                     PIIVVLDGYVLGGGFGLAQACHIVVSSEKSRFAMPETAIGFFPDVGATHFLSRLDDIG
                     VYMAITGEQISSSDALYLDLIDYHVPSDQLQALQDALVEAPSLSKEGIEHIITRFITR
                     PAESELKQLAEGIRKHFGYQHLDEIEQSLENEQDESLKTWASKMLSILQQRSFIAKQT
                     SLKLQHLGRGLSLQQCMQLERDLQDIWFEHGDFIEGVRALIVDKDKQPRWQERNPELE
                     QILEKLS"
     gene            153761..155113
                     /locus_tag="ABZJ_RS00740"
                     /old_locus_tag="ABZJ_00137"
     CDS             153761..155113
                     /locus_tag="ABZJ_RS00740"
                     /old_locus_tag="ABZJ_00137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002017126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_001193290.1"
                     /db_xref="GI:447116034"
                     /translation="MQTIHGNGSHPKKSSHRLAGISSMVGTTIEWYDFFVYGAAAALI
                     FNKLFFPNLDPLTGVLAAFATYAVGFIGRPLGGLVFGHFGDKIGRKSMLLLTLMLMGI
                     PTVLIGLLPTYESIGYWAAIGLVVLRFIQGMAMGGEWGGAVLMAVEHAPEGGKGFWGS
                     LPQASTGGGLMLASIALGLVSLLPEQALFSWGWRLPFLASIILLAVGWYIRVKVPESP
                     DFEKVKQQSEEVKVPAFQVFKNHPKQLITIILARAAENAWFYIASTFTLAYTTTQLGI
                     PRQDILFATICGAAVILFMTPLCGHLSDKVGQRNMFMFGLCVLALYSYPFFSMLNTKD
                     PVLVWTAIVLAIGVVFPIMYAPQAQLFARQFPAEIRYSGISISVQLAGVLGGGLAPMI
                     ATKLLSIGQGNPYLIMFYIGSMAVVAIISTSFMPRDWSYKKDETYYKKENLNLKTKID
                     "
     gene            complement(155206..155757)
                     /locus_tag="ABZJ_RS00745"
                     /old_locus_tag="ABZJ_00138"
     CDS             complement(155206..155757)
                     /locus_tag="ABZJ_RS00745"
                     /old_locus_tag="ABZJ_00138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001020939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acylhomoserine lactone synthase"
                     /protein_id="WP_001020941.1"
                     /db_xref="GI:446943685"
                     /translation="MNIIAGFQNNFSEGLYTKFKSYRYRVFVEYLGWELNCPNNEELD
                     QFDKVDTAYVVAQDRESNIIGCARLLPTTQPYLLGEIFPQLLNGMPIPCSPEIWELSR
                     FSAVDFSNPPSSNSQAVSSPVSIAILQEAINFAREQGAKQLITTSPLGVERLLRAAGF
                     RAHRAGPPMTIDGYSMFACLIDI"
     gene            complement(155836..156201)
                     /locus_tag="ABZJ_RS00750"
                     /old_locus_tag="ABZJ_00139"
     CDS             complement(155836..156201)
                     /locus_tag="ABZJ_RS00750"
                     /old_locus_tag="ABZJ_00139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001004972.1"
                     /db_xref="GI:446927716"
                     /translation="MNENQLMSYPLQHIISTVESRHTEASQIFYYGFTEWATSQTPAL
                     STGWDWELIENNGITTVKRVGLPRSNIMIVDVSGMDIGFDINETLLEKKIDTLFWEPF
                     IYAQINTSLTKSSLSQTFS"
     gene            157012..157728
                     /locus_tag="ABZJ_RS00755"
                     /old_locus_tag="ABZJ_00140"
     CDS             157012..157728
                     /locus_tag="ABZJ_RS00755"
                     /old_locus_tag="ABZJ_00140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002118060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_000446790.1"
                     /db_xref="GI:446368935"
                     /translation="MESWQEDLLSAFLVVKNEYQLFEIVKSTASRLGFDYCAYGMQSP
                     LSIAEPKTIMLNNYPEAWQKRYVERQYVKIDPTVQHCMVSLQPLVWSSQSAKTQAEKD
                     FWEEARSYGLNVGWAQSSRDFIGTRGMLTLARSNDQLSEKEQKAQYTNMYWLTQTVHS
                     SIAKIVNDVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQ
                     KLNVNNKISAAIRAVMLGLL"
     gene            158344..160233
                     /locus_tag="ABZJ_RS00760"
                     /old_locus_tag="ABZJ_00141"
     CDS             158344..160233
                     /locus_tag="ABZJ_RS00760"
                     /old_locus_tag="ABZJ_00141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013199204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_000279945.1"
                     /db_xref="GI:446202090"
                     /translation="MAVMCTDNIIATLESHAKLNGNKIAFEYLGRQSGGIQSLTYADL
                     NERVQHQAQILMSIVDSGDRAVLLFEPGLDFIVSFFACLKAKIIAVPVSLPFNRNGFS
                     NILNIMNDCEPKIVLTTKKILELAGLITLKAQNENLILHAVDAELQRDLVEKDFPLIT
                     EKDICFLQYTSGSTGWPKGVIVTHKNIMANEVMIAEAFGTQPEDVGLTWLPVYHDMGL
                     IGSVLQTVYVGLTCYVMSPLDFIRKPLKWLQFISEKGVTISGGPNFAYELCLHRITDE
                     QAAALDLSRVRVLFNGAEPIKAHVMQRFMEKFNTQSRLRLDTFLPCYGLAEVTLLVSG
                     VTGPLNAISLDRDKLNAHLVQTSQDQTAVQVVSCGKISKHIDCRIVNPHTRKEVAAHE
                     VGEIWLAGESVTAGYWQKPEVNRETFEATILDEAGQPSQVHYLRTGDMGFIKNGDLYI
                     TGRLKDVIIIRGKNYYPQDIECSVEMAHPAVRKGCVAAVNFADSEGVTVVLEIKKKSL
                     DKTLNFETIRTQVKEQVAADIGLPVDGVYLLHQGRINKTTSGKIRRRKIKEQIERGQL
                     VCLTHPNRRTMIARNYVKNGLDVIRDREQRGQLIRYSSNLLNSMIKEREVRTLIFNRL
                     KSALF"
     gene            160266..162059
                     /locus_tag="ABZJ_RS00765"
                     /old_locus_tag="ABZJ_00142"
     CDS             160266..162059
                     /locus_tag="ABZJ_RS00765"
                     /old_locus_tag="ABZJ_00142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000060274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_000060276.1"
                     /db_xref="GI:445982421"
                     /translation="MSLTSNLRQFQSAARLEQILGSVHDTNNDFSWSAAIERDEKEQY
                     PQRAVDFLNAVGMNRFYVPSELGGRMEIGEELLYLHRVLARRDLTINSTYSTNAWSVI
                     VWIGGNESQCQNIANRILSGAAPALAYSEKAHGADLLSSEVTAQPSDSKYVLNGEKWS
                     INRATLGDSLSLIAKTSNDRGPRSLSAFWLDKRHMASKGTYSLNRLPTVGMRGLDISG
                     IGFNNAEIHKDALIGEEGQGLELGLKTLQVTRAYCSSFSLGAGDTMLRIATEFAIERE
                     LYNKKVISIPLVREQLATAYAYLLAAEVLSLVGARGLHVCINQFSTWSPIVKVLVPEY
                     VESLAKITSSVLGSRFFLRNAYADGMFQKAFRDHLIVSVFDGSSTVCLDSLSFQLKSA
                     NKGRSKKADHLNQAEAKARYRQLYDLQVETGAIDFRELEIFNRDGDLVMESLETIIEM
                     LNDSNVTVGLSAETLATLHERANQLLVEQRSLDQKIQDYFSNSEQSKEFETMRFSLAR
                     NYAELFARIAVLGFWVFNRHGLRPALQNGAWLIIFLNAAEGQTAPPMTSLRESTLADL
                     LDRISTNHMLSVIDFALAPRDAKPVKKEITP"
     gene            162056..162316
                     /locus_tag="ABZJ_RS00770"
                     /old_locus_tag="ABZJ_00143"
     CDS             162056..162316
                     /locus_tag="ABZJ_RS00770"
                     /old_locus_tag="ABZJ_00143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001030689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_001030690.1"
                     /db_xref="GI:446953434"
                     /translation="MNKDKAYWSAIIRTLVAKEMRVEPETIDPDQKFTSYGLDSIVAL
                     SVSGDLEDLTKLELEPTLLWDYPTINALAEYLVSELQQGVAS"
     gene            162313..166272
                     /locus_tag="ABZJ_RS00775"
                     /old_locus_tag="ABZJ_00144"
     CDS             162313..166272
                     /locus_tag="ABZJ_RS00775"
                     /old_locus_tag="ABZJ_00144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001060990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_001060976.1"
                     /db_xref="GI:446983720"
                     /translation="MNNLARLEPEVLSRHAISAEQLGIWYIQRLEPTCSAYNMVVAFD
                     VKVNQPLGNKPIEILEAVMHDYPLLRVSMPANDQGIEQLIWDRVYPNIIFSDARHIEA
                     SELTQLVEQDAKQPFDLTQPPLWRIHCYERGQNHYVIAFVIHHALMDFWSIGLLLRDV
                     SKRFGLVAESDAVNGIEFAQYADKQQSSVIDDSDESLIFWKNALKHAPHVHSIPLDYP
                     RPAVQKHTGSSLVFRVPESVSSGLVNLAKDYEITLFGLVLSGFYILLHKLSNENNLVI
                     ATPVAGRLERSLRNALGQFVNTIAIHIDIDADQTLRQFTQQVQEQLRQSLKHQKVAFS
                     RVGEAVAPKRDGSINPLAQIGMFWERLGGMDEFKELLLPIQTPATLVGQDLTLGSFPV
                     RQQEGQLDITLEMGGEYQGELVGVLKYNTDLFSAQSAKNMVQLLQAVLSEMVAHPERK
                     IVELDIAPDYKDSIQFEALRGKATDYAQHDLFAMILKQIDERGDNHALTSNDHAVSYC
                     ELGQHIAGIAEYLCAHGITRGDRVGLMLDRTALLPAAILGIWAAGAAYVPLDPNFPTE
                     RLQNIIEDAEPKVILTQTELMDGLNVSVPRLDINQAGVVALEQVRETLAFGDIAYVMY
                     TSGSTGKPKGVRIGHPSIINFLLSMNDRLQVTTETQLLAITTYAFDISILELLIPLMY
                     GGVVHVCPREVSQDGNQLVDYLNAKSINILQATPASWKMLLDSEWSGNAGLTALCGGE
                     ALDTILAEKLLGKVGCLWNVYGPTETTVWSSAARITDAKYIDLGEPLANTQLYVLDEQ
                     QRLVPPGVMGELWIGGDGLAVDYWHRPELTDAQFRTLPSLPNAGRLYRTGDKVCLRTD
                     GRLTHHGRLDFQVKIRGFRIELGEIENVLKQIDGITDAVVLVKTTADNDQKLVAYVTG
                     QELDIAGLKKTLQIHLPAYMVPSAFIRLDEFPMTANNKLDRKAFPEPIFEQSNDYVAP
                     RDPIEIELCTTFEQILSVKRVGIHDDFFELGGHSLLAVKLVNHLKKAFGTELSVALLA
                     QYSTVERLGEIIRENKEIKPSIVIELRRGTYEQPLWLFHPIGGSTFCYMELSRHLNPN
                     RTLRAIQSPGLIEADAAEVAIEEMATLYIAEMQKMQPQGPYFLGGWCFGGAIAYEISH
                     QLRQMGQQVTGIVMIDTRAPIPENVPEDADDAMLLSWFARDLAAPYGKKLTIPAQYLR
                     ELSPDQMFDHVLKEAKAINVLPLDADPSDFRLYFDTYLANGIALQTYFPEPEDFPILL
                     VKAKDEQEDFGESLGWDQLVKDTLTQVDLPGDHSSIMYAENVVAVAQTIDQMYPIPT"
     gene            166297..169947
                     /locus_tag="ABZJ_RS00780"
                     /old_locus_tag="ABZJ_00145"
     CDS             166297..169947
                     /locus_tag="ABZJ_RS00780"
                     /old_locus_tag="ABZJ_00145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000256272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_000256275.1"
                     /db_xref="GI:446178420"
                     /translation="MVTIEHAFLIPAKIDKVFTYLANPANDAGWQLSCKHSELLDSTP
                     RVGSKYEIGFSFIGREMSFKGEITHLVPNELYAFKVVEGPFHYTGTYRFKPHPEGTWI
                     EWVFEAEPGSFFGVLPPALLKKMVLAQFKKDVDNLQALAQKGEAYESVGNENKLTIET
                     NKPPRKTQQMMEKYARWILSHRRIVLTVVMLLTLALAYLASGVKIIIDPDALAPKGHP
                     YITSTKLIEKKFGSKYMVVIGITPKQGDIYQPQVLEKVKRITEEVDNAPGVVRSTMMS
                     LAARQAKGIEANAEGFDAKKLLPSNSVTQEDIDHLKKLLALNPTYMNSVVSKDQRTAA
                     ILLELEESPEGFQKMMGPINKIVESEQSKDMTISVGGNPVYLDKAEDYSKRINILFPI
                     AVLVIGLLHFEAFRSKQGLILPLVTALLAVAWGMGMMGLFKQPMDIFNSPTPILILAI
                     AAGHAVQLLKRYYEDFDRLIAQGMEPKAANSEAVVQSLVRVGPVMVLAGGIAAAGFFS
                     LLTFNIPTIRSFGIFTGIGIISTLVIEMTFIPALRSMLPPPSVVKVKRKGLPVWDWIP
                     NRIGDVILSVRPRMMLMTAIAAMGILLAIGTSRIVVDNDSRNFFSRDLPMQQDDRFLN
                     QSLGGTNSLYIMVDTKVRDGIENPEILKAIDNTEKFANSIPEVGKTISIVDYIKRMNQ
                     AMNADQPQAFQVPATKDIVAQYLLLYSMSGEPTDFESYIDTTQRYAKITILLKTGSNH
                     RIKEILESLKTYMAGQLGDKAVVSFGGDVTQTIALTETMVHGKLMNILQISFAVFFIS
                     ALVFRSISAGLIVLTPLLFSILAIFGVMGWLDIPLNIPNSLISAMAVGIGADYAIYFL
                     YRLREILREEGGDIKDAIRKTLSTAGKASLFVATAVAGGYGVLSLSQGFHVHQWLAMF
                     IVIAMLFSVFATLIMVPTMILILKPRFIFSSKKKSIPVAQTVVTSLLLGTVLTMSMPK
                     TSHADEVQDIVNRSDDASKFLSSTASAKFILTSKNGEQRVRLTKNMTKLAGNTQNNMR
                     LTEFISPADVQGTTTLLIENAKGSDSMFVYLPALKKVRRLASANKGDAFIGTDFSYGD
                     VLGYKLSDWKYTKLADGKFNGKDCYMIEATPINNTVKSDFGYSKRRMCILKDNFVTAT
                     IDIWDTAGKPLKHIEFTDIRPYGKVKPRWQAMKSMAKNLQTQHMTQVIVNDFAAEKTL
                     SDKLFSPQSLEK"
     gene            169944..171218
                     /locus_tag="ABZJ_RS00785"
                     /old_locus_tag="ABZJ_00146"
     CDS             169944..171218
                     /locus_tag="ABZJ_RS00785"
                     /old_locus_tag="ABZJ_00146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_000191723.1"
                     /db_xref="GI:446113868"
                     /translation="MTQGAYWVFVCCSSFMLLQHTYADDSEMSFVSQNSARLDVWSSD
                     RDLSSLKNIGQASFWSNGTLKFNPAFKLHYDIVVSDETDHTVNPDQVSKVNRNLRELY
                     ASYNWDQTVYVDVGRQIVVWGRADGINPTDNLSPRDYTRLVPDETDQRLGNDAIKLTY
                     IPESGTNKWTALWYPRSRSDVIPLRQIAGVQYDIDRKSRPAFAMRWDYSVDGLDVGAS
                     YFSGLDHMPDLSVLSASPTGEATLQLKNNPMSVYGFDFSYNHNDLVWRGEAAYTKTDS
                     NGSEDLTHKKNNLTIVMGPEWSLKNSTLSLVGVYKHTEDFKSADSLTNPSLSTVYRYQ
                     QTISDQYEQDQYGAMLRYALNLLNDNLKLEFTGFYFAPEPNELLRVRINYNLNDHWQL
                     NAGGDRFWGRNDTVLGQFRDNSLVYAQVRYNF"
     gene            171273..173138
                     /locus_tag="ABZJ_RS00790"
                     /old_locus_tag="ABZJ_00147"
     CDS             171273..173138
                     /locus_tag="ABZJ_RS00790"
                     /old_locus_tag="ABZJ_00147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000369408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000369418.1"
                     /db_xref="GI:446291563"
                     /translation="MDNLNNAKKDNFSRKTILVTGAAGFIGSRLIVELLREGHQVIAA
                     LRNAATKKDKLLGFIATQGLADPSISFVEYDLSRDFKLDSLLSDAQTKIHVIYHLAAS
                     FNWGISKAEAERTNIKSGLALIEWAATLKQLERFIWIGGYRVAAPPQESADELYCKHG
                     GYEASKILGHQAFIEACKRLNVPWTAINPATVIDGFYNYGDMQYIGIADMIGKLYQGR
                     LLALPGGRDTFLPLCNMQYIVSFLIRTMSYPETIAQEYMLLDPATPKFHRLVHLAAEH
                     LGVSSPHLQIPKVLLEKLPEVLLDGSKEQLSFISTEHYHVAGAEAMAAKMGIADLISI
                     MPYFSRWIDRLVFTRFGRMQVPTPNSFSYQNRYWTEIYTNQPVGSEKVSALFLHGIPF
                     DSACWSPIINKITYDQVAMMDLPGLGRSGSYEMMEDNNHQFIDTAAELLAPNSVVIAH
                     SLGCLFALNLAKKYPDKVARLILISPYFVQAQAAKMFQIQAISKLIFRFVPKDVIAKD
                     LHPEGQQNLSVRYAMDSLRRMSVSKHISEYMHHINLPQQRAAQTALLSELRSKIEIIV
                     GEKDPIVTPISPDIPVHIIAGAGHNPHVTHVEAVYDHLTPVLTKYISTTAQLSDV"
     gene            173131..173895
                     /locus_tag="ABZJ_RS00795"
                     /old_locus_tag="ABZJ_00148"
     CDS             173131..173895
                     /locus_tag="ABZJ_RS00795"
                     /old_locus_tag="ABZJ_00148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001286030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-protein transferase"
                     /protein_id="WP_001286029.1"
                     /db_xref="GI:447208773"
                     /translation="MSDVANVQVYVCPISRVPNNHLILSHYLSFLNAAEKLRYDQYHP
                     HVARLFLISRVLMKSVLSDKLGILPHEVIIQLQPNGKPFVRGNKAIYFNLSHSADFIV
                     FAVTEKGEIGVDVERMDHEFEWRRVDSVLAPSEIEWIQQNEWTNPTSVYQRFFQIWTL
                     KESYIKCTGEGMSRHLKKLNFHVSPEHIQFFDLTNNDVQRTEQYHFKSYIYNYSFIFS
                     LCLQQSHCLESFNIDCFQLLPYISTHRITLEPCEHN"
     gene            complement(173990..174065)
                     /locus_tag="ABZJ_RS00800"
                     /old_locus_tag="ABZJ_tRNA3"
     tRNA            complement(173990..174065)
                     /locus_tag="ABZJ_RS00800"
                     /old_locus_tag="ABZJ_tRNA3"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(174030..174032),aa:Gly,seq:gcc)
     gene            complement(174111..174186)
                     /locus_tag="ABZJ_RS00805"
                     /old_locus_tag="ABZJ_tRNA4"
     tRNA            complement(174111..174186)
                     /locus_tag="ABZJ_RS00805"
                     /old_locus_tag="ABZJ_tRNA4"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(174151..174153),aa:Gly,seq:gcc)
     gene            174417..174725
                     /locus_tag="ABZJ_RS00810"
                     /old_locus_tag="ABZJ_00149"
     CDS             174417..174725
                     /locus_tag="ABZJ_RS00810"
                     /old_locus_tag="ABZJ_00149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000051228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family transcriptional regulator"
                     /protein_id="WP_000051231.1"
                     /db_xref="GI:445973376"
                     /translation="MSLEQQLIERLQTLAPSYLEVINESAGHGGYFPGKESHFKVIVV
                     SEEFNGLRLVQRHQKVYALASDLMNPGQIHALAIHAYLPSEWQGQAPASPECAHAPKS
                     "
     gene            174744..175136
                     /locus_tag="ABZJ_RS00815"
                     /old_locus_tag="ABZJ_00150"
     CDS             174744..175136
                     /locus_tag="ABZJ_RS00815"
                     /old_locus_tag="ABZJ_00150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000387256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000338677.1"
                     /db_xref="GI:446260822"
                     /translation="MDAHLLTKIIHMTAVAAALMVFVLRASTLFIGVQGEQPNPAGRK
                     VLVALQHLSFTVVFITGAILLVMKNFQVQPWFYAKIILFLVLLSSLMKAFKKDDTILL
                     AQRRAGLVISAIAFVAIIILVIVKPVFA"
     gene            175213..176055
                     /locus_tag="ABZJ_RS00820"
                     /old_locus_tag="ABZJ_00151"
     CDS             175213..176055
                     /locus_tag="ABZJ_RS00820"
                     /old_locus_tag="ABZJ_00151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005049075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_000957992.1"
                     /db_xref="GI:446880736"
                     /translation="MLTRVVFNQKGGVGKSSITVNLAAISAKHGLRTLVIDLDPQANS
                     SQYLLGEEATYAADKAVLEPNIENFFEDVLGNNQQKGLIGNALGSILKAPRNKDLDSF
                     VHSTSFAKLDVLPASPTLGTLEHALESKHKIYKLRDSIQSLVGRYDRIYIDTPPAFNF
                     FTLSALIAADKVLIPFDCDVFSKRALQTLIENVLETQDDHNDRLEIEGIVVNQFQSQA
                     KLPREVVQQLKDEGLPVLNSMLPPSILMKESHQKNLPLAHLAPEHKLTQSYEALFSEI
                     EPKR"
     gene            176066..176452
                     /locus_tag="ABZJ_RS00825"
                     /old_locus_tag="ABZJ_00152"
     CDS             176066..176452
                     /locus_tag="ABZJ_RS00825"
                     /old_locus_tag="ABZJ_00152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002009349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000677531.1"
                     /db_xref="GI:446600185"
                     /translation="MKGLYIVPLAAATLLLSACATTVKPTYVSPTQYQSLSCQQLQSE
                     YNRIQQYIDNGVQTPKSTGMGVGLGLGGGWGRGGWGFGPSISVNMGQSSSTKNTELSR
                     VLGQQEAIVQAAQFKNCPIIVRKKTN"
     gene            176668..177258
                     /locus_tag="ABZJ_RS00830"
                     /old_locus_tag="ABZJ_00153"
     CDS             176668..177258
                     /locus_tag="ABZJ_RS00830"
                     /old_locus_tag="ABZJ_00153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000573142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine transporter RhtB"
                     /protein_id="WP_000573138.1"
                     /db_xref="GI:446495284"
                     /translation="MIESWFFVLAMLAVLLIPGPTNALLATAAHSQGLSKTFWLIPME
                     WLGYAYGISFWAVFIHLADPVWPALLLILHITSVLYVFWMAFRLWKTKHLQQFSQNHR
                     NIRPRQLFFSTLKNPKSLLFAAGIFPTETWNSPENFLMVLAAFTLILIPAASFWMFFG
                     RALLTGSMKKIKADHLYKGSAMLLILCMLPVVFRFF"
     gene            complement(177266..177907)
                     /locus_tag="ABZJ_RS00835"
                     /old_locus_tag="ABZJ_00154"
     CDS             complement(177266..177907)
                     /locus_tag="ABZJ_RS00835"
                     /old_locus_tag="ABZJ_00154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000421343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome O ubiquinol oxidase"
                     /protein_id="WP_000421342.1"
                     /db_xref="GI:446343487"
                     /translation="MELLDFILHVDQHLAEFITNYGTWIYGILFLIIFVETGLVVMPF
                     LPGDSLLFAAGALAASTGTMDPWLLGILLFIAAVLGDTVNYHIGRFIGPRVFEMNSRF
                     INKQHLIKTQEFFARHGGKTIIFARFIPFARTFAPFVAGAGSMNYKFFLTYNIIGAFC
                     WVASFVTLGYLFGGHPLVKDNFTHLIFGIIIISILPGVIGFIRQKLKNRKANV"
     gene            178101..178538
                     /locus_tag="ABZJ_RS00840"
                     /old_locus_tag="ABZJ_00155"
     CDS             178101..178538
                     /locus_tag="ABZJ_RS00840"
                     /old_locus_tag="ABZJ_00155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016142516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000483005.1"
                     /db_xref="GI:446405150"
                     /translation="MFNPNVVVKNIVTQLGADSFISLVARLLIAYIFLAAGWGKITGY
                     AATAGYMEAMGVPGGLLPLVILVEFGGGLALLFGFQARFAAFGLGIFSILTAFLFHQG
                     GADAAAQYNNGIHFMKNLAMAGGLFFLMLHGAGRISLDHAIEK"
     gene            complement(178598..179827)
                     /locus_tag="ABZJ_RS00845"
                     /old_locus_tag="ABZJ_00156"
     CDS             complement(178598..179827)
                     /locus_tag="ABZJ_RS00845"
                     /old_locus_tag="ABZJ_00156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017725337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000942220.1"
                     /db_xref="GI:446864964"
                     /translation="MLQTMIADFQQHFWLYVSIPFMSGLIGYVTKVIAIQMMFSPLEF
                     KGIKPFFGWQGIVPRKAEKMATTAVELMTAKLIKPEEIFARLDPKRIAKEIEKPLMAA
                     AEDITREVAQEYQPGLWEGMPEFARQRLIRRVQSKAPEIVEHIMSEVQRDVNRYFDIK
                     HLVISNLLKDKRLLNNIFKRVGKQEFKFFSNVGFVFGFGIGVIQMLCWIVTQGKYPWM
                     LPLFGGFVGFFSDWIALQMMFRPLYPKKILGYTWQGLFIKRQNEVAADYAALISKQLL
                     TSRHMMEELFSGTHSARVIELVNRHVKQEIDMQAGVIRPLVVYAIGGEKYQNMKTQVA
                     ERIMQQLPETMKYVESYAEDAMNIRNTLIERMQKLTPSEFEGMLRPAFKEDEWALIAV
                     GAVLGFVVGELQIQFML"
     gene            180203..181771
                     /gene="guaA"
                     /locus_tag="ABZJ_RS00850"
                     /old_locus_tag="ABZJ_00157"
     CDS             180203..181771
                     /gene="guaA"
                     /locus_tag="ABZJ_RS00850"
                     /old_locus_tag="ABZJ_00157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005154414.1"
                     /note="contains glutamine-hydrolyzing domain and glutamine
                     amidotransferase; GMP-binding domain; functions to produce
                     GMP from XMP in the IMP pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="WP_000210750.1"
                     /db_xref="GI:446132895"
                     /translation="MTTNTQITEDRILILDFGSQYSQLIARRVREAGVYSEMYAFDMS
                     EEDIRAFKPNGIILSGGPESVHEEGSPRAPQVVFELGVPVLGICYGLQTMSEQLGGKV
                     EPGTVHEFGYAEVDIVKRDQLIGNLQDRENQLHVWMSHGDKVSQIPEGFTITASTPSC
                     PVAAVSDETRRFYGVQFHPEVTHTAKGEELLSNFVHKICGCGGLWTPEHIIDLRVEQL
                     REQIGNEKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMQMFAE
                     NMGIRVIRADAEARFLNALAGVTDPEAKRKIIGREFIEVFAEEARKLDGVKFLAQGTI
                     YPDVIESAASKQGKAHVIKSHHNVGGLPDDLAFELVEPLRDLFKDEVRKLGTTLGLPH
                     SMIYRHPFPGPGLGVRILGEVKKEYADILRLADDIFMQELRDSGWYDKTAQAFAVFQP
                     VKSVGVVGDGRRYAWVIALRAVETVDFMTARFAHLPYELVDKISTRIMNEIKDVSRVV
                     YDVSSKPPATIEWE"
     gene            181837..182625
                     /locus_tag="ABZJ_RS00855"
                     /old_locus_tag="ABZJ_00158"
     CDS             181837..182625
                     /locus_tag="ABZJ_RS00855"
                     /old_locus_tag="ABZJ_00158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004843626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylyltransferase"
                     /protein_id="WP_001279061.1"
                     /db_xref="GI:447201805"
                     /translation="MSDFIQLEYLQEKLQQLLAESLFAIYLYGSAVDGGLGPESDLDV
                     LVVVTQPLTSALREQLAQELLKISQPVGELQRPLEVTILLKDEIQSGNYPLSYEMQFG
                     EWLREELKEGGTLSSQKDPDISILLRKARFHHAVLFGPALDQWAPEISDQELWQAMSD
                     TYPEIVAHWDEDADERNQILALCRIYFSLVMKDIASKDNAARWVKSQLPPEQKFVLQR
                     LIQEYRGEIGKQNWQEEHYALQPIVNFLSSKIEEQFEQKRNLIT"
     gene            182847..183374
                     /locus_tag="ABZJ_RS00860"
                     /old_locus_tag="ABZJ_00159"
     CDS             182847..183374
                     /locus_tag="ABZJ_RS00860"
                     /old_locus_tag="ABZJ_00159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004711067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_001249774.1"
                     /db_xref="GI:447172518"
                     /translation="MRQQSEHHHAEHNDHHHAHHRSGRRGRLFEAGRMKLLVLHLIQQ
                     SPKHGYEIIKEISDLVGDGYTPSAGTIYPTLTSLEEMNLINLLDVERKQYQITEFGEA
                     YLNEHQDKLSGLLEKLRLRREIHSNDQLIEIHRAMENLKTALRLKLNTTELKQEQIYQ
                     IAEKIDQAAVAIGRL"
     gene            183435..183740
                     /locus_tag="ABZJ_RS00865"
                     /old_locus_tag="ABZJ_00160"
     CDS             183435..183740
                     /locus_tag="ABZJ_RS00865"
                     /old_locus_tag="ABZJ_00160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004967019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000809281.1"
                     /db_xref="GI:446732025"
                     /translation="MKQHQYHVTVQHLKDAKGEVSTYTERLEFYTGNHDDIFEIVEKL
                     KKAEFFDDQTTKSFAVGLKLFSEVMLENRDHPLFQEFLPQFGQFMKNLKQQVKTQSP"
     gene            183897..184844
                     /locus_tag="ABZJ_RS00870"
                     /old_locus_tag="ABZJ_00161"
     CDS             183897..184844
                     /locus_tag="ABZJ_RS00870"
                     /old_locus_tag="ABZJ_00161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002124746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quercetin 2,3-dioxygenase"
                     /protein_id="WP_000069626.1"
                     /db_xref="GI:445991771"
                     /translation="MSNNNDYDISDSKDCEKFANQFIQEFPIRSAEIGQGTVIKRALP
                     SRQKRMIGAWCFLDHAGPVTFPAGNGLDVGPHPHIGLQTFTWMIEGTMMHTDSLGSKQ
                     LIRPKQVNLMTAGHGISHTEVAPDTETQMHAAQLWIALPDHKRNMDPKFEHYPDLPVV
                     EKDGLEFTVLVGEYLETTSPVVVHTPLVGVDLIATQDTKTRIPLNPEFEYGFMALDGV
                     AHVNGHELTADNMVVLDTGLNEIEIEVKKGNRVLLIGGEPFETPILLWWNFVARTMDD
                     LKEAREQWVNHDVRFGEIPDYVGARLEAPVLPDQMRASK"
     gene            184841..185248
                     /locus_tag="ABZJ_RS00875"
                     /old_locus_tag="ABZJ_00162"
     CDS             184841..185248
                     /locus_tag="ABZJ_RS00875"
                     /old_locus_tag="ABZJ_00162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002061909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="osmotically inducible protein C"
                     /protein_id="WP_000127662.1"
                     /db_xref="GI:446049807"
                     /translation="MTAVIASSKAKPLAEQWKGEITSGRHQYFCDEPEKLEGHDQGPA
                     PYDLLTGSLAACTLITLRMYAKHKGYDFGEYSVEIDFHTNREHEEHIERRIVFKELPN
                     EELQQKILTICSKTPVTKTLLRSLDIHTVLVTA"
     gene            185361..186029
                     /locus_tag="ABZJ_RS00880"
                     /old_locus_tag="ABZJ_00163"
     CDS             185361..186029
                     /locus_tag="ABZJ_RS00880"
                     /old_locus_tag="ABZJ_00163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000626446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_000626445.1"
                     /db_xref="GI:446549099"
                     /translation="MISVHHLECSRSFRILWALEELGLDYDIHFYQRLPNYSAPETLK
                     CIHPLGKAPILTDDEQVIAESAVILEYLQQRYDQKQQFKPKQAQDLQQYIYWMHYAEG
                     SLMPLLVMTLVMNNVNKHVPWLIQPVAKKITEGVKANFVRPRMKDHISFLENYLAEHE
                     YFAGDFSFADIQMSFPLEALQSRLQGKYPHIQAFLHRIQQRPAFQKARQKGLGSNERN
                     CADI"
     gene            complement(186073..186699)
                     /locus_tag="ABZJ_RS00885"
                     /old_locus_tag="ABZJ_00164"
     CDS             complement(186073..186699)
                     /locus_tag="ABZJ_RS00885"
                     /old_locus_tag="ABZJ_00164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000467258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein"
                     /protein_id="WP_000467261.1"
                     /db_xref="GI:446389406"
                     /translation="MFGKTQRGVSERPNKPKKPLIPKWLGTLVAILAVLCIAVMLMLW
                     KPWQPVSSKNQITSEHYKEEETNKDYRFYDLLPQQQVTPIPEQAIPESKNQGTAMIVE
                     APSTAQPAASEPASVSTDDTTDSTAAIPQQPNYILQVRSYTDPDQADARRAEIILNGL
                     SADVIKSSENGKTWYRVISGPYDTQEAALAAQQTLQHSGIDSIVIKRK"
     gene            complement(186853..188643)
                     /gene="argS"
                     /locus_tag="ABZJ_RS00890"
                     /old_locus_tag="ABZJ_00165"
     CDS             complement(186853..188643)
                     /gene="argS"
                     /locus_tag="ABZJ_RS00890"
                     /old_locus_tag="ABZJ_00165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017725340.1"
                     /note="catalyzes a two-step reaction, first charging an
                     arginine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; class-I aminoacyl-tRNA
                     synthetase; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginyl-tRNA synthetase"
                     /protein_id="WP_001090284.1"
                     /db_xref="GI:447013028"
                     /translation="MNTAIQAALDHAVQTLQQEGVLPSDWNNSSNLTRTKDRSHGDFA
                     SNIAMIGSKAAGMKPRDLAEKILAALPEVADISKAEIAGPGFINFFLNADQRFAILDQ
                     IQAQKESFGRSQSNAAKKIQVEFVSANPTSSLHVGHGRGAAYGMTVANLLEATGAKVD
                     REYYVNDAGRQMDILATSTYLRYLELLGQNLVFPKNAYQGDYVKEIAQGIIDKDGDAY
                     VREVANVYKDVPEDVQYAEELDSEGNKVVLSGDKEKHIDGLIANSQQLLGEGYRVFHQ
                     AALHAILDDIKDDLADFGVTFNQWFSEASLSAKIDEALETLDQRGFLYEKDGNIWFKS
                     TEFGDEKDRVVKRRNGQTTYFASDIAYHLNKLQRGYTDLVDIWGSDHHGYISRVKAAI
                     DAMGYDSKKLTVLLVQFVSLWRGGEMVQMSSRSGQFVTLRDLRKEVGNDAARFYYVMR
                     KSEQHIDFDLDLAVSQSKDNAVYYIQYAHARICRMLEKAASTGLQFEVSAARSHAARL
                     SLDAETEILAKLAAYPDVVLRAANAYEPHQVGNYLKELAALFHGWYNEHKVLSDDAEL
                     TQARLLLSINVQQVLRNGLELLGVSAPEAM"
     gene            189139..190836
                     /locus_tag="ABZJ_RS00895"
                     /old_locus_tag="ABZJ_00166"
     CDS             189139..190836
                     /locus_tag="ABZJ_RS00895"
                     /old_locus_tag="ABZJ_00166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000623107.1"
                     /note="malic enzyme; oxaloacetate-decarboxylating;
                     NAD-dependent; catalyzes the formation of pyruvate form
                     malate; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_000623101.1"
                     /db_xref="GI:446545755"
                     /translation="MISGHPSKHPLYIPYAGYTLLELPLLNKGSAFTQEERSNFNLHG
                     LLPHIIETIEEQSQRSYQQYCAFNDDINKHIYLRNIQDTNETLFYHLIENHLEEMMPI
                     IYTPTVGEACQRFSDIYRRHRGVFISYPDRDVIDDILQNVNKNNVKVIVITDGERILG
                     LGDQGIGGMGIPIGKLSLYTACGGISPAYTLPITIDVGTNNPQLLNDPIYMGWRQPRI
                     SGDEYYDFVDMVIEAVKRRWPKALIQFEDFAQKNAMPLLEKYRDKICCFNDDIQGTAA
                     VSVGSLIAASRAAGKQLKDQTIAFLGAGSAGCGIAEQIVAQMVSEGLTDAEARARVYM
                     VDRFGLITENQPNLLDFQRKLAQKAEVVDQWGNIEEVISLLDVVKNAKPTVLIGVSGQ
                     PGLFTEEIIKTMAANCERPIVMPLSNPTSRVEAVPADIVEWTEGKALIATGSPFAPVN
                     HHGKLYNISQCNNSYIFPGIGLGVVASGAKRVTENMLMASSSALADCSPLLKDPQADL
                     LPPLGEIQQVSKVIAFEVAKAAMADGVAVTISDDLLKQKIDQSFWKPEYRKYKRIPF"
     gene            191080..191523
                     /locus_tag="ABZJ_RS00900"
                     /old_locus_tag="ABZJ_00167"
     CDS             191080..191523
                     /locus_tag="ABZJ_RS00900"
                     /old_locus_tag="ABZJ_00167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000790523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000790522.1"
                     /db_xref="GI:446713178"
                     /translation="MKNIYILIFIGALIACSDKGTDKNQHNSNHKLDVVQTETNKSQS
                     VVGENQENTDKTVKTKEADQVAQFSCSNPNITQWYGFNENIAEPKCEVVKNFQLKAYK
                     CDISKNAFGASKDAILLENQDKRIFVYSTSKDCNEMLEVRNANAP"
     gene            complement(191663..192583)
                     /locus_tag="ABZJ_RS00905"
                     /old_locus_tag="ABZJ_00168"
     CDS             complement(191663..192583)
                     /locus_tag="ABZJ_RS00905"
                     /old_locus_tag="ABZJ_00168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000126808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxidase"
                     /protein_id="WP_000126808.1"
                     /db_xref="GI:446048953"
                     /translation="MTAQSVILPLPSDHARFIVLRLKDLTIAELKEQLEALFETRDRL
                     ITQHSDAQIKTAVAFGPELWKQLYSQSPAGFKQLEPENGAFNMPVVPADVLIHIASMR
                     SDICFALSQAFFEGIKDKVEVLDERVCFRYFDGRDITGFIDGTENPQFPDDRAETALL
                     PESAGVFADGSFIFAQRYAHDLEKWKKLKVDAQENVMGRTKLESIELDDDVKPENAHV
                     ARTVVEDEEGEEMEILRHSLPYGDGRGDQGLFFIAYTKDLSIIDAMLKRMFGTSGDGI
                     HDRLLHFVTPLDGAYYFAPSEELLEEILEE"
     gene            192742..193368
                     /locus_tag="ABZJ_RS00910"
                     /old_locus_tag="ABZJ_00169"
     CDS             192742..193368
                     /locus_tag="ABZJ_RS00910"
                     /old_locus_tag="ABZJ_00169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine transporter RhtB"
                     /protein_id="WP_000058354.1"
                     /db_xref="GI:445980499"
                     /translation="MSLQVWFAYMLACWVISISPGAGAIASMSSGLNYGFRHGYWNAI
                     GLQIALLIQIMIVAAGVGVLFATTPLAFQAVKWFGVAYLLYLAYLQWTAPVKDIEIQH
                     EKKDKSVSALLLNGFVVNISNPKAIVFLLAVLPQFLDLSKPQWIQYLIMAATMVTIDL
                     IVMAGYTGLASKVLRLLRSPKQQKYLNRGFAVMFSCAALLLSTVHQAA"
     gene            complement(193370..194179)
                     /locus_tag="ABZJ_RS00915"
                     /old_locus_tag="ABZJ_00170"
     CDS             complement(193370..194179)
                     /locus_tag="ABZJ_RS00915"
                     /old_locus_tag="ABZJ_00170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000970832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein HhH-GPD"
                     /protein_id="WP_000970834.1"
                     /db_xref="GI:446893578"
                     /translation="MMEWLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHG
                     TLLGVAIAGALSLPLWLGVAGTAILLVAILWALHDNRLPNDALLALCSATLLCSGLLF
                     IQHVPSLRPELLSYLFGDLLSIDWPDLPVFTLIIAVSLAILYRFWQPQIQIAIDPDIA
                     ISEGVNAKWQRLIFMLLLALFTVLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIW
                     AFVLAQLGVSVGLWSSAALNISTGLSIVLCMALSFALIFMVQKIKNQTQAA"
     gene            complement(194183..194971)
                     /locus_tag="ABZJ_RS00920"
                     /old_locus_tag="ABZJ_00171"
     CDS             complement(194183..194971)
                     /locus_tag="ABZJ_RS00920"
                     /old_locus_tag="ABZJ_00171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001112012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter ATP-binding protein"
                     /protein_id="WP_001112013.1"
                     /db_xref="GI:447034757"
                     /translation="MPAVPHSSLNPVLIQLEQVSVHRDQRDILKKVDFALHENEIVTL
                     IGPNGAGKSTLIKVLLGILKPSSGRVISNKKLKMAYVPQKFNPSHSLPLRVQDLLDLE
                     KCSPALRQEIIQDTGIAKLQQSKVQQLSGGERQRVLLARALLRKPDILVLDEPMQGLD
                     IQSEAELYEYVRSLPERYGCAILIVSHDLQWVMQGTQRVVCLNKHICCSGLPESIQQH
                     PEYQAIFGTQRVFYQHHHDHCAHGDAAHPCPHNSRPHIHPEPEA"
     gene            complement(194944..195441)
                     /locus_tag="ABZJ_RS00925"
                     /old_locus_tag="ABZJ_00172"
     CDS             complement(194944..195441)
                     /locus_tag="ABZJ_RS00925"
                     /old_locus_tag="ABZJ_00172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_000093118.1"
                     /db_xref="GI:446015263"
                     /translation="MSSCMHEHHDSLHGVHDHHNVASRLAEAETLCTAVGARLTPLRK
                     EVLELILNASGPMGAYDLLARIKSQTDRPAAPPTVYRTLDFLLEKGLIHRLTSINAYI
                     PCCHPREGHQAAFLICTECHTVKEASSQGLTQQLDQLAALDDFAAQHSIIEISGKCQQ
                     CRTAR"
     gene            195569..196408
                     /locus_tag="ABZJ_RS00930"
                     /old_locus_tag="ABZJ_00173"
     CDS             195569..196408
                     /locus_tag="ABZJ_RS00930"
                     /old_locus_tag="ABZJ_00173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000490208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein HhH-GPD"
                     /protein_id="WP_000490203.1"
                     /db_xref="GI:446412348"
                     /translation="MFRVFVFSLFSLMSTLGWSQGLVVSTHPIYLIAKEITKGVEEPQ
                     LLLQGQSGHDVQLTPAHRKAINDASLVIWLGKAHEAPLNKLLSNNKKAIALLDSGILS
                     ILPQRNTRGAALPNTVDTHVWLEPNNAVRIGFFIAALRSQQHPENKAKYWNNANTFAR
                     NMLQAAQAYDSSSNGKPYWSYHDAYQYLERSLNLKFAGALTDDPHVAPTAAQIKYLND
                     SRPKAQMCLLAESFTTKGQYQKLGSITFQPVDESMNNEDNFVTAWKKLAIKTDKCVLN
                     TQK"
     gene            196578..196976
                     /locus_tag="ABZJ_RS00935"
                     /old_locus_tag="ABZJ_00174"
     CDS             196578..196976
                     /locus_tag="ABZJ_RS00935"
                     /old_locus_tag="ABZJ_00174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013199183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit I"
                     /protein_id="WP_000084237.1"
                     /db_xref="GI:446006382"
                     /translation="MSQTSRLIDRRLAKALVFLQACMIPVSALVAWSIKDMTAALSAA
                     LGALVCWLATSYFAWQSFRTAGARASKQVLSNMYRGMLGKFAIMIVGFILILSNVKPL
                     SPLALLFGFILVQAMSWVAPFWVSRLQKRV"
     gene            197081..197956
                     /locus_tag="ABZJ_RS00940"
                     /old_locus_tag="ABZJ_00175"
     CDS             197081..197956
                     /locus_tag="ABZJ_RS00940"
                     /old_locus_tag="ABZJ_00175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004773235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit A"
                     /protein_id="WP_000718586.1"
                     /db_xref="GI:446641240"
                     /translation="MAAEEHALTSTEYIKHHLTNMTYGKMPDGTWKLAETAEEAHSMG
                     FTAIHLDSMGWSIGLGVIFCLLFWIVARAANAGVPTKFQSAIEMIIEFVDSSVRDTFH
                     GKSRLIAPLALTIFVWIFLMNLMDLIPVDWIPQVAAFVGANVFGMDPHHVYFKIVPST
                     DPNITLGMSLSVFVLILFYSIREKGVGGFVGELALNPFNPSNPVAKALLIPVNLILEL
                     VTFLARPISLALRLFGNMYAGELIFILIALLPFWIQWALSVPWAIFHILVITLQAFIF
                     MMLTIVYLSMASEKH"
     gene            198041..198286
                     /locus_tag="ABZJ_RS00945"
                     /old_locus_tag="ABZJ_00177"
     CDS             198041..198286
                     /locus_tag="ABZJ_RS00945"
                     /old_locus_tag="ABZJ_00177"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6FFK5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit C"
                     /protein_id="WP_000424060.1"
                     /db_xref="GI:446346205"
                     /translation="MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPEL
                     APQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFVG"
     gene            198325..198795
                     /locus_tag="ABZJ_RS00950"
                     /old_locus_tag="ABZJ_00178"
     CDS             198325..198795
                     /locus_tag="ABZJ_RS00950"
                     /old_locus_tag="ABZJ_00178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016654736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit B"
                     /protein_id="WP_001024691.1"
                     /db_xref="GI:446947435"
                     /translation="MNINLTLIGQAIAFAFFVAFCMKFVWPPLINAISERQRKIADGL
                     NAAEKAKADLADAQAQVKQELDAAKAQAAQLIEQANRRAAQLIEEARTQAAAEGERIR
                     QQAKEAVDQEINSAREELRQQVAALAVTGAEKILNQQVDAEAHNAMLSQLAAKL"
     gene            198808..199344
                     /locus_tag="ABZJ_RS00955"
                     /old_locus_tag="ABZJ_00179"
     CDS             198808..199344
                     /locus_tag="ABZJ_RS00955"
                     /old_locus_tag="ABZJ_00179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004941560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit delta"
                     /protein_id="WP_000818995.1"
                     /db_xref="GI:446741739"
                     /translation="MAELLTLARPYAKAAFAYASEQGATDNWSNALQVLSAAVQDEAF
                     SAYLNRPELTPAEQVKLFAKVLGEDQSQAVSNFLTLLADNDRLVLLPEIAAEYEQLKS
                     QNNNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTVSVEVKPELIAGVVIRAGDQV
                     IDDSALNKLEKMRTRLLA"
     gene            199391..200935
                     /locus_tag="ABZJ_RS00960"
                     /old_locus_tag="ABZJ_00180"
     CDS             199391..200935
                     /locus_tag="ABZJ_RS00960"
                     /old_locus_tag="ABZJ_00180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005403950.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the alpha chain is a
                     catalytic subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit alpha"
                     /protein_id="WP_001186635.1"
                     /db_xref="GI:447109379"
                     /translation="MQQLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHG
                     LADAMYGEMIEFDGGLFGMALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGP
                     ELLGRVVDALGNPIDGKGPIDAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPV
                     GRGQRELIIGDRQTGKTAMAIDAIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGA
                     MAYTTVVAAAAADPAAMQYLAPYSGCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISL
                     LLRRPPGREAYPGDVFYLHSRLLERASRVSAEYVEKFTNGAVTGKTGSLTALPIIETQ
                     AGDVSAFVPTNVISITDGQIFLETSLFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSG
                     GIRTALAQYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPYSIADQAVSVY
                     ASNEGYMADVEVKKIVDFDAALIAYFRSEYAPLMKQIDETGDYNKDIEAAIKAGIESF
                     KATQTY"
     gene            201013..201882
                     /locus_tag="ABZJ_RS00965"
                     /old_locus_tag="ABZJ_00181"
     CDS             201013..201882
                     /locus_tag="ABZJ_RS00965"
                     /old_locus_tag="ABZJ_00181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018678429.1"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. The gamma chain is a
                     regulatory subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit gamma"
                     /protein_id="WP_001284971.1"
                     /db_xref="GI:447207715"
                     /translation="MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRP
                     YADNMRRVIAHLVQANPEYKHRYMVDRPVKRVGYIIVSSDRGLAGGLNINLFKKVVQH
                     VKAQQEQSIEVQFALIGQKAVSFFKNYGGKVLGATTQIGDAPSLEQLTGSVQVMLDAF
                     DKGELDRIYLVSNGFVNAMTQKPKVEQLVPLAPAEEGDDLNRTYGWDYIYEPEAEELL
                     NGLLVRYIESMVYQGVIENVACEQSARMVAMKAATDNAGQLIKDLQLIYNKLRQAAIT
                     QEISEIVGGAAAV"
     gene            201913..203307
                     /locus_tag="ABZJ_RS00970"
                     /old_locus_tag="ABZJ_00182"
     CDS             201913..203307
                     /locus_tag="ABZJ_RS00970"
                     /old_locus_tag="ABZJ_00182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010117196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit beta"
                     /protein_id="WP_000094481.1"
                     /db_xref="GI:446016626"
                     /translation="MSSGRIIQIIGAVIDVEFERTSVPKIYDALQVDGTETTLEVQQQ
                     LGDGVVRTIAMGSTEGLKRGLTVTSTNAPISVPVGTATLGRIMDVLGRPIDEAGPVAT
                     EERLPIHRQAPSYAEQAASTDLLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMME
                     LINNIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRV
                     ALTGLTMAEYFRDEKDENGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTL
                     AEEMGVLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASSG
                     IYPAIDPLDSTSRQLDPLVVGQEHYEIARAVQNVLQRYKELKDIIAILGMDELAEEDK
                     LVVYRARKIQRFFSQPFHVAEVFTGAPGKLVPLKETIRGFKGLLAGEYDHIPEQAFYM
                     VGGIDEVIAKAEKL"
     gene            203325..203744
                     /locus_tag="ABZJ_RS00975"
                     /old_locus_tag="ABZJ_00183"
     CDS             203325..203744
                     /locus_tag="ABZJ_RS00975"
                     /old_locus_tag="ABZJ_00183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004705935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit epsilon"
                     /protein_id="WP_000224542.1"
                     /db_xref="GI:446146687"
                     /translation="MATMQCDVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTL
                     LQPGPIRVLLENGTEEIVYVSGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAE
                     QLLANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ"
     gene            complement(203805..204404)
                     /locus_tag="ABZJ_RS00980"
                     /old_locus_tag="ABZJ_00184"
     CDS             complement(203805..204404)
                     /locus_tag="ABZJ_RS00980"
                     /old_locus_tag="ABZJ_00184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002163354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000757152.1"
                     /db_xref="GI:446679806"
                     /translation="MKKVLQGAFFPFVIFASGMLLLGCDQTQDHAKEQESVQTNDQIS
                     DQADDSQQEITATQNKTELKNGNVFYIVRDAANLQLKAGDYIEKLKDTQLDVEQAIQD
                     KDQHELKTTVTTLKAQLEGLNQALLGLDIRSQEVENIRQSLLQANQQALSMPLLNGKL
                     EQINFDQIEKQLNTIQMDMVKLAAMIMAGDEKSDSKTDS"
     gene            complement(204549..205094)
                     /locus_tag="ABZJ_RS00985"
                     /old_locus_tag="ABZJ_00185"
     CDS             complement(204549..205094)
                     /locus_tag="ABZJ_RS00985"
                     /old_locus_tag="ABZJ_00185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005037441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="WP_000194676.1"
                     /db_xref="GI:446116821"
                     /translation="MTQSVYHIPVKAISGETVDLDQYKGKVLLIVNTASKCGLTPQYE
                     GLEKLYQAKKDQGLEILGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGE
                     DKHPLYQALTTAQPERIGEGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVVARF
                     APNLTADDEQIVKAVEAELAK"
     gene            complement(205217..205981)
                     /locus_tag="ABZJ_RS00990"
                     /old_locus_tag="ABZJ_00186"
     CDS             complement(205217..205981)
                     /locus_tag="ABZJ_RS00990"
                     /old_locus_tag="ABZJ_00186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017725342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_000786954.1"
                     /db_xref="GI:446709608"
                     /translation="MKNEDQQFSLLESIEVHEFLYEKEDIVRPHASLWGDFNFSLNGI
                     LEIQVEEQIYLSPPSYGLWIPPQTVHQSTHIDHEIHYICIRLHPRLCSILGDICRCFS
                     IQPFFRTLVLQILEQQKQTEKPEYLEHLLQVLFDQLQQAPAYSHYLPQTRHPVLLPIL
                     EKLSDPLLFNLSLQQLLQNFSVSDRHLLRLSQQELQLSLSEWRNRAKIVYAIHQIRQG
                     TPIKRLAYDLGYQHSSSFIEFFKRYTGQTPVQIRNN"
     gene            complement(206003..207217)
                     /locus_tag="ABZJ_RS00995"
                     /old_locus_tag="ABZJ_00187"
     CDS             complement(206003..207217)
                     /locus_tag="ABZJ_RS00995"
                     /old_locus_tag="ABZJ_00187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004705931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_000372838.1"
                     /db_xref="GI:446294983"
                     /translation="MDQSTTSKARPMTSTQGSWFAILAVAIAAFALVTSEFLPVGVLN
                     SVAADLHISVGTAGLIITVPGIMAAIAAPLLPVSVKQLDRRYVLILLTAIMVIANTIT
                     AFAENFHVLLLSRLILGISIGGFWATAIALSGKLAPANLPIAKATAVVMAGVTFATVL
                     GVPIGTWLSEFYGWRSAFGITAAIGLVVLVLQLIFLPKLLPESAIHIRDLPALLRTPK
                     ARSGMLIVLLIGLAHFCAYSYLAPFFKNVAGFNGTTISSLLLLYGIAGIFGNAFAGYS
                     GNLNVRYTLAFVGTCFAIVFFGFPIFAIHEFGAIVLTALWGFAFGAFPTSANIWMFVH
                     APHAVEKGMPLFVGMFQVMIATGSLLGGYVVDHFNENTLIYGVLSFVALALISTFTLA
                     KGLNNPKATCEN"
     gene            207363..208004
                     /locus_tag="ABZJ_RS01000"
                     /old_locus_tag="ABZJ_00188"
     CDS             207363..208004
                     /locus_tag="ABZJ_RS01000"
                     /old_locus_tag="ABZJ_00188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000184769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_000184769.1"
                     /db_xref="GI:446106914"
                     /translation="MTNRHETDLVNEDTLKKKRGRPKCFDEQQVLEKAMLLFWEHGYE
                     ATSISDLTHALEITAPSLYSAFGDKAGLFYKSIDYYLAHEACPIETIFLEAKTAKIAF
                     ELYLYDNVKRLVQPNKPAGCMLVVAAMNCSDATQEVQQNLLDKRIKTKEKLLKRLEQG
                     VEQGDLPTNAPLQEMTDFYATVIQGLTIQARDGASTEQLHKVVEHAMKAWTLF"
     gene            208122..209030
                     /locus_tag="ABZJ_RS01005"
                     /old_locus_tag="ABZJ_00189"
     CDS             208122..209030
                     /locus_tag="ABZJ_RS01005"
                     /old_locus_tag="ABZJ_00189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005124872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug DMT transporter"
                     /protein_id="WP_000873721.1"
                     /db_xref="GI:446796465"
                     /translation="MKYHKWAFIFPILAVLIWSLNIVVTRYVSDYISPVSISFYRWLI
                     AFIILTPFMFLSVWRQRRLVIPYLPKLAVLSAFGMVLYQGLAYTAAHYTSATNMGIVN
                     AFIPIFTIFVSLAILKDVPNRFAVFGSILSFAGLLYVMSQGNINKLLSGGGHLGDALM
                     IIAVFFYAFYGVFLKKWQLSLPIMTSLYVQIGFSVLFHLPLIFWFGLDALNAQNAPSA
                     IYAGVFASLIAPLVWMLAVQQLGPNRTSIFMNLVPVFTAIIASIWLSEQWTIYHTFGG
                     IMILVGIIMAQKKVNSKKSDLLPEQN"
     gene            complement(209422..209991)
                     /locus_tag="ABZJ_RS01010"
                     /old_locus_tag="ABZJ_00190"
     CDS             complement(209422..209991)
                     /locus_tag="ABZJ_RS01010"
                     /old_locus_tag="ABZJ_00190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019458003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA threonylcarbamoyladenosine biosynthesis
                     protein RimN"
                     /protein_id="WP_000633612.1"
                     /db_xref="GI:446556266"
                     /translation="MITTSVTEAAECLQQGQVLAYPTEAVWGLGCDPFNEQAFQKILE
                     LKQRPIEKGVILLAGHISQVEHLLTSLPQTTQQEIIDCWTNHQPSERATTWLLPADQH
                     IPSWIKGEHPLVAVRVTTHPLCVALCNAFHGFIVSTSANPSGQEPAHSLQDACQYFGS
                     QLNYLNGDLGQSQQPSRIINALTGEVIRP"
     gene            complement(210042..211172)
                     /locus_tag="ABZJ_RS01015"
                     /old_locus_tag="ABZJ_00191"
     CDS             complement(210042..211172)
                     /locus_tag="ABZJ_RS01015"
                     /old_locus_tag="ABZJ_00191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000957666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_002017176.1"
                     /db_xref="GI:487943710"
                     /translation="MLTQLSSHHYHTLKVWYLVQHSLVSFKKIIDYFGNCEKATQPDG
                     LAKWSSLGLHANHLKRVNEFQTPQGQAQFEQLVQQVRQHTDFILTPDDSGYPTQLLPY
                     TDYPPIIFGKGQAQALLQPQIAIVGSRKPSPHGRQVAYDFAYYLSEKGFFISSGLAYG
                     IDEAAHQGASTHQRTIAVTGTGLDTTYPAQNKKLAEHILAKNGAIITEFLPGTPPLQQ
                     NFPRRNRIVSGLSLGVLVVEATLKSGSLITANKAAEQGKTVFAIPGHIYSEFHQGCHQ
                     LIREGAILIDHPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWVG
                     QNIDQLVVHHNIPVSELTSSLMELELLGLCMQQSGLYLRCRS"
     gene            complement(211193..212347)
                     /locus_tag="ABZJ_RS01020"
                     /old_locus_tag="ABZJ_00192"
     CDS             complement(211193..212347)
                     /locus_tag="ABZJ_RS01020"
                     /old_locus_tag="ABZJ_00192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004843596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein LysM"
                     /protein_id="WP_000755281.1"
                     /db_xref="GI:446677935"
                     /translation="MKKVFNGMVNFHALGIKKHLLALALCTGVAIGTIAEVHATSPNH
                     NPPSLKSNAPNVYVVKRGDTLWDISGHFLNKPWRWPEIWASNQHVKNPHWIYPGDRLL
                     LCSLDGRPLVGKDEGDGCVGIIRRYTGQTTNLQPQVRVEALNNSVPVIPLEHIKQWLE
                     NSTILPADSITNTPYIVGTADQRVLAGKGQTIYARGQGLINGQRYAVYREGEPYYFTD
                     NKGKKHSLGIELLQVASGVAVSSEKDITTLELTDSYNAEVRRGDRVMPEEQATLPTLF
                     YPVDAKQVTDGGKIIRVMGSIGRAAKNSVVTLDRGTTQGIQVGQVFDITQQGESIRDP
                     KTKEVIQLPGQQIGSLMVFRTFDQLSYAYVLESDLPIKVGSSIQPPQFND"
     gene            212470..213000
                     /locus_tag="ABZJ_RS01025"
                     /old_locus_tag="ABZJ_00193"
     CDS             212470..213000
                     /locus_tag="ABZJ_RS01025"
                     /old_locus_tag="ABZJ_00193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005094528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_001196539.1"
                     /db_xref="GI:447119283"
                     /translation="MALLPILSFPDPRLRTIAKPVEEVTDEIRQLAADMFETMYAAPG
                     IGLAASQVDRHIQLIVMDLSESKDEPMVFINPKVTPLTEETQPYEEGCLSVPQIYDKV
                     DRPSRVKIEAINLEGQAFEIEADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKV
                     EKIVRQREREKVAVKR"
     gene            213037..213465
                     /locus_tag="ABZJ_RS01030"
                     /old_locus_tag="ABZJ_00194"
     CDS             213037..213465
                     /locus_tag="ABZJ_RS01030"
                     /old_locus_tag="ABZJ_00194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000231983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000231985.1"
                     /db_xref="GI:446154130"
                     /translation="MVFRSGLLLACAAVFLQIAVFLQPLLPKQYQIAPVCETITRALL
                     KPKAQTEAMSHAMHHSHHQYHIEQAQVPDHHDHHDANHQCQYCTVYANLVLPPEFGIK
                     EVLVRIQVRLVAYQQAFRHVYFALQRLFLLPQGRAPPLFA"
     gene            213537..215650
                     /locus_tag="ABZJ_RS01035"
                     /old_locus_tag="ABZJ_00195"
                     /note="TonB-dependent receptor; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            215704..215910
                     /locus_tag="ABZJ_RS01040"
                     /old_locus_tag="ABZJ_00196"
     CDS             215704..215910
                     /locus_tag="ABZJ_RS01040"
                     /old_locus_tag="ABZJ_00196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017387367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000182542.1"
                     /db_xref="GI:446104687"
                     /translation="MTNKLSPEQSWWGWKLLIVASILSVLFMIIFYLAINNEPDYMPS
                     QKKKQMMESHEQMNHAEMHSSSAQ"
     gene            complement(215980..217194)
                     /locus_tag="ABZJ_RS01045"
                     /old_locus_tag="ABZJ_00197"
     CDS             complement(215980..217194)
                     /locus_tag="ABZJ_RS01045"
                     /old_locus_tag="ABZJ_00197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002018417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001177965.1"
                     /db_xref="GI:447100709"
                     /translation="MQMISPTRLASFNDMQDSNFFTQFLNICCGKPVQPNYKEYVSLQ
                     HALYEGDIEMDKVIDWVMQSPKDHRIIFEKILFQGRDEFSKPIPTELENFFNYIEQKP
                     DWLDQQQIDEAVKFTHRLGINNGFILRDLSLMAGYLYPGFNQPLILTGALKKEAGTRL
                     AETTKWWVDITEPQGLFRLSAGFTSTIYVRFIHALVRRQLKKSSRWDSEIWGIPLNQF
                     DLAMTNLAFSSVVLLGIRALGIWPTKQEAKSFLHFWRYVGWLMGIDEKWLIQSEPEGW
                     RLLYWMQFAHPRSDHSSIELGLSLSKEPFERKYLHLRSLQQKLAYRQHLELTQFFIGK
                     KRMKLLGLPQQSASWFAYYLIVRNLLLYNGAKLSPKVEKFLSKSGRNIQKLGLTLYQN
                     QGKAKTLASMHQ"
     gene            217283..217879
                     /locus_tag="ABZJ_RS01050"
                     /old_locus_tag="ABZJ_00198"
     CDS             217283..217879
                     /locus_tag="ABZJ_RS01050"
                     /old_locus_tag="ABZJ_00198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005124866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_001224032.1"
                     /db_xref="GI:447146776"
                     /translation="MRKAPQQQRSKIIVDHILEATQQCIAQYGLLHTTTPKIAEKSGV
                     SVGSIYQYFENKDQIIEELLRRKSELLGQQLKELVVRQGNIPLELLIPLAIELGFNAL
                     KADHGFFIEVLKHWHDYSHSQAAQILEKHFFEVGLYTFSRNPHQWDFEQVKHKSFVII
                     NSTLFTMMRYVSQNNFLISEQQLKRELSSMILAYLSQK"
     gene            218371..219914
                     /locus_tag="ABZJ_RS01055"
                     /old_locus_tag="ABZJ_rRNA4"
     rRNA            218371..219914
                     /locus_tag="ABZJ_RS01055"
                     /old_locus_tag="ABZJ_rRNA4"
                     /product="16S ribosomal RNA"
     gene            219969..220045
                     /locus_tag="ABZJ_RS01060"
                     /old_locus_tag="ABZJ_tRNA5"
     tRNA            219969..220045
                     /locus_tag="ABZJ_RS01060"
                     /old_locus_tag="ABZJ_tRNA5"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:220003..220005,aa:Ile,seq:gat)
     gene            220101..220176
                     /locus_tag="ABZJ_RS01065"
                     /old_locus_tag="ABZJ_tRNA6"
     tRNA            220101..220176
                     /locus_tag="ABZJ_RS01065"
                     /old_locus_tag="ABZJ_tRNA6"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:220134..220136,aa:Ala,seq:tgc)
     gene            220510..223426
                     /locus_tag="ABZJ_RS01070"
                     /old_locus_tag="ABZJ_rRNA5"
     rRNA            220510..223426
                     /locus_tag="ABZJ_RS01070"
                     /old_locus_tag="ABZJ_rRNA5"
                     /product="23S ribosomal RNA"
     gene            223593..223707
                     /locus_tag="ABZJ_RS01075"
                     /old_locus_tag="ABZJ_rRNA6"
     rRNA            223593..223707
                     /locus_tag="ABZJ_RS01075"
                     /old_locus_tag="ABZJ_rRNA6"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            223884..224426
                     /locus_tag="ABZJ_RS01080"
                     /old_locus_tag="ABZJ_00199"
     CDS             223884..224426
                     /locus_tag="ABZJ_RS01080"
                     /old_locus_tag="ABZJ_00199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001159726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_001159739.1"
                     /db_xref="GI:447082483"
                     /translation="MQFKIIAAQDLDRNQRHQIAELCFSAFDEDPWTQYAFMQKAIHV
                     AGILNNQIVSHALWTDRVFTINGSSDVKTAYVEYVTTDYTMRGKGLASQLLKYLVDTL
                     THLEYGLAALQPEDEAFYEKLGWTVWKGNLSIKQNTCSYLTDEYEIMLYPLNIQMKDQ
                     LSNSSEEDTICADWREGELW"
     gene            224633..225631
                     /locus_tag="ABZJ_RS01085"
                     /old_locus_tag="ABZJ_00200"
     CDS             224633..225631
                     /locus_tag="ABZJ_RS01085"
                     /old_locus_tag="ABZJ_00200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000063934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase A"
                     /protein_id="WP_000102354.1"
                     /db_xref="GI:446024499"
                     /translation="MSTDPQFPTPNNLGIAVYSNNAEAIGNTPLVRINRLIKTDAIVL
                     AKVESRNPAFSVKCRIGAALIADAEKRGVLKEGMHIVEPTSGNTGIALAFVAAAKGYS
                     ITLTMPASMSLERRKVLKALGANLVLTEPAKGMKGAVDEAVRLATEQPEVYFLPQQFE
                     NPANPQIHVDTTGPEIWQATGGQVDILVAGVGTGGTITGISRYFEQVQNKPLYSVAVE
                     PAESPIITQTKNGENITPAPHKIQGIGANFIPKNLDLDLVDEVLPVSSEEAIQWARKC
                     ATQEGILVGISSGAALAAAAKIAERPENAGKTIVVILPDSGERYLSSVLFEGLFDE"
     gene            complement(225687..226175)
                     /locus_tag="ABZJ_RS01090"
                     /old_locus_tag="ABZJ_00201"
     CDS             complement(225687..226175)
                     /locus_tag="ABZJ_RS01090"
                     /old_locus_tag="ABZJ_00201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011858065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="WP_000145303.1"
                     /db_xref="GI:446067448"
                     /translation="MTGCTSLGPNSGSFSWRSSKLSSGLQKAYSVPPSTANRLSPMII
                     QSADRYNVPPLLLAAVIRQESSYNSNARSPTGAIGLTQIIPSYWQQTCAGNLYDESTN
                     IQCGAYILNHYYQTADSWFKATAYYNVGPTGYERSFWTRHKAKKYARSVKRHQKTLKS
                     AL"
     gene            complement(226601..227167)
                     /locus_tag="ABZJ_RS01095"
                     /old_locus_tag="ABZJ_00202"
     CDS             complement(226601..227167)
                     /locus_tag="ABZJ_RS01095"
                     /old_locus_tag="ABZJ_00202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000799837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="WP_000859327.1"
                     /db_xref="GI:446782071"
                     /translation="MKTVAIIYHSRQGHTQFIAQQIQIGVLSHHNIKADLLNAEDLIE
                     RPEILIQYDGLIWGSPTYLGGVSSKLKQLMDATGPLWKKQSFKGKLAAGFTVSSLPAG
                     DKQSTLISIFTFCMQHGMLWVGNPILPEQHQGVAYTQAANRLGSWSGLMAQAEHASNA
                     DGFDEGDIKTAQQFGENFALTLNAYQGT"
     gene            complement(227184..227669)
                     /locus_tag="ABZJ_RS01100"
                     /old_locus_tag="ABZJ_00203"
     CDS             complement(227184..227669)
                     /locus_tag="ABZJ_RS01100"
                     /old_locus_tag="ABZJ_00203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001098168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001098168.1"
                     /db_xref="GI:447020912"
                     /translation="MNTSTLFFQALCLGIGATIVMDIWLLILKIFKVPTLNFAFLGRW
                     VGWIFQGKLVHQSIAKSPPMKGEYLLGWIAHYSVGIIFALSFLLIVGSTWLDHPQFYS
                     ALLFGLVTVLIPFFIMQPAMGSGFASSKTPHPFLNCLKSLLNHSVFGCGLYLTAKLFQ
                     I"
     gene            227751..228155
                     /locus_tag="ABZJ_RS01105"
                     /old_locus_tag="ABZJ_00204"
     CDS             227751..228155
                     /locus_tag="ABZJ_RS01105"
                     /old_locus_tag="ABZJ_00204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017391132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_000351002.1"
                     /db_xref="GI:446273147"
                     /translation="MDIGEVAKKAKVTTATLRFYEEKGLIKSIGRQGLRRQYSKQVID
                     QLALIALGRAAGFSLNEIATMFGQDGKPDLDRQKLKDKAEQLEQMAKRLHFISQGLEH
                     AAVCPAENHMECPTFQKFLKAAIAGEYQPTKL"
     gene            228303..229562
                     /locus_tag="ABZJ_RS01110"
                     /old_locus_tag="ABZJ_00205"
     CDS             228303..229562
                     /locus_tag="ABZJ_RS01110"
                     /old_locus_tag="ABZJ_00205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytase esterase"
                     /protein_id="WP_000039483.1"
                     /db_xref="GI:445961628"
                     /translation="MSKKTLIALLCCASLGLTACNDDNDQDQTSPTENVTEPTLISFA
                     KLPVETYAAGPDSGAYVKGANGIYPPFKGQPVQGFSAALKNEDGSYMAMADNGFGTQD
                     NSSDFLLRIYKIKPDFKTKTKGTGQVNVQSFIQLRDPNKLIPFNIINGNTPERLLTGA
                     DFDPESMQRTSDGTYWIGDEFGPYLLHFSADGVLLDAPIPLPNPLNPTQELRSPQNQF
                     NKAQINFVEPLVQQSGGFEGMAISPDGQYLYPLIEKPIKSIRETERQLLISQFDLKKK
                     AYTGKYYWFQLDSKATNIGDFQLFNDKEGIIIERDATQNNLGGYKKLIRIKLNESGQL
                     VSREDLVDLIKIANPNMLYGTARAGDIGTGQVFAFPFETIEDVIIENGTTLTVFNDNN
                     FPGSTGRNAKLADDNEIIQIRLPKALF"
     gene            229777..232155
                     /locus_tag="ABZJ_RS01115"
                     /old_locus_tag="ABZJ_00206"
     CDS             229777..232155
                     /locus_tag="ABZJ_RS01115"
                     /old_locus_tag="ABZJ_00206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006581197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_000102049.1"
                     /db_xref="GI:446024194"
                     /translation="MSTAYTMQTAPKALFDYDKYWASCFEPAPFLPMSREEMDQLGWD
                     ACDFILVCGDAYIDHPSFVSGVIGRVLEAQGFRVGIIAQPDWTNVESFRVLGKPTIAW
                     GVTAGNMDSMINRYTADRKIRSDDAYSPNNEPNKRPDRAATVYCQRCREAFPDVPVLL
                     GGIEGSLRRIAHYDYWSDKVRRSILMDSKADMLMYGNGERAIIDVMHRLAKGEKIHEI
                     TDVRGTAFIINKHNKAAKAKFVEIASNDVDTIGRVDPIINPYVMTEDIDGCEIEKDKG
                     NTLAQYQGFQKEIVANPIVREGDQLDENTQIVQLKPAQSKAIKHKLPPRELAVIRLPS
                     FEEVANDQVLYAHANRILHLETNPGNARALVQRHGERDVWINPPPIPLTTEEMDYVFD
                     LPYARLPHPAYGDARFPAFDMIKFSVNIMRGCFGGCTFCSITEHEGRIIQNRSEDSIL
                     REIEKIRDTAPNFTGIISDLGGPTANMYRLHCKDPEIEKNCRKPSCVYPGVCQNLHTD
                     HAPLVQLYRKARAIKGVKKILIGSGLRYDLAVLNPEYVKELVQHHVGGYLKIAPEHTE
                     QGPLSKMMKPGIGTYDRFKQMFDRFSKEAGKEQYLIPYFIAAHPGTSDYDMMHLAIWL
                     KKNGFRADQVQTFYPSPMATATTMYYSGKNPLAKVARYTENVDIVKGEKRRRLHKAFL
                     RYHDPNNWPLLREALKEMGRADLIGNSKQHLIPTYQPKGAEGEYKSARKKNSTVAGDS
                     VKRSGQTVQNKNQHKRPQKGQVLTQHTGLPPRETGEKRPFGGKSKPKSKARG"
     gene            232469..232969
                     /locus_tag="ABZJ_RS01120"
                     /old_locus_tag="ABZJ_00207"
     CDS             232469..232969
                     /locus_tag="ABZJ_RS01120"
                     /old_locus_tag="ABZJ_00207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005079504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000291529.1"
                     /db_xref="GI:446213674"
                     /translation="MYYLITILLLFLTVVMAAKSLSRKHQQDSALKRRAVLSSHEQMT
                     LTRLQTVLPKFTVLAHVSFDALLTTKYAHTRRKYQNMTADFVVLDQNYQVVVVVMLEE
                     SGLRRAHQQYERRLLQLAGYRVLSYSTVPDYHELRRDLLTPESEMATLHVTPQLERIS
                     NAFVKS"
     gene            complement(233115..233468)
                     /locus_tag="ABZJ_RS01125"
                     /old_locus_tag="ABZJ_00208"
     CDS             complement(233115..233468)
                     /locus_tag="ABZJ_RS01125"
                     /old_locus_tag="ABZJ_00208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000216806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C2"
                     /protein_id="WP_000216805.1"
                     /db_xref="GI:446138950"
                     /translation="MTVKRLHVTSRYCEVAISGNLVHLAGQLADDTSVDITAQTQQTL
                     DNIDRLLAEAGTDKSHILSVMIFLKDIDKDYAAMNTVWDAWISKEHPPARTCVESKLY
                     APDVLVEMTVVAVLP"
     gene            complement(233789..234844)
                     /locus_tag="ABZJ_RS01130"
                     /old_locus_tag="ABZJ_00209"
     CDS             complement(233789..234844)
                     /locus_tag="ABZJ_RS01130"
                     /old_locus_tag="ABZJ_00209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001226146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="WP_001226146.1"
                     /db_xref="GI:447148890"
                     /translation="MRKIIHIDMDAFYASVELRERPDLRHLPVVISSHHPRAVIAAAS
                     YPARQFGLRSAMSMSQARKLCPQVVIIEPNFEKYRAISAQIHSIFQQYTTLIEPLSLD
                     EAYLDVTENLKQIASATEVAMHIREDIFRQTGLTASAGVAPNKFLAKVASDWNKPNGL
                     FVIKPSQVASFIQDLPLKKIPGVGKVTQEKLQQLELHTLGDLQKIEEAVLVHHFGKYG
                     QQLYLYAQGIDNRPVQAERARQQISKETTFDSDFTLAQCQPYWHGLAEKVWQSLEKKQ
                     LNARGVNIKLKLKNFQTLQHSKSFKNPIHSQQDLIQVLFLLLNEMHIPENFQFRLIGI
                     GVYQLQTKADDFQLSLW"
     gene            complement(234846..235604)
                     /locus_tag="ABZJ_RS01135"
                     /old_locus_tag="ABZJ_00210"
     CDS             complement(234846..235604)
                     /locus_tag="ABZJ_RS01135"
                     /old_locus_tag="ABZJ_00210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000163509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysozyme"
                     /protein_id="WP_000163501.1"
                     /db_xref="GI:446085646"
                     /translation="MTKLAKTFSAPRYNTLIGIVLACVMGVLTYFGLFYQQKAIAQDY
                     PVQGFDVSHHQENINWKKISPKKFQFVYLKATEGGDYKDPKFQENWLKAREHGFHVGA
                     YHFYRLCRDGKTQAENFISTVPNKADALPPVIDLEYDSNCINSHTKEQLLKEIGIMHD
                     SLKHHYGKQPIFYISKTFYHIVLIGSFPNTPLWVRDYEGKPELKDKRKWLFWQHSNQG
                     KIEGMTKPVDLNVYEGSVKEWHQFLQQQGIVKAQ"
     gene            complement(235682..237073)
                     /locus_tag="ABZJ_RS01140"
                     /old_locus_tag="ABZJ_00211"
     CDS             complement(235682..237073)
                     /locus_tag="ABZJ_RS01140"
                     /old_locus_tag="ABZJ_00211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_000994598.1"
                     /db_xref="GI:446917342"
                     /translation="MNATPTHQALQPEYRLLVLLVSIGFFMQALDTTIVNTAIPAMAH
                     HLNEDPLRMHSVVVAYVLSVAACIPLSGWLADRFGVRNTFLSAIIIFTLASLGCGLSQ
                     SLNQLLFFRVIQGVGGALLLPVGRLSLLKIIPRTQFLAAMSLMSLAGLLGPLAGPTLG
                     GWLVEVATWHWIFLINIPMGVLGILMTLKVMPNVKEPTVKTFDLIGFVLLVIAMIGWS
                     LGIEHLASPEYSKWFSISLLVVGAVATLWYAYHSHTHQNALFRSRLFRNKIYAIGILG
                     NFFARFGGNALPFVLPLMLQVAFGFEPFIAGLMMIPLVLGSLFSKPIVRPIIQKMGYR
                     RFLLINTTLVGLCIASFTIMTVDTPTWFRALHFFLFGTLNSLQFVGMNTLTLKDLPQQ
                     DASSGNSFLSMIMMLSMSIGVALAGTLINVFTDYYGTAHVTTAFHVTLICLGCINIIT
                     ALIFWQIPKNTPV"
     gene            complement(237282..237905)
                     /locus_tag="ABZJ_RS01145"
                     /old_locus_tag="ABZJ_00212"
     CDS             complement(237282..237905)
                     /locus_tag="ABZJ_RS01145"
                     /old_locus_tag="ABZJ_00212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001986939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001089658.1"
                     /db_xref="GI:447012402"
                     /translation="MNSVLTMAVNDSPITSVKTTQPLIALYCGSRAGNNPIYREKAIE
                     LASGIAEQGFGLVYGGASIGLMGQVAESVLAHGGEAVGVIPEFMLDYEVAHAGLTELH
                     VVETMHERKAMMAERASAFIALPGGLGTFEEILEIATWGQLNQHQKPMILYNVNGFYN
                     ALIAQLDHAVQEGFLPLQHRAKLIVCEEIDQIYNVIKNLKMPKRFVV"
     gene            238232..239824
                     /locus_tag="ABZJ_RS01150"
                     /old_locus_tag="ABZJ_00214"
     CDS             238232..239824
                     /locus_tag="ABZJ_RS01150"
                     /old_locus_tag="ABZJ_00214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005037379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000575778.1"
                     /db_xref="GI:446497924"
                     /translation="MIFEWMSDPSAWVGLATLIVLEIVLGIDNLVFIAILAEKLPPEQ
                     RTKARIVGLILALGMRLILLASIAWVVTLTQPLFHIFSHPFSGRDLILLFGGVFLLFK
                     GTMELHERMEGKQLHKEDNPVHAAFWMVIVQIVVLDAVFSLDSVITAVGMVKELSVMM
                     VAVVIAVGIMLWASRPLMDFVNKHPTVVILCLGFLMMIGFSLVVEGFGFHIPKGYLYA
                     AIGFSILVEMINQTMRRNQEKLVTTTDLRYRTASAVLRMLGSKNSGSTSDAQTADKED
                     VLATQAFADEVFDEENGAYHSVLVQGVLGLSERPVKSVMTPRPELEWIDLDEEPEVLK
                     ERLMSMTHSRLIVARGELDNIEGIALTHKVLNGFIETGVIDFQKHLREPVIVHENAQV
                     LMVMEQLRQAPLQMAIVLNEYGSIEGIATPIDILEAIAGEFPDEDELDAAAESLEDGS
                     LILEGSTDIRHVSLLLGRDLVDESEQYSTLSGYLLFHLGRLPENGETVEADGYRFEVV
                     TMEGHKIEKVHIVSIEQDESKD"
     gene            239896..240396
                     /locus_tag="ABZJ_RS01155"
                     /old_locus_tag="ABZJ_00215"
     CDS             239896..240396
                     /locus_tag="ABZJ_RS01155"
                     /old_locus_tag="ABZJ_00215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase SecA"
                     /protein_id="WP_014466016.1"
                     /db_xref="GI:504278914"
                     /translation="MTQQTCPCGKGSYAECCEPLHLGTAKALTAEQLMRSRYSAFALQ
                     QIDYIVQTTALGQQTALDKEAIAEWSKQNQWLGLEVVNANEKLDKTHAQVEFKAHYHD
                     GKSAQIHHEVSHFVFHQQQWFFLDPTVDMQVTMKQPCICGSGKNLNNAVHNSYNFILK
                     YAHRLA"
     gene            240408..241052
                     /locus_tag="ABZJ_RS01160"
                     /old_locus_tag="ABZJ_00216"
     CDS             240408..241052
                     /locus_tag="ABZJ_RS01160"
                     /old_locus_tag="ABZJ_00216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002067995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000927792.1"
                     /db_xref="GI:446850536"
                     /translation="MLLTVIYIIAITAEAMTGALSAGRRSMDWFGVVLIACVTALGGG
                     SVRDVLLGHYPLTWVKHPEYLVLTCCAAFVTIVIAKWMRHLHNIFLVLDALGLIGFTI
                     IGCQIALQMGHGFVVSAVAGVLTGVSGGILRDILCNDVPFVFRRELYASISFVAVICY
                     WVCLDLGLSLELTVISTLVFGFTLRLIAIYFGLEMPKFIYKDDDAESASSTDEH"
     gene            241135..242454
                     /locus_tag="ABZJ_RS01165"
                     /old_locus_tag="ABZJ_00217"
     CDS             241135..242454
                     /locus_tag="ABZJ_RS01165"
                     /old_locus_tag="ABZJ_00217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017387776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_000364292.1"
                     /db_xref="GI:446286437"
                     /translation="MDLISRIQNLPIGKFHYTLLWVVGLGWMFDAMDTGIIAFIMTTL
                     VKDWSLTPVESGWIVSIGFVGMAIGAVCSGALADRFGRKTVFAMTMAIYSIATALCAF
                     APDLKWLLIFRFIVGLGLGGQLPVAVTLVSEYVPAHVRGRFIVLLESFWGLGWLVAAL
                     ISYFIIPKFGWHIAFLIGGLPLIYILVIWKKVPESIPYLINRGRIEEAHALVQKLEAE
                     ACVQIVHHIEVVPVAMRQKVSFKQLWSGQFARRSLMLWLIWFGIVYSYYGIFTWLPSL
                     LVKQGYDIVKSFEYVLLMILAQLPGYLAAAWFVERLGRKITLAAFIGFCALSAYFFGQ
                     ADSVNSIMFWGCLMSFFNLGAWGVLYTYTPEQYPANIRAFGSGWASAMGRIGGIVAPM
                     VVTHMMVAKNGFNHVFMMFTVVLLAVALVILILGEETQGKRLESIGL"
     gene            242608..244827
                     /locus_tag="ABZJ_RS01170"
                     /old_locus_tag="ABZJ_00218"
     CDS             242608..244827
                     /locus_tag="ABZJ_RS01170"
                     /old_locus_tag="ABZJ_00218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000202264.1"
                     /note="decatenates newly replicated chromosomal DNA and
                     relaxes positive and negative DNA supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="WP_000202252.1"
                     /db_xref="GI:446124397"
                     /translation="MTSLAHHATENRSVAEFTEQAYLNYAMYVIMDRALPHISDGLKP
                     VQRRIVYAMSELGLKSSGKPKKSARTVGDVLGKYHPHGDLACYEAMVLMAQPFSYRYP
                     LIEGQGNWGSPDDPKSFAAMRYTEAKLSAYSELLLSELGQGTSEWQDNFDGSLKEPIT
                     LPARVPNILLNGTTGIAVGMATDIPPHNLREVVKGTIALIRNPQTSDEKLAEYIPAPD
                     LPTKAEIITPPEELLKIQTTGRGSYRMRAVYTIEKNEIVITELPYQVSGSKVITQIAD
                     QMQAKKLPLVVDVRDESDHENPTRLVIVLRSNRIDAEAVMSHLFATTDLESSYRVNLN
                     MIGEDGRPQVKSIRRILLEWIEIRKKTVTRRLQYHLNRIEKRLHILAGLLIAYLDIDT
                     VIRIIREEDQPKPVLMEHFNIDEIQAEAILELKLRHLAKLEEMEIRHEQDELSAKAAI
                     IREQLENPESLKNLIIGELKEDAKKFGDERRSPIVARAEAVQIKEQDLMPAETVTVVL
                     SEAGWVRAAKGADVDAENLNYRAGDQYLSHAVGKTNQRVYFLDETGRSYALPISNLPS
                     ARGLGDPLSSKLSPASGVSFIQVYLDDDESELIAASSAGYGFKTQTKQLDTNAKAGKT
                     FLTVPDKAKALPLISAQNMTHLAVLSSAGRLLILDLAELPNLNKGKGNKLIQLEGKEQ
                     ILSMTTLNLDEIIQVVAGQQHLKLKGDDLQKYMGKRASKGQLLPRGYQKANKLLIQR"
     gene            245125..246804
                     /locus_tag="ABZJ_RS01175"
                     /old_locus_tag="ABZJ_00219"
     CDS             245125..246804
                     /locus_tag="ABZJ_RS01175"
                     /old_locus_tag="ABZJ_00219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000411992.1"
                     /note="activates fatty acids by binding to coenzyme A;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_000411991.1"
                     /db_xref="GI:446334136"
                     /translation="MEKIWFAEYQKTGIPETVALPAENTSLVDIFERNFQKFGSRDAF
                     IFMDKAMSFNELELASRKFATYLQNLGLAKGTRVAVMMPNVLQYPVVALAVLRAGLVL
                     VNVNPLYTARELEHQLNDSGAEVLVIIENFASVYQSILGKTPVKHVVVASVGDMLGTL
                     KGTLVNFVLRKVRKQIPAWNIPGHVKFNSALNKENPSNYKRPTLTLSDTAVLQYTGGT
                     TGVSKGAELTHRNLVANLLQCDGIFQSKFGANDGAKGDRIVCALPLYHIFAFMVCAMY
                     GMYKGQANILIPNPRDLPAVIKELRKYQPSFFPAVNTLFNALVNNEEFKQLDHSNLKM
                     AMGGGMAVLPSTAEAWKKITGTTIIEGYGLSETSPVATANPPASTEFSGTIGIPLPLT
                     EVAILDDDGKEVPLGEQGEISIRGPQVMKGYWNRPDETAKVMTADGFFRTGDIGVMDS
                     RGYVKIVDRKKDMILVSGFNVYPSEIEEVIAKHPKVLEVAAIGVPDEKSGEVPKLFIV
                     KKDPSLTTEEVLNFAKENLTGYKRPRYVEFMDELPKSNVGKILRKDLRKPA"
     gene            complement(246843..247226)
                     /locus_tag="ABZJ_RS01180"
                     /old_locus_tag="ABZJ_00220"
     CDS             complement(246843..247226)
                     /locus_tag="ABZJ_RS01180"
                     /old_locus_tag="ABZJ_00220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001186999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001187001.1"
                     /db_xref="GI:447109745"
                     /translation="MQQPDQKELFEVLEKQKKNQLQVDRIFKIVLPIVAFLLSVICAN
                     FNWQSTLGTFVILTVTFIAVGVKRLPLWHWLIVITIYCLVDNYLSYGQLDVTHLRLQL
                     GTMLVFVGMVGIGRPYVDRWFMKNH"
     gene            247333..247731
                     /locus_tag="ABZJ_RS01185"
                     /old_locus_tag="ABZJ_00221"
     CDS             247333..247731
                     /locus_tag="ABZJ_RS01185"
                     /old_locus_tag="ABZJ_00221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000546045.1"
                     /db_xref="GI:446468191"
                     /translation="MHGISSIIYIILVACLLPYAFTVIAKFTGGFQPVDNQNPRDFLA
                     NTKGIAARANAVQQNSFESLPLFLTAILMAEYMVVPEYFILRLGWAYIILRVIYGICY
                     LSNWATLRSIVWFLSLLCPIFLLIVTIKLT"
     gene            247859..248386
                     /locus_tag="ABZJ_RS01190"
                     /old_locus_tag="ABZJ_00222"
     CDS             247859..248386
                     /locus_tag="ABZJ_RS01190"
                     /old_locus_tag="ABZJ_00222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004749952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrophosphatase"
                     /protein_id="WP_000122443.1"
                     /db_xref="GI:446044588"
                     /translation="MSYSNIPAGKDAPNDIYVIIEIPANAAPIKYEIDKDSDALFVDR
                     FMGTAMFYPANYGYVPNTLSEDGDPLDVLVVTPHPVAAGSVIRCRPVGKLNMEDDGGI
                     DAKLIAVPHEKLSPLYKDVQEYTDLPPLLISQVEHFFSHYKDLEPGKWVKISGWEGAD
                     VAKAEVLKAIEAAKK"
     gene            complement(248493..249809)
                     /locus_tag="ABZJ_RS01195"
                     /old_locus_tag="ABZJ_00223"
     CDS             complement(248493..249809)
                     /locus_tag="ABZJ_RS01195"
                     /old_locus_tag="ABZJ_00223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002059892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000910004.1"
                     /db_xref="GI:446832748"
                     /translation="MLKAQKLTLAVLISAAIISSAQASEQSEAKGFVEDANGSILFRT
                     GYISRDKKQGAKDTSSVAQSAIVSIESGFTPGIVGFGVGVVGDGSFKIGENKNAGNQM
                     IPKHNDGSAYDHWARGGGSVKARFSNTTVRYGTQVLDLPVLASNTGRMVPEYFTGTLL
                     TSHEIKNLEVVAGKFTKDQMSDQINTDADASGRGLDRAIVWGAKYKFNDNLNASYYGL
                     DSKNALERHYANVNFKQPLANDSSLTYDFSGYHTKFDANAHTYSATGTVAPNYAADGI
                     AGEEKTNNIWAISGTYATGPHSVMLAYQQNTGNVGYDYGQNADGFQSIYLPNSYMSDF
                     IGNHEKSAQIQYNVDFGKLGVLPGLNWTTAFVYGWDIKVRNVTDDAQEREFFNQVKYT
                     VQSGFAKDASLRIRNSYYRASDAYQGAYIGDTNEWRIFLDIPVKLF"
     gene            250733..251545
                     /locus_tag="ABZJ_RS01200"
                     /old_locus_tag="ABZJ_00225"
     CDS             250733..251545
                     /locus_tag="ABZJ_RS01200"
                     /old_locus_tag="ABZJ_00225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000975211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_000975212.1"
                     /db_xref="GI:446897956"
                     /translation="MMKFALKAVTFGVLTAGSTMVMAEDAPSFYGITATGSVAATTDY
                     RFRGITQSSNNPAIQGGFTFSHKSGAYVALWGSSVDFNTPGVSTETDISLGYTNTLKL
                     SDTLAPTYDVGVIRYGYIGSDSKFTNPYNGDTGFDFTEFYGKLTFADSLFKGDALSVG
                     VNYSNDYWGHSDEFWYFNVGYSAPIADTGFTGLASVGYNKLKNKDSLLVVAGGPGEDD
                     SYIDYKVGVNYNILGIVAELDVVGTDISTSGMTDAQKKPYDTGLVFSLTKTF"
     gene            complement(251588..252466)
                     /locus_tag="ABZJ_RS01205"
                     /old_locus_tag="ABZJ_00226"
     CDS             complement(251588..252466)
                     /locus_tag="ABZJ_RS01205"
                     /old_locus_tag="ABZJ_00226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017817050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="WP_000772971.1"
                     /db_xref="GI:446695625"
                     /translation="MKLNGIIGYPVTPFSDDNNINLPVLKQMLDLLIENGCDAIAPLG
                     STGESAYLEWDEWCLVAKTSIESINKRVPVIIGISELTTNQAIKKAQIAQSYGADALM
                     VIPVSYWKLTDQEIFEYYQAIAQATTLPIMIYNNPATSGVDMSPELIVRMFNNIANIM
                     MVKESSGDIQRMHKIYELSKGELPFYNGCNPLALEALCAGASGWCTAAPNLLGQRPQQ
                     LIEYVKNGELEQAQKSFYQQLPLLRFIVKGGLPKTIKAGLQLKGVAAGTPRKPLTKAT
                     DIELNQLKQLLSEIEN"
     gene            complement(252482..253258)
                     /locus_tag="ABZJ_RS01210"
                     /old_locus_tag="ABZJ_00227"
     CDS             complement(252482..253258)
                     /locus_tag="ABZJ_RS01210"
                     /old_locus_tag="ABZJ_00227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000845035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_000845026.1"
                     /db_xref="GI:446767770"
                     /translation="MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDH
                     GHDAGLAGQITCRSENKETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANR
                     FHTWIYKEHPEVNCIIHTHPTYVAALSMLQIPLMISQMDVCALYEDCSFVGHWPGVPV
                     GNEEGILISSALGKNRAVLLSHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQI
                     QPIPHALAAEAHDWVSTDKRNKVNFAYYARKALKKHSDCI"
     gene            253370..254803
                     /locus_tag="ABZJ_RS01215"
                     /old_locus_tag="ABZJ_00228"
     CDS             253370..254803
                     /locus_tag="ABZJ_RS01215"
                     /old_locus_tag="ABZJ_00228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000945958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_000945958.1"
                     /db_xref="GI:446868702"
                     /translation="MLRPWQIHFRIDEREEKTVFLKLTNLISQEILSGRLVQGTMLPG
                     SRILSKELGINRKTVQAVYEELEAQGWLVTRPRKGTFVADVLPEKKPQIEPRADRKVS
                     DKPIIQQVAQRPHNDGVPDPRLIPYELFSRAYRHALIKITQNQYMGYGDPRGMAELRQ
                     ALKQMLSMERFMNVAEDEICVVRGSQMGIFLASRALPNRQGVIVVEELYYPSAFKAFQ
                     SNGFQVVSVKLDEQGIVIEDLERILKEHSVAAIYTTPHHQYPTTVTMTMSRRLQLLEL
                     SKKWGFYIIEDDYDHEFHYDSRPMPPLASLPHSELVIHVGSLSKVFAPGIRLGYIVAA
                     PTIIQTITEDILLIDRQGNNITELALADLMQRGEIKRHIRKMKKIYQLRRDHALAEFQ
                     RVFAESIQIQPPAGGMALWVKFQKSFTQNQLIKLKELNIDTEQKFKQKEYPNCSIRFG
                     FAALSEKEITSLIETLNEALNKRTADL"
     gene            complement(254818..>255489)
                     /locus_tag="ABZJ_RS01220"
                     /old_locus_tag="ABZJ_00229"
     CDS             complement(254818..>255489)
                     /locus_tag="ABZJ_RS01220"
                     /old_locus_tag="ABZJ_00229"
                     /EC_number="6.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456995.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComM domain protein"
                     /protein_id="WP_002034926.1"
                     /db_xref="GI:487961624"
                     /translation="SIAVNDSGSHPKPGEITLSHLGVLFLDELPEFDRKVLEVLRQPL
                     ESKEIIISRAARQITYPANFQLIAAMNPCPCGYAFNQDSRCQCSPESIKRYQNRISGP
                     LLDRIDLHIDVPPLKAQELQDPTPAEDSTTVRQRVIYAYEQQMQRQDCLNQALSPKQL
                     EQHAVLDSTSQRMIEMAQQRLNLSARAYHRVLRVARTIADLAQSEVIQSPHLTEALSY
                     RGNHS"
     gene            255626..256336
                     /locus_tag="ABZJ_RS01225"
                     /old_locus_tag="ABZJ_00230"
     CDS             255626..256336
                     /locus_tag="ABZJ_RS01225"
                     /old_locus_tag="ABZJ_00230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000793771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_000736396.1"
                     /db_xref="GI:446659050"
                     /translation="MKKLSDEYLPVRKAQTVYGSISGNYAFRGEKTIWFESTLERDFI
                     LKQEFNNNVIDVIGQPVVIPYITELGNQSTYTPDFLVQFSSSNCDDFEDFPVPMLIEI
                     KPKKKLVEDWDKLKPKFRAAHRFAADKGWKFKIISETRLYDQYWENINFLKKFRRSHV
                     GAVDQQLLLDTLQELGQSTINQLPAHIFKDKTNVLKGIHQVWALVAKRMIACDLYCPL
                     TAETVIWVNQNDAFARNI"
     gene            256337..258247
                     /locus_tag="ABZJ_RS01230"
                     /old_locus_tag="ABZJ_00231"
     CDS             256337..258247
                     /locus_tag="ABZJ_RS01230"
                     /old_locus_tag="ABZJ_00231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016654431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000573060.1"
                     /db_xref="GI:446495206"
                     /translation="MIESNAVNIDRSRIILKPNVVVGYEGQPYKIVNVLNANDIVISS
                     LDSVRSLQVNARSLTIFNGGNTLTERLNKGDQDISNEAWQIALQRYEIIKPLIEYSTT
                     ELVENRANEYDVNRSTLWKWLKDYRENNSLMALIPKKRGWTTEKSRLSPQVSNIIKQA
                     INDEYLNAKKPSISKTIEIVKAECSRLQLEAPHENSIRRRIEALNDYQVTKARLGSKA
                     AIDKFKAAAGSFPNADYPLAYVQIDHTPLDIEIVDDEFREAIGKPHLTLAIDVFSRMI
                     VGYYLSLEAPSTTSVAMCIASCILSKKRKLIELDIDAEWQVEGIMDSVHTDNGPDFRT
                     NHISKACLKYGIHWEYRPIGGARFGGHIERMLGIVNLEMHVLDGTTFSNVQQRGTYDS
                     AKQACMTLKELEYYIVYWITKVYHQKKHSALGTSPIVKWEEGVWGTKTTAGTGLKERV
                     SDEDTLFIDFLPEFEATIQRTGVQKDNLFYFADCLRQWVNSIDPEDNNRKRKRKFLFK
                     RDPRDISQIWFYEPYSNTYFKVPTAKREIPPISLFEYKQVQNYLKSERQDVQNQDEIY
                     KAILHLRDQLNQARSLTRKQRRSNQRKKENAKAITQLSEQNQSKKAVVSESLQTSDDL
                     WSTPLTAFDDLR"
     gene            258252..259172
                     /locus_tag="ABZJ_RS01235"
                     /old_locus_tag="ABZJ_00232"
     CDS             258252..259172
                     /locus_tag="ABZJ_RS01235"
                     /old_locus_tag="ABZJ_00232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012300780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000417085.1"
                     /db_xref="GI:446339230"
                     /translation="MEKYEHLAEHVLEIMQLSDSERIETLFTDRWIGYKKAITIMNTL
                     TDILNRPRKLRPECLLIVGDSNMGKTTIIHEFARQYYTKTVSDADMDLLSVTKPVLPI
                     LAPAKANVKELYINILNHFFVPFRASDPEAKLRNQAVHLMRKYETKMLIIDEIHNCLT
                     GSAKLLPEVMNTLKNLSNELSLNIVGVGTREAITILHTDPQYASRFDVVNLPKWELNQ
                     DFLRLLVSYVRLLPLKKQSNLASKEIATLIFEVSGGNLGDLNRLLVECAKEAILQGDE
                     EITYDIVHKFKWLKPTEGLRNIRNINLSLS"
     gene            259202..260317
                     /locus_tag="ABZJ_RS01240"
                     /old_locus_tag="ABZJ_00233"
     CDS             259202..260317
                     /locus_tag="ABZJ_RS01240"
                     /old_locus_tag="ABZJ_00233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000081836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000081835.1"
                     /db_xref="GI:446003980"
                     /translation="MSQPEQCWYIRTPIQQGEIFSSWLIRSALDVGCSPMVLIEALWG
                     KWRALTIDLDKGVDAERFDALLSHSMESKQKIQQSMLSSVVSQIQPNYDSNQNIPWVL
                     SLGTRNRSNTSGRQVCVECLKSHENPPYLRLMWRIGWHCSCVEHQLSLIDHCPECGVT
                     IQPFKADMEHGCLAICTTCGFDLRRCEESKNINLNALNFQNKAEQVLKQKIGFYNQSP
                     VTTQVWFEIARSWLSEIRFLVNTPNKNVIQLFESFDVNLHLSHPVTPLAFEYLSTQER
                     IVLLSMLDQIMDIPCDLLVQRSKEYGVSRANFWDKRKKLPVQLQQMKDLMIKPTRRYP
                     VSRAAITVTKPKSKATVQRQWLNLLRRSNNSGAMHID"
     gene            260826..261740
                     /locus_tag="ABZJ_RS01245"
     CDS             260826..261740
                     /locus_tag="ABZJ_RS01245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000559578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000559585.1"
                     /db_xref="GI:446481731"
                     /translation="MIAAGCADLCDDCYWHQNLWNKFDQNQKVFESSDLKQQYENYIG
                     WLEKKVGSHKAALYINKHTHFFIKTEIDWNQSVPTPKQLLVRLRSSGLRKFELVMQWL
                     EEVHDIRIDMDNKKSCSERDQMEKLVQRILQPSLAYDVVLEYKNKLEEKIKRGETSIR
                     SARLAVKPAVALMLSMEGESAQLPNLEHVKAYLAEYSGQAAALTGFINFLNENYGASI
                     DYLKLKKSDFLKTKQKKKLEMELIALTQTDLNDSELILSWVRNGLRYFHQLPYIDALK
                     IKTEMITEIEDGFTVVLNGQYYWLPKTQ"
     gene            complement(262115..262486)
                     /locus_tag="ABZJ_RS01250"
                     /old_locus_tag="ABZJ_00236"
     CDS             complement(262115..262486)
                     /locus_tag="ABZJ_RS01250"
                     /old_locus_tag="ABZJ_00236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000529372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000529372.1"
                     /db_xref="GI:446451517"
                     /translation="MGQAKQRGTLEQRVKQAQEQKDDFYGTERSVAEVLAELGLPKES
                     TVKGYVIHLPEKDEFVAAINDNNISFSVAYARTPELAMIYDEPQKAISDAKKISKHKL
                     LVCVLFETSNQYMINDIWANY"
     gene            complement(262559..262858)
                     /locus_tag="ABZJ_RS01255"
                     /old_locus_tag="ABZJ_00237"
     CDS             complement(262559..262858)
                     /locus_tag="ABZJ_RS01255"
                     /old_locus_tag="ABZJ_00237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001095006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001095006.1"
                     /db_xref="GI:447017750"
                     /translation="MNTMLISPTLNVSCSENVLLKISSYFGVSHEQAYRKGVDSLLKL
                     TEMVIANNEHSEIIKLFLCDCHLRTSINLDDISDMPTQLIGDCLNVIVLRYAFVV"
     gene            complement(262926..263777)
                     /locus_tag="ABZJ_RS01260"
                     /old_locus_tag="ABZJ_00238"
     CDS             complement(262926..263777)
                     /locus_tag="ABZJ_RS01260"
                     /old_locus_tag="ABZJ_00238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000034565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein A"
                     /protein_id="WP_000034564.1"
                     /db_xref="GI:445956709"
                     /translation="MSKIIACIDGSLVTNTVCDYAAWFSDKLNSPIKLLHVIDKPKAK
                     APQDLSGAIGLGSRETLLKELVELEERKGKIELEHGQILLREAKNYLLEKFSIDAQSF
                     QRHGSVLETIMGMEDDIRVLVMGKHGNETEHDSSKIGTHIENVVRALHKPVLITSAPF
                     SPPKSFLIAFDGSQTARKCVERIASSPLLKGLAVHLVYVGNPNSEMQNQLSWAKEQLE
                     SQGFNITSNTLDGEVDKAIINYAEQHQIDLIVVGAYGHSKIRQFFIGSTTTKVITSAN
                     KPVLLLR"
     gene            complement(263790..265277)
                     /locus_tag="ABZJ_RS01265"
                     /old_locus_tag="ABZJ_00239"
     CDS             complement(263790..265277)
                     /locus_tag="ABZJ_RS01265"
                     /old_locus_tag="ABZJ_00239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000953322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="WP_000953322.1"
                     /db_xref="GI:446876066"
                     /translation="MLSTIREQWFSNIRGDVLAGIVVALALIPEAIAFSIIAGVDPKV
                     GLYASFCIAVVIAFVGGRPGMISAATGAMALLMVTLVKEHGLQYLLAATILTGFIQIL
                     AGYLKLGALMRFVSKSVVIGFVNALAILIFMAQLPELTNVTWHVYAMTIGGLAVIYLF
                     PYIPVIGKLLPSPLICIVLLTLFALFIGLDVRTVGDMGQLPDTLPIFLLPDIPLNLET
                     LAIILPYSLGLAAVGLLESMMTATIVDDLTDTTSDKNRECKGQGVANVASGFLGGMAG
                     CAMIGQSIINVKSGGRTRLSSFSAGVFLLIMVVFISDWLKAIPMAALVAVMIMVSIGT
                     FNWDSLRNIRQYPLSSNIVMIVTVVVVVATHNLAYGVLVGVLLSALFFANKIERYMAI
                     QSVFDESESTRTYTVTGQVFFSSADKFTSAFDFKEALSKVVIDVSQAHFWDVSAVAAV
                     DKVVIKFRREGTEVELIGMNEASKTLVDKFGIHDKPDALDRLNSH"
     gene            complement(265572..267368)
                     /locus_tag="ABZJ_RS01270"
                     /old_locus_tag="ABZJ_00240"
     CDS             complement(265572..267368)
                     /locus_tag="ABZJ_RS01270"
                     /old_locus_tag="ABZJ_00240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002048912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001144964.1"
                     /db_xref="GI:447067708"
                     /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEV
                     LLIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTDQSYRFSGKLITKRFS
                     FDFTNNKPKNIKLTDRIPNTSDYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNH
                     CLMHSNDGTQVITSSIHVLHSLFVNRKDIRGLLLGTSSQSIINRFLESYTTEIVDDNV
                     EYKIKIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEITEFNHLQQGTGKRYP
                     IVFPPHPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTISKPDEK
                     NPRPREKSQNKNEHINTQKPPSRTSGEYRKRSEVETGNTQGILKYSFNEPTDDPIEVG
                     ASNQPYSDKSEEVETSSDEPYGNQNTKIKKSETTDTPPSRDERFDIQYIIQSLQELAS
                     EMGSPLEHLSAINEHGEMIASINLLQIKKLVPEPKHPSWIDYDKGRKLLFLKLDLKDQ
                     NGFSYLIDIHKNKNHEAFCAFLIFTQNKLTSEQIKKICIELENAKGIKKWALYCDSFI
                     HKMIAIKHLYATPDEWKNRFKNLFISLQKDKS"
     gene            complement(267655..268236)
                     /locus_tag="ABZJ_RS01275"
                     /old_locus_tag="ABZJ_00241"
     CDS             complement(267655..268236)
                     /locus_tag="ABZJ_RS01275"
                     /old_locus_tag="ABZJ_00241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000370460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000370460.1"
                     /db_xref="GI:446292605"
                     /translation="MDNSESKILAEYEKAKKWDKYEKVFSILGVLSLFIFMVMIIISA
                     ITLSLNDTSPTKIFNSYCWAAILFLAVLFTSLRNIAEQISFKKSMEILIDSKDAEDEK
                     DQLAVVRRQHTIICITAFCALIVADFILFYFIAFNLTLPLNILIHKPLFIIMLACLIF
                     FTINYLIYKYKFNKLNNEAMVAFGKHLDNKRKK"
     gene            complement(268257..269420)
                     /locus_tag="ABZJ_RS01280"
                     /old_locus_tag="ABZJ_00242"
     CDS             complement(268257..269420)
                     /locus_tag="ABZJ_RS01280"
                     /old_locus_tag="ABZJ_00242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000157684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000157684.1"
                     /db_xref="GI:446079829"
                     /translation="MASLNSEFQIPLKVVTTRLNHMKINLPQLVKKIEKRAIENLKRR
                     KDKKEQIDLLITWDDWIYAALDADHERIHGSADPHPLPPTFKNNMVSGVYEKALKNVM
                     GHFGVKATVPAWAANIKVGEHIPKELLDRLPVTTGELVTLGNWMLTKNIYRFEDIVIN
                     ELIKTGFNGVIPNHILNLPDLCVYIQTDNAKGLTFENRQVVGVLFCVTELCGDRLLVS
                     TMYLDDGMPRTIAIMLNEDQDIEASLTNFVDQFQQDYDPETMASDLKERLKIQKKLIN
                     LVLWFSQSKPEVTPLTPDTNKPVQFVEIKKEKRLFEAGKYKTFKIGSETARKLTKLYE
                     EIEVAKAEGKASGREPHLRKSHWHLYWYGKKGRYERYDFLLIPVTIVGGVSKD"
     gene            complement(269505..271007)
                     /locus_tag="ABZJ_RS01285"
                     /old_locus_tag="ABZJ_00243"
     CDS             complement(269505..271007)
                     /locus_tag="ABZJ_RS01285"
                     /old_locus_tag="ABZJ_00243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000192313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000192314.1"
                     /db_xref="GI:446114459"
                     /translation="MTQKNELDTKYAVIVAGGNGAGKSTLIDNVIIPKFNSLNLDINF
                     INADVWQLQHFGHFDNTNPTHAREAQKWAEAERQKHLDEGRSFIAETVFSHPSKVDLI
                     KEAKSKGFYVVLYHIHLENSDIALDRIKDRVRKGGHDVDEDKVKARYERVLPLVAEAT
                     QYADLTFVLDNSVRDRPHQQVFKLEYGKITAIDNNVPDWAIKAYEKQLTDYLGLDQAT
                     KISNTNEDLTMSNTKEKLGFEYNARLLANDIQPQHRETVVANYRKNFVEHVANSAAVA
                     GNSHKLDDVASLINGTTVGGHSVKDQRQVLNLIDASNELVNMVRNGNFALNKSTYLKV
                     NGIVADRESIEAGVLRGEGVEQSFTPDVGIRHFRTHRPMKTEEDAPALNKFMQEGFDH
                     INSLKNPLEKGIATFLYGSLNQFTFEGEKRTAHLMMNGVLMSAGLDAISIPADKAIDF
                     RQKMVRFYESKNADEVMEFLADLHPALNNTKKLDAEKEKKSENDFGRSFQ"
     gene            complement(271008..271235)
                     /locus_tag="ABZJ_RS01290"
                     /old_locus_tag="ABZJ_00244"
     CDS             complement(271008..271235)
                     /locus_tag="ABZJ_RS01290"
                     /old_locus_tag="ABZJ_00244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014462688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001085038.1"
                     /db_xref="GI:447007782"
                     /translation="MNSKFSVDQSNKISLKAVLEDLGDQMFEANKCPDTHPVYDQLRE
                     RLRKDRQLLDALDAQDENANTEERSRSLDIN"
     gene            271336..272268
                     /locus_tag="ABZJ_RS01295"
                     /old_locus_tag="ABZJ_00245"
     CDS             271336..272268
                     /locus_tag="ABZJ_RS01295"
                     /old_locus_tag="ABZJ_00245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000886982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase"
                     /protein_id="WP_000886984.1"
                     /db_xref="GI:446809728"
                     /translation="MLDREILLKKWLDEYLLANKSNETIYTLKNSLNLFFEYTNLALE
                     EIEASDIRTFIAYRAQNGVGVSTLKKNISAIRTFFHYLTKEKLINFNPAEDIKIKKSS
                     KVLPKFHEVTVINEVLDSNKNLEFERPSSTVIFKRDLALIEIAYSCGLRLEEIHSLQI
                     ENVEVKRKQVRVTGKGNKTRIIPLGSKAIEAYLEWLPLREEIMNKDTNQKHNYVFVTT
                     TGAQLSRVQINKRIKNAFKLAGYPIQSNPHMLRHSFATHLINNSVGIREIQEMLGHSN
                     LNTTQIYTDLDHTSMTNVYMDTHPRAVKNTEGEN"
     gene            272475..272792
                     /locus_tag="ABZJ_RS01300"
                     /old_locus_tag="ABZJ_00246"
     CDS             272475..272792
                     /locus_tag="ABZJ_RS01300"
                     /old_locus_tag="ABZJ_00246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001006517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001006517.1"
                     /db_xref="GI:446929261"
                     /translation="MNEVKAYKLTVENVELFEEIEHEVLFQTTIKTKKSILNYLTPVS
                     TLATLLQRHNIILPKGIFLGSIIEIYDEEVEPRVIIGHEGCDFGNVKTVRQLEIYWEE
                     VAF"
     gene            272838..273194
                     /locus_tag="ABZJ_RS01305"
                     /old_locus_tag="ABZJ_00247"
     CDS             272838..273194
                     /locus_tag="ABZJ_RS01305"
                     /old_locus_tag="ABZJ_00247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000798673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000798673.1"
                     /db_xref="GI:446721360"
                     /translation="MKNSVSNSYIVQANGVKVVKADVNSIVTTNKRIHVGDDTPAFAF
                     YVCGFWDSIDQFERYGMTPHVTLYKTESEVKEYCKGKVVSYREYYANSEKEVDDLIAT
                     NRMSHENHARSLAELF"
     gene            273248..273517
                     /locus_tag="ABZJ_RS01310"
                     /old_locus_tag="ABZJ_00248"
     CDS             273248..273517
                     /locus_tag="ABZJ_RS01310"
                     /old_locus_tag="ABZJ_00248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000168733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000168733.1"
                     /db_xref="GI:446090878"
                     /translation="MASTAAERKAKQRQEMLKKGFTRKDLWLSKESLEVIEKFKSEHK
                     LSSNDEAINLLLKTIVVIEKFKSEHKFNTIDEVINLFLKSLNECK"
     gene            273829..274539
                     /locus_tag="ABZJ_RS01315"
                     /old_locus_tag="ABZJ_00249"
     CDS             273829..274539
                     /locus_tag="ABZJ_RS01315"
                     /old_locus_tag="ABZJ_00249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000736393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_000736393.1"
                     /db_xref="GI:446659047"
                     /translation="MKKLSDEYLPVRKAQTVYGSISGNYAFRGEKTIWFESTLERDFI
                     LKQEFNNNVIDVIGQPVVIPYITELGNQSNYTPDFLVQFSSSNCDDFEDFPVPMLIEI
                     KPKKKLAEDWDKLKPKFRAAHRFAADKGWKFKIISETRLYDQYWENINFLKKFRRSHI
                     DAVDQQLLLDTLQKLGQSTINQLPAHLFKDKTNVLKGIHQVWALVAKRMIACDLYCPL
                     TAETVIWVNQNDAFVRNI"
     gene            274540..276450
                     /locus_tag="ABZJ_RS01320"
                     /old_locus_tag="ABZJ_00250"
     CDS             274540..276450
                     /locus_tag="ABZJ_RS01320"
                     /old_locus_tag="ABZJ_00250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016654431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000573066.1"
                     /db_xref="GI:446495212"
                     /translation="MIESNAVSIDRSRITLKPNVVVGYEGNPYKIVNVLNANDIVISS
                     LDSVRSLQVNSKSLTVFEGENTLTENLNKGDKDISNEAWQIALQRYEIIKPLIEYSTT
                     ELVENRANEYDVNRSTLWKWLRDYRENNSLMTLIPKKRGWTTEKSRLSPQVSNIIKQA
                     INDEYLNAKKPSISKTIEIVKAECSRLQLEAPHENSIRRRIEALNNYQVTKARLGSKA
                     AIDKFKAAAGSFPNADYPLAYVQIDHTPLDIEIVDDEFREAIGKPHLTLAIDVFSRMI
                     VGYYLSLEAPSTTSVAMCIASCILSKKRKLIELNIDAEWQVEGIMDSVHTDNGPDFRT
                     NHISKACLKYGIHWEYRPIGGARFGGHIERMLGIVNLEMHVLDGTTFSNVQQRGTYDS
                     AKQACMTLKELEYYIVYWITKVYHQKKHSALGTSPIVKWEEGVWGTKTTAGTGLKERV
                     SDEDTLFIDFLPEFEATIQRTGVQKDNLFYFADCLRQWVNSIDPDDNNRKRKRKFLFK
                     RDPRDISQIWFYEPFSNTYFKVPTAKREIPPISLFEYRQVQNYLKNGRQDVQNQDEIY
                     KAILHLREQLNQARSLTRKQRRSNQRKKENEKAITQLSEQNQSKKAVVSESLQTSDDL
                     WSTPLTAFDDLR"
     gene            276455..277375
                     /locus_tag="ABZJ_RS01325"
                     /old_locus_tag="ABZJ_00251"
     CDS             276455..277375
                     /locus_tag="ABZJ_RS01325"
                     /old_locus_tag="ABZJ_00251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012300780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposition helper"
                     /protein_id="WP_000417111.1"
                     /db_xref="GI:446339256"
                     /translation="MEKYEYLAEHVLEIMQLSDSERIETLFTDRWIGYKKAITIMNTL
                     TDILNRPRKLRPECLLIVGDSNMGKTTIIHEFARQYYTKTVSDADMDLLSVTKPVLPI
                     LAPAKANVKELYINILNHFFVPFRASDPEAKLRNQAVHLMRKYETKMLIIDEIHNCLT
                     GSAKLLPEVMNTLKNLSNELSLNIVGVGTREAITILHTDPQYASRFDVVNLPKWELNQ
                     DFLRLLVSYVRLLPLKKQSNLASKEIATLIFEVSGGNLGDLNRLLVECAKEAILQGDE
                     EITYDIVHKFKWLKPTEGLRNIRNINLSLS"
     gene            277405..278520
                     /locus_tag="ABZJ_RS01330"
                     /old_locus_tag="ABZJ_00252"
     CDS             277405..278520
                     /locus_tag="ABZJ_RS01330"
                     /old_locus_tag="ABZJ_00252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000081836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000081835.1"
                     /db_xref="GI:446003980"
                     /translation="MSQPEQCWYIRTPIQQGEIFSSWLIRSALDVGCSPMVLIEALWG
                     KWRALTIDLDKGVDAERFDALLSHSMESKQKIQQSMLSSVVSQIQPNYDSNQNIPWVL
                     SLGTRNRSNTSGRQVCVECLKSHENPPYLRLMWRIGWHCSCVEHQLSLIDHCPECGVT
                     IQPFKADMEHGCLAICTTCGFDLRRCEESKNINLNALNFQNKAEQVLKQKIGFYNQSP
                     VTTQVWFEIARSWLSEIRFLVNTPNKNVIQLFESFDVNLHLSHPVTPLAFEYLSTQER
                     IVLLSMLDQIMDIPCDLLVQRSKEYGVSRANFWDKRKKLPVQLQQMKDLMIKPTRRYP
                     VSRAAITVTKPKSKATVQRQWLNLLRRSNNSGAMHID"
     gene            279029..279943
                     /locus_tag="ABZJ_RS01335"
     CDS             279029..279943
                     /locus_tag="ABZJ_RS01335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000559578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000559585.1"
                     /db_xref="GI:446481731"
                     /translation="MIAAGCADLCDDCYWHQNLWNKFDQNQKVFESSDLKQQYENYIG
                     WLEKKVGSHKAALYINKHTHFFIKTEIDWNQSVPTPKQLLVRLRSSGLRKFELVMQWL
                     EEVHDIRIDMDNKKSCSERDQMEKLVQRILQPSLAYDVVLEYKNKLEEKIKRGETSIR
                     SARLAVKPAVALMLSMEGESAQLPNLEHVKAYLAEYSGQAAALTGFINFLNENYGASI
                     DYLKLKKSDFLKTKQKKKLEMELIALTQTDLNDSELILSWVRNGLRYFHQLPYIDALK
                     IKTEMITEIEDGFTVVLNGQYYWLPKTQ"
     gene            complement(280318..280689)
                     /locus_tag="ABZJ_RS01340"
                     /old_locus_tag="ABZJ_00255"
     CDS             complement(280318..280689)
                     /locus_tag="ABZJ_RS01340"
                     /old_locus_tag="ABZJ_00255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000529372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000529372.1"
                     /db_xref="GI:446451517"
                     /translation="MGQAKQRGTLEQRVKQAQEQKDDFYGTERSVAEVLAELGLPKES
                     TVKGYVIHLPEKDEFVAAINDNNISFSVAYARTPELAMIYDEPQKAISDAKKISKHKL
                     LVCVLFETSNQYMINDIWANY"
     gene            complement(280762..281061)
                     /locus_tag="ABZJ_RS01345"
                     /old_locus_tag="ABZJ_00256"
     CDS             complement(280762..281061)
                     /locus_tag="ABZJ_RS01345"
                     /old_locus_tag="ABZJ_00256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001095006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001095006.1"
                     /db_xref="GI:447017750"
                     /translation="MNTMLISPTLNVSCSENVLLKISSYFGVSHEQAYRKGVDSLLKL
                     TEMVIANNEHSEIIKLFLCDCHLRTSINLDDISDMPTQLIGDCLNVIVLRYAFVV"
     gene            complement(281129..281980)
                     /locus_tag="ABZJ_RS01350"
                     /old_locus_tag="ABZJ_00257"
     CDS             complement(281129..281980)
                     /locus_tag="ABZJ_RS01350"
                     /old_locus_tag="ABZJ_00257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000034565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein A"
                     /protein_id="WP_000034564.1"
                     /db_xref="GI:445956709"
                     /translation="MSKIIACIDGSLVTNTVCDYAAWFSDKLNSPIKLLHVIDKPKAK
                     APQDLSGAIGLGSRETLLKELVELEERKGKIELEHGQILLREAKNYLLEKFSIDAQSF
                     QRHGSVLETIMGMEDDIRVLVMGKHGNETEHDSSKIGTHIENVVRALHKPVLITSAPF
                     SPPKSFLIAFDGSQTARKCVERIASSPLLKGLAVHLVYVGNPNSEMQNQLSWAKEQLE
                     SQGFNITSNTLDGEVDKAIINYAEQHQIDLIVVGAYGHSKIRQFFIGSTTTKVITSAN
                     KPVLLLR"
     gene            complement(281993..283480)
                     /locus_tag="ABZJ_RS01355"
                     /old_locus_tag="ABZJ_00258"
     CDS             complement(281993..283480)
                     /locus_tag="ABZJ_RS01355"
                     /old_locus_tag="ABZJ_00258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000953322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="WP_000953322.1"
                     /db_xref="GI:446876066"
                     /translation="MLSTIREQWFSNIRGDVLAGIVVALALIPEAIAFSIIAGVDPKV
                     GLYASFCIAVVIAFVGGRPGMISAATGAMALLMVTLVKEHGLQYLLAATILTGFIQIL
                     AGYLKLGALMRFVSKSVVIGFVNALAILIFMAQLPELTNVTWHVYAMTIGGLAVIYLF
                     PYIPVIGKLLPSPLICIVLLTLFALFIGLDVRTVGDMGQLPDTLPIFLLPDIPLNLET
                     LAIILPYSLGLAAVGLLESMMTATIVDDLTDTTSDKNRECKGQGVANVASGFLGGMAG
                     CAMIGQSIINVKSGGRTRLSSFSAGVFLLIMVVFISDWLKAIPMAALVAVMIMVSIGT
                     FNWDSLRNIRQYPLSSNIVMIVTVVVVVATHNLAYGVLVGVLLSALFFANKIERYMAI
                     QSVFDESESTRTYTVTGQVFFSSADKFTSAFDFKEALSKVVIDVSQAHFWDVSAVAAV
                     DKVVIKFRREGTEVELIGMNEASKTLVDKFGIHDKPDALDRLNSH"
     gene            complement(283775..285571)
                     /locus_tag="ABZJ_RS01360"
                     /old_locus_tag="ABZJ_00259"
     CDS             complement(283775..285571)
                     /locus_tag="ABZJ_RS01360"
                     /old_locus_tag="ABZJ_00259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002048912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001144964.1"
                     /db_xref="GI:447067708"
                     /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEV
                     LLIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTDQSYRFSGKLITKRFS
                     FDFTNNKPKNIKLTDRIPNTSDYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNH
                     CLMHSNDGTQVITSSIHVLHSLFVNRKDIRGLLLGTSSQSIINRFLESYTTEIVDDNV
                     EYKIKIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEITEFNHLQQGTGKRYP
                     IVFPPHPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTISKPDEK
                     NPRPREKSQNKNEHINTQKPPSRTSGEYRKRSEVETGNTQGILKYSFNEPTDDPIEVG
                     ASNQPYSDKSEEVETSSDEPYGNQNTKIKKSETTDTPPSRDERFDIQYIIQSLQELAS
                     EMGSPLEHLSAINEHGEMIASINLLQIKKLVPEPKHPSWIDYDKGRKLLFLKLDLKDQ
                     NGFSYLIDIHKNKNHEAFCAFLIFTQNKLTSEQIKKICIELENAKGIKKWALYCDSFI
                     HKMIAIKHLYATPDEWKNRFKNLFISLQKDKS"
     gene            complement(285654..286871)
                     /locus_tag="ABZJ_RS01365"
                     /old_locus_tag="ABZJ_00260"
     CDS             complement(285654..286871)
                     /locus_tag="ABZJ_RS01365"
                     /old_locus_tag="ABZJ_00260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001089073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetracycline resistance protein"
                     /protein_id="WP_001089073.1"
                     /db_xref="GI:447011817"
                     /translation="MNSSTKIALVITLLDAMGIGLIMPVLPTLLREFIASEDIANHFG
                     VLLALYALMQVIFAPWLGKMSDRFGRRPVLLLSLIGASLDYLLLAFSSALWMLYLGRL
                     LSGITGATGAVAASVIADTTSASQRVKWFGWLGASFGLGLIAGPIIGGFAGEISPHSP
                     FFIAALLNIVTFLVVMFWFRETKNTRDNTDTEVGVETQSNSVYITLFKTMPILLIIYF
                     SAQLIGQIPATVWVLFTENRFGWNSMMVGFSLAGLGLLHSVFQAFVAGRIATKWGEKT
                     AVLLGFIADSSAFAFLAFISEGWLVFPVLILLAGGGIALPALQGVMSIQTKSHQQGAL
                     QGLLVSLTNATGVIGPLLFAVIYNHSLPIWDGWIWIIGLAFYCIIILLSMTFMLTPQA
                     QGSKQETSCQFHK"
     gene            286953..287576
                     /locus_tag="ABZJ_RS01370"
                     /old_locus_tag="ABZJ_00261"
     CDS             286953..287576
                     /locus_tag="ABZJ_RS01370"
                     /old_locus_tag="ABZJ_00261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000088607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_000088605.1"
                     /db_xref="GI:446010750"
                     /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWH
                     VKNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLG
                     TRPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERET
                     PTTDSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS"
     gene            complement(287554..287958)
                     /locus_tag="ABZJ_RS01375"
     CDS             complement(287554..287958)
                     /locus_tag="ABZJ_RS01375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000512977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_000512977.1"
                     /db_xref="GI:446435122"
                     /translation="MGISLNHGVHAKVSTPVHLRKARTCYDHLAGEVAVKIYDSLCQQ
                     QWITENGSMITLSGIQYFHEMGIDVPSKHSRKICCACLDWSERRFHLGGYVGAALFSL
                     YESKGWLTRHLGYREVTITEKGYAAFKTHFHI"
     gene            complement(288196..289689)
                     /locus_tag="ABZJ_RS01380"
                     /old_locus_tag="ABZJ_00263"
     CDS             complement(288196..289689)
                     /locus_tag="ABZJ_RS01380"
                     /old_locus_tag="ABZJ_00263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001120888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001120888.1"
                     /db_xref="GI:447043632"
                     /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMA
                     EQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARR
                     MAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKK
                     AGHTHQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPE
                     LTQLTHTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQ
                     AGRKVFTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSE
                     KRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPN
                     SRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAM
                     KVIACIEDPIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD"
     gene            complement(289900..290124)
                     /locus_tag="ABZJ_RS01385"
     CDS             complement(289900..290124)
                     /locus_tag="ABZJ_RS01385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000743213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000743213.1"
                     /db_xref="GI:446665867"
                     /translation="MKKPNQDDEPFFITEEIAAEMIAGGYEFELPPIPCTIRLRDVLE
                     RMTDAELALQPGEIADQERERCRRKPCSTS"
     gene            complement(290244..291080)
                     /locus_tag="ABZJ_RS01390"
                     /old_locus_tag="ABZJ_00265"
     CDS             complement(290244..291080)
                     /locus_tag="ABZJ_RS01390"
                     /old_locus_tag="ABZJ_00265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017397613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="StrB"
                     /protein_id="WP_000480968.1"
                     /db_xref="GI:446403113"
                     /translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLK
                     PIEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATE
                     IAAELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMM
                     SNASELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDP
                     RRIAQMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQT
                     SY"
     gene            complement(291080..291883)
                     /locus_tag="ABZJ_RS01395"
                     /old_locus_tag="ABZJ_00266"
     CDS             complement(291080..291883)
                     /locus_tag="ABZJ_RS01395"
                     /old_locus_tag="ABZJ_00266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005826108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_001082319.1"
                     /db_xref="GI:447005063"
                     /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASR
                     RGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAW
                     PSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLL
                     ARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLA
                     LMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"
     gene            complement(292266..294053)
                     /locus_tag="ABZJ_RS01400"
                     /old_locus_tag="ABZJ_00267"
     CDS             complement(292266..294053)
                     /locus_tag="ABZJ_RS01400"
                     /old_locus_tag="ABZJ_00267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002011499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001144971.1"
                     /db_xref="GI:447067715"
                     /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEV
                     LLIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTNYTYRFSGKLITKRFS
                     FDFSNNKPRNIKLSDKIPDTSEYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNH
                     CLMHSNDGTQVITSSIHILHSLFVNRKDIRGLLLSTSGQSIINRFLESYTTEVENDNI
                     EYKIKIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEVTEFHHLQHGTGIRYP
                     IVYPPHPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTVSKTDEK
                     NPRPREKSQNKNEHINTQKPPSRTSGEYRKRSDVETGNTQNILKYSFNEPANDPIEVG
                     TSNHPYSDKSEDVETSSDEPYGNKNTKTKKSETTDNPPSRDERFDIQYIIQSLNHLTL
                     DTTSPLERVYSIDILGNEIHGFNLLQIKKLVPQPKHPSWIDAEFGRKLLFLKLELKDQ
                     HDQYYLIDIHKNKSHEAFCAFIIVSPHKLTREQIKNICIELENAKGIKKWTLRCESFT
                     KKIISIKHSSATPDEWKNRFKNLFSTLIN"
     gene            complement(<294154..294993)
                     /locus_tag="ABZJ_RS01405"
                     /old_locus_tag="ABZJ_00268"
     CDS             complement(<294154..294993)
                     /locus_tag="ABZJ_RS01405"
                     /old_locus_tag="ABZJ_00268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456995.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative Mg chelatase-like protein"
                     /protein_id="WP_000010463.1"
                     /db_xref="GI:445932608"
                     /translation="MSFSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRE
                     SKDRVRSAIINSGFQFPTKRLTINLAPADLPKDGSRLDLPIALGILIASGQLPENCTE
                     DFEFIGELALDGHVRPVSGALTLAMACQQAQHKIVLPVDNSQDISHLPNLECYPVNHL
                     KEVCEHFLGTQKLAHAQPSDHSNEMPYKFDLADVKGQLRPRRALEIAAAGGHSLLFKG
                     PPGTGKTLLASRLPSILPPLSTQETLEVASIYSISNTPHTFGQRPFRAPHHTASAIAL
                     VGGG"
     gene            complement(295059..295286)
                     /locus_tag="ABZJ_RS01410"
                     /old_locus_tag="ABZJ_00269"
     CDS             complement(295059..295286)
                     /locus_tag="ABZJ_RS01410"
                     /old_locus_tag="ABZJ_00269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004699277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000894500.1"
                     /db_xref="GI:446817244"
                     /translation="MLETLLQAILEQIDEPKKDLEKNLRALLNETVEKLDLVSKQEIE
                     RQKTALHLANQRLEALQKQVSLLEEALKNKK"
     gene            295566..295904
                     /locus_tag="ABZJ_RS01415"
                     /old_locus_tag="ABZJ_00270"
     CDS             295566..295904
                     /locus_tag="ABZJ_RS01415"
                     /old_locus_tag="ABZJ_00270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005248434.1"
                     /note="indirectly regulates nitrogen metabolism; at high
                     nitrogen levels P-II prevents the phosphorylation of NR-I,
                     the transcriptional activator of the glutamine synthetase
                     gene (glnA); at low nitrogen levels P-II is uridylylated
                     to form PII-UMP and interacts with an adenylyltransferase
                     (GlnE) that activates GlnA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II 1"
                     /protein_id="WP_000780326.1"
                     /db_xref="GI:446702980"
                     /translation="MKLVTAIVKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTE
                     LYRGAEYVVDFLPKVKIEIAISDEMVDAVIESITRVASTGKIGDGKIFVTNLEQVIRI
                     RTGETGPDAV"
     gene            295962..297359
                     /locus_tag="ABZJ_RS01420"
                     /old_locus_tag="ABZJ_00271"
     CDS             295962..297359
                     /locus_tag="ABZJ_RS01420"
                     /old_locus_tag="ABZJ_00271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004842762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonia channel protein"
                     /protein_id="WP_000738520.1"
                     /db_xref="GI:446661174"
                     /translation="MKKMLMALSLTGALLGGTAAWAEETVTTPTSEVTATSTSEAPAT
                     IAAAPAAEETPAAPTPTAKLDTGDTSWILISTALVLLMTIPGLALFYGGMVRKKNVLS
                     TMMFSLSAAILVSLLWVIAGYSIAFSGTGAYFGDLSKAMLNGVAFDALSGTIPESLFV
                     IFQMTFAIITVAILSGSIADRMKYSAFMAFIAIWVLVVYAPITHWVWAADGWLFKAGA
                     LDFAGGTVVHINSGVAGLVAAYMLGKRIGLGRESMAPHNLTLTVIGASLLWVGWFGFN
                     GGSALGAGARASMAILVTQVAAAAAAFSWLVVERMIRGKASVLGGASGAVAGLVVITP
                     AAGFVGVGGALVMGLIGGVVCFWGITALKRLLKADDALDAFGLHAVGGIVGAILTGVF
                     YSDEIIKAANVALAPTFAGQLWVQVEGVLATMVYSGIATFIILKVIDLIIGLRVNSDD
                     ERMGLDLSQHGERIE"
     gene            297517..297975
                     /locus_tag="ABZJ_RS01425"
                     /old_locus_tag="ABZJ_00272"
     CDS             297517..297975
                     /locus_tag="ABZJ_RS01425"
                     /old_locus_tag="ABZJ_00272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004795187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NrdR family transcriptional regulator"
                     /protein_id="WP_000543541.1"
                     /db_xref="GI:446465687"
                     /translation="MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESY
                     EVVMPRVIKSNGKNEPFDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERD
                     VKSRTIGEIVMQSLFALDHVAYVRFASVYQDFQDVEAFRRQIEQMQQREH"
     gene            297991..299076
                     /locus_tag="ABZJ_RS01430"
                     /old_locus_tag="ABZJ_00273"
     CDS             297991..299076
                     /locus_tag="ABZJ_RS01430"
                     /old_locus_tag="ABZJ_00273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxycytidylate deaminase"
                     /protein_id="WP_001292506.1"
                     /db_xref="GI:447215250"
                     /translation="MSELKQDQYWMQQAIELAKRGLYSTKPNPNVGCVIVKDDQLIGE
                     GFHPKAGQPHAEVFALRQAGEQAQGATAYVTLEPCAHYGRTPPCAEALVKAQVKKVVV
                     ACPDPNPLVAGKGVQILKNAGIEVEIGICEDLAAQLNQGFLKAMSTGMPYVRLKVASS
                     LDGRTAMASGESKWITGSAARQDVQHWRAISGAVITGIETVIADDCQLNVRSLHNVDI
                     ETVAQPKRVILDRRGRLPLTAKILENPETVMVMGPYRQELADLGVIQLEIQPLKTLLQ
                     TLSKQYQIYDVLIEAGATLSSAFLQEGLIDEMISYVAPTLLGQSARAMFNADFEYMAQ
                     QLRFKLLDVTQLDQDIRLRLIPTQEKV"
     gene            299073..300365
                     /locus_tag="ABZJ_RS01435"
                     /old_locus_tag="ABZJ_00274"
     CDS             299073..300365
                     /locus_tag="ABZJ_RS01435"
                     /old_locus_tag="ABZJ_00274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004699273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA modification methylase"
                     /protein_id="WP_001083669.1"
                     /db_xref="GI:447006413"
                     /translation="MNSEPSVYHKRRHAARTTDEYLFHQLVPYLGNKRRLLHLILEAL
                     EITGTLNSKKKNPPIFADFFAGSGVVSRLARQNGYRVIANDWEPYSHALNHAILACVD
                     APAFKELGGYQKAIDYLNRLPEVKGWVTHNLCPRNDDVYDPSRDRLFFKRRNGMRIDA
                     IRQQIATWQAQGAINDVEMSALLAPLLYSASFVSNTSGVFKSFHQGWGGRTQTALERI
                     ESLLWLTPSRFCEIGDRKRPAAEMWCVDAQHLANQMSGFEVDVAYLDPPYNQHAYSSN
                     YHVLNALTLWDQVDLPPPDTKGYKSGIDRAWRKERPSPYNSSKHAKDAYEKLLSTINA
                     RYILTSYSTDGNIEPKDLLMANLERGKVTLLTQDVPRYRVSKQRQSERARVLEFIVIT
                     DTHAKPGPPLRQLLGQLYHFAELGGVDTSGNSTQLALW"
     gene            300408..301067
                     /locus_tag="ABZJ_RS01440"
                     /old_locus_tag="ABZJ_00275"
     CDS             300408..301067
                     /locus_tag="ABZJ_RS01440"
                     /old_locus_tag="ABZJ_00275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016805951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase subunit alpha"
                     /protein_id="WP_000493866.1"
                     /db_xref="GI:446416011"
                     /translation="MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATN
                     GICLTVIEWGDNWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHV
                     DGVGEITLVREDARSIYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLI
                     PHTAERTNIGTWQVGSKVNLEVDVLARYIERLLLGDKAAEQKTESNISMAFLAENGFL
                     K"
     gene            complement(301127..301345)
                     /locus_tag="ABZJ_RS01445"
                     /old_locus_tag="ABZJ_00276"
     CDS             complement(301127..301345)
                     /locus_tag="ABZJ_RS01445"
                     /old_locus_tag="ABZJ_00276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000354152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000354154.1"
                     /db_xref="GI:446276299"
                     /translation="MDIPHQISTQIEQLNQGEQWTFSAQELYMSHNDFNSLSILLTRA
                     SEKGEFSITRTQHNKPWVGTHSVTLTKH"
     gene            complement(301476..302030)
                     /locus_tag="ABZJ_RS01450"
                     /old_locus_tag="ABZJ_00277"
     CDS             complement(301476..302030)
                     /locus_tag="ABZJ_RS01450"
                     /old_locus_tag="ABZJ_00277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002008139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002008139.1"
                     /db_xref="GI:487934673"
                     /translation="MARICDLLEPQTPIQLWVLNDEKAQLESQQNIEKAYADLKAELI
                     EQARIRRQLALEKALADKRAKEAAYAAELQADEVRKFSEQTEALQALRSHLEQEVAEH
                     TARYQKNPETPAIDYSSGAKLSITDDQILSELESVRVRLELEAESLIEQAVTVFRAKL
                     HAAAQEEIEYILKNSNFSDEKIEK"
     gene            complement(302152..302558)
                     /locus_tag="ABZJ_RS01455"
                     /old_locus_tag="ABZJ_00278"
                     /note="DNA polymerase III subunit chi; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(302551..303999)
                     /locus_tag="ABZJ_RS01460"
                     /old_locus_tag="ABZJ_00279"
     CDS             complement(302551..303999)
                     /locus_tag="ABZJ_RS01460"
                     /old_locus_tag="ABZJ_00279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005112463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase A"
                     /protein_id="WP_000673449.1"
                     /db_xref="GI:446596103"
                     /translation="MKFTTYTTFPEQTSNESLWILVDSEQLQSNLNTYQINNLESILT
                     ATQFKANFNETLPLFGQLSTQPHSQLLGLGKAAELQAAKLAKLAQTIIKSAQNKFKHI
                     AIDIAALPVEYHYLFALSLTQAAYGYDEFKSKKNEFVLQQVDLISSQTSLDENQLALV
                     HAVQSGQSYARDLGNRPGNICFPEYLAEQALALAAEFPDLLKVTVLNEQQMADLGMYA
                     FLAVSKGSERPGRIVTLEYQAQLEQAPVVLVGKGVTFDTGGISLKPGLGMDEMKFDMC
                     GAASVLGTIRALCEARLPIHVVGAIAAAENMPSGKATRPGDIVTTMSGQTVEILNTDA
                     EGRLVLCDTLTYIKRFNPAVVIDIATLTGACVVALGKVLSGLFSPDDTLAAELQQAGE
                     QSFDRVWRMPVIDDYQELLDSPFADIANIGGPHGGAITAACFLERFTRDYRWAHLDVA
                     GTAWLSGSAKGATGRPVPLLMQFLANRVSTNG"
     gene            304143..305243
                     /locus_tag="ABZJ_RS01465"
                     /old_locus_tag="ABZJ_00280"
     CDS             304143..305243
                     /locus_tag="ABZJ_RS01465"
                     /old_locus_tag="ABZJ_00280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003317163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_000586912.1"
                     /db_xref="GI:446509384"
                     /translation="MIIRRYLVKQVVSTSLVVIALLTLIMMGGRLIKYFGVAAQGRLD
                     ASILFSIIGYRLPEFLTLILPLGFFIGLMLVFGRLYVDHEMAVLNGSGVSRHQLARLL
                     IPMTLVYMVCQSVLMLWMTPWGLREFEKLTTTQAVRTGFDLVRPREFISSGPYTIYAG
                     SLSEDRKNLKDIFFYQRAAKEGKPDVMILAKEATRVEVANDTANVVDLVQGRRYEIFP
                     GQPKYTQAEFQSYRLRLENDKDVKFESGDVEALSTSKLFSKANDPVVRSELGWRLFGP
                     FTIIIALMLSVALSEVSPRQGRYYRLIPSIFIFASLIVLMIAIKTRISKGELDIWAYP
                     VALLVYAIAAALFSRKQKLGPKIKKQIKRVKL"
     gene            305243..306313
                     /locus_tag="ABZJ_RS01470"
                     /old_locus_tag="ABZJ_00281"
     CDS             305243..306313
                     /locus_tag="ABZJ_RS01470"
                     /old_locus_tag="ABZJ_00281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_000881094.1"
                     /db_xref="GI:446803838"
                     /translation="MLARRIVAKYVTKTTALAMFGTTIVLSVLQILFTYLGELGELKP
                     DYNAWQAFIYVLWGAPRYLYEILPISALIGAVIGLGALASNSELIVMRSVGISLWRIV
                     GWVMRSALLLIVLSFALSEWVVPYTNEKAQSVKSHRSVAALGEVKGYWSREGQRFIYI
                     DYANSQGNLRDIQVVDFNKDYHLQSLINAEQGKFIQDGQWTLQKASQMDILTDGNSIL
                     NNHDQQSLGLALQPKYVHMVTLDPEDLSPSQLISFMRYMDEYSQVPKTYQLAFWQKVA
                     SPFSLITLVLVACSFIFGPLRQQSMGFRLVIALFIGLGFYYLQDFLGYASLVYAPSPA
                     WFVLMPIILMFGAGSYLLYRAR"
     gene            306439..307986
                     /locus_tag="ABZJ_RS01475"
                     /old_locus_tag="ABZJ_00282"
     CDS             306439..307986
                     /locus_tag="ABZJ_RS01475"
                     /old_locus_tag="ABZJ_00282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000128738.1"
                     /note="catalyzes the interconversion of 2-phosphoglycerate
                     and 3-phosphoglycerate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase"
                     /protein_id="WP_000128749.1"
                     /db_xref="GI:446050894"
                     /translation="MTDATAGKIPHVLVIMDGVGHREAIEDNAFLAAKTPNLTAMKAK
                     HPNSLISGSGEDVGLPDGQMGNSEVGHMNLGAGRVLYQDFTRITKDIRTGAFFEHEVL
                     VDAVEKAKAAGGAVHIMGLLSEGGVHSHEDHIVAMCELALKRGAKVYLHAFLDGRDTP
                     PRSAQPSLEKLDALFAQYEGKGRIATMIGRYFAMDRDNRWDRVEQAYRLLTEGEAVRT
                     ATTAVEGLELAYAANENDEFVKATRIGEIAKVQDGDSVVFMNFRADRAREITRAFVEK
                     DFAGFERKVVPNLSKFVMLTRYQASIDAPVAYMPEELKNSLGEYLSSLGKTQLRIAET
                     EKYAHVTFFFSGGREDEYPGEKRILIPSPNVATYDLKPEMSAYEVTDELVKAINSGEY
                     DLLVVNYANGDMVGHTGVFDAAVKAVEAVDTCLGRVYEAVMAKKGHMLITADHGNVEQ
                     MQDYESGQVHTQHTTELVPFIYVGPTQATIAEGGVLADVAPTILNLMQIPVPAEMQGR
                     NLITLSA"
     gene            308002..309186
                     /locus_tag="ABZJ_RS01480"
                     /old_locus_tag="ABZJ_00283"
     CDS             308002..309186
                     /locus_tag="ABZJ_RS01480"
                     /old_locus_tag="ABZJ_00283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000332764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S41"
                     /protein_id="WP_000942504.1"
                     /db_xref="GI:446865248"
                     /translation="MLQYNIYKAFFVSVLMCCSQLAFAAPVVKEKLSSLHPDSPESEE
                     SYAEVPIESIQQFVQIYGIVRDNYVDEKSDDALFLQAIKGLVSGLDRYSRYLSAEEYR
                     QLIQYTEGDLASVDFVLSPESHVHKWMIRDLKTGSDSYKLGLRNGQTILKIDNQELKN
                     LTHDQVLGLLYGSIGSTLQVQTEESNSPISLVRNKKIETDIEPVMLHNQVLVLKIRVF
                     QQDTANEIKRLIEENSSSRLKAVLIDLRNNPGGLLSAAVESADLFLNHGIIVSTKSRS
                     EGNQQFQALPGNDFQNIKVGILINHRSASAAEVFTAAMKEHQRAWVMGEKSYGKGVVQ
                     KLFPLPSGAALQMTVSHYYTPNGNMIEGQGIQPNQTYPLPPEMKEEVYLDRVADLLLK
                     RK"
     gene            complement(309190..310611)
                     /locus_tag="ABZJ_RS01485"
                     /old_locus_tag="ABZJ_00284"
     CDS             complement(309190..310611)
                     /locus_tag="ABZJ_RS01485"
                     /old_locus_tag="ABZJ_00284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002131933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_000840549.1"
                     /db_xref="GI:446763293"
                     /translation="MAEQQPLVLLVDDEEDLCLLMQMTLARMGIKTHLAYRVEQAKQL
                     FTQFHYDACLTDLNLPDGSGIDLVKHVSQNYTNTPIAVLTAYGNMDIAIAALKAGAFD
                     FVSKPVNQVHLDQLLQKALNRQKVEHDAAENALENKLLIGRSLPIQQLRIAIKKIARS
                     QAPVFVTGESGTGKEVVANLVHRLSNRSEGPFIAINCGAIPTELMESELFGHKKGSFT
                     GATQDKQGLILSAHGGSLFLDEIAELPLSMQVKLLRAVQEKKIRPVGSDQEIDVDFRV
                     ISASHQDLDLLVRQGKFRQDLFFRIHVMDLILPPLRERGEDVLLLANHFIQKICMEWE
                     TPPKQLTEAAETYLLQQHFPGNVRELRNMIERAITLSEDTTIDVSHLHPAPLRANISN
                     PFASAAQSIQTTVAAPQVVKKLPSEGLERYLENIEKDILLNALNMTHWNRTLAAKKLG
                     MTFRSLRYRLKKFGLDTETEQEV"
     gene            complement(310636..312204)
                     /locus_tag="ABZJ_RS01490"
                     /old_locus_tag="ABZJ_00285"
     CDS             complement(310636..312204)
                     /locus_tag="ABZJ_RS01490"
                     /old_locus_tag="ABZJ_00285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001981717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_001160333.1"
                     /db_xref="GI:447083077"
                     /translation="MQFPLNSSLSHTIFRLGTWYGLYRLIIAVSLNIILVLTDAQTDN
                     SLQQPALYSYTLLGYSLLSLVQLLCFKFIATQATRQLILFFIVDIICLSLLTFSVGEP
                     NLQLSLLYVIAIFTSAILLSARMSLLITLLAVIAVIYQRFVGSLFDYNNLNTIGNSAL
                     LAFLFFVVHGIGQIAVQRFKLLEALTFHQSIELYQLQNINRYILEQIEEGYLVLDENY
                     DIVVSNPAACSLLGIPPQFANEKYPLAKWHADLFEILKFGDLKEGDRFIFESRLSAYS
                     INIKVQHLLVPQQTLTLLILQDAQQINQQAQQLKLAALGQLSASIAHEIRNPLAAIVQ
                     ANELLKDSDPEQQNTLRHMIGKQTKRIDSIVQDTLGLARSERTHPIQIDVKHFIVTLL
                     EEDLFDVKHSIQLKISDSSLKFLFDEKQLRQVMINLVRNALRHNAPDSPYITINIHSQ
                     TNKIYIDVIDYGEGVSKRDISQLFKPFFSTEINGTGLGLYLSHSFCEANHAKLTYVEQ
                     KQGACFRIECPIIY"
     gene            complement(312215..312850)
                     /gene="sirA"
                     /locus_tag="ABZJ_RS01495"
                     /old_locus_tag="ABZJ_00286"
                     /gene_synonym="uvrY"
     CDS             complement(312215..312850)
                     /gene="sirA"
                     /locus_tag="ABZJ_RS01495"
                     /old_locus_tag="ABZJ_00286"
                     /gene_synonym="uvrY"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000633800.1"
                     /note="in Escherichia coli the protein UvrY is part of a
                     two-component system along with BarA that is needed for
                     efficient switching between glycolytic and gluconeogenic
                     carbon sources possibly by regulating the Csr system; in
                     Salmonella SirA and BarA regulate virulence gene
                     expression also via the Csr system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_000633799.1"
                     /db_xref="GI:446556453"
                     /translation="MITVLVVDDHELVRTGICRMLEDHADVEVIGQAESGEEAIAIVR
                     QQHPQVVLLDVNMPGIGGVETTRRLLQTAPETKVIAVSGLAEEPYPSLLLKAGAKGYI
                     TKGAPIAEMVRAINKVMQGGKYFSADIAEQLASSYLSDTQQSPFDSLSEREMQVAMMV
                     VNCISAQEIADKLFVSVKTVNTYRYRIFEKLGIDSDVKLTHLAIRYGLIKP"
     gene            313102..314109
                     /locus_tag="ABZJ_RS01500"
                     /old_locus_tag="ABZJ_00287"
     CDS             313102..314109
                     /locus_tag="ABZJ_RS01500"
                     /old_locus_tag="ABZJ_00287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001988706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine endopeptidase"
                     /protein_id="WP_000025645.1"
                     /db_xref="GI:445947790"
                     /translation="MSILLSLSSTSFAELVNNPSSGSTGTASLNWSAADASQLLNDED
                     DEPTPQGSTSVTTTLRGSNAPRVITSTPKVAPIRDTVGYNAQPSVSARAALVMDAQTG
                     EVLYSKNTNASVPIASITKLMTAVVTADARLNMSEEITLEQIDFAGAGGKNSSSTLRV
                     GDKMNRAEVLLFALMKSENPAAAALARTYPGGRAAFVAAMNAKARALGMNATHYYEST
                     GLDPRNVSSARDLGILASTASQYGLIRQFSTTPTYDFNLGYRVLKSNNTNALVRNGGW
                     NINLSKTGYINEAGRCVVMHTTVNSRPAVIVLLGEPSTQARNNDATNLLGWLSNLPKR
                     I"
     gene            complement(314216..315355)
                     /locus_tag="ABZJ_RS01505"
                     /old_locus_tag="ABZJ_00288"
     CDS             complement(314216..315355)
                     /locus_tag="ABZJ_RS01505"
                     /old_locus_tag="ABZJ_00288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004674289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="WP_000063593.1"
                     /db_xref="GI:445985738"
                     /translation="MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPR
                     IIGKDVEIYVKYEGLNPTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAA
                     RAGIKAFVLIPEGKIAMGKMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNS
                     INPYRLQGQKTIAYEIVEALGRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQ
                     VVYDAATDQFTGPKPEGLPTMVGYQASGAAPFLRGAPVEKPETVATAIRIGNPQSWNH
                     AKAVVRDSKGWFDELQDSEILEAQRLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEG
                     SVIVCTVTGNGLKDPDTAIKQCADAVMLSIDATMDQVKDSILSNM"
     gene            complement(315411..316712)
                     /locus_tag="ABZJ_RS01510"
                     /old_locus_tag="ABZJ_00289"
     CDS             complement(315411..316712)
                     /locus_tag="ABZJ_RS01510"
                     /old_locus_tag="ABZJ_00289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019385864.1"
                     /note="catalyzes the formation of L-aspartate
                     4-semialdehyde from L-homoserine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="WP_000805827.1"
                     /db_xref="GI:446728514"
                     /translation="MKPVRLAILGLGTVGGGALKLLQENAAEIKRRTGREIQITHVGT
                     RRPRPDLELEGIKQSADLLDIVRQPDVDVVVEVMGGIHPAYEIIMEAIKHGKQVVTAN
                     KALLAEHGNELFKAAEDNAVQIAYEAAVAGGIPIIKVIREGLAANHIEWLAGIINGTG
                     NFILTEMREKGRAFDDVLKEAQELGYAEADPTFDVEGIDAAHKLTILASCAFGIPLQF
                     DKVYTEGISKITAQDVKYAEELGFRIKHLGIARRAEKGIELRVHPTLIPDEQLIANVN
                     GVKNAVLVQANAVGPTLYYGAGAGAGPTASAVVADVIDIVRDISYTEDGAGTIPQLAF
                     EALTNMPILSREEMTTGYYIRLNAEDQTGVLADVTTILSRAGISIDAIMQQSRLKDLI
                     PIVILTDPIVESKMDDALAQIQALPAIRGEIVRIRLESLDS"
     gene            complement(316957..317772)
                     /locus_tag="ABZJ_RS01515"
                     /old_locus_tag="ABZJ_00290"
     CDS             complement(316957..317772)
                     /locus_tag="ABZJ_RS01515"
                     /old_locus_tag="ABZJ_00290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005120616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_000011159.1"
                     /db_xref="GI:445933304"
                     /translation="MSFTRSQIFLACALASSLLFSACSKENKPQKEDALTATAPATGE
                     ASTIIERNAKQRLIETLQKQFKNANINVKILDIKPTEVPNLYWVNLEGMTSVYTTSDG
                     KYLIQGDVIRLGDKELHNIGDSLQASENKKHLAALKNEDLIVYPAKGGKAKHVIYVFT
                     DASCPYCHKLHEHLAEINEKGIEVRYIAWPRGEQFMPTMEAVWCSADRKAAFDQAVQG
                     ISIPPAQCKNPVREQYQLGLNMGVNGTPAIYNVDGEYLGGYLTPDELIKRLDK"
     gene            complement(317919..318839)
                     /locus_tag="ABZJ_RS01520"
                     /old_locus_tag="ABZJ_00291"
     CDS             complement(317919..318839)
                     /locus_tag="ABZJ_RS01520"
                     /old_locus_tag="ABZJ_00291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002067991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerD"
                     /protein_id="WP_000608730.1"
                     /db_xref="GI:446531384"
                     /translation="MINKKPRIPSPVQIPEHLSFLQGFRDYLVAQTVSPHTRNAYLSD
                     LIQCSELHKKNRLPDWTSDDISDVLIELTKVGKSPRSIARCLSALRQFYKFLREQKLR
                     SDNPVATHHSPKIGRALPKDLCEEDVEALIQAPDITTALGLRDRAMFEVLYACGLRVS
                     ELLNLRLELINLKQGYLRITGKGNKERLVPLGQYACDWVERYLNEARPQFYKSSTDYL
                     FLTQHGGIMSRQNFWYAIKRYALQANIQAELSPHTLRHAFATHLLNHGADLRVVQMLL
                     GHSDLSTTQIYTHVAQVRMQQLHEKHHPRG"
     gene            318947..319246
                     /locus_tag="ABZJ_RS01525"
                     /old_locus_tag="ABZJ_00292"
     CDS             318947..319246
                     /locus_tag="ABZJ_RS01525"
                     /old_locus_tag="ABZJ_00292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016139511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_000288743.1"
                     /db_xref="GI:446210888"
                     /translation="MYTSKKGLGSDAVRLSALKVKQAATITKVNRIEVESEQQDLVAI
                     RLESLGFVPGTRVEVITKGVFGGDPILIQIGFTRFALRKAEAEKIEIQVEEGVPA"
     gene            319243..321096
                     /locus_tag="ABZJ_RS01530"
                     /old_locus_tag="ABZJ_00293"
     CDS             319243..321096
                     /locus_tag="ABZJ_RS01530"
                     /old_locus_tag="ABZJ_00293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017400168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoB"
                     /protein_id="WP_001278225.1"
                     /db_xref="GI:447200969"
                     /translation="MSDALRIALVGNPNCGKTSLFNHLTGTRQKVANYAGVTVERKVG
                     HFQLPSGRSVRVLDLPGTYSLNATSPDEAITRDVCLGKIAEEGQQDAFLCVVDATNLK
                     LHLGLVLEMIELGRPILLVLNMMDEARRRGIQINTQKLSQRLGVPVVETVAVRNAGIE
                     NLLHALDQEKYSVPQTELSGLTGTHHQKIDMIFKDVVHYVDQEDKRTDFLDRIFLHPV
                     LGLLSLAIMMFIVFQAVFAWAAPFMDGIEGFFGWLGEVVGSVITQPLLHSLVVDGIIA
                     GAGGVVVFLPQILILFFFILVLEESGYLPRAAFLLDKLMFQAGLSGRAFIPLLSSFAC
                     AVPGIMATRSISDPRDRFTTIMVAPLMTCSARLPVYALLIAAFIPEKMVWGIFNLQGL
                     VLFGLYMAGIVSALCVSFLMKFFQKDKSQHALLLELPSYRFPDLKSVGIGLLDRAKIF
                     LKRVGGIIFALSILLWFLCTFPQPPEGATLPAIDYSFAGMLGHLIQPLFAPVGFNWQI
                     CIALIPAMAAREVVVAALGTVYALSATDEDAVAQGLSHLISADGTGWSLATGLSLLVW
                     FIYAPHCLATLATVRRETGSWKHVAAMTAYLFGLAYFASFVTYQIASHYWG"
     gene            321117..321368
                     /locus_tag="ABZJ_RS01535"
                     /old_locus_tag="ABZJ_00294"
     CDS             321117..321368
                     /locus_tag="ABZJ_RS01535"
                     /old_locus_tag="ABZJ_00294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000942502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000942498.1"
                     /db_xref="GI:446865242"
                     /translation="MLQYLIIAVLVIWSAIVVFKKVFPKTANSAFSALSVFCEKQGWA
                     TLAKWLKPKMTFGCAGGCGCSSEDKPTNTIQEIKPVKWQ"
     gene            321529..322875
                     /gene="murD"
                     /locus_tag="ABZJ_RS01540"
                     /old_locus_tag="ABZJ_00295"
     CDS             321529..322875
                     /gene="murD"
                     /locus_tag="ABZJ_RS01540"
                     /old_locus_tag="ABZJ_00295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017481915.1"
                     /note="UDP-N-acetylmuramoylalanine--D-glutamate ligase;
                     involved in peptidoglycan biosynthesis; cytoplasmic;
                     catalyzes the addition of glutamate to the nucleotide
                     precursor UDP-N-acetylmuramoyl-L-alanine during cell wall
                     formation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
                     synthetase"
                     /protein_id="WP_000908243.1"
                     /db_xref="GI:446830987"
                     /translation="MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTDSRPTPPGH
                     DQIPAGVKTSFGQLDQELLLQAEEIILSPGLAPQLPEIQAAIAKGISVVGDIQLLRRA
                     TDVPIVAITGSNAKSTVTTLIGLMAKDAGKKVAVGGNLGRPALDLLKDQPELLVLELS
                     SFQLETTSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVFNRDDALSR
                     PLVPDTTPMQSFGLNAPDLNQYGVLRDADGTLWLARGLQRLIKSSDLYIQGMHNVANA
                     LACLALGEAIGLPMESMLETLKRFKGLEHRCEYVKTVRDVRYYNDSKGTNVGATLAAI
                     DGLGAAIEVKKGKVALILGGQGKGQDFSPLRSSIEKYAKVVVLIGEDAPVIEQAIQGA
                     TKILHAATLKEAVELCQRETQAEDVVLLSPACASFDMFKSYNDRGQQFVACVNSLV"
     gene            322900..324096
                     /locus_tag="ABZJ_RS01545"
                     /old_locus_tag="ABZJ_00296"
     CDS             322900..324096
                     /locus_tag="ABZJ_RS01545"
                     /old_locus_tag="ABZJ_00296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005065738.1"
                     /note="integral membrane protein involved in stabilizing
                     FstZ ring during cell division; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsW"
                     /protein_id="WP_000907680.1"
                     /db_xref="GI:446830424"
                     /translation="MAGLAQTTIQKINHWYERILPKWPAEVTPRNVLIFCVVALLCIG
                     SVMVASASMPYAEYMHENPFHYVIRHGISIVAAGVVAYLTYRISLNTWFKNTFPLWLL
                     TMVLLLAALAVGSEVNGSTRWIKIGGFTLQPTEVAKVMMAIFTADYVVRRAKEVRTHW
                     KGLLRLSGVMAITVGLIIAEPDLGATVVIVMMMVGVFFLAGAPPTQFLIMLGAIVTGI
                     VFLILFEPYRFQRLISFTDPWADPLGVGYQLSNALMAFGRGEWFGTGLGHSVQKLSYL
                     PEAHTDFMLAVLGEEFGFFGISIVIGLSFLMLACCIKIGHRALKHHYLRAGYLAYGIS
                     IIFLLQILVNAGMNMGLMPTKGLTLPFISYGGTSLMMCAAMISLILKIDASTQEVNPE
                     REESNF"
     gene            complement(324146..325078)
                     /locus_tag="ABZJ_RS01550"
                     /old_locus_tag="ABZJ_00297"
     CDS             complement(324146..325078)
                     /locus_tag="ABZJ_RS01550"
                     /old_locus_tag="ABZJ_00297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000216746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-Q tRNA(Asp) ligase"
                     /protein_id="WP_000216739.1"
                     /db_xref="GI:446138884"
                     /translation="MTVKNSPAELSSALANQRNDVPLIRYSGRFAPSPTGPLHFGSLI
                     TAVASYCDARAHQGRWLVRVEDTDIPRIYPGSEDHILASLEAFQFDPDAEIIFQKDRL
                     DIYESVLDQLKKEGLVYACQCTRKMLGSNAIYAGTCRDLHLDFQHQAIRVKVQDQPIC
                     FDDRLQGLHCSNLEHDLGDFVLKRRDGIINYQLAVVVDDYLQGITHVVRGADLLDNTE
                     RQIWLGQLLGYPKLSYMHLPLAMNDQGQKLSKQNLAHALDLTKAPELLQQAIQALGQP
                     QVDLDRPEVMLKQAVAQWNVDLIPHGQQLCGTYL"
     gene            complement(325081..325617)
                     /locus_tag="ABZJ_RS01555"
                     /old_locus_tag="ABZJ_00298"
     CDS             complement(325081..325617)
                     /locus_tag="ABZJ_RS01555"
                     /old_locus_tag="ABZJ_00298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002121205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="WP_001262524.1"
                     /db_xref="GI:447185268"
                     /translation="MANDNHNQVLDEHTEVVVEGDKASAKRARKVKPKTSDVGSTASL
                     FGIAPYQPKKNEEYMSEGQLEHFRQILQAWKAELMSEVDRTLNTMQDESTALPDVNDR
                     ATQEEEFAIELRTRDRERKLIRKIEQSLEAIKNEDYGFCETCGIEIGLRRLEARPTAT
                     LCIDCKTLAEIKEKQNNG"
     gene            complement(325828..326640)
                     /locus_tag="ABZJ_RS01560"
                     /old_locus_tag="ABZJ_00299"
     CDS             complement(325828..326640)
                     /locus_tag="ABZJ_RS01560"
                     /old_locus_tag="ABZJ_00299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005079443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphatase"
                     /protein_id="WP_000143915.1"
                     /db_xref="GI:446066060"
                     /translation="MTFQVSTLSQKNHVIIQITDTHLLEYPQLEFVGMNPEESFHAII
                     QQILKQHPEADAIIHTGDLAQAPTPITYKRYINFMQTLGLPFFQTLGNHDNVDHFPLH
                     NENHQQPVVVGLGNWRVIMLNSAVKGKVDGHLSSEQLENLANLLEQFADHPVLLACHH
                     HPFAMKSKWIDHHKLQNSNALLDTLSPFQNVKALVCGHVHQDSLNIWQGIEFFSTPST
                     SVQFKPFSNDFALDQNAPGYRYIRLNNDGSFETKVFRLENFKTRINTDISGY"
     gene            complement(326645..327271)
                     /locus_tag="ABZJ_RS01565"
                     /old_locus_tag="ABZJ_00300"
     CDS             complement(326645..327271)
                     /locus_tag="ABZJ_RS01565"
                     /old_locus_tag="ABZJ_00300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002062410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_000029221.1"
                     /db_xref="GI:445951366"
                     /translation="MSIVERPSYTSKDVEVTSREPLFSGFIQVEKVSLRHRLFNQSEY
                     TPVLQRELVHRPEAAGVLLYNDQKQQFALIEQFRVGALDDSHSPWQLEIIAGVLDGNE
                     SPESCIRRESLEESGCEVQDLEHLFSFYPSAGACSELFHLYVAETNLPAVGGVFGVDN
                     EGENIQLHLFSYSEIQTLLDSGRLRNAPVIMALQWLAQHSKTIINPKR"
     gene            complement(327347..329224)
                     /locus_tag="ABZJ_RS01570"
                     /old_locus_tag="ABZJ_00301"
     CDS             complement(327347..329224)
                     /locus_tag="ABZJ_RS01570"
                     /old_locus_tag="ABZJ_00301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001072866.1"
                     /note="catalyzes the formation of
                     4-amino-2-methyl-5-phosphomethylpyrimidine from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole and
                     S-adenosyl-L-methionine in thiamine biosynthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase ThiC"
                     /protein_id="WP_001072861.1"
                     /db_xref="GI:446995605"
                     /translation="MNQLTNLSSAEISAQHEQDAKDLTRILPASKKVYIEGSRPDIQV
                     PMREISLTDTPTGLGGEHNPPIMVYDTSGVYTDPNVQIDLNKGLPSVRQKWIEERNDT
                     DVLSGLTSKFGQERLKDIRTADIRFAHIQNPRRAKAGKNVTQMHYAKQGIITPEMEYI
                     AIRENQRQREAVDMRQHPGQNFGAKNLKEITPEFVRQEVAEGRAIIPANINHPELEPM
                     IIGRNFLVKINANIGNSALGSSIDEEVAKMTWATRWGADTIMDLSTGKNIHETREWII
                     RNSPVPIGTVPIYQALEKVDGVAENLTWEIFKDTLIEQAEQGVDYFTIHAGVLLRYVP
                     LTANRLTGIVSRGGSIMAQWCLAHHEENFLYTHFDEICEIMKAYDVSFSLGDGLRPGC
                     IQDANDEAQFSELKTLGELTHRAWEHDVQVMIEGPGHVPMHMIKENMDLQLEVCKEAP
                     FYTLGPLTTDIAPGYDHITSAIGAAMIGWYGTAMLCYVTPKEHLGLPNKKDVKDGIIT
                     YKIAAHAADLAKGHPGAQVRDNALSKARFEFRWDDQFNLSLDPDTARSMHDETLPKEA
                     HKSAHFCSMCGPKFCSMKITQNVRDYANNLTNSDSEVEEGLKAMKEVYQEQGQKLYHK
                     V"
     gene            complement(329483..330547)
                     /locus_tag="ABZJ_RS01575"
                     /old_locus_tag="ABZJ_00302"
     CDS             complement(329483..330547)
                     /locus_tag="ABZJ_RS01575"
                     /old_locus_tag="ABZJ_00302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000333698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002017182.1"
                     /db_xref="GI:487943716"
                     /translation="MMSMCGALLLTGCNKTSQQDQTVSKEQKSTAQKATEQRDSSCLQ
                     IMVAMHTINQNSKIEDLNQINEKLKTCVPSLKNEEQLKLIDASTTMYQRFIKQDYTEK
                     TGRAFEAFGYAVLEQKQDLKKVIQSQKKLFAQLSPRDQYLLQHEGQAYIELLYQGEGM
                     FTYRRQPNYLVDVFSKALPADQKEFLSRMAKDNQDIFYNDGALAVSWKELTERALFWE
                     KFIQKYPKSYFINDAKLLFNEYRYFIFFGLDNTPVSNEYAPNTWFDPDALQQIRFLST
                     QSQSSLAKPAQQFLKFIATPVDERNKQFKIDLTDENGQKKSTYQIVHEQLEQLLKFDS
                     PWNTEVYRDCHIDAVCIDTN"
     gene            330673..331254
                     /locus_tag="ABZJ_RS01580"
                     /old_locus_tag="ABZJ_00303"
     CDS             330673..331254
                     /locus_tag="ABZJ_RS01580"
                     /old_locus_tag="ABZJ_00303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000999894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_000999896.1"
                     /db_xref="GI:446922640"
                     /translation="MNDRTARQKILDAAATLFYNDGITATGINTVTAKADVAKMSLYN
                     NFSSKGELVDAYIAARHQEWLDLYQKRLEKTKTAKEAILAVFDAYQDHAEFAYEKGFR
                     GCGLLNAAAEFPANSSGRNAVRQHKEQVEAIVAEHLNRLLKDSQRVSYIASQLSFLLE
                     GSMARAGLEGSSRQLQLARQMAEDVLDRECQHD"
     gene            331247..332152
                     /locus_tag="ABZJ_RS01585"
                     /old_locus_tag="ABZJ_00304"
     CDS             331247..332152
                     /locus_tag="ABZJ_RS01585"
                     /old_locus_tag="ABZJ_00304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000624464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000624470.1"
                     /db_xref="GI:446547124"
                     /translation="MISLIKNSSYGGTIAILVASFLWGTTGTAAAFAPTLGPLAIGAV
                     AMGGGGLLQALIASRAIREHRQFIGRNISIILLGVVAVGIYPLAFYSSMHYAGITIGT
                     VVSIGSAPLIAAVLERFFDRKVLSKTWFLSFVLGVVGVSLLSMGESHAAQESTNEWNK
                     IFGIFLGLVAGATYSLYSWAAKRLIDRGIAAKAAMGMIMGGGAVILLPTLLITGGGLL
                     QSSTNLLVAGYMMLIPMFLGYLLFGFGLKTVNASQATTLTLFEPLVAAIFAIVLVGES
                     VSWIGWAGMFLIFICILMLSKPENT"
     gene            332233..333579
                     /locus_tag="ABZJ_RS01590"
                     /old_locus_tag="ABZJ_00305"
     CDS             332233..333579
                     /locus_tag="ABZJ_RS01590"
                     /old_locus_tag="ABZJ_00305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006581162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_001988699.1"
                     /db_xref="GI:487915233"
                     /translation="MKIKLMLVAGLWSFTSSSFALDLVETYERAKLNDPTWQANQQQF
                     EADQLNLGLATGALLPTVTLSGNITRNRQTVKRSNFPGVDQEGLSDALVSNTSTTKQA
                     TLSARQPLFRMDAWEGYKQVKTSVALSEITLRLQKQDHVLNVAEAYFNVLRQQALTAA
                     YLQEEKALLEQLNMMSAKLKEGLVARSDVSEANAQYQNARANRIATNVQLLLAQEQLS
                     EYIGPYQDKLAVLRSDFIFQKPYPAQLDEWLGLAQQQNLKIQQARLQKRYAEDQRRVE
                     KAALYPQIDAVASYGYTKQTPETLISTDGKFDQVGVEMNWNLFNGGRTRTSIKKASVE
                     LNKAQAQLDAAIRRANVDVKSAFMQVDTDRAKLEARKAAMDSSALVSQASKASYNEGL
                     KSMVDVLLAQRNAFSAKQDYLNAQYDYLLNVLRLKAAVGQLGEKDLVELNSWLTYQ"
     gene            333687..334409
                     /locus_tag="ABZJ_RS01595"
                     /old_locus_tag="ABZJ_00306"
     CDS             333687..334409
                     /locus_tag="ABZJ_RS01595"
                     /old_locus_tag="ABZJ_00306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013199117.1"
                     /note="regulates several genes involved in high affinity
                     phosphate uptake; under conditions of high phosphate
                     concentrations downregulates the PHO regulon; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_000075183.1"
                     /db_xref="GI:445997328"
                     /translation="MSPSNPVLSHHISSQFNEDLQDVNTKFMTMGGLVEQQVANAIHS
                     LLDTDANLAIDVQFKDNAVNQYERDIDEGLTLILARRHPAAIDLRMVIAMSKANTDLE
                     RIGDEAAKIARIAQNLCEEGGSPRGYMETRHIGNQVRVMIHDALDAFARLDADQALRV
                     LLADADIDREYQSATRTLMTYMIEDPRHIARVINVMWVLRSLERIGDHARNIAEQVIY
                     MAKGFDARHTKIEEIEAKVHEK"
     gene            complement(334722..334991)
                     /locus_tag="ABZJ_RS01600"
                     /old_locus_tag="ABZJ_00307"
     CDS             complement(334722..334991)
                     /locus_tag="ABZJ_RS01600"
                     /old_locus_tag="ABZJ_00307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004883612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_000089996.1"
                     /db_xref="GI:446012141"
                     /translation="MSRQVFCRKYQKEMEGLDFAPFPGAKGQEFFENVSKQAWQEWLQ
                     HQTTLINEKRLNVFEPEAKKFLEEQREKFFNNDESVEKAEGWKPE"
     gene            complement(335001..336434)
                     /locus_tag="ABZJ_RS01605"
                     /old_locus_tag="ABZJ_00309"
     CDS             complement(335001..336434)
                     /locus_tag="ABZJ_RS01605"
                     /old_locus_tag="ABZJ_00309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000213741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="WP_000213740.1"
                     /db_xref="GI:446135885"
                     /translation="MTTSSNPPNSAAPNQTSGMWGGRFSEATDAFVAEFTASVQFDQR
                     FYKQDIAGSIAHATMLAKVGVLTEAERDDIIEGLSTIRAEIEAGTFEWRIDLEDVHMN
                     IESRLTQRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDDILGLLERLQKGLLGLAAK
                     NVNTIMPGFTHLQTAQPVTFGHHLLAWFEMLVRDTERLQDCRKRVNRMPLGSAALAGT
                     TYPIDRAYTAELLGFEAVSENSLDAVSDRDFAIEFNAAASLIMMHLSRMSEELILWTS
                     AQFKFVNIPDRFCTGSSIMPQKKNPDVPELIRGKSGRVFGDLISLLTLMKGQPLAYNK
                     DNQEDKEPLFDAIDTVRGSLMAFADMIPALVPNVEIMREAALRGFSTATDLADYLVKK
                     GVAFRDAHEIVGKAVALGVAEEKDLSELTLEQLQQFSDLITADVFDKALTLEASVNAR
                     DHIGGTSPKQVEAAIARAHKRLEQLYA"
     gene            336425..337564
                     /locus_tag="ABZJ_RS01610"
                     /old_locus_tag="ABZJ_00308"
     CDS             336425..337564
                     /locus_tag="ABZJ_RS01610"
                     /old_locus_tag="ABZJ_00308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016803688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alginate biosynthesis protein"
                     /protein_id="WP_000269799.1"
                     /db_xref="GI:446191944"
                     /translation="MWSWWLSKIKKSISLAEAQQTKLFSTAYRNQNSSYFFTKIDRWQ
                     HLLELIIASNVLALVLALAEAQSWHALNGSRLLQYIVFINWVILSFFALVEHFQDFFS
                     QLQQKYALVIGFVMLQAIVVVTTIISNFFQFGVLKKTSVIAQDWSIYFTNVPLYLSYG
                     ILLGAFCLRYLYVREQWLHQQYAELNARIQAMQARIHPHFLFNSLNNVVSLITIDPDK
                     AESMLISLSRLFRASFQELKLVSLHEEIELSKQYLMIEQIRLGERLKVEWKVEIEPLQ
                     LKQVTIPLLTLQPLLENSIFHGVEPMMGKATIGVLVEILQNQVSIVITNPYTHDTINS
                     RKGHGIALENVKQRLKAYYGNSVRFQVYKGEALYTTIMSYQYQSK"
     gene            337625..338365
                     /locus_tag="ABZJ_RS01615"
                     /old_locus_tag="ABZJ_00310"
     CDS             337625..338365
                     /locus_tag="ABZJ_RS01615"
                     /old_locus_tag="ABZJ_00310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000783056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_000865993.1"
                     /db_xref="GI:446788737"
                     /translation="MKVLICDDEPLAVERLSRLVSKMGHEVVATAHHGQDALEQARLH
                     HPDVILLDIQMPGMNGLVCAEQLSQLNPRPAIVFCTAYDQHALEAFKSQAQAYLLKPI
                     DPQELEQTFKQLTQLTQAQLSALPKPELLQDLKTQRHQIAAKTYRGVELIPVENIYYF
                     LADQKYVTVRHKNGSVLIDETLKELETEFADQFIRIHRNALVSIAYLDGLELVSSGQY
                     QVRLRGLDERLSVSRRHLSTLRERIHQL"
     gene            338466..339383
                     /locus_tag="ABZJ_RS01620"
                     /old_locus_tag="ABZJ_00311"
     CDS             338466..339383
                     /locus_tag="ABZJ_RS01620"
                     /old_locus_tag="ABZJ_00311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002159654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="WP_031944971.1"
                     /db_xref="GI:690970061"
                     /translation="MKTLKIATRQSPLALWQAEHIRARLQELHPDLTVELVKFVTQGD
                     KILDTPLAKIGGKGLFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDP
                     LDAFVSNQFEKFADLPQGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDG
                     QYDAIILASAGLKRLGLAERIRHCIEPSVSLPAVGQGALGLECRADDQEVLTLIQPLL
                     HPETDVCVRAERAFNAYLEGGCQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTD
                     EANNAQQLGENLARNLLDQGAGDLLKALY"
     gene            339388..340155
                     /locus_tag="ABZJ_RS01625"
                     /old_locus_tag="ABZJ_00312"
     CDS             339388..340155
                     /locus_tag="ABZJ_RS01625"
                     /old_locus_tag="ABZJ_00312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002062491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="WP_000897421.1"
                     /db_xref="GI:446820165"
                     /translation="MLFINTRPDSRAAELTHALQNKGFQVESLPLLELVAQPFSESLS
                     QLYQQLTGAQAIVVVSPTAVDVGMQYLTQSGLKIDELKHIQWIAVGQATANRLHDYGI
                     EAHVPEVETSEGMLNLPLLHHMQKSGSVAFWRGEGGRQFMMETLQQQGIQILNFVLYR
                     RQCPQASYSTFKHLTQNSNYNLDKWLVLITSEASWKYWLELCLKNKAQPDCVYLVLGP
                     RLFQLVKDYRDQQQAHFHIIQLENLSPSGMIHHIQAL"
     gene            340164..341003
                     /locus_tag="ABZJ_RS01630"
                     /old_locus_tag="ABZJ_00313"
     CDS             340164..341003
                     /locus_tag="ABZJ_RS01630"
                     /old_locus_tag="ABZJ_00313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001230201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001230204.1"
                     /db_xref="GI:447152948"
                     /translation="MRKLVSIIILLGIAWVAKLSYDMWQISRTVPELQQSLLQSEQQY
                     ANLNDQLVALQRQIQNQPSHNSKTTPLATTEVVQTGIAPTVLIKQKLELIQFAIDQQQ
                     FIYAVDHLTQLQQTLPQYGIAPALQHSLNQALEQDKQAIQQFVLAQNQRHQLIDDLLQ
                     NIDKNIQQALQQPKFEMDQSEAVSWWKKWFRIEKVETPSINLMNRSVVLKEVQLRLLI
                     AEQALNQGKMAEYQNELQTVMQKLNELPDATSQQLKNRIAKVAHLSVVPVPKLSTLGL
                     IGS"
     gene            341013..342206
                     /locus_tag="ABZJ_RS01635"
                     /old_locus_tag="ABZJ_00314"
     CDS             341013..342206
                     /locus_tag="ABZJ_RS01635"
                     /old_locus_tag="ABZJ_00314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000681770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000681783.1"
                     /db_xref="GI:446604437"
                     /translation="MKHLLWVYFLISLVLFAALALLSYGYGMGYVYIYWRQLQLQTNV
                     WGLVFTFVVMSFIAQVIWLWIKRYSSREQRKRENIFQFKNLHPYEQLGIVWLLEAAED
                     QRVFIERVFTQSGLLKNIIDAKFLVLSGDYQKALEALDQSPPMAFELAELQRIEIFLA
                     QNEAERALTHLEFLYQHQLSPWLEEIETAYQQRLTALWGQLALQQPWVYLRSMKYGLL
                     DAEHRDLWLQQLLQQFDQASIDDLQALQQRYLDLESEIQTRPYSSKLLWLKLLARMPE
                     MSIQHEVLTLHLLKEQFDPDVFYLWFQQQLLKQVPDYADVEEKINQFESQYMNLPVLT
                     FAKWHVYMATGRQAEAEILLSLYPDNILMSYLRIKSTLKEDDELIKQLNLIFENDANF
                     LKFKI"
     gene            342214..342654
                     /locus_tag="ABZJ_RS01640"
                     /old_locus_tag="ABZJ_00315"
     CDS             342214..342654
                     /locus_tag="ABZJ_RS01640"
                     /old_locus_tag="ABZJ_00315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000661569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_000661570.1"
                     /db_xref="GI:446584224"
                     /translation="MKELSVYPVIYDQKVAWGDMDAFGHVNNVQYYRYIESSRILYME
                     NVNILTPNIYTVVASSQCKYLKSVFYPDVLKVGVRVEELRKSAFRMAYILWSESQQQI
                     VATGEAVMVCVNKMTGLKCEIPSEVKSKIIELEKSVGHDLIHLA"
     gene            342849..343175
                     /locus_tag="ABZJ_RS01645"
                     /old_locus_tag="ABZJ_00316"
     CDS             342849..343175
                     /locus_tag="ABZJ_RS01645"
                     /old_locus_tag="ABZJ_00316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003284367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_000801427.1"
                     /db_xref="GI:446724114"
                     /translation="MKPDISELSVEELKRLQEEAEALIASKKDQAIEDAYNQIIEIAE
                     NVGFSVEQLLEFGAQKRKKTTRKSVEPRYRNKNNAEETWTGRGKQPRWLVAEIEKGAK
                     LEDFLI"
     gene            343507..344250
                     /locus_tag="ABZJ_RS01650"
                     /old_locus_tag="ABZJ_00317"
     CDS             343507..344250
                     /locus_tag="ABZJ_RS01650"
                     /old_locus_tag="ABZJ_00317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016144128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein"
                     /protein_id="WP_000730343.1"
                     /db_xref="GI:446652997"
                     /translation="MKKKSKQWKWWFFALIAFLIFIILQIPATWLISKFSKNNQTVHN
                     VSGNIWQGQADWHRGALRGTIHWKTRPLDLLLLRFAADVDIHSGNTQLTGIMAYGFGK
                     KVIVRDMNGQIAPETLKQIVNWQWPVNSIQLKDIQFNYKKEQGFAAVDGQLHWGGGAL
                     IYNIGDRQDRMNMPSLSGQLTDQNGQLQVDIRDQRNQKMANLLLDANMMLDVQLTQRL
                     LLNVPSYDGKAGLDTFVISSRQPLLQGGN"
     gene            344250..345086
                     /locus_tag="ABZJ_RS01655"
                     /old_locus_tag="ABZJ_00318"
     CDS             344250..345086
                     /locus_tag="ABZJ_RS01655"
                     /old_locus_tag="ABZJ_00318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000870032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein"
                     /protein_id="WP_000870033.1"
                     /db_xref="GI:446792777"
                     /translation="MKVWIDKLQQLQWQKLDRLSVVVLAILILWLCWKLASFFWLVIA
                     PPQLMQFDRVELGSQQPQIPNISTFSLFNEPSANAAQESVNLELQGVMVGYPNRFSSA
                     VIKIDNTAERYRVGETIGSTSYQLAEVYWDRVVLSQGNGSTRELQFKGLPNGLYQPMT
                     PDASQQSATPSQSTEPMNTAQQALGQAIQQMQGNREQYLRDMGVSGNSGEGYEVTERT
                     PTALRNKLGLRPGDRIVSLNGQTVGQGQTDVQLLEQARRAGQVKIEIKRGDQVMTIQQ
                     NF"
     gene            345128..347404
                     /locus_tag="ABZJ_RS01660"
                     /old_locus_tag="ABZJ_00319"
     CDS             345128..347404
                     /locus_tag="ABZJ_RS01660"
                     /old_locus_tag="ABZJ_00319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001196427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein D"
                     /protein_id="WP_001196426.1"
                     /db_xref="GI:447119170"
                     /translation="MALLNHQRPLWALLAAAPLIATVSSSAYAQTWKINLRDADLTAF
                     INEVADITGKNFAVDPRVRGNVTVISNKPLNKDEVYDLFLGVLNVNGVVAIPSGNTIK
                     LVPDSNVKNSGIPYDSRNRVRGDQIVTRVIWLENTNPNDLIPALRPLMPQFAHMAAIA
                     GTNALIVSDRAANIYQLENIIRNLDGTGQNDIEAITLQSSQAEEIITQLEAMSATGAS
                     KDFSGARIRIIADNRTNRILIKGDPQTRKRIRHMIEMLDVPSADRLGGLKVFRLKYAS
                     AKNLSEILQGLVTGQAVSSSNNSNNSSNSSNPINSLIGNNQNSGSNTSGSNGASISTP
                     AINLNGNSNSSNQNNITSFNQNGVSIIADNAQNSLVVKADPQLMREIESAIQQLDVRR
                     QQVLIEAAIIEVSGDDADQLGIQWALGDLSSGIGLLSFSNVGASLSSIAAGYLSGGSA
                     GAASAIANGANKGNGATLGLGNFDNSRKAYGALIQALKTNTKSNLLSTPSIVTMDNEE
                     AYIVVGQNVPFVTGSVTTNSTGINPYTTVERKDVGVTLKVVPHIGEGGTVRLEVEQEV
                     SAVQDSRGQAADLVTSKRAIKTAVLAEHGQTVVLGGLVSDDTSLSRQGIPGLSSIPYV
                     GRLFRSDNRSNVKRNLLVFIHPTIVGDANDVRRLSQQRYNQLYSLQLAMDKNGNFAKL
                     PEQVDDIYNQKMTPPSIASKPKNYQQVPSGGKSSTITTPVAVEPTVQKQTLQLPDPEI
                     NRTKNTVTTTTLRPSTAP"
     gene            347445..348074
                     /locus_tag="ABZJ_RS01665"
                     /old_locus_tag="ABZJ_00320"
     CDS             347445..348074
                     /locus_tag="ABZJ_RS01665"
                     /old_locus_tag="ABZJ_00320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000219964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_000219967.1"
                     /db_xref="GI:446142112"
                     /translation="MTWKLQAITGEFTGQEINVDRDMLVGRHQDADLLLQAAEISRRH
                     AALLLKDQALWVQDLNSSNGTFVNDIRIEQEKQLHDGDIVQFASLKFSVFAPAQENTD
                     LPEIEVEPVQTAPTQDLSDQGMPSIAERAAETEVSRDGMPQRVSVPKPAPIPEGVDIH
                     AQPEQTPVAIEEPVSRVTEEKEQQKNASIGLVTIIILVILAVLAWLFFK"
     gene            348140..348808
                     /locus_tag="ABZJ_RS01670"
                     /old_locus_tag="ABZJ_00321"
     CDS             348140..348808
                     /locus_tag="ABZJ_RS01670"
                     /old_locus_tag="ABZJ_00321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000109462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="WP_000109464.1"
                     /db_xref="GI:446031609"
                     /translation="MSVAQLSKRDLILFDLDGTLVDSAADLYRSMNLSLQSLSWPLVT
                     EAQIREWVGKGASKLCESVLLHVFGKLDVEQHKVLLQKFVEVYGAELCVNTQIYPGVP
                     EFLKHCQTLNIKMACVTNKPVKLAQGLLDELELSSYFQVVLGGDSLPERKPHPLPLLH
                     CMESLKISASQSLMIGDSSNDIEAARRAGIDCIVVSYGYNHGENIYDCQPQQVVDSLA
                     ELIV"
     gene            348917..350410
                     /locus_tag="ABZJ_RS01675"
                     /old_locus_tag="ABZJ_00322"
     CDS             348917..350410
                     /locus_tag="ABZJ_RS01675"
                     /old_locus_tag="ABZJ_00322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009508051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase"
                     /protein_id="WP_000209084.1"
                     /db_xref="GI:446131229"
                     /translation="MTTLAQFEQLKAAGYNTIPVYRQRLADTETPLSVFARFKDQTQA
                     YLFESVEGGENWARYSMIGLGESTVFSCNAGVLSIQHADGSVTQQNCLDPFQYIREFQ
                     KQFKVPAAKLLPDLPSFTGGLVGYLGYDAVRYIEPRLKNVPAADPITLPDLWLMLSKT
                     VIVFDNLKDTLFLIVHADTEQSNAYEDAQQKLDQLEQLLATPVSLQARPHTPPHFESI
                     TGKAKFLETVEKVKEYIRAGDVMQVVPGQRMVSDFDGEALQVYRALRHLNPSPYLFLV
                     QGQTITDKKPFHIVGSSPEILSRLENGIATVRPLAGTRPRGKTKEEDIALEKDLLSDE
                     KEIAEHLMLIDLGRNDVGRVSKIGKVQVTDQMVIERYSHVMHIVSNVQGEVRDDIDAL
                     DVFKATFPAGTLSGAPKIRAMEIIDEVEPVKRGVFGGAVGYLGWHGEMDMSIAIRTCV
                     IRDKKVYVQAGAGLVADSNPESEWNETQIKARAVIKAVELSSNGLIL"
     gene            350510..350585
                     /locus_tag="ABZJ_RS01680"
                     /old_locus_tag="ABZJ_tRNA7"
     tRNA            350510..350585
                     /locus_tag="ABZJ_RS01680"
                     /old_locus_tag="ABZJ_tRNA7"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:350543..350545,aa:Thr,seq:tgt)
     gene            350642..350725
                     /locus_tag="ABZJ_RS01685"
                     /old_locus_tag="ABZJ_tRNA8"
     tRNA            350642..350725
                     /locus_tag="ABZJ_RS01685"
                     /old_locus_tag="ABZJ_tRNA8"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:350676..350678,aa:Tyr,seq:gta)
     gene            350763..350838
                     /locus_tag="ABZJ_RS01690"
                     /old_locus_tag="ABZJ_tRNA9"
     tRNA            350763..350838
                     /locus_tag="ABZJ_RS01690"
                     /old_locus_tag="ABZJ_tRNA9"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:350796..350798,aa:Gly,seq:tcc)
     gene            350852..350926
                     /locus_tag="ABZJ_RS01695"
                     /old_locus_tag="ABZJ_tRNA10"
     tRNA            350852..350926
                     /locus_tag="ABZJ_RS01695"
                     /old_locus_tag="ABZJ_tRNA10"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:350884..350886,aa:Thr,seq:ggt)
     gene            351090..352280
                     /gene="tuf"
                     /locus_tag="ABZJ_RS01700"
                     /old_locus_tag="ABZJ_00323"
     CDS             351090..352280
                     /gene="tuf"
                     /locus_tag="ABZJ_RS01700"
                     /old_locus_tag="ABZJ_00323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001029611.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_001029610.1"
                     /db_xref="GI:446952354"
                     /translation="MAKAKFERNKPHVNVGTIGHVDHGKTTLTAAIATICAKTYGGEA
                     KDYSQIDSAPEEKARGITINTSHVEYDSPTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCAATDGPMPQTREHILLSRQVGVPYIIVFLNKCDLVDDEELLELVEMEVRELLST
                     YDFPGDDTPVIRGSALAALNGEAGPYGEESVLALVAALDSYIPEPERAIDKAFLMPIE
                     DVFSISGRGTVVTGRVEAGIIKVGEEVEIVGIKDTVKTTVTGVEMFRKLLDEGRAGEN
                     CGILLRGTKREEVQRGQVLAKPGTIKPHTKFDAEVYVLSKEEGGRHTPFLNGYRPQFY
                     FRTTDVTGAIQLKEGVEMVMPGDNVEMSVELIHPIAMDPGLRFAIREGGRTVGAGVVA
                     KVTA"
     gene            352341..352416
                     /locus_tag="ABZJ_RS01705"
                     /old_locus_tag="ABZJ_tRNA11"
     tRNA            352341..352416
                     /locus_tag="ABZJ_RS01705"
                     /old_locus_tag="ABZJ_tRNA11"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:352374..352376,aa:Trp,seq:cca)
     gene            352492..352932
                     /locus_tag="ABZJ_RS01710"
                     /old_locus_tag="ABZJ_00324"
     CDS             352492..352932
                     /locus_tag="ABZJ_RS01710"
                     /old_locus_tag="ABZJ_00324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004920616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_000063880.1"
                     /db_xref="GI:445986025"
                     /translation="MSNDKSRDALSDAPIPQRNNSAEVVRSGSPLDIVLWVIAIALLL
                     SATMVNQHLPAYWAPANDVWVRVGVIFACIVVALGLLYATHQGKGFVRLLKDARVELR
                     RVTWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG"
     gene            352940..353473
                     /locus_tag="ABZJ_RS01715"
                     /old_locus_tag="ABZJ_00325"
     CDS             352940..353473
                     /locus_tag="ABZJ_RS01715"
                     /old_locus_tag="ABZJ_00325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004637638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="WP_000832994.1"
                     /db_xref="GI:446755738"
                     /translation="MKRWYIIHAYSGYEKQVMRSLKERIQRSAVADSFGDVLVPTEEV
                     VEMKDGKKRKSERKFFPGYVLVEMEMNDDTWHIVKECPKVLGFIGGTPEKPAPITQRE
                     ADAILARVRNTGEAPRPKTMFEPGEELLVIDGPFTDFKGVVEEVQYDKSRLTLTINVF
                     NRPTQVELEFRQVEKTI"
     gene            353582..354010
                     /locus_tag="ABZJ_RS01720"
                     /old_locus_tag="ABZJ_00326"
     CDS             353582..354010
                     /locus_tag="ABZJ_RS01720"
                     /old_locus_tag="ABZJ_00326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005017067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_001074682.1"
                     /db_xref="GI:446997426"
                     /translation="MAKKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNA
                     ATQKVEPGLPIPVVITVYNDKSFTFIMKTPPASILLKKAAGIQKGSSVPNKTKVGKLT
                     RAQLEEIATTKEPDLTGADLDARVRTIAGSARSMGLEVEL"
     gene            354014..354709
                     /locus_tag="ABZJ_RS01725"
                     /old_locus_tag="ABZJ_00327"
     CDS             354014..354709
                     /locus_tag="ABZJ_RS01725"
                     /old_locus_tag="ABZJ_00327"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B7I357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_001096694.1"
                     /db_xref="GI:447019438"
                     /translation="MAKLTKRQKAIAAAVEANKVYTLEEAVQVLNSLPAAKFKESLDI
                     SVNLGVDPRKSDQVVRGATTLPAGTGKTVRVAVFAQGAQAEAAKEAGADVVGFDDLAE
                     SIQGGNLDFDVVIAAPDAMRVVGKLGTILGPRGLMPNPKVGTVTPDVAGAVKNAKSGQ
                     ARYRVDKAGIIHAAIGQVGFDAAAIRQNVETLVADLKKLKPATSKGVYIKKITLSSTM
                     GPGLTVDVNNVSN"
     gene            355029..355535
                     /gene="rplJ"
                     /locus_tag="ABZJ_RS01730"
                     /old_locus_tag="ABZJ_00328"
     CDS             355029..355535
                     /gene="rplJ"
                     /locus_tag="ABZJ_RS01730"
                     /old_locus_tag="ABZJ_00328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004774017.1"
                     /note="binds the two ribosomal protein L7/L12 dimers and
                     anchors them to the large ribosomal subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_001196213.1"
                     /db_xref="GI:447118957"
                     /translation="MALLIEDKKQIVAEVSEVASKAFAAVVADYQGLSVEQLTTLRVE
                     ARKLGVTTRIVRNTLAKRAFQGTQFDILNDNLVGPTILGFSTSEDDMGAAARLFEEFA
                     KTNKAFELKAAAFDGKVYQGADVSVIANLPNQEKALTMLASVLQAPISKLGRLITALK
                     EKNESEAA"
     gene            355578..355949
                     /gene="rplL"
                     /locus_tag="ABZJ_RS01735"
                     /old_locus_tag="ABZJ_00329"
     CDS             355578..355949
                     /gene="rplL"
                     /locus_tag="ABZJ_RS01735"
                     /old_locus_tag="ABZJ_00329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002114729.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_001229360.1"
                     /db_xref="GI:447152104"
                     /translation="MALTNEEILNAVAEKTVLELVELISAFEEKFNVSAAAVAVAAPA
                     GGAAAAAEEQSEFNVELTSFGANKVAVIKAVREATGLGLKEAKDLVEGAPQVLKEGVS
                     KEEGEELKKKLEEAGATVTLK"
     gene            356255..360343
                     /gene="rpoB"
                     /locus_tag="ABZJ_RS01740"
                     /old_locus_tag="ABZJ_00330"
     CDS             356255..360343
                     /gene="rpoB"
                     /locus_tag="ABZJ_RS01740"
                     /old_locus_tag="ABZJ_00330"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3M1G3.2"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_000331899.1"
                     /db_xref="GI:446254044"
                     /translation="MAYSYTEKKRIRKNFGKLPQVMDAPYLLSIQVDSYRTFLQDGKS
                     PKNREDIGLQAAFRSVFPIESYSGNAALEFVEYSLGKPEFDVRECILRGSTYAAPMRV
                     KIRLIIKDRETKSIKDVREQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFD
                     HDKGKTHSSGKVLYSARIIPYRGSWLDFEFDAKDLVYVRIDRRRKLLATVVLRALGYN
                     NEQILNLFYEKVPVYLDMGSYQIDLVPERLRGEMAQFDITDNEGKVIVEQGKRINARH
                     VRQMEAAGLTKLSVPDEYLYERITAEDITLRDGEVIAANTLLSHEVMVKLAEGGVKQF
                     NILFTNDIDRGSFVADTLRADLTRDREEALVEIYKVMRPGEPPTKEAAENLFNNLFFS
                     SERYDLSPVGRMKFNRRLGRPYEVGTDQKSREVEGILSHEDIIDVLRTLVEIRNGKGE
                     VDDIDHLGNRRVRSVGEMTENQFRVGLVRVERAVKERLSQAETDNLSPQDLINAKPVA
                     AAIKEFFGSSQLSQFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHQTHYGR
                     VCPIETPEGPNIGLINSLSVYAKANDFGFLETPYRKVVDGRVTDDVEYLSAIEEVGTV
                     IAQADSAVDKDGNLTEEFVSVRHQGEFVRMPPEKVTHMDVSAQQVVSVAASLIPFLEH
                     DDANRALMGSNMQRQAVPTLRADKPLVGTGMEANVARDSGVCVIANRGGVIEYVDASR
                     IVIRVNEDEMVAGEAGVDIYNLIKYTRSNQNTCINQNVIVNLGDKVARGDILADGPST
                     DMGELALGQNMRVAFMTWNGYNYEDSILLSERVLQEDRLTSIHIQELSCVARDTKLGA
                     EEITADIPNVGEAALSKLDESGIVYIGAEVTAGDILVGKVTPKGETQLTPEEKLLRAI
                     FGEKAADVKDSSLRVPSGTKGTVIDVQVFTRDGLEKDDRALAIEKAQLDSYRKDLKEE
                     YKIFEEAARERVIRLLKGQESNGGGSTKRGDKLSEDLLSGLELVDLLEIQPADEAIAE
                     RLTQIQVFLKEKSAEIDEKFAEKKRKLATGDELTTGVLKVVKVYLAVKRRIQPGDKMA
                     GRHGNKGVVSNILPVEDMPHDANGVPVDIVLNPLGVPSRMNVGQILETHLGMAAKGLG
                     DKIEKMLKEQRTVLELREFLDKIYNKVGGEQEDLDSLTDEEILALAGNLRAGVPLATP
                     VFDGAEESQIKDLLELADISRTGQTVLFDGRTGEQFDRPVTVGYMYMLKLNHLVDDKM
                     HARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVEGR
                     TRIYKNIVDGNHYMDPGMPESFNVLTKEIRSLGINIELKNGD"
     gene            360430..364623
                     /locus_tag="ABZJ_RS01745"
                     /old_locus_tag="ABZJ_00331"
     CDS             360430..364623
                     /locus_tag="ABZJ_RS01745"
                     /old_locus_tag="ABZJ_00331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004699163.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_000653927.1"
                     /db_xref="GI:446576581"
                     /translation="MKDLLDIMRKKTDSDGHAPVEFDRIRIGLASPEMIKSWSHGEVK
                     KPETINYRTFKPERDGLFCAKIFGPVKDYECLCGKYKRMKYKGVICEKCGVEVTTAKV
                     RRERMGHIELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVTDPGMTPFE
                     KYQLLNDEEYFTALEEHGDEFVAKMGAEAVQDLLKDIDLEAEISRLREEIPQTTSETK
                     LKKASKRLKLMEAFKDSNNKPEWMVMNVLPVLPPDLRPLVPLEGGRFATSDLNDLYRR
                     VINRNNRLKRLLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLAD
                     MIKGKQGRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFAKLQA
                     SGQATTIKAAKKMVERETPEVWDVLASVIRQHPVMLNRAPTLHRLGLQAFEPILIEGK
                     AIRLHPLVCAAFNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPS
                     QDVVLGLYYITRDAVNAKGEGMVFADTHEVNRALATGQVAIHARVKVRVHQTVINENG
                     EREQQTIIVDTTPGRCLLWEVVPEGLSFDMINLEMTKKNISKLINSCYRKLGLKDTVI
                     FADQLMYLGFRQATRSGVSVGMEDMLIPPTKHTIIDKAETEVREIEQQFEQGFVTAGE
                     RYNKVVDIWARTNDQVAKAMMDNLSYTLVKNKQGEDEKQKSFNSIYMMSDSGARGSAA
                     QIRQLAGMRGLMAKPDGSIIETPIKANFREGLTVLQYFISTHGARKGLADTALKTANS
                     GYLTRRLVDVAQDLVITEPDCGTSGGLVMTPFIQGGDVIEPLRDRVLGRVTAEDVRRA
                     SDDEVVLPRGTLIDEKIAAQLEEAGVDEVKVRSVIACESTFGVCAKCYGRDLARGHLV
                     NPGESVGVMAAQSIGEPGTQLTMRTFHVGGAASRTSAANSVQVRNKGTVRFHNVKTVQ
                     HAKGHLVSVSRSGEIGIADELGRERERYKLPYGASILLKDGELVEAGGIVATWDPHTH
                     PLVTEVAGKARFSQIADGVTATSKTDDATGMTTVEILPVTARPASGKDLRPAIVLDTT
                     DGGEQFYFLPQNTIVTVRDGETIGVGDVIGRVPQESSRTRDITGGLPRVADLFEARKP
                     KEHAILAEVSGIVSFGKETKGKNRLVITPDDGSEIYEELIPKWRQINVFEGEHVNRGE
                     TISDGPQNPHDILRLKGEVALTNYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKVDI
                     IDGGDTSFIKGEQVDYIRVVQENQAVLAQNKFPAKFERQLMGITKASLSTDSFISAAS
                     FQETTRVLTEAAVTGKEDDLRGLKENVVVGRLIPAGTGLAYHLERRRQEAEAAEHALH
                     NDFSEVDQAFSQALNSEQF"
     gene            364791..365156
                     /locus_tag="ABZJ_RS01750"
                     /old_locus_tag="ABZJ_00332"
     CDS             364791..365156
                     /locus_tag="ABZJ_RS01750"
                     /old_locus_tag="ABZJ_00332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000723327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000738603.1"
                     /db_xref="GI:446661257"
                     /translation="MKKMMMIAGVGLMSTTLFVGCQNASPESKRIGSAAIGGGAGGAV
                     GKHIGGNIGAGLGAALGAGVAANAKGSSSKTVRNSAIGAGVGAILGGAVIGGDAGAAA
                     GGALGGSAGAAYEEKKGKY"
     gene            365370..365726
                     /locus_tag="ABZJ_RS01755"
                     /old_locus_tag="ABZJ_00333"
     CDS             365370..365726
                     /locus_tag="ABZJ_RS01755"
                     /old_locus_tag="ABZJ_00333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001034852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001034851.1"
                     /db_xref="GI:446957595"
                     /translation="MNKKIGLISTVILSTVMFTGCQNMSPSDQRIGAAAAGGALGGGL
                     GNHVGGGIGAGLGAAVGAGVGSNTQGGSKQTTTKSAIGAGIGSVVGKAIIGGDTGAAI
                     GGAIGGGAGAAIEEKK"
     gene            complement(365755..366252)
                     /locus_tag="ABZJ_RS01760"
                     /old_locus_tag="ABZJ_00334"
     CDS             complement(365755..366252)
                     /locus_tag="ABZJ_RS01760"
                     /old_locus_tag="ABZJ_00334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000996189.1"
                     /db_xref="GI:446918933"
                     /translation="MAILKKLQNIPSISKFLFNHYPPYRGAGIHIEVMNLELCHVRVK
                     MPLTWKNQNLVGTHFGGSLYSMVDPFYMLILMHHLGSKYIVWDKAAEINFLSPGRSTV
                     YADIRVDLAEIEQIRELAENYAPVLRTYHLNIFDESGVRIAEVQKTLYIRRKKAKPST
                     NKISA"
     gene            366376..367248
                     /locus_tag="ABZJ_RS01765"
                     /old_locus_tag="ABZJ_00335"
     CDS             366376..367248
                     /locus_tag="ABZJ_RS01765"
                     /old_locus_tag="ABZJ_00335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001987811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_001182617.1"
                     /db_xref="GI:447105361"
                     /translation="MQPKIYAVTTSDQQTLCAKAWGDEKNTPLVLVHGYPDNQEVWES
                     VIEHLINDFYIVTYDVRGAGLSSIPKRIRDYRLERLSLDLQEVVDEVIPNRQFHMAAH
                     DWGSIQSWESATEPKFKGRLLSYTTISGPCLDHAALFLREKFKTSPAQILKILTKSWY
                     IGAFHLPLIAPTVWSLFSPEKWGKILNDLERKDNLPLNSNISSDGKYGINLYRANFIP
                     RLTRPRQRYAQCPVKAIILKYDTFVSPEYITEAMPKWVENFEYVELEANHWAILSQAE
                     KVAAHIRQFINSQS"
     gene            367353..368777
                     /locus_tag="ABZJ_RS01770"
                     /old_locus_tag="ABZJ_00336"
     CDS             367353..368777
                     /locus_tag="ABZJ_RS01770"
                     /old_locus_tag="ABZJ_00336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000994937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_000994938.1"
                     /db_xref="GI:446917682"
                     /translation="MNAVVIAIAVMFLLSLARVSVVLTLVVSAIVGGLVAGLSLSQTV
                     EAFNAGLGDGAEVALAYAVLGAFALALSKSGLPDLLAHKLIGLLGMEAGKSRETKVKY
                     LLLGILLIAAIFSQNLIPVHIAFIPVLVPPLLRVMNHLKLDRRAAACVLTLGLVGTYI
                     FLPVGFGAIFLEQILMGNINKIGAAYGLHVERGMMPIGMAIPVLGMVLGTLVAVFISY
                     RKPRIYADRSISPVTTIDLDKPLRATAQDETADLKADAEELKHEAEQGPVIAKKTIFM
                     ALLAIGLTLVAQLYSGSMILGGLVGFAVLSTAGIFKWQDADDVFVQGMRMMALVGFIM
                     ISAAGFASVMTHTGDINQLVKGVVEIIGDNRALAAFLMLCIGLFVTIGIGSSFSSVPV
                     LAVIYVPLCVQFGFSPLATIALIGTAAALGDAGSPASDSTLGPTAGLGVDGQHDHIWD
                     TVIPTFIHFNIPLLIFGWIAAMVL"
     gene            369104..369685
                     /locus_tag="ABZJ_RS01775"
                     /old_locus_tag="ABZJ_00337"
     CDS             369104..369685
                     /locus_tag="ABZJ_RS01775"
                     /old_locus_tag="ABZJ_00337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000472954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000475285.1"
                     /db_xref="GI:446397430"
                     /translation="MFKKVLVVALMGVSSFTFAGNWQVKFGGSVIAPSEDTTTALGVV
                     KADHEYAFTPSVEYFFGQTPFSAELLLATPVNHDVLLDGQKVARIKQLPPTITAKYHF
                     KNSTRFTPYIGIGATAFIPWDEQGVADKVKEDFGVAGQVGFNFQPADAKNWGVFVDVR
                     YADISPEVTLTNGAKFDLDINPFVYTLGYSYKF"
     gene            369870..370223
                     /locus_tag="ABZJ_RS01780"
                     /old_locus_tag="ABZJ_00338"
     CDS             369870..370223
                     /locus_tag="ABZJ_RS01780"
                     /old_locus_tag="ABZJ_00338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001080202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_001080202.1"
                     /db_xref="GI:447002946"
                     /translation="MNRKFAMGLALFSGLAFTHSLQAASFSCNAAKTKTELSICKNRS
                     LNDADVKMATTYQIVLHALPMGGRDNQKDTQQQWLKKRNACAANVSCISKAYQQRQKQ
                     LDTILQDRVLSHGPF"
     gene            370326..372245
                     /locus_tag="ABZJ_RS01785"
                     /old_locus_tag="ABZJ_00339"
     CDS             370326..372245
                     /locus_tag="ABZJ_RS01785"
                     /old_locus_tag="ABZJ_00339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001294938.1"
                     /note="molecular chaperone; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein 90"
                     /protein_id="WP_001294942.1"
                     /db_xref="GI:447217686"
                     /translation="MSEQASQNYSFQAEVAQLLHLVTHSLYSNPEIFLRELISNASDA
                     CDKLRFEGINHPEYYENDPNLHVRISLNKEDKTLTISDNGIGLSQQEAIDNLGTIAKS
                     GTKDFMSKLTGDQKADAQLIGQFGVGFYSGFIVADKITVESRRAGLDASEGVRWISGG
                     TGEFEVQQIDKASRGTDIILHLRDDALDYLESYKVKQIVNKYSDHISLPIEMQKEVWQ
                     EEEVAEGEEPKGGQMVKTDEWEAINSASALWTRNKSEVTEEQYVEFYKNLTHDFEAPL
                     AWAHNRVEGSTEYTQLLYIPSKAPHDIFTREAKAGIKLYVKRVFIMDDADNLIPNYLR
                     FVQGVVDSADLPLNVSRELLQESRDVKTIREGNARRVLTLLDGLAKSEDEKDQEKFKT
                     FYTEFGSVLKEGLGEDFGNRERILKLLRYATSTNDEVTTSFADYKARMKEGQKAIYYV
                     TAESLAAAKNSPQLELFKKKGIEVLLMAERVDEWAMNFVHEFDGTPLKNVSKGAVDLG
                     DLQDAEEKKALEQAAEQFKPVVEKLSDSLKAKTKEVRVTTRLVDSPACLVTSEGELSP
                     QLIRMLKQAGQAVPEIKPILEINPEHPLVKKLEGSEQFDDLANVIFDQAVIAEGGLPE
                     DPAAYVKRINSLLLK"
     gene            complement(372329..373231)
                     /locus_tag="ABZJ_RS01790"
                     /old_locus_tag="ABZJ_00340"
     CDS             complement(372329..373231)
                     /locus_tag="ABZJ_RS01790"
                     /old_locus_tag="ABZJ_00340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005112416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="selenocysteine synthase"
                     /protein_id="WP_002001381.1"
                     /db_xref="GI:487927915"
                     /translation="MNQFSSFSFEYRSTALLCIYSLGMLVLIPHIQLFPTSLKHSRST
                     RRTLYSSVVTLKTKSQSVSFLHSPCEVEPSHSSDTALIQDLMAVFGNDTLWSRAAQHK
                     HPYKTFGKIKKKASTPHVSENNPLTASWNTISTWMPFENDLDLGSNSESDVYVQFLAK
                     KKWNLRHNISLDTEQIFRYGSTSRNYTETTLNLTQKMQDNTLFSNTFNVNKSGKEDYN
                     WGNWTFQQFEFVKDNRLTYGIYSGGVYANNDIRLNSWGPYISWRQPIWRDWIFMQNDL
                     NFFNYLDDDPKHQLSVQMNLEANF"
     gene            complement(373353..374492)
                     /locus_tag="ABZJ_RS01795"
                     /old_locus_tag="ABZJ_00341"
     CDS             complement(373353..374492)
                     /locus_tag="ABZJ_RS01795"
                     /old_locus_tag="ABZJ_00341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000846675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000846679.1"
                     /db_xref="GI:446769423"
                     /translation="MKTFHIITYRQLFALLTLGFGSVCMAHAEVNSSSTQQVNGLSSG
                     AQTEENKDENLLDQIPRWIDATPTIFPEQSNEPIVPPTEQTEDQTWFDRKQKKIRNWA
                     DRTSGKIDNWFGEVDPQKPASATIRVMIDNYWNEYDNYEIKPRIRGKIKLPTLEKRLS
                     VVFGDDSLDDEFNNSPANINQNPNQDPNKKLDGKRTRDDNSSIALRWSNFSKKLPFET
                     DADLGIRSGDDIYVRLKASRDWQLRNDFKFYAEQIYRYGIDSENYLRTNLELTHARPN
                     QPILSNQFSLTYADDQDDDLTWENRLFREHSFFANNRFNYGIYTGGYYNDNDLRLNSW
                     GPFVSWRQPVLREWFFVQGDLNYFNDHREDRNHYVSTFLRLEALF"
     gene            complement(374851..375555)
                     /locus_tag="ABZJ_RS01800"
                     /old_locus_tag="ABZJ_00342"
     CDS             complement(374851..375555)
                     /locus_tag="ABZJ_RS01800"
                     /old_locus_tag="ABZJ_00342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001261848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dithiol-disulfide isomerase"
                     /protein_id="WP_001261850.1"
                     /db_xref="GI:447184594"
                     /translation="MRVDVWSDVVCPFCYIGKKRLEHVAAEAGIELDIHWHSFELDPD
                     APAKHDTSNTERLAKKYGRTYEEMEEMERNIAAMAASEGIDFQWQKANSGNSFNAHRI
                     IHLAQSKGLGNEAKEAFFHAYMTEGLAIGEREVVEEIASRIGLDNAEVEYVLDTNELA
                     DFVRHDEKIAHEQLNVTGVPFFVFDQRIALAGAQPREVFLQVLEQAQLKANAENIEQD
                     DAAVCNDETCDIPQNK"
     gene            375714..376490
                     /locus_tag="ABZJ_RS01805"
                     /old_locus_tag="ABZJ_00343"
     CDS             375714..376490
                     /locus_tag="ABZJ_RS01805"
                     /old_locus_tag="ABZJ_00343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002019378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002019378.1"
                     /db_xref="GI:487945912"
                     /translation="MEIGGVYAPSFDCNCKSGCYYEYCFFTYQHIKQQQAKDSSQMFD
                     VVMTEKMNQLYDQAQDWTKPVQLDIHDKRLAGHYKQVSEFLLSYWVQNVNARNEYLRE
                     LKAAKWDTFLNVDRLDHDKKQKYAETEKMLADVRRASDKYQSEYEKIHKTFLAKIQEL
                     SVDKEMRQILEIKLGAQQKADQDHAIFMIELQILDKAEEMFKLLKTYPWQKKDQMILF
                     HENAQVKKFNALYQDVLKLNAKIEKIKKKNVAALEGELKE"
     gene            complement(376511..376876)
                     /locus_tag="ABZJ_RS01810"
                     /old_locus_tag="ABZJ_00344"
     CDS             complement(376511..376876)
                     /locus_tag="ABZJ_RS01810"
                     /old_locus_tag="ABZJ_00344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001046655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_001046657.1"
                     /db_xref="GI:446969401"
                     /translation="MNLAKVSELTKVSPRMLRYYENLGLIQPHRASNNYRSYTQKDIE
                     NIKKIKILNDAGMNLKDIHVLLPCFDLDERVFTLCPVVQEKLQTELKHVSDQLNKLQT
                     SQSLLQSFLAKGKAESTNI"
     gene            377036..377593
                     /locus_tag="ABZJ_RS01815"
                     /old_locus_tag="ABZJ_00345"
     CDS             377036..377593
                     /locus_tag="ABZJ_RS01815"
                     /old_locus_tag="ABZJ_00345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001248889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001248893.1"
                     /db_xref="GI:447171637"
                     /translation="MRQIFVLHGYSASINDHWFLDLKHQIEDENTTVTLIPFPDSEHP
                     DVDAWQKVLDEQIPAVNENTYFVAHSLGVITLLHFLQRHDYQNIGGMILVSGFSGPIS
                     DSSPLSPYITKSKVDTNYFRDIKKKLVYLSDNDDLVPPQLTIQLAKDIDAPYITVPNG
                     GHFLGREGYTEFPQLVDSLKEMLEN"
     gene            complement(377662..378378)
                     /locus_tag="ABZJ_RS01820"
                     /old_locus_tag="ABZJ_00346"
     CDS             complement(377662..378378)
                     /locus_tag="ABZJ_RS01820"
                     /old_locus_tag="ABZJ_00346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000669368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001009587.1"
                     /db_xref="GI:446932331"
                     /translation="MNFKILNQNILMSCLLASFFLTGCVSNRIIGENTRELFTKYDSG
                     YEWITLTEDDVIAFGKPSVSLPNEPEDSIVIAGKKYSYVISKGGNDFIQLISQLNPQY
                     IQISNELDFNAPASNSNHFYGHIRFSYTPPNGKLNEKESALFKQYGVIPCDYEKTLEL
                     HKFELNLRGTVYPPVNNLKKITPLSKPYHVRIQYLHDKSGKVPLSTKEKLASLPLLPF
                     TLTFDIIALPAKVMGIIYQP"
     gene            378654..379145
                     /locus_tag="ABZJ_RS01825"
                     /old_locus_tag="ABZJ_00347"
     CDS             378654..379145
                     /locus_tag="ABZJ_RS01825"
                     /old_locus_tag="ABZJ_00347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001010064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide signal protein"
                     /protein_id="WP_001010132.1"
                     /db_xref="GI:446932876"
                     /translation="MNFLKQSAFIAVFAFMGLPTVQAEEVATLPTIRVMAESELREEV
                     GFVPFQEDKKVRQALQHREYKTHNDIQNALVPEGMTTVDYQPVMAQPDLSQLSPFLRE
                     YILAVAGGIQSSDPTNGLFEMLKPLQINRSNVDAYREGTMKVNLDDILKLQQQIQDGL
                     KGR"
     gene            complement(379190..380362)
                     /gene="fadA"
                     /locus_tag="ABZJ_RS01830"
                     /old_locus_tag="ABZJ_00348"
     CDS             complement(379190..380362)
                     /gene="fadA"
                     /locus_tag="ABZJ_RS01830"
                     /old_locus_tag="ABZJ_00348"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B7H1I1.1"
                     /note="FadA; fatty acid oxidation complex component beta;
                     functions in a heterotetramer with FadB; similar to
                     FadI2J2 complex; functions in beta-oxidation of fatty
                     acids; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="WP_000212712.1"
                     /db_xref="GI:446134857"
                     /translation="MATLNPRDVVIVDGVRSAMGKSKNGMFRNVRADSLSAELVRALV
                     ARNQFDVNEVEDLIWGCVNQTLEQGMNIGRNIGLLAGLPKTVAGQTVNRLCGSSMQAI
                     HTAAAQIATNQGDIFIIGGVEHMGHVGMMHGIDLNPEASKHYAKASNMMGLTAEMLGR
                     MNGITREEQDAFGVESHRRAWAATQEGRFKNEIIGVEGHDANGFKILCDIDEVIRPDA
                     NLEAFKALKPVFDPKGGSVTAATSSALSDGASAMLLMSAERAQALGLKPRAVIRSMAV
                     AGCDAAIMGYGPVPATQKALKRAGLSIADIQTVELNEAFAAQGLSVLKGLGLYDKQDI
                     VNLNGGAIALGHPLGCSGARITTTLLNVMEQQDTQIGLATMCIGLGQGIATVIERV"
     gene            complement(380375..382528)
                     /gene="fadB"
                     /locus_tag="ABZJ_RS01835"
                     /old_locus_tag="ABZJ_00349"
     CDS             complement(380375..382528)
                     /gene="fadB"
                     /locus_tag="ABZJ_RS01835"
                     /old_locus_tag="ABZJ_00349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002000675.1"
                     /note="includes enoyl-CoA hydratase,
                     delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase,
                     3-hydroxyacyl-CoA dehydrogenase, and 3-hydroxybutyryl-CoA
                     epimerase; catalyzes the formation of an hydroxyacyl-CoA
                     by addition of water on enoyl-CoA; also exhibits
                     3-hydroxyacyl-CoA epimerase and 3-hydroxyacyl-CoA
                     dehydrogenase activities; forms a heterotetramer with
                     FadA; similar to FadI2J2 complex; functions in
                     beta-oxidation of fatty acids; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional fatty acid oxidation complex
                     subunit alpha"
                     /protein_id="WP_000580938.1"
                     /db_xref="GI:446503084"
                     /translation="MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAI
                     AAVKANNDIKGLVVTSGKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDL
                     DLPKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIG
                     IDNAVEWMAMATPKKPAAALKDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQE
                     KLEAVKLNPLEQMMAFNTAKGAVLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEA
                     EGFAKAAVTPQAEALIGLFINDQVVKKASKQHEKGAHPVNQAAVLGAGIMGGGIAYQA
                     ASKGTPIIMKDIGNPQLALGMKEANNLLTKQVERKKMKPAQMGETLARIRPTLSYEEF
                     KEVDIVIEAVTENPKVKEIVLAETEKNVRENTIIASNTSTISITRLAKALQRPENFVG
                     MHFFNPVHMMPLVEVIRGEKTSEEAIATTVVLAQKMGKTPIVVNDCPGFLVNRVLFPY
                     FGAFDLLVKDGADFQQIDNVMSKFGWPMGPAYLIDVVGIDTGVHGAEVMAEGFPDRMK
                     PDYKGAIEAMYEAKRLGQKNDVGFYKYELDKKGKKAKTVDPTAYEVIAPFVTGEKREF
                     DNQEIIDRMMLALCNETVRCLEDNIVATASEADMAMIMGIGFPPFRGGPCRYIDQTGV
                     AEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG"
     gene            383100..384014
                     /locus_tag="ABZJ_RS01840"
                     /old_locus_tag="ABZJ_00350"
     CDS             383100..384014
                     /locus_tag="ABZJ_RS01840"
                     /old_locus_tag="ABZJ_00350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000598894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/asparaginyl beta-hydroxylase"
                     /protein_id="WP_000598899.1"
                     /db_xref="GI:446521553"
                     /translation="MIKWIILAIFVISALYIQHRGKVRHSFYRQFFDHSTLLAPINFL
                     MYIFSKVPNQPYIDTQHFKDLKVLDENWEMIRDEAKALYDQGGIKASSTYNDLGFNSF
                     FKTGWKRFYLKWYESSHPSAAELCPKTTALLKTLPTIKAAMFTELAPDSRLVRHRDPY
                     AGSLRYHLGLITPNDDRCFIDVDGERYSWRDGQSVVFDETYIHYAENKTDQNRIIFFA
                     DVERPMKVKWMERFNHWFGRNVMTAASSPNETGDQTGGLNKAFGYVYQIRIKAKALKA
                     KNRKLYYFLKWFLMLGIFFLIFVRPYVF"
     gene            complement(384362..384733)
                     /locus_tag="ABZJ_RS01845"
                     /old_locus_tag="ABZJ_00352"
     CDS             complement(384362..384733)
                     /locus_tag="ABZJ_RS01845"
                     /old_locus_tag="ABZJ_00352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001092666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001092666.1"
                     /db_xref="GI:447015410"
                     /translation="MNTKEFVKELINTISDEYIDTYKQIYSSTLIDNKIKEDPYWFDA
                     LTFYQSLSQKDKETLFKIIKQTTIDTTSIILGIIDGPVSLNQIPGDFTLTYTENEKTV
                     ILNGDLQDEFLTKIKERDRSQ"
     gene            384874..385404
                     /locus_tag="ABZJ_RS01850"
                     /old_locus_tag="ABZJ_00353"
     CDS             384874..385404
                     /locus_tag="ABZJ_RS01850"
                     /old_locus_tag="ABZJ_00353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002058722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan hydrolase"
                     /protein_id="WP_000929585.1"
                     /db_xref="GI:446852329"
                     /translation="MAHAHHAAHAHVHHIEERKEDRSQGDLKTKVMLRQAASTTEKSK
                     RSRTKNHKTEDQNINLHKFSSKLESISAKHSKEKCAKNIRIALQAAGADVSKHPVAAS
                     DWGHTLEKNGYKKIKPAFNRPQEGDIYIIERTSGHTYGHIAGYTGNGWFSDFRQKTYA
                     VYKEKDVKYSYYRLDS"
     gene            385538..387337
                     /gene="uvrC"
                     /locus_tag="ABZJ_RS01855"
                     /old_locus_tag="ABZJ_00354"
     CDS             385538..387337
                     /gene="uvrC"
                     /locus_tag="ABZJ_RS01855"
                     /old_locus_tag="ABZJ_00354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001123266.1"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. UvrC both incises the 5'
                     and 3' sides of the lesion. The N-terminal half is
                     responsible for the 3' incision and the C-terminal half is
                     responsible for the 5' incision; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit C"
                     /protein_id="WP_002000672.1"
                     /db_xref="GI:487927206"
                     /translation="MNQNARPHIEKILANLTQLPGVYKMLGKEGELLYVGKAKNLKNR
                     VSSYFVKTIEHPKTQALVARIYDIETLVTRSETEALLLEQNLIKQHRPPYNIMLRDDK
                     SYVYIFVSADKPYPRIASGRGKGKHQIGKFFGPYPSAYSARDTLLVLQKLFNVRQCEN
                     SYFSQRKRPCLQYQIKRCSAPCVGLVSPEDYKEDVNNSIRFLQGDTKELNQELIAKME
                     QAAADLEFEKAVFYRDRLSLLREVQAQQAVFKVKGEADILAIAYQAGVTCVQIMHVRN
                     GRMLGGKSYFPDMLGDDLGQMLSDFMANFYFQVADEVPSELIVNTALPDRKELEEALA
                     QQFGKKVQIKSSVRETRAEWLELAEMNVQHAIKGQLSNHLELNERFHQLEQVVGRPID
                     RIECFDISHTMGEAPIASCVVFDQGGARKRDYRQFAIQDITAGDDYAAMRQALTRRYK
                     KAMLPDLLLIDGGKGQLHMAIEVMQELGLEAFMVGVSKGEGRKPGLETLHFTDGTKIQ
                     LPEDSKALHLIQQVRDEAHRFAITKHRAKRDKRRSTSVLEAIPGLGPKRRRDLLTHFG
                     GIQGVLKASEKELTVVPGLGEVMARTIYKILHE"
     gene            387458..388252
                     /locus_tag="ABZJ_RS01860"
                     /old_locus_tag="ABZJ_00355"
     CDS             387458..388252
                     /locus_tag="ABZJ_RS01860"
                     /old_locus_tag="ABZJ_00355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA thioesterase"
                     /protein_id="WP_000055171.1"
                     /db_xref="GI:445977316"
                     /translation="MSLLQLWEDVKQNEWIDIPAGWLQGRTVFGGLVAGVLMQKACSY
                     IQDSNKRLLSCSVIFVGPVQQGAARLTIEVLREGKSVTTLEARLWQDDAVQTILVASF
                     GASRASSIEVKQEPVVPAYVPPENLSVIPFAKHMPECFQHFEVCWAEGNYPVTGSKHP
                     DFGGWSRFSPEQHANRQMTLSDLIVLMDIWPPGVLPMFKQVAPASSLSWHITYVHPVR
                     HQLCDWFKYKVTTEYAAEGYSTEYAYLWDQNDHLIAILRQTVTVFT"
     gene            388371..388958
                     /locus_tag="ABZJ_RS01865"
                     /old_locus_tag="ABZJ_00356"
     CDS             388371..388958
                     /locus_tag="ABZJ_RS01865"
                     /old_locus_tag="ABZJ_00356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006580943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="WP_000206941.1"
                     /db_xref="GI:446129086"
                     /translation="MTTGRILNIPNILTLARIALIPVFLVIAYWPPAIGIGEHVGSMT
                     RHIILTAIFVLAAVTDWFDGYLARTLNQTSAFGRFLDPVADKLMVAAALIVLVQWKPT
                     IAMAFAAIVIISREITVSALREWMAELGARTSVAVSTVGKYKTAFQMIAISVFLLNWQ
                     PLEVLAYALLYTAVILTLWSMFIYLKAAWPYLKQP"
     gene            389081..389935
                     /locus_tag="ABZJ_RS01870"
                     /old_locus_tag="ABZJ_00357"
     CDS             389081..389935
                     /locus_tag="ABZJ_RS01870"
                     /old_locus_tag="ABZJ_00357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001178158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="WP_001178150.1"
                     /db_xref="GI:447100894"
                     /translation="MQMLSSRQFAAIATIIEYLYEHLDQQPSLEDVATYMNLSPSYIQ
                     RQFQEWVGISPKKFVQYMSLQQAKYYLMQQRSLLDAALNTGLSGTGRLHDLFIQLEGM
                     TPGEYKQQGDGVELNYSVETSPFGDLLVVSSDKGICSVRFVDHSENIQEIVKQYFPKA
                     QLKNHSPIWHQQIAQWFRQDFSEHLQQKLPLNLAGTPFQLQVWEALLTIPEGQLRTYQ
                     DIAEQIGKPKAVRAVATAIGQNPIAYLIPCHRVIRATGMVGEYHWQKGRKLALLAWEM
                     AKQQGEIA"
     gene            389932..390543
                     /locus_tag="ABZJ_RS01875"
                     /old_locus_tag="ABZJ_00358"
     CDS             389932..390543
                     /locus_tag="ABZJ_RS01875"
                     /old_locus_tag="ABZJ_00358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006580945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase"
                     /protein_id="WP_000171259.1"
                     /db_xref="GI:446093404"
                     /translation="MTLDLFSPEPCSNLLPYDGEVQDYGCILTAEEAEQYFHYLYQYL
                     AWRHDEAKLYGKHFITPRKVAWYGDEHYRYKYSGVFRDSLPWDKALAQLKQQVEQILS
                     EKFNSCLANLYEDGTQGMAWHSDSDVSLARTTTIASLSFGATRKFSFRHIQTKEKVEM
                     WLQPGQLIVMRGETQQYWQHRLNRSTKILQPRINLTFRQFKFS"
     gene            complement(390738..391511)
                     /locus_tag="ABZJ_RS01880"
                     /old_locus_tag="ABZJ_00359"
     CDS             complement(390738..391511)
                     /locus_tag="ABZJ_RS01880"
                     /old_locus_tag="ABZJ_00359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009393025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_001018361.1"
                     /db_xref="GI:446941105"
                     /translation="MAISSFGKILTVLDLFSVSRPVINVDIICEELGLSKPTSYRYLK
                     ELVSADLLKRINGTSGDYTLGSKIAVLDYVSRTTDPLVQISTPFMRNIVERTELCCLL
                     TYLNDDYCIDIHHEIFKDTELLSYGRGCPRPIYVGASPKTMVSHLSKQRMHDYYERFQ
                     HELSESGFAVDEPSFIQRMRKIKKQGFYFSQGEIDPNVSGLAVPVRFSSKEVPLALTL
                     VASKNRFDFLNIEKLIEILQENAALIEQRFMELSEKGEI"
     gene            392007..394106
                     /locus_tag="ABZJ_RS01885"
                     /old_locus_tag="ABZJ_00360"
     CDS             392007..394106
                     /locus_tag="ABZJ_RS01885"
                     /old_locus_tag="ABZJ_00360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000925019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein"
                     /protein_id="WP_000925023.1"
                     /db_xref="GI:446847767"
                     /translation="MLLKQILAFRPSKLDLIFAIKTFIAGMLALFVSFELDLINPMWS
                     IGTVLIIANPYSGMVSSKCVYRLLGTVGGAIIALTITPHLINTPWIFTVVLSLWVGFA
                     LYVSLLDRTPRSYAFMLAGYSTAMIVYNAITYIDQYNIFDIALARVLEISIGVISSAV
                     VSATILPMHIGSAIKQRVTKTLKDTENLFANLLNADQQQNNTQLLAAITRDTTDIHAL
                     AVHLSYEKGELHGMTKPLQEMLHQMSMVVANLVALSERIKQLQELNFIESHSDKLKQL
                     SGHVIHFLEQKDQMTDENILQLPDEFENDFLNLNDSASEHQQVLLAAMKMDVRHFISN
                     VLAVKVLWQRIKQGNKEIPDNITPMTTTYPSLHRDHGVAVRGGISAVLITFIVTGVWI
                     LSGWKAGFMMAQIGAVTACILTALDNPVPVLRIFIWGSVASAVLVFIYAFGIFPYVTT
                     FWELGLVLLPMFLFAVSMMANQALMPVGMVLGINTMMGLNLHNAYSMDAVSYLDSSFG
                     MVMGVLVSLVVIDVVRAMSPDTSANRILALHYRAMRQAIYIPYGIEFKVHLRGMLDRV
                     GVLNTKMVQSEEIKKSIQQALVESSAIIDLSRLQELANQVPTSSELAHHIGRLQQDLD
                     ELFRAKENEKGESDVLVQHIHQTLFELKQLASNIEDMTLRQRLFISLNNIAYSMCHVS
                     SNQMNADRTLTGATAHG"
     gene            394099..394305
                     /locus_tag="ABZJ_RS01890"
                     /old_locus_tag="ABZJ_00361"
     CDS             394099..394305
                     /locus_tag="ABZJ_RS01890"
                     /old_locus_tag="ABZJ_00361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000503613.1"
                     /db_xref="GI:446425758"
                     /translation="MGEFNVYGIYVPALLVQAIFAYICFRWLSPLTNKWIAQGWIALP
                     SIFNLCFYLLLLLVIHQIFVGLGA"
     gene            394345..395346
                     /locus_tag="ABZJ_RS01895"
                     /old_locus_tag="ABZJ_00362"
     CDS             394345..395346
                     /locus_tag="ABZJ_RS01895"
                     /old_locus_tag="ABZJ_00362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FusE-MFP/HlyD membrane fusion protein"
                     /protein_id="WP_001072475.1"
                     /db_xref="GI:446995219"
                     /translation="MNQLELKKVIRPVILIVALMIAVYTIVHLWNYYNAAPWTRDGRV
                     RGDVIQVSSDVAGLVTEVLVQDNQTVKKGQVLFKIDVSRRALDVEQAKSDLAKAKAAY
                     AQAQAGLAQAKANLIKSSTNIKLAEKNANRYSNLMDGAISKQEQDQVFATRDQSHAEH
                     EQLQAAIQQAEATIKQQQALVEAATSNLHLAELNMHRAAVVAPADGTLSNFDLRPGNY
                     VQVGQAVAALLDRKQLYVVGYFEETKLDRIHIGDEATVQLMGDRQKIKGHVQGIASGI
                     EDRERSSSSKLLANVNPTFSWVRLAQRVPVKIVLDEAPKNELAFVSGRTATVHIIEK"
     gene            complement(395403..395843)
                     /locus_tag="ABZJ_RS01900"
                     /old_locus_tag="ABZJ_00363"
     CDS             complement(395403..395843)
                     /locus_tag="ABZJ_RS01900"
                     /old_locus_tag="ABZJ_00363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004699093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase"
                     /protein_id="WP_000127528.1"
                     /db_xref="GI:446049673"
                     /translation="MTATQSKSIMAFDFGTQKMGMAIGQSAIESANPLPLFVMKDGIP
                     NWDQLLKIVKEWQPDLFIVGLPLNMDDSESELSTRARKFARRLRHQTNIETWMVDERL
                     TTREAREELGFYQEQGRAKKLSADSFAAALLIQSWYRNPVGLTP"
     gene            complement(395843..396397)
                     /locus_tag="ABZJ_RS01905"
                     /old_locus_tag="ABZJ_00364"
     CDS             complement(395843..396397)
                     /locus_tag="ABZJ_RS01905"
                     /old_locus_tag="ABZJ_00364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000149693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001979301.1"
                     /db_xref="GI:487905835"
                     /translation="MTKQYMTHRCLIAPPEMADDFFANTVIYLARHDEEGAQGIIINR
                     PAGIQIKELLNDLDIDADNVNPHEVLQGGPLRPEAGFVLHTGQPTWHSSIAVGENVCI
                     TTSKDILDAIAHNEGVGRYQIALGYASWGKNQLEDEIARGDWLICDADMDLIFNLPYD
                     DRWDAAYKKIGVDRTWLASEIGHA"
     gene            complement(396524..398191)
                     /locus_tag="ABZJ_RS01910"
                     /old_locus_tag="ABZJ_00365"
     CDS             complement(396524..398191)
                     /locus_tag="ABZJ_RS01910"
                     /old_locus_tag="ABZJ_00365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002132792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA strand exchange inhibitor protein"
                     /protein_id="WP_000955430.1"
                     /db_xref="GI:446878174"
                     /translation="MLTHLTLINFALADHLAIDIEQGFNVLTGETGAGKSLLLDALSA
                     CLGERTDTNYVRYGSDKADVTAVFTYQDNSPEAKWLKEHELDDDSGEIHLRRVIFATG
                     RSKAWVNGRPSSLSELKELGRLLVQLYSQHSQQQLLEPPYPKHWLDRYSNFYAEANDV
                     REAYSTWQRNIRQHQAALDAQATRLQRIATLELQIEELEEVIQTDYKEIEQEFDRLSH
                     HEHIMQDCSYSLNALDEAEQNITQEMSSIIRRLESHAGRSEQLSEIYNSLLNAQSEID
                     DATSNLRQFIDRQSFDPERMEELNSKLEVFHRLARKYRTQPETLKEEYETWQSELEQL
                     HQLEDPETLAEQVEKSHQEFLEKAQHLDNIRREAASPLAKQLTEQVKPLALPEAHFEF
                     KFEPLEQPNAEGLSFIQLLFTANKGIPPQPLARVASGGELSRIALVMQVMNAEKTEAE
                     VLVFDEIDVGISGGTAEVVGRLLADLAQHVQLLCITHQAQVAAQSDQHLLVKKQQTDP
                     ASSTIVQLDENQIISELARMSGGVEINETTLQHAKQLRQLKFQASST"
     gene            398306..399616
                     /locus_tag="ABZJ_RS01915"
                     /old_locus_tag="ABZJ_00366"
     CDS             398306..399616
                     /locus_tag="ABZJ_RS01915"
                     /old_locus_tag="ABZJ_00366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012297396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000753294.1"
                     /db_xref="GI:446675948"
                     /translation="MKKTLSLPKAPIGMINRHKKTNPAEMNKILNQHFNAFKQAAAQG
                     DYVKAYQHVKKAVSLVPGHPGALSDLAYTELRLRRYDDAYQHYMQSIKASGSNVNTNL
                     YDGLTEVCHHLNKKEEKIKFGRLAISTKKELTKNEPTLNIPTHKPVPFSPNPQENIIA
                     FSLFGANPRYCETSILNTKLAQEIYPEWTCRFYVDESVPELVQQRLQANGAQVVHVSP
                     TQKQLSGLFWRFLVMDDPVVKRFLVRDADSIVSYREKAAVDAWLKSDQWFHLMRDSYS
                     HTELILAGMWGGCTGIFHNIEAHIRDYVATGRYPDNRVIDQHYLRYCIWPTLKQSVLV
                     HDSQQFDENSADFPVYDLTSMQNDQDNFHVGMDNGSPIVTTAVNHPTAEKVYWILFDE
                     NHDEVCRYDAIVSKSRNIEVNLPHAFAKKIQLQQWKLQVYPYEN"
     gene            399693..400019
                     /locus_tag="ABZJ_RS01920"
                     /old_locus_tag="ABZJ_00367"
     CDS             399693..400019
                     /locus_tag="ABZJ_RS01920"
                     /old_locus_tag="ABZJ_00367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009392983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000099685.1"
                     /db_xref="GI:446021830"
                     /translation="MSSTQFDHVTVIKKSNVYFGGACISHTVQFEDGTKKTLGVILPT
                     EQPLTFETHVPERMEIISGECRVKIADSNESELFRAGQSFYVPGNSVFKIETDEVLDY
                     VCHLEG"
     gene            400121..400870
                     /locus_tag="ABZJ_RS01925"
                     /old_locus_tag="ABZJ_00368"
     CDS             400121..400870
                     /locus_tag="ABZJ_RS01925"
                     /old_locus_tag="ABZJ_00368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016803977.1"
                     /note="Specifically methylates the ribose of guanosine
                     2251 in 23S rRNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (guanosine-2'-O-)-methyltransferase"
                     /protein_id="WP_001118149.1"
                     /db_xref="GI:447040893"
                     /translation="MAKPEYYYGVHSVESLLELEPERVLTLFTLKGRDDQRLQKILQL
                     AEPFGISVQKASRDSLEKLAGLPFHQGVVAAVRPHPTLNEKDLDQLLAETPDALLLAL
                     DQVTDPHNLGACIRTAAAMGVQAVIVPRDRSASLTPTARKVAAGGAEKVKFIQVTNLA
                     RTLAHLKETTHVRVIGTMLDENALPIQKCDFSGAVVIVMGAEDTGLRPITQAQCDQKA
                     YIPMSGNLQSLNVSVATGMALYEACRQRSEV"
     gene            400906..401820
                     /locus_tag="ABZJ_RS01930"
                     /old_locus_tag="ABZJ_00369"
     CDS             400906..401820
                     /locus_tag="ABZJ_RS01930"
                     /old_locus_tag="ABZJ_00369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000075011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000075011.1"
                     /db_xref="GI:445997156"
                     /translation="MSPRTQGYFFVLVTMCIWGGFTLFARLNAQWHISAWDIAALRFA
                     IAFLILMPILIYKKDLAFLWSKHAVILALIGGVIYCLTVYTAFLYAPAAHAAIFLNGC
                     IPICTAIAAYILFRQPFDKHTWVSLAIMITALALMSALMLKSSTSAFGIGDLLLFISA
                     IWWGIFTVLLKQWKLSAWHSMASVAIWSAIIYLPIYLLFLPKHFMDVDPLHLAVQSIF
                     HGVFVVIIATLTYVAAIQRLGAFKTGSIVTLAPFIAAILAVPLLGESLSPSIVVGLVG
                     MGIGALQPWRWFRQDSLTQKIKQQNTQN"
     gene            complement(401817..402413)
                     /locus_tag="ABZJ_RS01935"
                     /old_locus_tag="ABZJ_00370"
     CDS             complement(401817..402413)
                     /locus_tag="ABZJ_RS01935"
                     /old_locus_tag="ABZJ_00370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004883551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="WP_000874125.1"
                     /db_xref="GI:446796869"
                     /translation="MAFILGITGGIGSGKSAATQWFESQGIQVVDADIVAREVVEKGQ
                     PALQKIQQTFGDWVLQPDGSLDRRALREYIFQNPQARHTLEQITHPAIRQSIIQQLQN
                     PKSPYVILVSPLLFETNQHELVNHTLLIDASEQTQIQRASQRDGQNQEQIQKIIAAQM
                     PRERKRELANDIVFNDGLLEHLYQQLEPLHQSYLKRAN"
     gene            complement(402415..403275)
                     /locus_tag="ABZJ_RS01940"
                     /old_locus_tag="ABZJ_00371"
     CDS             complement(402415..403275)
                     /locus_tag="ABZJ_RS01940"
                     /old_locus_tag="ABZJ_00371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004710834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-methyltransferase"
                     /protein_id="WP_001152285.1"
                     /db_xref="GI:447075029"
                     /translation="MQDIIAYFIQNLTALYIAVALVSLCIGSFLNVVIYRTPRMMEQD
                     WQQECQMLLNPEQPIIDHERLTLNKPASSCPACQQPIRWYQNIPVISWLVLRGKCGHC
                     QHPISIRYPAIELLTMLCSLVVVMVFGPTIQMLFGLILTWVLIALTFIDFDTQLLPDR
                     FTLPLAALGLGINTFNIYTSPNSAIWGYLIGFLCLWIVYYLFKVITGKEGMGYGDFKL
                     LAALGAWMGPLMLPLIVLLSSLIGAIIGIILLKLRNDNQPFAFGPYIAIAGWVAFLWG
                     DQIMKIYLGG"
     gene            complement(403275..404501)
                     /locus_tag="ABZJ_RS01945"
                     /old_locus_tag="ABZJ_00372"
     CDS             complement(403275..404501)
                     /locus_tag="ABZJ_RS01945"
                     /old_locus_tag="ABZJ_00372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005065874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein F"
                     /protein_id="WP_000279216.1"
                     /db_xref="GI:446201361"
                     /translation="MAVKKAQMMPTFAYEGVDRKGVKIKGELPAKNMALAKVTLRKQG
                     VTVRNIREKRKNILEGLFKKKVTTLDITIFTRQLATMMKAGVPLVQGFEIVAEGLENP
                     AMREVVLGIKGEVEGGSTFASALRKYPQHFDNLFCSLVESGEQSGALETMLDRVAIYK
                     EKSELLKQKIKKAMKYPATVIVVAIVVTIILMVKVVPVFQDLFASFGADLPAFTQMVV
                     NMSKWMQEYWFIMIIAIGAVIAAFLEAKKRSKKFRDGLDKLALKLPIFGDLVYKAIIA
                     RYSRTLATTFAAGVPLIDALESTAGATNNVIYEKAVMKIREDVATGQQLQFAMRVSNR
                     FPSMAIQMVAIGEESGALDSMLDKVATYYENEVDNAVDGLTSMMEPLIMAILGVLVGG
                     LVIAMYLPIFQMGSVV"
     gene            complement(404531..406243)
                     /locus_tag="ABZJ_RS01950"
                     /old_locus_tag="ABZJ_00373"
     CDS             complement(404531..406243)
                     /locus_tag="ABZJ_RS01950"
                     /old_locus_tag="ABZJ_00373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002061634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretory protein GspE"
                     /protein_id="WP_001274990.1"
                     /db_xref="GI:447197734"
                     /translation="MSALHTSPKFTGFFRRLVEEKHVSAATMQTALDAAKRAKQDTVA
                     YLIEEVHLSPSLLAETISAEFAEPYFDLDVYDTSQIPKDLVDQKLILKHRILPLIQRG
                     QILYVATSNPSNIEAIDAIRFNSKLLVEPVIVEHHKLEKVLGQHFAEESSFDFNDEEF
                     DLDVNLDGPTTQEDEEEAPQGDEAPIVKYINKLLIDAIRMGASDLHFEPYEKSYRVRY
                     RVDGMLRQIANPPLQLANRLASRLKVMSQMDISEKRVPQDGRIKLKLSKSKAIDFRVN
                     SLPTLFGEKLVLRILDPSSAMLGIDALGYEEDQKALFMEALDKPQGMLLITGPTGSGK
                     TVSLYTGLNILNTESSNISTAEDPVEINLEGINQVNVNPKVGLTFAAALKSFLRQDPD
                     IIMVGEIRDLETAEIAIKAAQTGHMVMSTLHTNSAPETLTRLRNMGVPSFNIATSVNL
                     VIAQRLARRLCSQCKIPADIPKQSLLEMGFTEQDLAHPDFRVFQPVGCPECREGYKGR
                     VGIYEVMKVTPEISKIIMEDGNALEIAAASEKLGFNNLRRSGLKKVMQGVTSLQEVNR
                     VTSE"
     gene            406535..407329
                     /locus_tag="ABZJ_RS01955"
                     /old_locus_tag="ABZJ_00374"
     CDS             406535..407329
                     /locus_tag="ABZJ_RS01955"
                     /old_locus_tag="ABZJ_00374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="WP_000016939.1"
                     /db_xref="GI:445939084"
                     /translation="MSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENC
                     HVGVAPVSIALTTVQAQLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFV
                     LVGHSERRDIFGDNVEILKAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICD
                     IAPVVTAEQWQNQVVIAYEPIWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSNIAI
                     LYGGSVKAENAVELAACPDINGALVGGASLNAASFYQIVQAFAQSK"
     gene            407342..407671
                     /locus_tag="ABZJ_RS01960"
                     /old_locus_tag="ABZJ_00375"
     CDS             407342..407671
                     /locus_tag="ABZJ_RS01960"
                     /old_locus_tag="ABZJ_00375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_000555572.1"
                     /db_xref="GI:446477718"
                     /translation="MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFG
                     ASGSGNFLTRVTAILTALFFVTSLTLAVFAKKQTTEAYSLKTVQTTVPVQTTSPETSP
                     NAPKTGQ"
     gene            407728..407812
                     /locus_tag="ABZJ_RS01965"
                     /old_locus_tag="ABZJ_tRNA12"
     tRNA            407728..407812
                     /locus_tag="ABZJ_RS01965"
                     /old_locus_tag="ABZJ_tRNA12"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:407762..407764,aa:Leu,seq:gag)
     gene            407854..407930
                     /locus_tag="ABZJ_RS01970"
                     /old_locus_tag="ABZJ_tRNA13"
     tRNA            407854..407930
                     /locus_tag="ABZJ_RS01970"
                     /old_locus_tag="ABZJ_tRNA13"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:407888..407890,aa:Met,seq:cat)
     gene            408145..408669
                     /locus_tag="ABZJ_RS01975"
                     /old_locus_tag="ABZJ_00376"
     CDS             408145..408669
                     /locus_tag="ABZJ_RS01975"
                     /old_locus_tag="ABZJ_00376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000777731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000777730.1"
                     /db_xref="GI:446700384"
                     /translation="MKLSNKSQALYDMIAPAVEACGVDLWGIEFLPQGKRSLLRIYID
                     RPVDENAEPVINEDGEVEQGRGIGVEDCVRVTQQVGAMLDVHDPISGEYALEVSSPGW
                     DRPFFQLEQLQGYIGQQVALRLIAAVENRRKFQAKLLAVDLENEEIQVEVEGKHVLDI
                     DSNNIDKANLIYQD"
     gene            408707..410191
                     /gene="nusA"
                     /locus_tag="ABZJ_RS01980"
                     /old_locus_tag="ABZJ_00377"
     CDS             408707..410191
                     /gene="nusA"
                     /locus_tag="ABZJ_RS01980"
                     /old_locus_tag="ABZJ_00377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004932481.1"
                     /note="modifies transcription through interactions with
                     RNA polymerase affecting elongation, readthrough,
                     termination, and antitermination; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor NusA"
                     /protein_id="WP_000532247.1"
                     /db_xref="GI:446454392"
                     /translation="MGREILTVVETVSNEKGVSREAIFEALEQALVAATKKKFYEGTN
                     SEEAQLRVEIDRRTGDYRTFRQWTVVADEDHEMPACQDAISDVDPAKWSIGDVRELEV
                     ESIEFGRIAAQIAKQVIVQKIREAERALVADAYESKVGELIYGEVKKQTKDGFIIDLG
                     DNAEAYLAREEMIPKEILRPKQRVNAILYSVNREGRGAQLLLSRAKPEMLIALMKKEI
                     PEISEEIIEIKAAARQPGVRAKIAVKTNDHRIDPVGACIGMRGTRIQAVQQELNGERI
                     DVVVWSDDPAQYIASALEPADVSGIVLDEDAKSADIIFATNDQLARAIGSQGQNVRLA
                     SDLTGYKLDMMLEEEYRARQQNEAQQYLDMFVSRLDIEEDLAMALVEMGFTSLEEIAY
                     VPAETFDEIELDAELVELLQSRAKEAALTDALKQQENIQEPSADLLNMEGMTSEIAYS
                     LAARGIITVDDLADQATDDISDIEGLGHDKAGQLIMKARESWFN"
     gene            410202..412901
                     /locus_tag="ABZJ_RS01985"
                     /old_locus_tag="ABZJ_00378"
     CDS             410202..412901
                     /locus_tag="ABZJ_RS01985"
                     /old_locus_tag="ABZJ_00378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017725194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_000130326.1"
                     /db_xref="GI:446052471"
                     /translation="MTDKSIKELALSVGRPVEKLLEQAREAGLPQRTADDIITTEQQD
                     TLVNYLKKVHGQESGNTGKIALKRKTTSTAKVASTSGKAKTINVEVRKKQVFAKPNPE
                     QIAAEAKARAEAEAKARAEQQAREAAEQKARLQTEQKAKATLDAMRAAHQQDSAAQSA
                     PKAAVVVKKRGGGTVKPAPKPAETLEQKKAREAQTAQLKATEEAARRKAAEEAQQRTL
                     EQMRKMASKYSNDDATATIRVIDDSPLASGLVGQAYEDSFNQEDREIKRGGATTNPRA
                     GKKGGRRGQEEQSFVNHNKRGLKSSQANKHGFEKPVKKQVYDVEIGSSIVVADLAQKM
                     AIKVREVIKTLMKMGELVNQNQTIDQDTAALVVEEMGHNPVLVSDTQAEDNLLEAAEE
                     ARGEQTTRPPVVTIMGHVDHGKTSLLDRIRRSKVAAGEAGGITQHIGAYHVETDKGII
                     TFLDTPGHAAFTSMRARGAKATDIVVLVVAADDGVMPQTAEAIDHARAAGTPIIVAIN
                     KMDKESADPDRVLNELTTKEIVPEEWGGDVPVAKVSAHTGQGIDELLDLILIQSELME
                     LKASAEGAAQGVVIEARVDKGRGAVTSILVQNGTLNIGDLVLAGSSYGRVRAMSDENG
                     KPIKSAGPSIPVEILGLPEAPMAGDEVLVVNDEKKAREVADARADREREKRIERQSAM
                     RLENIMASMGKKDVPTVNVVLRTDVRGTLEALNAALHELSTDEVKVRVISSGVGAITE
                     SDVILAESSEAVLLGFNVRADTAARQKSDQDGIDIRYYSIIYELIDDVKDAMSGKLAP
                     EHRETILGVAQVREVFRSSKFGAAAGCMVMEGVIHRNKPIRVLRDDVVIFQGELESLR
                     RYKDVVDEVRAGMECGLAVKGYNDIKPLDKIEVYDVQMVKRSL"
     gene            412901..413302
                     /locus_tag="ABZJ_RS01990"
                     /old_locus_tag="ABZJ_00379"
     CDS             412901..413302
                     /locus_tag="ABZJ_RS01990"
                     /old_locus_tag="ABZJ_00379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004991652.1"
                     /note="associates with free 30S ribosomal subunits;
                     essential for efficient processing of 16S rRNA; in
                     Escherichia coli rbfA is induced by cold shock; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="WP_000897047.1"
                     /db_xref="GI:446819791"
                     /translation="MAGGQRLKRMADSVQRELSELIRQELKDPRLGGLVTISGVKVSP
                     DLGYADVYVTVMGRELSDDQNEVAHRETLDILNKASGFLRQELSRRIKTRITPRLRFH
                     YDKTNAYGNYMFGLIEKAVQDLPKRESDDKE"
     gene            complement(413359..413763)
                     /locus_tag="ABZJ_RS01995"
                     /old_locus_tag="ABZJ_00380"
     CDS             complement(413359..413763)
                     /locus_tag="ABZJ_RS01995"
                     /old_locus_tag="ABZJ_00380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001167532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_001167533.1"
                     /db_xref="GI:447090277"
                     /translation="MQITMEIIVSIFLVFGAFFMLVGSIGMVRLPDLFMRLHAPTKSS
                     TLGLGSFLIASMIFFAFQGRFGFAELLITLLAFITAPVSANLIAQAALHLRLRSLSGE
                     VPEAIERPLPWDRYKIGQRFSQNKPPMEPPQE"
     gene            complement(413776..414051)
                     /locus_tag="ABZJ_RS02000"
                     /old_locus_tag="ABZJ_00381"
     CDS             complement(413776..414051)
                     /locus_tag="ABZJ_RS02000"
                     /old_locus_tag="ABZJ_00381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pesticidal protein Cry5Aa"
                     /protein_id="WP_000154079.1"
                     /db_xref="GI:446076224"
                     /translation="MTILPYALGISLVAITISMLLCLFRMVMGPSIVDRLLALDTLFL
                     NATCLIIVLGIYWTTTSLFEGALLVAMLGFVSTAALARYFTTGHVID"
     gene            complement(414048..414573)
                     /locus_tag="ABZJ_RS02005"
                     /note="pesticidal protein Cry1Ba; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(414576..416387)
                     /locus_tag="ABZJ_RS02010"
                     /old_locus_tag="ABZJ_00382"
     CDS             complement(414576..416387)
                     /locus_tag="ABZJ_RS02010"
                     /old_locus_tag="ABZJ_00382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_000459271.1"
                     /db_xref="GI:446381416"
                     /translation="MFDFLSFWQANTPIFSILIPAFTGFILLLLGNPGAGALKEDWRQ
                     PWRRGISLISAIAGLITAVSYLLVANTGQITVYQLSEWSAPFGIVLVLDRLSAFMLVL
                     TYALAVPVLWYASENWDTRGRYFHAIFHFLLMGLCGAFLTGDLFNLFVFFEILLMASY
                     VLLLHGQGKPRFQLGVHYVIINLLASALFLIGLGMIYGSVGSLNMADVSRLLPTLDAD
                     QHKLAVAGALLLFVVFGIKAAMLPVGFWLPKTYAVASTPVAAIFTIMTKVGIYAILRV
                     NGTVFNDVLSQEIFKSWLLPIGLVTSLYGVIGAIGADRLRRFVGFMVLSSIGTLLIAI
                     AMSNTQAWSGALFYLVHSTLIGAAFYLFCGWMTSQRGDFKDHLKIAPRIKQEKAAMLT
                     YFLIAMMLAGLPPFSGFFGKVFILQATVETAYQGWVIGIVLLVSLLSIIALTRVGFIL
                     FWRASPPEEDPINPAYIIYRALPEKAPPRNDTVIYILLAGLVAYVAFASPVLHYTTNT
                     AQQIQDHALYQQSILKTDQNGEVISVQPYDSTYLPETKYGGEVEDHNAYLIPDIISKD
                     TFNGEHISEYKHRQIQQQEKLQTPTIADESQLKPMEP"
     gene            complement(416387..416755)
                     /locus_tag="ABZJ_RS02015"
                     /old_locus_tag="ABZJ_00383"
     CDS             complement(416387..416755)
                     /locus_tag="ABZJ_RS02015"
                     /old_locus_tag="ABZJ_00383"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000624230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_000624232.1"
                     /db_xref="GI:446546886"
                     /translation="MISLEFLLATAIGLLVATGIYLILRARTFPVVLGLAVLGYAVNL
                     FLFAMGRLQVSSPAILTETTNITDPLPQALVLTAIVIGFATTAFIVQLALRSRYESGS
                     DHVDAKEDISPTYDPREDEP"
     gene            complement(416752..419601)
                     /locus_tag="ABZJ_RS02020"
                     /old_locus_tag="ABZJ_00384"
     CDS             complement(416752..419601)
                     /locus_tag="ABZJ_RS02020"
                     /old_locus_tag="ABZJ_00384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004748459.1"
                     /note="subunit A of antiporter complex involved in
                     resistance to high concentrations of Na+, K+, Li+ and/or
                     alkali; in S. meliloti it is known to be involved with K+;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_000381591.1"
                     /db_xref="GI:446303736"
                     /translation="MDTSVLPIIILLPLILGTTLVSLLQRFSRGVTALGAIGVSLTSF
                     GLLLTQAKTVLGGASIQQSWDWLPQLGINLSFRLDALGLLFSLLITGIGTLIYIYAYY
                     YLGPKNSLSKLYLLLMLFMAAMLGISLSNNLIILLVFWELTSISSFLLVGYWSHYEAA
                     QRGSRMALTITGMGGLAMLGGFVLLGQITGTYEINDIVGMKDLIQSHYLFVPTLLLIL
                     LGAFTKSAQFPFHFWLPNAMAAPTPVSAYLHSATMVKAGIFLLARLAPIFIGAALYHN
                     IVTFVGLFTLCMAACFAIFKEDLKGLLAYSTISHLGLIVCLLGIGSPLAVAAAIFHII
                     NHATFKAALFMIAGIIDHETGTRDLRKLSGIWQLLPFTATLTMITAASMAGVPLTNGF
                     ISKEMFFTELLASLSGSTVIFASIIATLAGIFAVSYSIRLVHGVFFDGPVGKQVPNKN
                     AHEPPIGMRAPAILLATLCILVGIFPALLVEPLVNSVTRASLMQPDFAGTHLAIWHGF
                     NAPLIMSIIALVGGTLFYFALAKDGMIRKIDLDPRLGRLQGRILFDLFLKHLLLTSRK
                     IKQKTENGSLQSYLFLIIAFSIVMVTLPLFNQGLTTGTRELTHAPWIAVVLWLTLFSG
                     CWMMLWFHHERIKAVLISGAIGLVVTMVFVTMSAPDLALTQITVDVVTTVLLLMSLSL
                     LPQLTPYESRRSRRWRDAALAIIGGLGIGWITWLILTRDHNSISWFFAQQSLPLGGGS
                     NIVNVILVDFRGFDTFGEITVLGIAAIGALCLMDGMRVHGTTMTQGLTYRFNPSPLMF
                     RITASWVLPLALVVSVYIFMRGHNYPGGGFIAGLITSMALIIQYIALGQDQAEQMLKA
                     QSGRLYEIWIGSGLTIAGLTGIAAWFWARPFLTSAHVYVELPVLGKLHLASAASFDLG
                     VYITVVGATMLLISVLGDSRHSSMSGPVPHGEKSS"
     gene            complement(419916..421298)
                     /locus_tag="ABZJ_RS02025"
                     /old_locus_tag="ABZJ_00385"
     CDS             complement(419916..421298)
                     /locus_tag="ABZJ_RS02025"
                     /old_locus_tag="ABZJ_00385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000764513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_000764515.1"
                     /db_xref="GI:446687169"
                     /translation="MKLESIQFKHIALFHDLKIQFQYDKQPITLILGEQATGKSMLLK
                     HIYHALTWFPARLKDARTPGIVMPDQDISHSRLQSKIEVSIQIPPEFGQLPETASTQQ
                     TDTSLCSWKLFKTLNSSGVGISQVETQQLDQTITLYHQVTRKDPLQGLPLLAYYPSER
                     FVNDINLLNKNLPGITQSISAYDISFIPFTTFARFFEWLREISDIENAQAAHVVQRII
                     SKQSNSQDQEEILRQLQLELAGHPKQLPSPNLYALKSTLKIIFPELEDFYLQYHPKLQ
                     LMAHYKGEVLAFQQLSNTTKTWIALVGDVVRRLCLLNPLSLDPCLEGEGVLLIDQIDS
                     QLDAAHCSEILNRLHRAFPRLQIIVTGSREELLEHAAVYQCFKLEHGKISPLDLSTTQ
                     QQLEHLYTLLQRDEALTPHIDPLPLDTEPATTQIDSLYQQIQNLNEQQKNELLRMIHA
                     GDTSEETSSL"
     gene            complement(421322..422824)
                     /locus_tag="ABZJ_RS02030"
                     /old_locus_tag="ABZJ_00386"
     CDS             complement(421322..422824)
                     /locus_tag="ABZJ_RS02030"
                     /old_locus_tag="ABZJ_00386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="WP_000065138.1"
                     /db_xref="GI:445987283"
                     /translation="MSNIEKPKATYEQAIAIDNARLGQSFKVIAYAGTGKTTTLQMIS
                     DAMPERRGMYLAFNKAIAGEAQNKFHRNVDCRTFHSLAFRSVPRGVTDKLRLPRLSPS
                     FIAKEYRLEPITLRRMMGGRYEKYVLMPSRLASLVANAVSYFCSTSSQYPAPRHIQAP
                     NWLHPDDITALQTHLYPAVERRWLESIDPNHQAGIGHDIYLKLWALSEPNIPADYVLF
                     DEAQDADPLMLGILLRQKSTQVIYVGDAHQQIYAWRGAVNAMQQLPLPESRLTTSFRF
                     GEAIADVANALLGGLNETVPLLGNPNQKSSVVNKPHTKMRDAILCRTNARAMELLLAG
                     LVHGDKVSLQADHQKLNRFVDAASLLKQGKRVTDVPELAWFNSWHDVHEYCETNEGSD
                     IKPLVKLVDDHGTDPLKKALAKITPLEQADYVISTAHKAKGLEWNRVHIEDDYQFKIN
                     GLEHKITDEELRLLYVACTRAKVSLNIHHLYDLIQQLKLRAPLSLRQSVG"
     gene            complement(422834..423607)
                     /locus_tag="ABZJ_RS02035"
                     /old_locus_tag="ABZJ_00387"
     CDS             complement(422834..423607)
                     /locus_tag="ABZJ_RS02035"
                     /old_locus_tag="ABZJ_00387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001061922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP diphosphatase"
                     /protein_id="WP_001066569.1"
                     /db_xref="GI:446989313"
                     /translation="MNNTQWLDEVKFNEQGLIPAIAQHHQTGRILMVAWMNRESLALT
                     AEKNQAVYFSRSRQKLWHKGEESGHFQTVYEIRLDCDGDVIVLQVEQHGGIACHTGRE
                     SCFYRKLTPQGWEIVDAQLKDPTAIYGDKAKAESHDHAHTTEQVDVLAHLGQLMQERK
                     QAEADTSYVASLYKKGINKILEKVGEEGVETIIAAKDYAAQNTESNLNDLIYETADLW
                     FHSIVMLGYFDLNPQLIIDELGRRQGLSGLVEKANRNKV"
     gene            complement(423761..425074)
                     /locus_tag="ABZJ_RS02040"
                     /old_locus_tag="ABZJ_00388"
     CDS             complement(423761..425074)
                     /locus_tag="ABZJ_RS02040"
                     /old_locus_tag="ABZJ_00388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000856572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_000856572.1"
                     /db_xref="GI:446779316"
                     /translation="MKTPHFAIIGAGTAGLATAILLAREGNHVTIFEQVDELSPVGAG
                     LLLQPAGLAVFEHLGVLDKALTLGAKVTGLEGQLPDKRLLVNSHYREASTNLYGLGIH
                     RATLCHVLTQKLNEYSSQITWYMNHSVERFEEHNDEVQIFGSHQNQKFDACFDGLLIA
                     NGARSQLRPKAWVKVNKAYPWGAAWSIVPECQVLDPEILHQFYDRSKIMMGILPTGAI
                     PTEPQQRLSSVFWSLPTPQLQSFLQDEQAKQAWLKQVSERWPKVAEWLKEILYNCQTQ
                     PKWLSANYRDVVMTQFGQGRIGVIGDAAHAMSPQLGQGANMALLDAWAFSQSLRQAQK
                     NQNIDWPLLWQHYHQFRGSSTQFYQFLSRLLTPLYQSDHWWAGGLRDLVFPWMYQIPY
                     FRKEMAITISGLKTGPFRHLEYDQVAQLPKESSTFHLKSESLADF"
     gene            complement(425199..426818)
                     /locus_tag="ABZJ_RS02045"
                     /old_locus_tag="ABZJ_00389"
     CDS             complement(425199..426818)
                     /locus_tag="ABZJ_RS02045"
                     /old_locus_tag="ABZJ_00389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005140149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenylphenol hydroxylase"
                     /protein_id="WP_000612218.1"
                     /db_xref="GI:446534872"
                     /translation="MIPHVSRLLELWRIAAHYRLDTLFPADELPVKAKHALNIIKMHP
                     AAWSSRERKNPLKLKEALEDMGPLAIKLGQLLSTRRDLIPPEILAQLVLLQDQVKPFD
                     GEVAKQRIQDSLKADVNTLFARFDDQPLAAASIAQVHTAALHDGREVVVKVTRPDIRS
                     QILQDFEILAWLGNTLESRLEAARALHLSEIIQDYRQIILNELDLSIEADNTRRMRHY
                     FTGSTMMYVPEVYMDTKDVMVAERITGVPISDTATFDRLGMDRAQLAEKGLTIFFTQV
                     FRDNFFHADMHPGNVFVETINPSNPRFIALDCAIMGELSKHDQMTVARMLLAVMNSNF
                     MQLIQIVHQAGWIPPGTDQDALAREMRRTVGPMVSKPMDQLDFAGILIQVMDIARRFH
                     LEIPPQLMLLLKTLVHVEGLGTDLYPQLDIWKLAKPILTEWVKSNMNPVKNVKELGQQ
                     LPDLLLGAQDFPSLIIDSLNGLKNQSAWQDRQLREIQQLRLQMEHQQRRSWMFGSTML
                     ILLTIAIISPWFVSIILIVLSSLLALWRVLK"
     gene            complement(426831..427499)
                     /locus_tag="ABZJ_RS02050"
                     /old_locus_tag="ABZJ_00390"
     CDS             complement(426831..427499)
                     /locus_tag="ABZJ_RS02050"
                     /old_locus_tag="ABZJ_00390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017816104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000269705.1"
                     /db_xref="GI:446191850"
                     /translation="MWSILALGAVERIIHHLIDLDALTRIQLNQLQGKMLRVIIDSPQ
                     LSVDVFFDQEKVRLEPTVTGHSEKPSIFEQRPFDPQFKISEATATLHVKDVVELIKLL
                     LSDPDQIGNIPLQGDYHLLQDIQKIMQQAEPDLAAHLSKWVGPQLAHEIGKIQLAPKH
                     LKRSLQSHLFFAEDALKEDSGLFAPRWEMDDLNQATRKLNQDIDRLEAKLQQLNAQLQ
                     PTQD"
     gene            complement(427511..428458)
                     /locus_tag="ABZJ_RS02055"
                     /old_locus_tag="ABZJ_00391"
     CDS             complement(427511..428458)
                     /locus_tag="ABZJ_RS02055"
                     /old_locus_tag="ABZJ_00391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005079312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_000064213.1"
                     /db_xref="GI:445986358"
                     /translation="MSNENQKPTSPTEQAQSSDKVSPFLSSPLPQGTPQGQQQSLQQT
                     LTDTPVSGSVPKYNLPRGAGNTGNVGETTHFGYSTVRTEDKAQKVAEVFHSVASKYDL
                     MNDLMSFGIHRLWKRFAINMSGVRRGQHVLDIAGGTGDLAKVFSREVGPQGHVVLSDI
                     NESMLNVGRDRLIDAGCTNVDFVLANAETLEPFADNSFDLVTISFGLRNVTDKDAALA
                     SMFRVLKPGGRLLVLEFSKPVFEPFSKLYDLYSFTALPIMGKLVANDSESYKYLAESI
                     RMHPDQRTLKGMMENAGFQNCDYHNLTGGIVAVHRGFKL"
     gene            complement(428607..429314)
                     /locus_tag="ABZJ_RS02060"
                     /old_locus_tag="ABZJ_00392"
     CDS             complement(428607..429314)
                     /locus_tag="ABZJ_RS02060"
                     /old_locus_tag="ABZJ_00392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002126509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000039800.1"
                     /db_xref="GI:445961945"
                     /translation="MSKLAAFDELLQQYKTFNYHDNPVLAQRLQDVQTWLKERMKETH
                     HDFFNLPEHKLMAQYFLNRLYGGPEFDALAAQIERLLKYAHKAEKVLPENAIKTGTKS
                     VSLAVLATQLDEQVAMQLLEDYPADTVLTDEIMRLTLIKLDQAEARYQQLALLDDLGA
                     ALDKYMRSFMMFTAFKMCKGIAQKYHFELMYDFIQDGFSAMKPLKSAEAFIKTFTEKE
                     RQIVEKVHSGHPNPFRV"
     gene            429522..430940
                     /locus_tag="ABZJ_RS02065"
                     /old_locus_tag="ABZJ_00393"
     CDS             429522..430940
                     /locus_tag="ABZJ_RS02065"
                     /old_locus_tag="ABZJ_00393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000003541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate:AMP phosphotransferase"
                     /protein_id="WP_000003541.1"
                     /db_xref="GI:445925686"
                     /translation="MSEQQPKFEIRDEEQLSVDLIEAQYALKESRGKPNAKSTLILMS
                     GIELAGKGEAVKQLREWLDPRYLRVKADAPRVLTDSEAFWQSYSAFIPTEGQIVVMFG
                     NWYSDLLVTATHVSEPLDDARFDAYVENMRAFEQDLKNNYVDVIKVWFDLSWKSLQKR
                     LDKIDPSEQHWHKLHGLDWRNKKQYDTLQKLRRRFTDDWYIIDGEDEKQRDQFFAQYL
                     LQHMRQLPEHETEVKGKWQQAKIPESLLKPAQEKMDKAEYKKELDKLSKKIADNMRFD
                     KRNVVIAFEGMDAAGKGGAIKRIVKNLDPREYDIHCIGAPERFEARHPYLWRFWNRIN
                     EAEKITIFDRTWYGRVLVERVEGFASPIEWQRAYDEINRFEKDLFDSQTIVVKIWLAI
                     SKDEQEQRFKAREETPHKRFKITAEDWRNRDKWDDYLKAAADMLERTSTEYAPWYIVA
                     TDDKYTARLEVLRAILKQLRAD"
     gene            complement(430963..431469)
                     /locus_tag="ABZJ_RS02070"
                     /old_locus_tag="ABZJ_00394"
     CDS             complement(430963..431469)
                     /locus_tag="ABZJ_RS02070"
                     /old_locus_tag="ABZJ_00394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000687234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000687236.1"
                     /db_xref="GI:446609890"
                     /translation="MKIDNIPDYIDPSLNLEQIRDECQELIQKRAYVSAGAAIVPIPF
                     FDVVVDLGILSQLIPDINSRFGLAPEHVSVYDPKTKTIHWDELRKRGFQFSGFVVART
                     TVKKTFNGFFGKIVTKQVTKFVPLGGQLVAASLGYFMMKKIAQTHLNDSYNLAKRIQQ
                     KSRGTVVN"
     gene            431641..435276
                     /locus_tag="ABZJ_RS02075"
                     /old_locus_tag="ABZJ_00395"
     CDS             431641..435276
                     /locus_tag="ABZJ_RS02075"
                     /old_locus_tag="ABZJ_00395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005112362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease V subunit gamma"
                     /protein_id="WP_000511247.1"
                     /db_xref="GI:446433392"
                     /translation="MGIHVIQSQRIDVLLQGVLASTSQPSTHPLQVLKAQHFIVPSPA
                     IEQWLIQKLAEQQGMSANYQFHQRVRGFQWYAYQQVLTAHKEQVRKANIPRLIFKWRV
                     HQALQEFIQPDVMSIDSSHPLHSIVQRIYDSADRLEQGIEKQLKKQKMLYWVAEQVAD
                     LFSNYMVYRGQCQRGCENMCTCPNNWLAAWGQGRSLDIEKYIAHKDKEVSAFTLQQTQ
                     ELERWQRWLWQQHFHEDFMQMQQIDELFWQELEHPERQKKALSRLPQQIVIFTLLDLP
                     PSQLQFLRRLGQYIDVLILHYNPSQEYWADSVDPLWKQRYDLGVKERFIAKNPQATDA
                     EIADFFNKFTLNFNAEARESRHPLLTRLGKQARDHFSLLSNLSTGEEGKWVDAFVDDF
                     PESLLGKVQSDILHLVEPQAKQYELAPNDDSIQIHVCHSTLRQLEVLKEQLIGWLAKP
                     HEQPRRPNDILVLVPNLAEVEPLIRSVFPATATEQGVHLPVKIAGIASLDALNAWRAV
                     IGRIHLMQGRFSFDEFADWLGLHATQQRYALEYAQVERILNLLADAGFKRGLDAEHLK
                     RSLCDGDDDYRYSFKFALERLALGIAIPEHATFNQVLSYAKVQPGDFELIGTLIQIYQ
                     DLNERRDWLIMHEQKKSHTVEYWLQTLSQDIIEFEQAGVTALKTAREIVKKQERMLTL
                     ASYYAETETGTLRKITLPLPYILDEIQRTLENQTAQAEPTGQITFAQIGQIRPLPYRL
                     IVMLNLDAGQFPNRDTHVPFDLMDALRQQLGDRSRLEDDQGAFLDALLLAQENLWLFY
                     NGFDVNDGEVRDPSSILQEFREHLALIVKPEPNAPDREVIEGIEIPTQLKQLYHLHYL
                     QPFDPKGFMAENRYIRYQDHWFNVAMQIQQASGVLKPWANISYPLEIPDMLVLDSHQW
                     IQDVTFPARLYLKTLGVENLGNVSVLDQNEPLLLDGLGRYTIRHFLQQNEQQAQPEVL
                     LDQLPVGKVQYSAWQQGIFEQECLLERLHHYAPAVTQTTQRVWRIAKQLHMNITVPKS
                     ETQDWVSMEASSARAKRRAKVWLEYLLWLAYLNEGSAGTERRRIVVFSDQTVICKGIS
                     SEQARQYLQPWFKIWRYAQQQPLVLPAALLLKPLEKAKAYQWETTNPTEKIKLDEKSY
                     AELLKYWNETGTFTSIDMTQNEACKLHQDWRFILQEQDAQALLQHACDEFAYDLYHPV
                     FQFQHSE"
     gene            435280..438978
                     /locus_tag="ABZJ_RS02080"
                     /old_locus_tag="ABZJ_00396"
     CDS             435280..438978
                     /locus_tag="ABZJ_RS02080"
                     /old_locus_tag="ABZJ_00396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002083658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease V subunit beta"
                     /protein_id="WP_001088720.1"
                     /db_xref="GI:447011464"
                     /translation="MNSRVQVSYQPIIDIEFSGLHLIEASAGTGKTYTLSSLMVRIFL
                     EKYLPGQVIATTFTRAAAAELKSRIRARLVETHRYLDAKRSLTEKEILLQAEQESDLL
                     LQHILKHFATRIAYACERLKLVIDQLDELFVGTLDSFSQKLLREFAFESGKIERAQIT
                     DDAKTYSRQLIHDVLREWIQSQPQTVIDALYLAGELKSVDSFVKLVEDSLNFSSAHFK
                     LPEKPTIQFEQLAQLKQLAAEIDISLLEPYYSLDGDHYKHVSGTIFRNGAFNKLFSEC
                     LPQLLQVLKQSDSILVFDGSLAIQRELVFKFLGQLADQKVFKKCPAEISDGFYQHPCI
                     QQIQQLFGVLKNYAEQFDQLHIYLKAYLCIEVKKRLPQVLQNKGETTFSQQIRTLSEA
                     LKGEQGQRFAVFVQARYPLILVDEFQDTNQDQDDMLASIWRHPERYQKGCMIMVGDRK
                     QAIYGFRGGDMLTFLNAYKDIQAKHGREYKLIHNHRSVADLVEVVDALFQRQIDFGEQ
                     VQYDPIRAGTRPHPVLIDQNQPNPHPLRWLMLKDKETEAQQVAWKIRDLLNQSHAGQL
                     YFQKDAQTQTLNEDDIAVLSRNHDGLDKVQFELERLGIRVNRPSKRSVFDCTIAQDVG
                     ALLTAILHPYDEAKVKRALISRLFAMDLKQLLQLEQTAEGLSQFMTGFDTIRELWSAQ
                     GFLVAWQQCLNQFGIWKNLVAVQSKDNERVVVNLRHLTEILSQHSEKYQGAQNLYHWY
                     LKQLQSPLDREWELERRLSSEAGVQLMTIHQSKGLEFKIVFLLGADKPFRENNKTLNF
                     STQDITVSESAQTLTQRVVAIADKTYLNENELKQHEERALAEQNRLWYVALTRASHRV
                     YALLQDTDGKSVSGLAFWKNRAEPFQHRCCTDEIILEQPPAARHLNQHINIIEIQAQH
                     FPDQRFYSRGKTSFSYLAQHLRHKVGTDLLASQSHEAVLAEDELDQVISVEAPAAQPI
                     SWIKSNFPRGTLAGNFLHEIFEHIDFQCSDEWVSEIRRRFKNDYSSLWQDLLIKYQES
                     FPEEQEAEYSLYHAVAEWLQEILSTPLYQGFRLNRLQPEHYLSECPFYLALSDRVLAM
                     KRIQQLFAEYGMEMPELLEARSARYLNGSIDLVYFDGQRYHIADYKSNYLGENLADYS
                     VESIAQSMSLASYWLQAGLYLVALHRYLKVKMQNYDIEQHLGGATYLYLRGMNGEAEQ
                     GYYYWQPSTEFVLRLDAILGYFAEDKIA"
     gene            439087..440838
                     /locus_tag="ABZJ_RS02085"
                     /old_locus_tag="ABZJ_00397"
     CDS             439087..440838
                     /locus_tag="ABZJ_RS02085"
                     /old_locus_tag="ABZJ_00397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000369446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease V subunit alpha"
                     /protein_id="WP_000369435.1"
                     /db_xref="GI:446291580"
                     /translation="MDNLNSPEQSDLSWLTTWSTFLNQAPFTAQTQAPEAAYFLQQLI
                     EASLQGDSCIEISPEQIETLGQLVISAEQAKSQVAPCVHDEQGLALYRYWNLEQRLAE
                     QIRRLKQQPIQPVSCEEHLDLLTDPHQQAALQMVTRQSLSIITGGPGTGKTYTLARII
                     AVLSQAIPHIRVAMAAPTGKAAQRMQEALQNSFNDPKLLESGLISAELRNQSTQTIHR
                     LLGMGHSQTPRFNQKQPLPYDVIVVDEASMLDLNLATLLFEAVPESCRIILLGDANQL
                     ASVDVGAVLADLQQIEALSENRVHLQTSRRFAEGALIGQVARFIQMQTSQINHEQILQ
                     KFEIDIVQVSELRSIPLETDMPDVVQLEYLPEESPIALETYYQKLMVDFQGYVQSLKA
                     YIQDDRSLEHIENIVRSFDDYRILTAVRHGPFGLQQLNQYAERWLQQQLGIVTLGGWY
                     VGRPVMMTYNDYQLGISNGDIGLCFEHRTQPQQFEVYFPSLNKWVAANRLPKSIQSAF
                     ALTIHKSQGSEFTHTAVVLDQAAKNLLSQELIYTAITRAKKVVSLLVDPEALLQSFTV
                     RTTRKSGLVEKVNRLVR"
     gene            complement(441555..442853)
                     /locus_tag="ABZJ_RS02090"
                     /old_locus_tag="ABZJ_00398"
     CDS             complement(441555..442853)
                     /locus_tag="ABZJ_RS02090"
                     /old_locus_tag="ABZJ_00398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017385387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_000689278.1"
                     /db_xref="GI:446611932"
                     /translation="MKIFSTNTCPVPNDLESVIHHKDEVPAELGGMSEQQVQKIWKSI
                     ESLYKTGNYPLITFCLRRQGKILLNRSIGYAQGNSPAGLQENALIATPDTPVCLFSAS
                     KMITAMLIHLLDEKGEINLLDPVSYYIPEYGVNGKRRATIFHLLSHRGGIPYVDGDVT
                     PELLFDKDEILRRLYAARPVSPAGNHLAYHAVTAGYILGEIIERVTGQDLRQFVHETI
                     EKPMDMPYFNYGLKPEYRAEVALNCATGLHPRLGTDHYLNHVLGGGLQLAVDVTNDSR
                     FMDTICPAGNIYTSAEQAGRFFEMLLSGGSYQGKQILSEKTIFRATLPTTGVNIDRTL
                     LIPMRYALGPMLGSNPVGLFGPMTGQAFGHLGFSNILCWADPERDISVSLLTTGKSVV
                     GTHLPALANLLYQISTQCPRIPRDQRRSLFGSDSHETDLV"
     gene            443066..443335
                     /locus_tag="ABZJ_RS02095"
                     /old_locus_tag="ABZJ_00400"
     CDS             443066..443335
                     /locus_tag="ABZJ_RS02095"
                     /old_locus_tag="ABZJ_00400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004916774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_001229357.1"
                     /db_xref="GI:447152101"
                     /translation="MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFK
                     AHKHDHHSRRGLIRMVNQRRKLLDYLNGKDHERYTALIGALGLRR"
     gene            443587..445680
                     /locus_tag="ABZJ_RS02100"
                     /old_locus_tag="ABZJ_00401"
     CDS             443587..445680
                     /locus_tag="ABZJ_RS02100"
                     /old_locus_tag="ABZJ_00401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004902390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide phosphorylase/polyadenylase"
                     /protein_id="WP_000061670.1"
                     /db_xref="GI:445983815"
                     /translation="MSMFNIVRKEFQFGQHQVVLETGRVARQANTVLITMGGVTVLVA
                     VVAAPTAKAGQDFFPLTVNYQEKQYAAGRIPGGYGKREGRASEAETLISRLIDRPIRP
                     LFPEGYYNEIQVTATVVSSDKTMEADIAAMLGTSAALAIAGTPFRGPIGAARVGLING
                     EYVLNPNFEQMAQSDLDLVVAGTESAVLMVESEAKELSEDQMLGAVLFGHDEMQIAIQ
                     AINEFAAAAGAKPSDWVAPAHNEELRAKLKEAFEAKISEAYTIAVKQDRYAALDALHA
                     EAVAQFVPEEDVDGIADEVDYLFEDLKYRTVRDNILSGKPRIDGRDTKTVRALDVQVG
                     VLERAHGSALFTRGETQALVTTTLGNTRDALMVDTLAGTKTDNFMLHYNFPAYSVGET
                     GRESGPKRREIGHGRLARRGVQAVLPAADRFPYVIRIVSDITESNGSSSMASVCGASL
                     SLMDAGVPLKAPVAGIAMGLVKEGERFAVLSDILGDEDHLGDMDFKVAGSANGITALQ
                     MDIKIEGITEEIMEVALNQAFAGRMHILNEMNKVISRARPEISMHAPTFEVITINPDK
                     IRDVIGKGGATIRQITEETKAAIDIEDNGTVRVFGETKAAAKAAIAKIQAITAEVEPG
                     KIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEGQEVKVQVQDVD
                     NRGRIKLTMKDIEQA"
     gene            445765..446976
                     /locus_tag="ABZJ_RS02105"
                     /old_locus_tag="ABZJ_00402"
     CDS             445765..446976
                     /locus_tag="ABZJ_RS02105"
                     /old_locus_tag="ABZJ_00402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006580964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_001198552.1"
                     /db_xref="GI:447121296"
                     /translation="MQVYYFYRHQSDGYVFISREKHTEHILEFFWIDSVRSDVVSQNE
                     EWQQKIQQLADVSINEFHMRDIANIEHPCAFDTLEEYDLLIFRKLVTPDDEIKNGESH
                     ESVFGLATTPISFIFTPKVLISVREQGNKSIENYIQRLENILCKTLEEQNKTRKLPNS
                     PVDLCLRLLNSMVDGYLDIRSPLTRRVEHWQQQLLQGNRRFKQWHQLFHENMAFQQVE
                     NLCEEQIETLQEFRDEIVENYHHVIGEKTHSSQDLLLVRLNDLMSHVERIQKHTLRLR
                     SAIQSAIDLHFSAIANQTNENMRILAIITAVFAPLTLLTGIYGMNFEFIPGLKSPVGF
                     WIMLGVMLLSTILLLYYFYRQHLVGRGEKSVIDLLAQQHRQDRMNLFWFLEYEPIKQT
                     LKEVEKITRLK"
     gene            complement(447223..447552)
                     /locus_tag="ABZJ_RS02110"
                     /old_locus_tag="ABZJ_00403"
     CDS             complement(447223..447552)
                     /locus_tag="ABZJ_RS02110"
                     /old_locus_tag="ABZJ_00403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000207457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcripitonal regulator"
                     /protein_id="WP_000207459.1"
                     /db_xref="GI:446129604"
                     /translation="MTTIHYREIVCDGHTFSAEVVDEQCTFDLQQFAQACGQSPDWIL
                     QLIEYDILAIDTPPEKHQFMGEDVIRARKAYRLQRDFDASLAAVAVMLDLIDEVQQLR
                     KQLKHFH"
     gene            complement(447564..448520)
                     /locus_tag="ABZJ_RS02115"
                     /old_locus_tag="ABZJ_00404"
     CDS             complement(447564..448520)
                     /locus_tag="ABZJ_RS02115"
                     /old_locus_tag="ABZJ_00404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016803958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_001107921.1"
                     /db_xref="GI:447030665"
                     /translation="MAKNYYEELGVKREASADEIKKAYRKLARKYHPDISKEKDAEEK
                     MQAINVAYDTLSNPEKKAEYDQMLDHPQGFNGFGQGAAQSGFDGARFYRQGFTGGEQA
                     DFSGFEDLFGRFGAGFGGGQQQYQRQQRSYRGEDQHASIEVDLDIAYHGSTQHITLQI
                     PTINAYGEPEVQRKTLQVKIPKGMKEGQQIRLSGQGQSGINGGANGDLYIEIQYKDTD
                     RVHVEGSDVYLTVDVAPWEAALGQGIEVKTPAGPLHVNLPKNAKQGQQLRLKDKGIPN
                     KTPGHLYLILNIVFPPAHSEKEKEAYQQLAEAFASFEPRSSH"
     gene            complement(448671..449282)
                     /locus_tag="ABZJ_RS02120"
                     /old_locus_tag="ABZJ_00405"
     CDS             complement(448671..449282)
                     /locus_tag="ABZJ_RS02120"
                     /old_locus_tag="ABZJ_00405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001105726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="WP_001105725.1"
                     /db_xref="GI:447028469"
                     /translation="MNYFDYFLFIFSVIIMIATPGPVMILVASAGLKGGYKKALETIF
                     GTNLASLVLIFISVLVLKGVLGINENYLNIIRVLGCLYIGYLGFSILKEVIQAPHPEA
                     IQTVSAQNGGFKKGFLVGISNPKDIIFFSAFFPQFVSISPHLDLSLTILTLTWIVLDF
                     LTLSLVYIFFRRLSNSHLYPKILGLCGLLLLVIAVYGLYQTFI"
     gene            complement(449421..450296)
                     /locus_tag="ABZJ_RS02125"
                     /old_locus_tag="ABZJ_00406"
     CDS             complement(449421..450296)
                     /locus_tag="ABZJ_RS02125"
                     /old_locus_tag="ABZJ_00406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004640903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp33"
                     /protein_id="WP_001281761.1"
                     /db_xref="GI:447204505"
                     /translation="MSDLRQRFYIEDFPVRGEVVHLEEALKTILAQRDYMLAVQILLG
                     EMLSATALLASTLKIKGRISLQIQANGSFKWAMAECNHLGEVRALADYETDPRFGEAT
                     DSSTVLAALVNPVLFINIEPEHGERYQGIVPLDQANLAGCLMQYYDLSAQIPTRIVLA
                     STAQRSGGLLIQLLPRHDEEEQKLVDEDLWPRLTMLTETLKSEELTELSANEILYRLY
                     NEEEVRLPEVEHLKFGCTCSKERCAKALIQIGVDAVHETLEAQNPIQMDCQFCNTRYE
                     FTAEEALGLFGEHLS"
     gene            complement(450462..452303)
                     /locus_tag="ABZJ_RS02130"
                     /old_locus_tag="ABZJ_00407"
     CDS             complement(450462..452303)
                     /locus_tag="ABZJ_RS02130"
                     /old_locus_tag="ABZJ_00407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456900.1"
                     /note="involved in potassium efflux; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_000008979.1"
                     /db_xref="GI:445931124"
                     /translation="MSFLLQATIFLGASLILVPLGKRLGIATVLGYLFTGILLGPSVL
                     NIAHDPEAIMELAEFGVILLMFLIGLELRPQRLWEMRDSIFVMGSLQVVITGIILMLT
                     VLLLFQQHLAASFVIGFALALSSTAFVLQLLTEKQQLNTTYGQQSFSILLFQDIAAIP
                     LLAVIPLLAGTESTHHGIAYFAAIIATFTGLFLFSRYVMRPFFRFVAKSGATELITAV
                     GLFIILAVVLLMDTLGISTTLGAFLTGVLLADSEFRHELEASIAPFKGLLLGLFFMTV
                     GMTTQLSLLIEMPWLIIGGAIGLLVIKTLVLTAIARYKKYSWNNSLLLGTCLAQGGEF
                     AFVILSLAKSEKILTDALLEPVTLIVTLSMVLTPVIYWIMACKIIPLFHKELPPEYDE
                     IPQQDNPIIIAGFGRFGQIIARIARLQHLGFTAIDNNLHQVDFVRRYGGKLYYGDVTQ
                     PDLLRSAGIEKAKVFILAIDDVEDSMNVARHLRLNYPNLKLLARARDRHHVHLLRDLG
                     VEHIWRETYLSSLGMAYRALRELGISDEQAYNNIEIFRDYDEKLLIQQQSIYTDEQKV
                     FETHRNALAELEHLFESDAQQATSKHDVNLKRHLQPNRIDITRDHEE"
     gene            complement(452380..454608)
                     /locus_tag="ABZJ_RS02135"
                     /old_locus_tag="ABZJ_00408"
     CDS             complement(452380..454608)
                     /locus_tag="ABZJ_RS02135"
                     /old_locus_tag="ABZJ_00408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000156635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent primosomal protein N'"
                     /protein_id="WP_000156646.1"
                     /db_xref="GI:446078791"
                     /translation="MTITPKPDSVVYRVRVAVPVHLYDTFDYTLTKAQYERAQVGSRV
                     AISFGRQNLIGIITEKVDPQESFTGHFQLKAISELLDDEPILDEQVLNLLTWSAQYYQ
                     FPIGEVMQTALPALLRQGKPMDVLFHLWKIIPCDNAEALLKRSIKQQDAYQILKLHPA
                     GTTENILNLSGVETATLKALQKKGLVDCTLEPHDFSPSPVQLAQMPLTLNEDQKKATQ
                     HVLNAQHQYQAFLLDGLTGSGKTEVYLHIMHEVLKQGKQVLVLVPEIGLTPQTISRFK
                     SRFNCDIALLHSGLNDSKRLQAWQQAQTGKASIILGTRSAIYTPLPRLGLIILDEEHD
                     LSYKQQEGFRYHARDVALYRGHLQGCPVLLGSATPSIDSYHLVETGKLTALQLNQRAG
                     HALLPKMHLIDLKIVKKQHGISQPLIEQIKNTLARKEQVLIFLNRRGYAPVLVCESCG
                     WQANCPHCDAHFTLHTQPYSYLHCHHCGTVHRLPDHCPECQQKSLKTLGAGTAKVEEH
                     LQELFPDHDVIRVDRDSTSRVGSWQKIYDRIQQNKPSILLGTQMLAKGHHFPHVTLVA
                     ILDIDAGLLSVDIRAPERTAQLIVQVAGRAGRGEHKGHVYLQTLRPDHPLLTTLIEKD
                     YRAVAKQTLAERKVALLPPYRYAVLIRAESKDRDYTLHFLNEAAEQLRQIAGDIVDIW
                     GPIPAPMERKAGRYRAHMVILSADRARLHFYLRQWWAQLVHAPRQHQLRLSIDVDPQE
                     FS"
     gene            454757..455962
                     /locus_tag="ABZJ_RS02140"
                     /old_locus_tag="ABZJ_00409"
     CDS             454757..455962
                     /locus_tag="ABZJ_RS02140"
                     /old_locus_tag="ABZJ_00409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005301929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein F"
                     /protein_id="WP_001112089.1"
                     /db_xref="GI:447034833"
                     /translation="MPAYQFTAIDASGKQQKGVLEGDSARQIRQQLRDKAWTPISVDP
                     VEQKDKHQSHGLFQKKFSAYDLALMTRQLSVLVAAAIPLEEALRAVSRQSEKAHVQNL
                     LLSVRSKVLEGHSLAQGMQQSGRFPDLYIATVAAGERSGHLDLILDQLSDYTENRFAM
                     QKKVQGAMIYPIILMLMSFGIVMGLMTYVVPEIVKTFDQSKDALPWITVALMKASDFI
                     RHAWVFIILFAIVGVVAFVRFLKTTAGHYAFDRLTLKLPLFGKLSRGINAARFASTLS
                     ILTRSGVPLVDALKIGAAVTNNWVIRDSISQAAERVTEGGNLGTQLERSGYFPPMMVQ
                     MIRSGEASGELDRMLERASTMQDREVTTFISTLLALLEPLMLVLMASIVLVIVIAVML
                     PIVNMNNMI"
     gene            456018..456566
                     /locus_tag="ABZJ_RS02145"
                     /old_locus_tag="ABZJ_00410"
     CDS             456018..456566
                     /locus_tag="ABZJ_RS02145"
                     /old_locus_tag="ABZJ_00410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011858201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein G"
                     /protein_id="WP_000809287.1"
                     /db_xref="GI:446732031"
                     /translation="MKQHSESVVSNQFEPTCHSEHSSVSDVCSSSAFGLATRSSRARM
                     KRASGFTLIEVMVVIVILGVLAALIVPNVMGRSEKAKIDTTQITLKGVAGALDQYKLD
                     NGHFPTMQEGGLDALINQPATAKNWMPGGYVKGGYPKDSWKNDIQYVVPGKDGHPFDL
                     YSFGADGKEGGEGNDADIYYQP"
     gene            456833..457177
                     /locus_tag="ABZJ_RS02150"
                     /old_locus_tag="ABZJ_00411"
     CDS             456833..457177
                     /locus_tag="ABZJ_RS02150"
                     /old_locus_tag="ABZJ_00411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004836221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000643174.1"
                     /db_xref="GI:446565828"
                     /translation="MKAFLVLDELNQFHWAMLKSVLLILALLPIAEVSLKLWLSTEGS
                     SQIMIGFFALSIVSAWLMVSFFTALKTSVWQTKQMASKYEQLLFKAYRYVPMVFLSSL
                     VAYLSLQLSIAF"
     gene            457322..457660
                     /locus_tag="ABZJ_RS02155"
                     /old_locus_tag="ABZJ_00412"
     CDS             457322..457660
                     /locus_tag="ABZJ_RS02155"
                     /old_locus_tag="ABZJ_00412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009393272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-binding protein"
                     /protein_id="WP_000434938.1"
                     /db_xref="GI:446357083"
                     /translation="MEQIEWNDFLKVELRVGKIIQAEVFEKARKPAYILHVDFGEELG
                     VRKSSAQITKLYQPQDLIGKLVVAVVNFPKKQIGPIQSECLVTGFHNADGDVALCIPE
                     FEVPLGTKLL"
     gene            complement(457662..459221)
                     /locus_tag="ABZJ_RS02160"
                     /old_locus_tag="ABZJ_00413"
     CDS             complement(457662..459221)
                     /locus_tag="ABZJ_RS02160"
                     /old_locus_tag="ABZJ_00413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005301941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="WP_001203086.1"
                     /db_xref="GI:447125830"
                     /translation="MRAYFEKLLDSSQQQKQLPLIFPLLIALFSGAVFSFALAPYYWW
                     WLAILSPALLYATLHNRSAKQAFAIGWSYGFGLWFVGAFWLYTSIHVYGDTNAFLSVC
                     MIAVMALVMGLFTAFQTWIYRRFFPETPLTFAPLWIIFEWAKTWVFTGFPWLFVGYAF
                     TERLLDGYAPLFGIYAISFVVIVLACALVEILRKRIFWIIPAALLVLGAWGASYIQFV
                     QPKAAKPLSVSLIQGNIPQDLKWLTEYQVRTLEIYAGLTQSEWGRDLIVWPESSIPLF
                     QTDIEPFLDAMDAQAKKNHTAWVTGIPYWDVAKSHQVGSPLYYNSIMASGSDSSGLYK
                     KQRLVPFGEYIPLSGLLSWVLPAMQNDISMSGFTRGESDQKPLLIKGHALAAAICYEV
                     AYPNLTRRNAEDSDFLVTVSNDAWFTGTAGPWQHLQMVQMRAKENGRWFIRATNTGVT
                     AFIDQNGHITEQAPIDKEFVLRGDLPAMQGQTLYNRLGDYPILGFAILLLVLGWIYRP
                     RKVDVSYKSRR"
     gene            complement(459218..460057)
                     /locus_tag="ABZJ_RS02165"
                     /old_locus_tag="ABZJ_00414"
     CDS             complement(459218..460057)
                     /locus_tag="ABZJ_RS02165"
                     /old_locus_tag="ABZJ_00414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004794939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_001154809.1"
                     /db_xref="GI:447077553"
                     /translation="MQEEPSPSWGMRGLRKWLGTAPETRDELLKLVQNSRRFLEPDTV
                     AMLEGVLDLPATKIREVMTPRTAMISMQEDDQLLDILHVLVESAHSRFPVFSADQPDN
                     VVGILLAKDLLPFLTEPNTKLDIGSLMRQPLFVPESARSDQVLRMLKHTQTHIAIVID
                     EYGSTAGLVTLEDILEEIVGEIEDEHDTADEDAQYIVPDNDHTIANAWMVQALTPIEH
                     FNTVLDADFSDDEVETVGGLLLQEIGLVSDLQGQTVELGNWLFTIVEADARTIHLIRA
                     VRQ"
     gene            460242..460499
                     /locus_tag="ABZJ_RS02170"
                     /old_locus_tag="ABZJ_00415"
     CDS             460242..460499
                     /locus_tag="ABZJ_RS02170"
                     /old_locus_tag="ABZJ_00415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004748427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000003406.1"
                     /db_xref="GI:445925551"
                     /translation="MSEQPISPTVQLNTRGLRCPEPVMMLHQAIRKAKSGDVVEVLAT
                     DPSTSWDIPKFCMHLGHELLLKEEVLDEQNHKEYRYLVQKG"
     gene            complement(460595..462307)
                     /locus_tag="ABZJ_RS02175"
                     /old_locus_tag="ABZJ_00416"
     CDS             complement(460595..462307)
                     /locus_tag="ABZJ_RS02175"
                     /old_locus_tag="ABZJ_00416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002114676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase"
                     /protein_id="WP_000400008.1"
                     /db_xref="GI:446322153"
                     /translation="MEHIERESMEFDVVIVGAGPAGLSAAIKIRQLAIENNLPDLSVC
                     VVEKGSEVGAHILSGAVLEPRAINELFPNWKEEGAPLNVPVTEDKTFFLLSETTSKEA
                     PHWMVPKTMHNDGNYVISLGNVVRWLGQKAEELEVSIFPGFAASEVLYHEDGTVKGIQ
                     TGDMGIGKDGEPTHNFTPGYELHAKYTLFAEGCRGHLGKRLIAKYNLDKDADPQHYGI
                     GIKELWEIDPAKHKPGLVMHGAGWPLSETGSSGGWWLYHAENNQVTLGMIVDLSYENP
                     HMYPFMEMQRWKTHPLIKQYLEGGKRISYGARAVVKGGFNSLPKLTFPGGCLIGDDAG
                     FLNFAKIKGSHTAMKSGMLCGEAVFEAIAAGVEKGGDLAVARVTEGEDLFVKELTSYT
                     DKFNNSWLKEELYNARNFGPAMHKFGQWIGGAFNFIDQNVFKVPFTLHDLKQDFAVLK
                     TVDATSFKPTYPKPDGKLTFDRLSSVFISNTVHEENQPAHLKLTDPSIPVNVNLPKWD
                     EPAQRYCPAGVYEIMENDDGSKRFQINAANCVHCKTCDIKDPSQNITWVTPEGGGGPN
                     YPNM"
     gene            462494..463105
                     /locus_tag="ABZJ_RS02180"
                     /old_locus_tag="ABZJ_00417"
     CDS             462494..463105
                     /locus_tag="ABZJ_RS02180"
                     /old_locus_tag="ABZJ_00417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004698985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000248028.1"
                     /db_xref="GI:446170173"
                     /translation="MVNQNNSPSDMGKIPLSDDKNLMNIAQYLKGVQQSHKRSIPPLE
                     QWHPKHCGKMDLTVKANGEWWHEGQLIKRQALLDLFTKVLWKEEGKFYLKTPVEQIEI
                     EVEDEPLLVNQVDQIEISGDEFLQLTTTNQDVILVDAEHPIFMREYAGELRPYVHVRF
                     GINALIQRQAFYHLVNYGTLVENDKGETILQLKSGNLHLQLGT"
     gene            463154..464020
                     /locus_tag="ABZJ_RS02185"
                     /old_locus_tag="ABZJ_00418"
     CDS             463154..464020
                     /locus_tag="ABZJ_RS02185"
                     /old_locus_tag="ABZJ_00418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_000125341.1"
                     /db_xref="GI:446047486"
                     /translation="MTAIQPLFTELEPMPKALADAPIGIFDSGIGGMSVAAEIAKYLP
                     NERIVYYADTAYVPYGPRSDEEIRELTARAVDWLYRQGCKIAVVACNTASAFSLDHLR
                     EHYGEHFPIVGLVPALKPAVLQTRSKVVAVLATPATFRGQLIKDVVEKFAVPAGVKVM
                     TLTSLELVPCVEAGQQMSPACLNALREVLQPAVEQGADYLVLGCTHYPFLNEAIHYLF
                     DNQFTLVDSGLAVARQTARILIKNELLCDQMRQNVARIECYVSGNNADALQPVLQNMI
                     PQELTWTLHNLS"
     gene            464141..465145
                     /locus_tag="ABZJ_RS02190"
                     /old_locus_tag="ABZJ_00419"
     CDS             464141..465145
                     /locus_tag="ABZJ_RS02190"
                     /old_locus_tag="ABZJ_00419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000887657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000887662.1"
                     /db_xref="GI:446810406"
                     /translation="MLDTRYQIFISTSGREMQPERMVLSQTLVNMGFFAWGLEYRNPL
                     TTTLARRQIDESDYVVLLLGSQYGEQSISGASYFSLEYEYALSRAKPIVVFMHEQPES
                     RDMHLQETHPQLKEKFLAFRKKLLHEANHIFYFKSPRDLELAVRLNMPLMVEQYMGQG
                     WVPARQAHHLEDEINRLKSKILQLEQQLSESSIQANEVAPQDVFAFEYQIQAFQDGNF
                     KELKRQRQMTWSQLLSILAKHFETAMPEENFGTCLNEYLNQDGLEDARQELPRAHAVA
                     GAQINHKALFRIKKQMQSQGWIVPTKIDQQHSLWKVTTKAQKLLLSYKWNHRSTRLKA
                     "
     gene            465219..466235
                     /locus_tag="ABZJ_RS02195"
                     /old_locus_tag="ABZJ_00420"
     CDS             465219..466235
                     /locus_tag="ABZJ_RS02195"
                     /old_locus_tag="ABZJ_00420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005301959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_000007331.1"
                     /db_xref="GI:445929476"
                     /translation="MSFEQKPKVTVILANLGTPDEATVPAVRRFLKQFLSDPRVIEIP
                     KFIWWIILNLFVLPFRPKRVAHAYASVWSTDSPMREIVFEQTQRVQAYLERENKQFDL
                     TVLPAMTYGNPGIDAVLEKLATNPQEHVILLPLFPQYSATSTAPLYDAFAKWIPTQRN
                     LPGLTIIKDYYQHPMFIQALAESVLAYQEQHGKPEKLLMSFHGIPQPYADKGDPYADR
                     CRITAKLVAEALHLKDDEWAISFQSRFGKQEWVKPYTDQLLQDWAKQGVKSVQVLSPA
                     FSADCLETLEELAIQNAELFQQAGGGSYAYIPALNSDQAHIDLLAGLVQANLDALTHT
                     LAHR"
     gene            466259..466903
                     /locus_tag="ABZJ_RS02200"
                     /old_locus_tag="ABZJ_00421"
     CDS             466259..466903
                     /locus_tag="ABZJ_RS02200"
                     /old_locus_tag="ABZJ_00421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019456911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000942274.1"
                     /db_xref="GI:446865018"
                     /translation="MLQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVE
                     ALGLKVKALWLTHGHLDHAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGFPI
                     PQPVKVDQWLEGGEVLKLGEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIG
                     RTDFPRGNHDQLIESIQRECFSLPDETQFISGHGPMSTIGYEKQFNPFVASKAG"
     gene            complement(466900..467094)
                     /locus_tag="ABZJ_RS02205"
                     /old_locus_tag="ABZJ_00422"
     CDS             complement(466900..467094)
                     /locus_tag="ABZJ_RS02205"
                     /old_locus_tag="ABZJ_00422"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002114956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase inhibitor"
                     /protein_id="WP_001138289.1"
                     /db_xref="GI:447061033"
                     /translation="MPRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRL
                     PTQDAPQQDKGSQHEDDYED"
     gene            467188..467820
                     /locus_tag="ABZJ_RS02210"
                     /old_locus_tag="ABZJ_00423"
     CDS             467188..467820
                     /locus_tag="ABZJ_RS02210"
                     /old_locus_tag="ABZJ_00423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001167155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methlyltransferase"
                     /protein_id="WP_001167153.1"
                     /db_xref="GI:447089897"
                     /translation="MQIRQFQAQRMQAPRDFTPIENTPICVEIGAGKGKHALLFSGQN
                     PQHTLYAIERTREKFLAMQKQHGLEPRDNLVPVHADALPWVVHALYPAQVEHFFILYP
                     NPEPHNPAQRWLNMPFFEFLLSRLKTGGTITLASNIPEYIEEAEQQLLNVWKLPYQKE
                     KIAQTSARTHFEIKYLERGELCQQLIMTKPEGYKTRFDEFAPLQGQTHVE"
     gene            467810..469015
                     /locus_tag="ABZJ_RS02215"
                     /old_locus_tag="ABZJ_00424"
     CDS             467810..469015
                     /locus_tag="ABZJ_RS02215"
                     /old_locus_tag="ABZJ_00424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002132787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="WP_000066760.1"
                     /db_xref="GI:445988905"
                     /translation="MSNKQIAIIGAGPAGLMAAEVLSQYAYEIDVFEQKPSAARKFLM
                     AGKTGLNISHAEPLPQFIERYDHAEWLKPWVEKWDAVWIQNWMKGLGIDSYVGSSGRI
                     FPVEMKAAPLLRAWLKRLAEQQVKFFYRHRCINLHGTTVTFENQNKQNTETFTQQYDA
                     VVLACGAVSWSQLGSDGAWQQWMDQSSIEPFQASNAGVLHTWSAFMESCFGEPLKRIN
                     AWVEPSQVTHGDIVITHYGLESGVIYKLGRALREQQKQGKSLNLFLDLLPDVELTQLV
                     KKLQASKKQSLTNIWRKAGLDTAKINLIREVVDKALWSQPETMAQKMKALQIKLDGFR
                     PIEESISCAGGVKQDALTERLELKQTSGVFCCGEMLDWDAPTGGYLLTACFATGRAAG
                     EGVHSFLEK"
     gene            469093..469503
                     /locus_tag="ABZJ_RS02220"
                     /old_locus_tag="ABZJ_00425"
     CDS             469093..469503
                     /locus_tag="ABZJ_RS02220"
                     /old_locus_tag="ABZJ_00425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000075981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde-activating protein"
                     /protein_id="WP_000075984.1"
                     /db_xref="GI:445998129"
                     /translation="MSQASPVYQGSCLCQGIRYEIKGDIGDIIQCHCQRCRKSNGTAF
                     ATNAPINSADFKITQGEDLVKKFAVNGVYRWFCSECGSPLISSRDAQPELYRLRIGTL
                     DTPLDQKPTMHIFAASKAEWECIHDDLPQYDERP"
     gene            469739..470119
                     /locus_tag="ABZJ_RS02225"
                     /old_locus_tag="ABZJ_00426"
     CDS             469739..470119
                     /locus_tag="ABZJ_RS02225"
                     /old_locus_tag="ABZJ_00426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000291736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="camphor resistance protein CrcB"
                     /protein_id="WP_000291738.1"
                     /db_xref="GI:446213883"
                     /translation="MYYPLLSIALGSVLGAWLRWLLGLKLNPIYPQIPLGTVTVNLAG
                     GFIIGFAMAYFAHSDLSPNYKLFVITGFCGALTTFSTFSIEIVTLLQSGKWGMAMLAI
                     SIHLIGSLIFTCLGLATYYWVAGN"
     gene            complement(470548..470880)
                     /locus_tag="ABZJ_RS02230"
                     /old_locus_tag="ABZJ_00427"
     CDS             complement(470548..470880)
                     /locus_tag="ABZJ_RS02230"
                     /old_locus_tag="ABZJ_00427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017393977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000046495.1"
                     /db_xref="GI:445968640"
                     /translation="MAQELLAQLQAGTAKFSDVLAYIEARYQHTPTAFQNGAQHNAAT
                     ENQGSAKVFSFAKLQGLDQAQTLSLFAEHYASVLATPEGTDHQNIRQFMQNGWDGVKF
                     EGQALTEK"
     gene            complement(471133..471387)
                     /locus_tag="ABZJ_RS02235"
                     /old_locus_tag="ABZJ_00428"
     CDS             complement(471133..471387)
                     /locus_tag="ABZJ_RS02235"
                     /old_locus_tag="ABZJ_00428"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3M1Q6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="WP_001224256.1"
                     /db_xref="GI:447147000"
                     /translation="MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQGQVYPY
                     VTLDISSASHPFYTGEVRQASNEGRVASFNKRFARFNRKS"
     gene            complement(471488..472786)
                     /locus_tag="ABZJ_RS02240"
                     /old_locus_tag="ABZJ_00429"
     CDS             complement(471488..472786)
                     /locus_tag="ABZJ_RS02240"
                     /old_locus_tag="ABZJ_00429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_001096918.1"
                     /db_xref="GI:447019662"
                     /translation="MAKNASSPGKRFMKLAGMTASIATKTVSNSIRNLTADEEQKLAA
                     KTKLFQDIGLQIADTLGEMKGAVMKVGQIASQYKDIFPPEVAKAISKLQRQAPAMPFA
                     AIQQQVERELGKPLNVAFKSFEQEPFAAASIGQVHKAVLPSGEQVVVKVQYPGVDEAC
                     ESDLKQVRLALRLMGVLKIDKKLQDQLFAEIQDSLSAELNYEIEAQNLEVFKTFHSKL
                     DDKIIIPTVYKDYSSRRILTLSLEQGDSIETASSWPIEIRNTIGRRLIRALGQEMFFL
                     KRFHCDPHPGNFAFRQDGSVIIYDYGSVKTLSNEIVYSFKRLVNAARHEDIDLIETEL
                     LELHSLAEKGKFPSDLYKLWIEVLLRPLTTTYDFAENSSHHDGMLLVKKSLKYWDVFK
                     PSPDTLMVNRTISGHYWNLIHLKVHDNLNDLFEELVPPSN"
     gene            473044..474291
                     /locus_tag="ABZJ_RS02245"
                     /old_locus_tag="ABZJ_00430"
     CDS             473044..474291
                     /locus_tag="ABZJ_RS02245"
                     /old_locus_tag="ABZJ_00430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000202665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_000202654.1"
                     /db_xref="GI:446124799"
                     /translation="MTSLNSSYGRSQAVPLSVFEQSKDAHIIRSDEEAIEIAKQLAQE
                     FAQEASDRDRERRLPLNEIQQFSQSGLWAITVPKQFGGAQVKYRTLAEVIKTIASVDP
                     SLAQLPQNHLAFIEHLRLDAKPEQQQFFFNLVLRGIRFGNAFSEKHSKTVADLTTKLQ
                     KTEHGYEINGKKFFATGALLAHWIPIVAINEQGQPYAALVPRETSGVNIINDWSGFGQ
                     RTTASGTVELNQVPVREEYLVPIYQAFERPTPAGAISQFIQAAVDAGIARGAIEETIQ
                     YVKNHSRAWIDSGLEKASDDPYTIANIGDLKIKLRAAEAVLDLAGDAIDQAIANTTEE
                     HVNQATLLVAEAKVLTTEIAILAANKLFELSGTRSTLSELNLDRHWRNARTHTLHDPV
                     RWKYHIVGNYYLNGVQPPRHAWS"
     gene            474325..475575
                     /locus_tag="ABZJ_RS02250"
                     /old_locus_tag="ABZJ_00431"
     CDS             474325..475575
                     /locus_tag="ABZJ_RS02250"
                     /old_locus_tag="ABZJ_00431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000205418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="WP_000205416.1"
                     /db_xref="GI:446127561"
                     /translation="MTTAQIELEELSVGADYEKVANRFRPIFEKIAQGAIQREKERIL
                     PFEPIQWLKEAKLGAVRIPRKYGGDGVSLPQLFQLLAELAEADSNIVQALRGHFAFVE
                     DRLVAHKEHSQEVWFQRFVQGDLVGNAWTEVGNVQIGDVVTRVTKDASGNLVVNGEKY
                     YSTGSIFADWIDLFAYDEVNDRHVIAAIYRHETGVSVIDDWDGFGQKTTGSGTLKVHQ
                     VHLPASHLIPFDQRFKYQTAFYQVVHLATLTGIARAAVETFSQEIRERKRIFSHGNGD
                     LVRHDPQVLQVVGKASAQAYASEAITLKTAEALQKAYESHFAESEVKEHQFNVDAELE
                     SAQGQVVISNLVLDLTSQLFNALGASASSQVKQLDRFWRNARTVASHNPLIYKEKVIG
                     DWEVNRTDLPFVWQIGASPRAKSA"
     gene            complement(475610..476956)
                     /locus_tag="ABZJ_RS02255"
                     /old_locus_tag="ABZJ_00432"
     CDS             complement(475610..476956)
                     /locus_tag="ABZJ_RS02255"
                     /old_locus_tag="ABZJ_00432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005079254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter MatE"
                     /protein_id="WP_000073360.1"
                     /db_xref="GI:445995505"
                     /translation="MSNVTSFRSELKQLFHLMLPILITQFAQAGFGLIDTIMAGHLSA
                     ADLAAIAVGVGLWIPVMLLFSGIMIATTPLVAEAKGARNTEQIPVIVRQSLWVAVILG
                     VLAMLILQLMPFFLHVFGVPESLQPKASLFLHAIGLGMPAVTMYAALRGYSEALGHPR
                     PVTVISLLALVVLIPLNMIFMYGLGPIPALGSAGCGFATSILQWLMLITLAGYIYKAS
                     AYRNTSIFSRFDKINLTWVKRILQLGLPIGLAVFFEVSIFSTGALVLSPLGEVFIAAH
                     QVAISVTSVLFMIPLSLAIALTIRVGTYYGEKNWASMYQVQKIGLSTAVFFALLTMSF
                     IALGREQIVSVYTQDINVVPVAMYLLWFAMAYQLMDALQVSAAGCLRGMQDTQAPMWI
                     TLMAYWVIAFPIGLYLARYTDWGVAGVWLGLIIGLSIACVLLLSRLYLNTKRLSQT"
     gene            complement(476990..477451)
                     /locus_tag="ABZJ_RS02260"
                     /old_locus_tag="ABZJ_00433"
     CDS             complement(476990..477451)
                     /locus_tag="ABZJ_RS02260"
                     /old_locus_tag="ABZJ_00433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001984522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001984522.1"
                     /db_xref="GI:487911056"
                     /translation="MMKFSSQLFLILPLAMGIGVAMAFQTAINAQLREQLHSPLQAAL
                     LSFFIGTIVLAIMVFFQSAEKPSLSEISNIPWLLWTGGFLGVYAISMSIYTAPKLGFL
                     TFTGLVVFGQLVISMLLDHFGWLGTEKTPVTWQRFLGGVVIFVGVLLTLQR"
     gene            477569..478723
                     /locus_tag="ABZJ_RS02265"
                     /old_locus_tag="ABZJ_00434"
     CDS             477569..478723
                     /locus_tag="ABZJ_RS02265"
                     /old_locus_tag="ABZJ_00434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001196472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidase"
                     /protein_id="WP_000279713.1"
                     /db_xref="GI:446201858"
                     /translation="MAVLNPASVPLSLYIHMPWCVRKCPYCDFNSHAVPDGALSAELE
                     QTYLKALVADFETQVEMAQGRSIHSVFIGGGTPSLISAKGYAWLFEQLKSLLNFEDDC
                     EITLEANPGTLEHDPFAGYLEAGINRLSIGVQTFNTDHLQKLGRIHSANNAMDAIEQA
                     RQAGFKRVNVDLMHGLPEQTLEQALYDLKTAVEQGATHISWYQLTIEPNTVFFRTQPV
                     LPQDEVLEDIQEQGEAYLKANGFINYEVSAWRKEQPSAHNLNYWQFGDYLAIGAGAHG
                     KVTRPDGVYRFQKTRLPKDYLAKVPAEHLQMKKIEADELPFEFMMNALRLNDGVKAEL
                     YEQRTGLSLDDLNDLLTSLRSRELLVEDSDRLACTEQGHIFLNSVLEEFL"
     gene            complement(478774..479529)
                     /locus_tag="ABZJ_RS02270"
                     /old_locus_tag="ABZJ_00435"
     CDS             complement(478774..479529)
                     /locus_tag="ABZJ_RS02270"
                     /old_locus_tag="ABZJ_00435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017816639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_000207252.1"
                     /db_xref="GI:446129397"
                     /translation="MTTHSLKDKVVLITGGAKNLGGLISRKFAEQGAKLAIHYNSSET
                     QADAEQTLADVKALGADAILIQADLTHIENIEKLFIDTKQHFGGIDIAINTVGKVLKK
                     PFLETTEQEFDSMSDINSKIAYFFIQSAGRHLNNGGKICSIVTSLLAAYTGFYSTYEG
                     LKAPVEHYTRAASKEFGDRQISVTAVAPGPMDTPFFYGQESAEAVAYHKSASALGGLT
                     KIEDIEPLVRFLVTDGWWITGQTIFANGGYTTR"
     gene            479642..480538
                     /locus_tag="ABZJ_RS02275"
                     /old_locus_tag="ABZJ_00436"
     CDS             479642..480538
                     /locus_tag="ABZJ_RS02275"
                     /old_locus_tag="ABZJ_00436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002061697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000375494.1"
                     /db_xref="GI:446297639"
                     /translation="MDRLQQFYIFTEVAKRQSFSEVANQLDLPRSTVTSAIQQLETHY
                     GVRLFHRTTRKVSLTQDGQRILPECQNLLFDYEQLEQLIQTQKQHYRGTLKISMPSRI
                     VHQVIIPELPDFYHRYPDIHLQLNSSDDLTDLIEKGIDCVVRVGELDNSSLIARFIGH
                     LVMVNCASPQYLQDYGVPEQLNDLEQHKLINYAGAVGEKQGEFIYQGGIVMMDSALSV
                     NNTEAYIAAACAGLGIIQLPYYDVQDKIEQGILVEVLSAYSAPSLPLNILYPNRSYIP
                     KRLEVFMNWVGEVLNRKCIVIF"
     gene            complement(480602..480677)
                     /locus_tag="ABZJ_RS02280"
                     /old_locus_tag="ABZJ_tRNA14"
     tRNA            complement(480602..480677)
                     /locus_tag="ABZJ_RS02280"
                     /old_locus_tag="ABZJ_tRNA14"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(480642..480644),aa:Lys,seq:ttt)
     gene            complement(480700..480775)
                     /locus_tag="ABZJ_RS02285"
                     /old_locus_tag="ABZJ_tRNA15"
     tRNA            complement(480700..480775)
                     /locus_tag="ABZJ_RS02285"
                     /old_locus_tag="ABZJ_tRNA15"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(480740..480742),aa:Lys,seq:ttt)
     gene            complement(481008..482849)
                     /locus_tag="ABZJ_RS02290"
                     /old_locus_tag="ABZJ_00437"
     CDS             complement(481008..482849)
                     /locus_tag="ABZJ_RS02290"
                     /old_locus_tag="ABZJ_00437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001986080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain acyl-CoA synthetase"
                     /protein_id="WP_000084320.1"
                     /db_xref="GI:446006465"
                     /translation="MSQTTQTDIITLGDVATRLPSFIPKVPHILNGLKQAYLRTSNTP
                     TGLGIAFEKAVKRNPKGTALLFEDQSYSYEALNEWANQISHYYLSLGARKGDVIAVMI
                     ENRSELIATIVGLAKIGVTIALVNTSQVGKVLAHSINLVKPIAVIAGEEVRAAIDEIR
                     QDLNVPKDRFHWFADQATRQNSGTAPEGYVNLADQIDQFPKFNPSTTRSVTGNDGLFY
                     IYTSGTTGLPKAVIFKHSRWTLAYGTYGHILNLGPDDVMYVTLPLYHATGVVVCWCGV
                     IAGSATLAIRRKYSTSAFWKDVQKFNASAIGYVGELCRYLMDAPVTELDRNHRVTKMI
                     GNGMRPNIWDKFKQRFGVKEVLELYASSEGNVGFSNIFNFDNTVGFSPTPYAIIQFDK
                     EKNEPVRDKNGWCQKVKAGEVGLLIGKITSRSPFDGYTDPEKNKSVIWKDVFKKGDSY
                     FNTGDLVRDIGFRHAQFVDRLGDTFRWKGENVSTTEVENMVCEYDKIAEAVVYGVEIP
                     NTNGRAGMAAITLADGEELNDADLTEMVTVFKKCLPTYAVPVFLRVQKKVETTGTFKY
                     QKNKLKEEAFNPSKTSERLLALLPGASSYCDITTEIFDNIQAYKYRF"
     gene            complement(483042..486374)
                     /locus_tag="ABZJ_RS02295"
                     /old_locus_tag="ABZJ_00438"
     CDS             complement(483042..486374)
                     /locus_tag="ABZJ_RS02295"
                     /old_locus_tag="ABZJ_00438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000827323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease E"
                     /protein_id="WP_000827301.1"
                     /db_xref="GI:446750045"
                     /translation="MKRMLINATHAEEVRVALITGNRLYDFDLENRTREQKKSNIYKG
                     HVTRVEPSLEAVFVEYGAGRQGFLSMREIANSYFQADPRQTSNIRELITEGTELLVQV
                     EKEERGNKGAALSTFISLAGRYLVLMPNNPKGGGISRQISGSVREELKEILASLNVPR
                     GMSVIVRTAGIGRTQEELQLDLQHLLDLWAQIQGTASSGPSPMLVHQEAGVVTRAIRD
                     YLRDDVAEILIDSEQAYNEAYNFVKAVMPRQLDKLKTYTLNEPLFAHFGIESQIQTAY
                     EREVKLPSGGSIVIDQTEALVSIDINSAKSTRGHDVEETALNTNLEAAEEIARQLRLR
                     DIGGLVVIDFIDMTKERNQRMVEAKLREATQSDRARIQFGQLSRFGLMEMSRQRLRPS
                     LEEATGYVCPRCHGTGMVRDLRSLSLSIMHKVEEIALRERHGEVQVEVPVEIAAFLLN
                     EKRHSLVYLEQTSGVRVTVLPHPHLETPHYEIAYNPDGFAPSSYERTEATRSSEKELG
                     YESSEWHLEEADHGHAHVTATASTHAAAQKKANHATQPVAQPSAQKAASPCAWLENLF
                     VQKQAQTVDQSRSAQNAAAAIEQMVNTGAVSRGQFGQVAVPAVAEVAPVQSNNAYISQ
                     SPVKQDVREHVEKDDKSQQQRQNNKKRKHKEQREQHHQSHEQQHQVHEEVVQLSRQEQ
                     RELKRQQKRQQQQDQQHQNNDVQHTENAVPRRDRNNQQRPNRPNRHRDPSVLNENQNT
                     PVVIDEKQIKVDVIDAPKHDVMNTALIINVDQGQSEIVALTPEHRHVERVETTSTEVA
                     QEPTPAPVVAEKAAVVETKEEAQPSQEAAQPQIKRASNDPRMRRRQQREAKHAKAATP
                     SIAPSQIPTLAQHTIGSLIRHVYGEDCTVLIEQFGLVPTFNRALQKFAEQYASTLVVE
                     VTAETEEKKPVTRDAELPSHKPAEEAEPAPVLPLTPPQAPAPRVANDPRERRRLAKLA
                     AEQAFEQVKQQHSAQEEVATPAPVAEETVAAPTAETQATVEPAQQPLELNQSTEVVQP
                     EAAPAEEKATEETVAEAPAAKEPAPSKAASKAKAAAEETVAPTEATTDAESEDVKADK
                     DKPSRPRRPRGRPPKKANPVAE"
     gene            487097..488029
                     /locus_tag="ABZJ_RS02300"
                     /old_locus_tag="ABZJ_00441"
     CDS             487097..488029
                     /locus_tag="ABZJ_RS02300"
                     /old_locus_tag="ABZJ_00441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA pseudouridine synthase"
                     /protein_id="WP_001089412.1"
                     /db_xref="GI:447012156"
                     /translation="MNSTQQWQSVTWFEVDEHQAGQRIDNFLFSRLKGVPKSRIYRLI
                     REGQVRVNKKRIKAETKLAIGDQIRVAPIRYEQKDETAVPVSDSVAQGLLSRVVYEDE
                     GLLVVNKPSGIAVHGGSGVAYGLIEALRAATGKKYLELIHRIDRDTSGLVMISKKRST
                     LKLLQDMLREHKIRKTYAAIVKGQVSLDKQLIDAPLFRYELANGERRVRVSKEGKPSK
                     TEWVVAERFKNATLVHASPLSGRTHQIRVHGLSIGHPLVGDDKYGHNTAYTGPEARRL
                     CLHAMRLDIPGYPTIEAPLPEDMTQLLEALRVAK"
     gene            488026..488700
                     /locus_tag="ABZJ_RS02305"
                     /old_locus_tag="ABZJ_00442"
     CDS             488026..488700
                     /locus_tag="ABZJ_RS02305"
                     /old_locus_tag="ABZJ_00442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002000648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="WP_000054126.1"
                     /db_xref="GI:445976271"
                     /translation="MSLKTELVIFDWDGTLYNSVGQIVASLQHAAEEHKLTLTDEAAK
                     SIIGLGLPEVMQTLFPEVPDLHDSILKAYGDHYIANSTNDAWFEGISELLHDLKAQGL
                     KLAVATGKNRRGLDRVIAKTQSTHLFDVTRAANETRSKPDPLMLQEILTVTGVSVEQA
                     VMIGDSSYDLEMAQRLGMPRIGVGYGVHSVEVLQQFQPLTIAKDVPELHNFLREYAKL
                     STVDVA"
     gene            488775..489470
                     /locus_tag="ABZJ_RS02310"
                     /old_locus_tag="ABZJ_00443"
     CDS             488775..489470
                     /locus_tag="ABZJ_RS02310"
                     /old_locus_tag="ABZJ_00443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002132751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_000091415.1"
                     /db_xref="GI:446013560"
                     /translation="MSRSIRLLNLLQQLRESRYPVTAQVLAERLGISIRSIYRDIDSL
                     RAQGVRIDASAGLGFQLKEDILLPPVTFNENEAEALFLALEWLKDVPDQAMKSAAVSI
                     YSKLYAVLPEHRKYLIDDMTLGVTHYWHPVDEALVEQVRLAIRKQVKIKVDYCDEHKR
                     ISQRSLWPFALGYLHDKVVLAAWCELRQAFRHFRIDRIHDLQMSEEIYPEFKKHLFQR
                     WWKQEMQRTTDKN"
     gene            489520..490125
                     /locus_tag="ABZJ_RS02315"
                     /old_locus_tag="ABZJ_00444"
     CDS             489520..490125
                     /locus_tag="ABZJ_RS02315"
                     /old_locus_tag="ABZJ_00444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017385682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_000053844.1"
                     /db_xref="GI:445975989"
                     /translation="MSLKLYTNNESRGVVIDWLLVELGVECERIEVAYRTEMKSPEYL
                     KLNPFGKVPVLVDGDVVIYELGAICAYLADKFSDKGLAPALDDPKRGLYYRWLFMMAG
                     PWEAAGVDKALGIEISPEQKMFVGYGDYNDAYQALVQGLSEANPYVCGEQFTAADISV
                     GAMLLWQLKMKTIESHPAIARYVETIKQREGLKQSSMGQLL"
     gene            complement(490184..490861)
                     /locus_tag="ABZJ_RS02320"
                     /old_locus_tag="ABZJ_00445"
     CDS             complement(490184..490861)
                     /locus_tag="ABZJ_RS02320"
                     /old_locus_tag="ABZJ_00445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002132811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000232918.1"
                     /db_xref="GI:446155063"
                     /translation="MVGLFQHLGRSVQNRPHFFIALIFGVVVASLLAWLTSWKWSTIL
                     LASWNGSISLYLLHVWKLMRSADHSQMQQQAKKQDESKWVIMLIVLLAITMSLVAILV
                     QLSQLPSGHYEKLGHVALALLTIISAWLFMHTVFALHYAHDFYMALSRNEENGGLDFP
                     GTEHPTYPDFLYFSYIIGTSAQTADVSITNKHMRLLNLFHAVLSFGFNTTILAICINV
                     AAGFLTN"
     gene            complement(491125..492024)
                     /locus_tag="ABZJ_RS02325"
                     /old_locus_tag="ABZJ_00446"
     CDS             complement(491125..492024)
                     /locus_tag="ABZJ_RS02325"
                     /old_locus_tag="ABZJ_00446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002058690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_000423241.1"
                     /db_xref="GI:446345386"
                     /translation="MELRHLRYFITVAEELNFSKAALKLYTAQPSLSQQIKDLEEDVG
                     VRLLNRTKRKVELTEEGEVFLEHARLTLAQADKAVAMARQVSKAKQQLLRIGFVPIAE
                     MKIFPYVLPNLRLQHPDLTIELSSLNNAEQLKALKRGELDITFTRDNTENDEIQSQFV
                     LTEPLIFLLPRNHPLAKYDRIPVKALHGIDFIIPAAEQSNTLHNTILEFTKTHGIDLN
                     IVQKADSILLNINSIGSGLGCTILPAYVAPLGVSNTVVRPLDVELPSLDLFVSYRKNT
                     ESVGVKRFIDQLNKVFHLDKNLD"
     gene            492759..493811
                     /locus_tag="ABZJ_RS02330"
                     /old_locus_tag="ABZJ_00447"
     CDS             492759..493811
                     /locus_tag="ABZJ_RS02330"
                     /old_locus_tag="ABZJ_00447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005037058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase"
                     /protein_id="WP_000653392.1"
                     /db_xref="GI:446576046"
                     /translation="MKDKPTLTYQLPTQSCWTHTWIKPPFCHPELGHENDTRFYNQQP
                     RSPARGSKELLRWLVTRESYTWNVDIQNEYDVRVNTPIALPQNRPHADLDDWQVWFVG
                     HATVLIQIGPYNFITDPVWCDYASPLHGRGPRRVCPAGFALEQLPTIHGVLLSHNHYD
                     HMDLATLEWLHKKFAMPIYTGLGNGFYLPKEFHVIEMDWWQEIPYHELRIVYTPAQHG
                     SGRGLRDQNKALWGGFSVLAKTGHCFFAGDTGYAGHFKQIHTRYGAPRVALLPIGAYE
                     PRKLMSYVHMNPQDAVHAHLDLQAHRSVAIHYRTFQLTDEGREDPEHALAQAIKASSK
                     LANPFYCIREGHKLTV"
     gene            complement(493878..496034)
                     /locus_tag="ABZJ_RS02335"
                     /old_locus_tag="ABZJ_00448"
     CDS             complement(493878..496034)
                     /locus_tag="ABZJ_RS02335"
                     /old_locus_tag="ABZJ_00448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004748395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase/hydroperoxidase HPI(I)"
                     /protein_id="WP_000064297.1"
                     /db_xref="GI:445986442"
                     /translation="MSNESKCPFSGHNSKPQVTVGGGTANLHWWPNQLRVDLLNQHSE
                     RSNPLGKDFNYRQEFKKLDYYALKADIKNVLTDSQDWWPADWGNYTGLFIRLAWHAAG
                     TYRMGDGRGGAGRGQQRFAPLNSWPDNASLDKARRLLWPVKQKYGQKISWADLFILAG
                     NIALESSGFRTFGFGAGREDVWEPDNDVNWGDEKEWLAHRNSEALAGSNLAATEMGLI
                     YVNPEGPQASGDPRSAAPFIRATFGNMAMDDEEIVALIAGGHTLGKTHGAASADHVQA
                     DPEGAPIEQMGFGWANSYGTGVGKDAITSGLEVIWSQTPTQWSNYFFENLFKYEWVQE
                     RSPAGAIQWVAADAEAIIPDPFDPSIKRKPTMLTTDLTLRFDPEFEKISRRFLNDPQA
                     FANAFARAWFKLTHRDMGPKARYLGPEVPAEDLIWQDPLPAASATPSSASIADAKAKI
                     VALGLSTGELVSLAWASASTFRGGDKRGGANGARIALSPQREWEVNKKAVETLTKIEE
                     LKASTQLSLADLIVLAGNVGVEQAAQAAGFNITVPFAPGRVDALQSQTDVESFQLLLG
                     LADGFRNWKKQGVNTPAEVLLIDKAQQLTLTAPELTALIGGLRVLGTNWDGSQHGVFT
                     QQVGVLSTDFFTNLLDMSNVWAPVDSTSEVFEGKDRKSGTVKFTATRNDLVFGSNSIL
                     RALAEVYAQADGKEKFVQDFVAAWTKVMNLDRFDLA"
     gene            complement(496548..498842)
                     /locus_tag="ABZJ_RS02340"
                     /old_locus_tag="ABZJ_00449"
     CDS             complement(496548..498842)
                     /locus_tag="ABZJ_RS02340"
                     /old_locus_tag="ABZJ_00449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000069128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="WP_000069129.1"
                     /db_xref="GI:445991274"
                     /translation="MSNMQLDTLRRIVQEINASVSLHESLDIMVNQVAEAMKVDVCSI
                     YLLDERNQRYVLMASKGLNPESVGHVSLQLGEGLVGLVGQREEIVNLDNAPKHERFLY
                     LPETGEEIYNSFLGVPVMYRRKVMGVLVVQNRLPQDFSEAAESFLVTLCAQLSGVIAH
                     AHAVGNIDVFRKPSNGPAYKTFQGVSGAGGVALGRAIILYPPADLGSVPDREAEDISD
                     ELRILDQAISSVRSEIRSLDEKMHDSLMAEERALFSVFLRMLDENALPAEIKELIRDG
                     HWAQGAVRRVIEKHTALFAQMEDDYLRERVSDLKDLGRRILAYLQEEDSSHRELSPDS
                     ILIGEEISTAALVELPVDNIAAIVTSEGAANSHMVIVARALGIPTVVGVTELPVNTLD
                     DAEMIVDAYQGRVFVNPPRRLRQRYKEIQKEDEQIAKDLKQYETKEAITPDGVSVQLF
                     VNTGLMIDVVRGVQRGAQGVGLYRSEIPFMLRERFPGEEEQRAIYRQQLSHFANKPVV
                     MRTLDIGADKDLPYFSIEEENSALGWRGIRFTLDHPEIFSAQIRAMLKASIGLNNLHI
                     LLPMVTTVSEVEEVLYLLERDWIAVQEEEQVKITKPKIGIMVEVPSVLLQIDEFAELV
                     DFFSVGSNDLTQYLLAVDRNNPHVANVYSHFHPSILRALTRLVKECHKYQKPVSICGE
                     MAGDPLSAILLMAMGFNTLSMSSSNILRVRKAICHVPMSDAQKLLDDVMKMNNPLIVK
                     SWLEYYFKTHGLADMVKSNRLVSV"
     gene            complement(498928..499413)
                     /locus_tag="ABZJ_RS02345"
                     /old_locus_tag="ABZJ_00450"
     CDS             complement(498928..499413)
                     /locus_tag="ABZJ_RS02345"
                     /old_locus_tag="ABZJ_00450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016144233.1"
                     /note="hydrolyzes diadenosine polyphosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pyrophosphohydrolase"
                     /protein_id="WP_000567254.1"
                     /db_xref="GI:446489400"
                     /translation="MIDSEGFRPNVGIILANDDGQVLWAKRIGHNAWQFPQGGIQFGE
                     TPEQALFRELREEIGLLPEHVQIIAQTKGWLRYRLPHRYIRSDSDPVCIGQKQKWFLL
                     KLTAPAKNIQLNLADPPEFDEWQWVSYWYPLGQVVNFKRDVYRKAMVELCTQLPVQQL
                     P"
     gene            499596..500246
                     /locus_tag="ABZJ_RS02350"
                     /old_locus_tag="ABZJ_00451"
     CDS             499596..500246
                     /locus_tag="ABZJ_RS02350"
                     /old_locus_tag="ABZJ_00451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009393222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_000761586.1"
                     /db_xref="GI:446684240"
                     /translation="MKLALFDLDHTLLNTDSDHSWGEFLVNEGLVDPVHHRQMNDKFY
                     EDYKAGQLDPYAYNEFVFGFLTKHDNNYLTELHQLFMEKVIRPQMRPKGFDAIKKHQD
                     LGHTIVGITATSDFITAPIFREFGITEILATNAEVADGKYTGKVAGLACYQKGKLARL
                     EAWLDGRSVSESWAYSDSINDRFLLEYATHAIAVNPDDRLEKLAQEHNWEIQDWSI"
     gene            complement(500301..500897)
                     /locus_tag="ABZJ_RS02355"
                     /old_locus_tag="ABZJ_00452"
     CDS             complement(500301..500897)
                     /locus_tag="ABZJ_RS02355"
                     /old_locus_tag="ABZJ_00452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000635911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000635911.1"
                     /db_xref="GI:446558565"
                     /translation="MIVKNQYSKIIKIGLYLFITLAILVLVTFIWFKRIRVIFAHHLS
                     LLHCDGQVCVDDPKTQPLAKTLYNQALKETQNKVGAFHQQPTMVFCSTPQCANTFGME
                     KAAAKAIGNLGLLVAPRGWKDFYITHELIHHRQAEEWGNIAMLTKPKWLVEGMAYSLS
                     DDPRPTLSVPFQQWRAQFKLWHQQNPDSNIWLTTEKIK"
     gene            500993..501229
                     /locus_tag="ABZJ_RS02360"
                     /old_locus_tag="ABZJ_00453"
     CDS             500993..501229
                     /locus_tag="ABZJ_RS02360"
                     /old_locus_tag="ABZJ_00453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000164722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000164722.1"
                     /db_xref="GI:446086867"
                     /translation="MTKNKRTKSKGSNGFFQEFIDQLITAIFGELLIYIIALLFMSAL
                     GGIIFAAICFSWGVLFLLLPFAALIYILVKKYSH"
     gene            complement(501235..502095)
                     /locus_tag="ABZJ_RS02365"
                     /old_locus_tag="ABZJ_00454"
     CDS             complement(501235..502095)
                     /locus_tag="ABZJ_RS02365"
                     /old_locus_tag="ABZJ_00454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016803641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_001046500.1"
                     /db_xref="GI:446969244"
                     /translation="MNLAAFEAFVKVMETGSISVAADQLFITQPAVTKRIHSLEEYFG
                     VKLFESAGRGVQATHAAHSLLPKVKSWLNELRDIHHTLSHEQTQIQGRLKIGTSHHIG
                     LHHLPAPLKHFVQQFPQVTLDVHFVDSEQAHEQVLAGDLELAFLTLPPSGDERLNYIT
                     IWNDPLVFVAAPFHPLAQKKNLTLQDLIEYPSLLPAAQTYTAQITLAEFEKQGLKPKI
                     TMSNNPLESIRMLVSIGLGWSVLPKTLLNQDMQQLDLNVEMNRQLGMVWHPARTQSRA
                     MQELIKMMQE"
     gene            complement(502213..502461)
                     /locus_tag="ABZJ_RS02370"
                     /old_locus_tag="ABZJ_00455"
     CDS             complement(502213..502461)
                     /locus_tag="ABZJ_RS02370"
                     /old_locus_tag="ABZJ_00455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019458024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001284190.1"
                     /db_xref="GI:447206934"
                     /translation="MANIQKFVVNNQRTLKKTLSYYIMHITVAMLVAYFVTGNIWMAL
                     TLSMLEPTVQAFAFFFHEKVWAAKDRRISALSENETTA"
     gene            502705..504123
                     /locus_tag="ABZJ_RS02375"
                     /old_locus_tag="ABZJ_00456"
     CDS             502705..504123
                     /locus_tag="ABZJ_RS02375"
                     /old_locus_tag="ABZJ_00456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000434219.1"
                     /note="dehydratase component, catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopropylmalate isomerase"
                     /protein_id="WP_000907606.1"
                     /db_xref="GI:446830350"
                     /translation="MAGKTLYDKLWDDHVVTQRDDGSCLLYIDRHLLHEVTSPQAFEG
                     LQLAGRQPWRLSANVATPDHNVPTSKKERDQGIAGIEDDTSRIQVQTLDDNCKAFNIV
                     EFGINDIRQGIVHVVGPEQGLTLPGMTVVCGDSHTATHGAFGCLAHGIGTSEVEHVLA
                     TQCLVQKKSKNMLVRVDGVLGKGVTPKDVVLAIIGKIGTAGGTGYAIEFGGQVFRDMS
                     IEGRMTVCNMAIEAGARVGMVAVDDKTIEYVKGRSYAPKGEQWEQAVAYWNTLHSDVD
                     AVFDAVVELNGAEIEPQVSWGTSPEMVIPVSKAVPTLEQAKDDVQRNDWTRAYQYMGL
                     NAGQALADIQLDRVFIGSCTNSRIEDIRAAAEVVKGRKVAPSIKQAMIVPGSGLVKQQ
                     AEKEGLDKIFLEAGFEWREPGCSMCLAMNADKLQPGEHCASTSNRNFEGRQGNGGRTH
                     LVSPAMAAAAAIAGHFVDVRSF"
     gene            504142..504789
                     /locus_tag="ABZJ_RS02380"
                     /old_locus_tag="ABZJ_00457"
     CDS             504142..504789
                     /locus_tag="ABZJ_RS02380"
                     /old_locus_tag="ABZJ_00457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019768020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_000649450.1"
                     /db_xref="GI:446572104"
                     /translation="MKAYTVEQGIVAPLDRANVDTDLIIPKQFLKSIKRTGFGDNLFD
                     ELRYLDEGYPGQDNSVRPKNPDFVLNQPRYQGATVLIARTNFGCGSSREHAPWALNEY
                     GFRTVIAPSFADIFFNNCFKNGMLPVILPEDIVDQLFKECAAQEGYQLTIDLAAQEVR
                     TPTGEAFKFEVDPFRKHCLLNGLDDIGLTLQNADAIRAYEEKTKQVRPWVFQEIN"
     gene            504902..505492
                     /locus_tag="ABZJ_RS02385"
                     /old_locus_tag="ABZJ_00458"
     CDS             504902..505492
                     /locus_tag="ABZJ_RS02385"
                     /old_locus_tag="ABZJ_00458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012297386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001984507.1"
                     /db_xref="GI:487911041"
                     /translation="MKRNVTHSFLLSLCAITLSACQSTYNVVDTVRIKQAEQENLGQN
                     AAIYCSGAKSCEFERLNDITVVDAQTRRISNQAIHQGIVRLNGSVLSQSNSLYLSVPA
                     KQYEVVIRYYPISPDRAETIHVIHQFKANHRYMFKMYRDKSNRSGSLLNVSVPDPLCV
                     DLEQDGRVIRRFCRPFDVTTGLGEFLEQKKLTPRQS"
     gene            505524..506603
                     /locus_tag="ABZJ_RS02390"
                     /old_locus_tag="ABZJ_00459"
     CDS             505524..506603
                     /locus_tag="ABZJ_RS02390"
                     /old_locus_tag="ABZJ_00459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004836201.1"
                     /note="catalyzes the oxidation of 3-isopropylmalate to
                     3-carboxy-4-methyl-2-oxopentanoate in leucine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="WP_000043186.1"
                     /db_xref="GI:445965331"
                     /translation="MSKQILILAGDGIGPEIVGAAEKVLNKVNEKFNLSLTWEHGLLG
                     GAAIDAHGEPYPAVTSEQAKKADAILLGAVGGPKWDTIERSIRPERGLLKIRSELNLF
                     ANLRPAILYPQLADASSLKPEIVAGLDILIVRELTGGIYFGQPRGIRELENGEKQGYN
                     TDVYSESEIKRIAKVAFELAGLRGGKVCSVDKANVLEVTELWKQTVTDLQQANYPNIQ
                     LSHMYVDNAAMQLVRAPKQFDVIVTGNLFGDILSDEAAMLTGSIGMLPSASLDENGKG
                     MYEPCHGSAPDIAGQNVANPLATILSVAMMLRYTFREEAAAKAIEDAVGQVLDQGLRT
                     ADIMSEGMTKVGTAEMGEAVVAALA"
     gene            complement(506657..507022)
                     /locus_tag="ABZJ_RS02395"
                     /old_locus_tag="ABZJ_00460"
     CDS             complement(506657..507022)
                     /locus_tag="ABZJ_RS02395"
                     /old_locus_tag="ABZJ_00460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000925852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000925848.1"
                     /db_xref="GI:446848592"
                     /translation="MLLNINGCASHPRQSIDLQEYLKNFIGKSSTTIQQDLNLRSLGF
                     QVARTPQKTSDQLIYTILRPLSIPIPMVSNVDMRGGSVPIQSGNLSGNSYDLNFNCKV
                     IFKLKNDIAESIQYEGKAC"
     gene            507233..507601
                     /locus_tag="ABZJ_RS02400"
                     /old_locus_tag="ABZJ_00461"
     CDS             507233..507601
                     /locus_tag="ABZJ_RS02400"
                     /old_locus_tag="ABZJ_00461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000724608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000724608.1"
                     /db_xref="GI:446647262"
                     /translation="MKKIVFAFLCFGITTVYADNCDSARNTYDDIYCTNKIYASADAD
                     LNKNYQALRAKLNTAQRNTLKKSQLAWIRQRDAECTDSNRNSVDVQCRLQTTQERNHW
                     LQERLRECQTVGCKTSRLSE"
     gene            complement(507653..507874)
                     /locus_tag="ABZJ_RS02405"
                     /old_locus_tag="ABZJ_00462"
     CDS             complement(507653..507874)
                     /locus_tag="ABZJ_RS02405"
                     /old_locus_tag="ABZJ_00462"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A3M1T2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="WP_001284370.1"
                     /db_xref="GI:447207114"
                     /translation="MANKEELIEFEGVVTETLPNTMFRVRLENGHEVIAHISGKMRKH
                     YIRILTGDSVKVEMTPYDLTKGRITYRAR"
     gene            508139..509149
                     /locus_tag="ABZJ_RS02410"
                     /old_locus_tag="ABZJ_00463"
     CDS             508139..509149
                     /locus_tag="ABZJ_RS02410"
                     /old_locus_tag="ABZJ_00463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004794851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_002009591.1"
                     /db_xref="GI:487936125"
                     /translation="MGQLTDASVVLRFGYQAIRRAGLPTEEILTKAGVALNQVDTNAR
                     TPLSAQYAFWTAAQEVSKDPDIGLHLGEHLPLYRGQVIEHLFISSETFGEGLKRALAY
                     QRLISDAFDAKLVVEDGRCYLTNGEQVGADNLVNRHFSECAISGVLRFFKFITEGQFH
                     PIFIDFNFSEGASEDEYFRVYGCPVSLGQKETRLYFDPAILDFQLWQAEPELLQLHEQ
                     LAIEKLQELARYDLVGEVRRAIGSTLESGETTLETVAAQLNITPRRLRTQLSEANTSF
                     QQILSDYRCRLAKKLLANTNESVERIVYLTGFSEPSTFYRAFKRWTNETPVEYRKRKQ
                     HR"
     gene            complement(509169..509966)
                     /locus_tag="ABZJ_RS02415"
                     /old_locus_tag="ABZJ_00464"
     CDS             complement(509169..509966)
                     /locus_tag="ABZJ_RS02415"
                     /old_locus_tag="ABZJ_00464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001190097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="WP_001190096.1"
                     /db_xref="GI:447112840"
                     /translation="MQRYAVGIEFSGIQYRGWQTQQPGVASVQETIELVLSKIADEPI
                     TLHGAGRTDAGVHATNMVAHFDTNAIRPERGWIMGANSQLPKDISIQWIKQMDEEFHA
                     RFKATARRYRYVVYNAPHRPALLHKQVTHIYQKLDVQKMIKAASKFEGTHNFETFRAA
                     ACQSNQPVRHVKHCRLFEHGRYLVLDIQADGFLHHMVRNIMGCLLEIGQGMYEIDHID
                     AMFAAEDRKAAGITAPPDGLYFIQCYYPEQFDLPQPPLGPHWLNLPE"
     gene            complement(509981..510952)
                     /locus_tag="ABZJ_RS02420"
                     /old_locus_tag="ABZJ_00465"
     CDS             complement(509981..510952)
                     /locus_tag="ABZJ_RS02420"
                     /old_locus_tag="ABZJ_00465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000717067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparaginase"
                     /protein_id="WP_000717085.1"
                     /db_xref="GI:446639739"
                     /translation="MKKIALFYMGGTFGCIGEPLAPMPYDQFLPQLEKVIPPHLTVHC
                     FAAPNIVDSSACTAPDWLRLIQRIQQLQLEGYQHFVVIHGTDTLSYAAATLARFLGQS
                     CHIVITGSQYPLLNIQGDNTREFTDAIENLYLALEQVIALPVGAYLAFHHQVFHAQTA
                     LKTHTTELDAFSGLSSNVEFTPQQNELIVQDAQIEKAASFQILNWMMQPIATQHLVQQ
                     LRHLLPAPPHFLVLQGFGTGNIAVNDEFLATLDELYTRGCVPILATQVTFGGMDQRYA
                     ISAWAKTAKIVINDAHSHADLYAKALQIYLKYPTPEQWLNHWNENLH"
     gene            complement(511011..512273)
                     /locus_tag="ABZJ_RS02425"
                     /old_locus_tag="ABZJ_00466"
     CDS             complement(511011..512273)
                     /locus_tag="ABZJ_RS02425"
                     /old_locus_tag="ABZJ_00466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002000641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000967572.1"
                     /db_xref="GI:446890316"
                     /translation="MLYVIPFIILLVVAVILKKRENSQKQEATSPKNINRKSGKKASA
                     KSSKSSREKTKAKVIEENTPAIPQSNPVPEALRHNIQQLIQEKQFSAAEAQVNQALKK
                     DNTQHELYLLLLEIHIAQKDEFAIQQLISHIRSLGLNEIAAQAETRQKEYESSRQPDA
                     IDFPQAQTYEEPKNTDTTAQFDELTTSSSEASFDDLQKDYTPVKQEPAVEIEPLEFNF
                     SFEQTSATENTNQPAQQPELSSTQETNELADLEFSFDLAPLHGTEEKSQPVELKADQE
                     NSINALDFNFDLNPSSSETKSVEQAPSLDEIKLVEQTPLEAASIAPLEFSLDEPALVP
                     APELETQSHIDVVNEAATQTQIEDPLLEAFPELKQINENELDLKLAEQYIKFGANQAA
                     CNLLQGDEQKFNTEQQQHAKNLLNRIAS"
     gene            complement(512333..513696)
                     /locus_tag="ABZJ_RS02430"
                     /old_locus_tag="ABZJ_00467"
                     /note="signal peptide protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(513845..514963)
                     /locus_tag="ABZJ_RS02435"
                     /old_locus_tag="ABZJ_00468"
     CDS             complement(513845..514963)
                     /locus_tag="ABZJ_RS02435"
                     /old_locus_tag="ABZJ_00468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004641000.1"
                     /note="catalyzes the formation of 4-aspartyl phosphate
                     from aspartate 4-semialdehyde; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="WP_000862762.1"
                     /db_xref="GI:446785506"
                     /translation="MKVGLVGWRGMVGSVLMQRMVEENDFAHIEPFYFSTSNAGGEAP
                     SFGGKTAPALMEATDITSLKQMDVIITCQGGDYTSEVFPKLKATGWDGYWIDAASTLR
                     MTDDAIIVLDPVNLNVIKDGLAKGTKTFVGGNCTVSLMLMGVGALFQNNLVEWMTAMT
                     YQAASGAGAQNMRELLTGMGYLYNNTKTLLDDPKSAILDIDRQVAELQRGEGFPSANF
                     GVPLAGSLIPYIDKQLESGQSKEEWKGQVETNKILGNSQIVPIDGHCVRIGAMRCHSQ
                     ALTIKLKKDVPLDEIEDMIRNSNQWAKVVPNTREASMTDLTPVAVTGTLTVPVGRLRK
                     LNMGKEYLGAFTVGDQLLWGAAEPLRRMLRILVEYKSS"
     gene            515153..516274
                     /locus_tag="ABZJ_RS02440"
                     /old_locus_tag="ABZJ_00469"
     CDS             515153..516274
                     /locus_tag="ABZJ_RS02440"
                     /old_locus_tag="ABZJ_00469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000262509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_000639217.1"
                     /db_xref="GI:446561871"
                     /translation="MIYIEVLAVVVIWLSFWSLIPRDEWWFRGADFPRLQILFIGLIA
                     LIGMLFWPTEWDVWRELLLAVLIAAIAYQLKMVLPYTLFWKKQVKKVKQHQLDPTKQI
                     SLIVSNVLTPNDKYHLLLEHVRTLKPDLLLTLESDTTWENALKEIEKDYPYRVPVPLD
                     NLYGMHLYSRLPLKNTEVKFILSNEIPSIHTTVILRSGMPVQLYCLHPKPPSPTEAKD
                     STLRDAELLIVGDQIKDLDESCIVMGDLNDVAWSRTTRLFQRISGLLDPRVGRHFINT
                     FHADYPLLRWSLDHIFHSTDFGLVKMQRLSHIGSDHFPVYVVLQTGRIFEEIHEELEQ
                     TQADEEEAQAAIQEGIAKAEKEEKIVTDEIAQPYKEKNI"
     gene            516964..518250
                     /locus_tag="ABZJ_RS02445"
                     /old_locus_tag="ABZJ_00470"
     CDS             516964..518250
                     /locus_tag="ABZJ_RS02445"
                     /old_locus_tag="ABZJ_00470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002061710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proton glutamate symport protein"
                     /protein_id="WP_000787678.1"
                     /db_xref="GI:446710332"
                     /translation="MKNFKFSLAWQILIALILGIVVGAVLHNQPEIKDSIVNNVLTPL
                     GKIFISLIKMIVIPIVFSTLILGIAGVGSTKSLGRLGFKTILYFEIITTIAILVGLFA
                     ANIFHPGSGIDMSQLVQTDISQYKHTTEEVQSQSHGIIQTILSLIPTNIISSMAHGEM
                     LPVIFFAVLFGIGLSSLPATTKDPLLNVFHAVSETMFRVTHIIMKYAPVGVFGLIAVT
                     VANFGFASLIPLGKLVVLVYGAILFFALVVLGITAKMFSINIFTLFKILKDELILAYS
                     TASSETVLPRIMQKMEAYGAPKAISSFVIPTGYSFNLDGSTLYQSIAAIFIAQLYGIE
                     MTISQQVILVVTLMITSKGIAGVPGVSFVVLLATLGSVGIPVEGLAFIAGVDRIMDMA
                     RTALNVVGNALAVLVISKWEKQYDYEKAAAYEASLK"
     gene            complement(518307..519407)
                     /locus_tag="ABZJ_RS02450"
                     /old_locus_tag="ABZJ_00471"
     CDS             complement(518307..519407)
                     /locus_tag="ABZJ_RS02450"
                     /old_locus_tag="ABZJ_00471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000867090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_000867091.1"
                     /db_xref="GI:446789835"
                     /translation="MKVMQLLPELNSGGVERGTLEIARALVAQGHQSLVVSNGGRLVS
                     QLEAEGSTHLTLPIHKKSLSSLWQIRPLRQLIEEHQPDIVHVRSRVPAWLTHFALRKI
                     PANKRPHLISTVHGFYSVNRYSAIMTQAEKVIAVSDSVVKYITDHYKNCPPQDIVRIY
                     RGIDPAAFPHNYQPSAQWFNQVFNDFPELENKFLLCLPGRITRLKGHESLIELMQKLG
                     EQYPQLHAVVVGGADVKKQAYLSELQNTIQSKGLADKITFVGHRSDIREWLAFSDIVL
                     SLSNQAETFGRTALEALSVGTPVIGWNRGGVAEILSHVYPQGLVEAENEKALVETVKN
                     HIEQPQTVAPVTMFSLKDMCDQTLELYQSVLK"
     gene            complement(519673..520608)
                     /locus_tag="ABZJ_RS02455"
                     /old_locus_tag="ABZJ_00472"
     CDS             complement(519673..520608)
                     /locus_tag="ABZJ_RS02455"
                     /old_locus_tag="ABZJ_00472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004883389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lauroyl acyltransferase"
                     /protein_id="WP_000078878.1"
                     /db_xref="GI:446001023"
                     /translation="MSQKQPYTPGEFQWSFLLPKYWGVWIAITFLMLLAILPWAIQWR
                     LAHGLANLAWKYLKSRRKTTIRNLEVCFPEWTPEKVQQQAKQVFVDMMLGIFETLNAW
                     YKPYWFKNRVTIEGLEHITNAQAQGKGVLLLGTHSTLLDAGGYVCAQYFEPDVVYRPQ
                     NNPLLDMLIYRCRGTIYKAQIDHDDMRGLIRHLKEGDAIWYSPDQDFGLKQGIMAPFF
                     GVPAATVTAHRRLLKISKAVAVPLYFYRHGDVQDPKYHILIEPAVDNMPSEDEVDDAT
                     RVNKIIENQLRIAPTQYMWFHRRFKTRPEGYEEIY"
     gene            complement(520728..521360)
                     /locus_tag="ABZJ_RS02460"
                     /old_locus_tag="ABZJ_00473"
     CDS             complement(520728..521360)
                     /locus_tag="ABZJ_RS02460"
                     /old_locus_tag="ABZJ_00473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017398157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_000886284.1"
                     /db_xref="GI:446809028"
                     /translation="MLDLSQILAFGFICLAMVLTPGPNMIYLISRSISQGKIAGFISL
                     GGVAVGFVFYMLCASFGITALVVAVPYAYDTIRIAGAMYLLWLAWKALRPNAAPIFNI
                     KDLAVDSPLKLFLMGFLTNLLNPKIAIMYLSLLPQFIHPQQGSILAQSIQLGTIQIFV
                     SVSVNALIVFSAGSIALFLQKKPLWASIQRWVMGTVLAGLAVRILLEHRR"
     gene            complement(521506..523416)
                     /locus_tag="ABZJ_RS02465"
                     /old_locus_tag="ABZJ_00474"
     CDS             complement(521506..523416)
                     /locus_tag="ABZJ_RS02465"
                     /old_locus_tag="ABZJ_00474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000323476.1"
                     /note="Uup; in Escherichia coli this cytoplasmic protein
                     was shown to contain ATPase activity; mutations in this
                     gene affect RecA-independent excision of transposons and
                     affects Mu bacteriophage growth; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter ATPase"
                     /protein_id="WP_000323476.1"
                     /db_xref="GI:446245621"
                     /translation="MAYITLRDVQLAFGGPALLDGANFNLERGERVCLIGRNGEGKST
                     LLKLIEGSLLPDSGEVSVQNGLTVSMLAQDVPMSSGKVADIVAEGAGEAAAVLKAYHE
                     ASDACVLGDMEACDRMGSLQHKLDQLDGWALENKVNTILGKMELDPNADLADLSGGRK
                     RRVLLARALLTQPDVLLLDEPTNHLDVESIEWLEKFLLDQNNLTLLFISHDRSFVDRL
                     ATRIVELDRGILRSYEGNYSRYLDLKAQQLEAEEKQNALFEKKLAEEEAWIRQGIKAR
                     RTRNEGRVRALKALREESKARRFQQSKVNMGVQEAQRSGKLVFDIEHLSVSYDGQTLI
                     RDFSAIVMRGDRIGLVGDNGVGKTTLIKAILGEVQHEGVVKTGTQLEIAYFDQLRNQL
                     DLEKSVSENVSEGSDFVDVNGQRRHILSYLQDFLFSPERARTPVKALSGGERNRVLLA
                     KLLLKPSNLIVMDEPTNDLDMVTLELLEEMLSEYKGTLLLISHDRAFMDNVVTSTWVF
                     DGKGGIAEYIGGYQDYLIQRPNERVVDQKGDVKKAQAKAEAEKNAAQTNVKKVKLSYK
                     DQRELEQLPAEIEKLENEQAELSDKLADGSWFVTDADAATKASQRLAEIEELLLEKLE
                     RWDELEQMGKGN"
     gene            523449..523694
                     /locus_tag="ABZJ_RS02470"
                     /old_locus_tag="ABZJ_00475"
     CDS             523449..523694
                     /locus_tag="ABZJ_RS02470"
                     /old_locus_tag="ABZJ_00475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005037011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000165735.1"
                     /db_xref="GI:446087880"
                     /translation="MTKPPYHDDQASFSAPIEDLQVRIAFLDDLVEELNQQLAIQTLE
                     IADLKKQMQLLYQRVESADLSEGVAPFDPLTNKPPHY"
     gene            complement(523742..524752)
                     /locus_tag="ABZJ_RS02475"
                     /old_locus_tag="ABZJ_00476"
     CDS             complement(523742..524752)
                     /locus_tag="ABZJ_RS02475"
                     /old_locus_tag="ABZJ_00476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004748378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent oxidoreductase"
                     /protein_id="WP_000648652.1"
                     /db_xref="GI:446571306"
                     /translation="MKAVAYQKAGPITSPEALVDIEIDTPVAKGHDLLVRVQAVSVNP
                     VDTKIRKNVSAEQSGWKVLGWDAVGTVEAIGDKVTQFKIGDVVWYAGALNRQGSNSEL
                     QLVDERIVGHKPKTLEVTEAAALPLTAITAWEMLFDRLQVPKTAPTNTTILVIGGAGG
                     VGSITIQLLKQLTNLTIIATASRPETKEWVEQLGADYVLDHRQPLAAQIKQLGLSAPL
                     YVFSTTETDQHLSDIVELIAPQGHFGLIDDPDQLDIKPFKSKSVSVHWEFMFTRSMFQ
                     TEDMEKQSELLNEVSKLVDEGKIKTTVTQVLSPINAENLTRVHEQIESGSTKGKIVLH
                     GF"
     gene            524852..525229
                     /locus_tag="ABZJ_RS02480"
                     /old_locus_tag="ABZJ_00477"
     CDS             524852..525229
                     /locus_tag="ABZJ_RS02480"
                     /old_locus_tag="ABZJ_00477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000513689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_001029768.1"
                     /db_xref="GI:446952512"
                     /translation="MAKARHSSFDCSPGCSVEAAISLIDGKWKCVILWHLLNEGTLRF
                     NEIRKRVPSITQRMLTNQLRELEQDGIIHREVYPQVPPKVEYCLTDLGRGLEQILLAL
                     KTWGDAHLDQFGKLTTLETEKSA"
     gene            525377..525826
                     /locus_tag="ABZJ_RS02485"
                     /old_locus_tag="ABZJ_00478"
     CDS             525377..525826
                     /locus_tag="ABZJ_RS02485"
                     /old_locus_tag="ABZJ_00478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000368721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000368721.1"
                     /db_xref="GI:446290866"
                     /translation="MDNIGIWVTVIIVLFVLGSIFGLRVSPREKALGIMRDKARKMGL
                     HPRVIAAPEWTHVPMATEKRASMVAYYSVLIPDARLPLMRARVIDGKLKVVQGDEKFN
                     DSPIALKGIYAIDMQANCVGLYWDEESDLKATQLDEMKAYLLALAEA"
     gene            525862..528498
                     /locus_tag="ABZJ_RS02490"
                     /old_locus_tag="ABZJ_00479"
     CDS             525862..528498
                     /locus_tag="ABZJ_RS02490"
                     /old_locus_tag="ABZJ_00479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019458040.1"
                     /note="catalyzes the ATP-dependent breakage of
                     single-stranded DNA followed by passage and rejoining,
                     maintains net negative superhelicity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="topoisomerase I"
                     /protein_id="WP_000024261.1"
                     /db_xref="GI:445946406"
                     /translation="MANTSRSASQSTASSASAAHKRALVIVESPAKAKTINKYLGSQY
                     IVKSSVGHVRDLPTGGSKATEKKPAARTKLTEAEKEQKANQALINRMGVDPEHGWQAH
                     YEVLPGKENVVAELKKLAKDADAIYLATDLDREGEAIAWHLREVIGGDDSRYHRVVFN
                     EITKNAIQEAFKQPTRLDLNRVNAQQARRFLDRVVGFMVSPLLWEKIARGLSAGRVQS
                     VAVKLVVEREREIRAFIPEEYWQVFADTKAKKDDIRLEAVKQAGKTLKLKNKAETDAL
                     LDVLKGAEYKVAQREDKPTKVNPSAPYITSTLQQAASTRLGFSVKKTMMLAQRLYEAG
                     FITYMRTDSTFLSDDAVSMVRAHIESQYGEKYLPAKPNRYGNKAGAQEAHEAIRPSNV
                     ALTGDQLAGVERDAQRLYDLIWRQFVACQMTPAEYLSSTLTVEAGNVELKAKGRTLVF
                     DGFTKVRGANKSDDDIILPAIKVGEILKLEKLDPSQHFTKPPARFTEASLVKELEKRG
                     IGRPSTYAAIISTIQERGYVKLENRRLFAEKMGEIVTDRLDESFNNLMNYAFTADLEG
                     QLDRVATGERNWKELLDTFYGDFKKRLTNAQGEQGMRRNQPVEVPAVHCPECSRPMQI
                     RTGTTGVFLGCSGYNLPPKERCKGTLNLTPVESLAALSDDDSAETADLMSKHRCPKCG
                     TAMDSYVIDGGRKLHVCGNNPDCDGYELEEGEFKIKGYDGPTIPCDKCDGEMQLKTGR
                     FGPYFACTSCDNTRKVLKNGQPAPPRVEPIKMEHLRSTKHDDYFVLRDGAAGLFLAAS
                     KFPKIRETRAPKVAELRSVADQLDPKYQFILQAPDVDPEGNPTIVKFSRKNQSQYVGS
                     ETPEGKQTKWSLIYQDGKWIEG"
     gene            528586..529344
                     /locus_tag="ABZJ_RS02495"
                     /old_locus_tag="ABZJ_00480"
     CDS             528586..529344
                     /locus_tag="ABZJ_RS02495"
                     /old_locus_tag="ABZJ_00480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000265760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_000265777.1"
                     /db_xref="GI:446187922"
                     /translation="MWKNIRILCLLIVLLIVAVQAWRDQNQDWNQPIVVVLHPINADG
                     LQTTQTYIHQLQNTDFQALKSYLSEWSQHYRGQSANFEIRLGQQLQQRPPEVPQNAGI
                     FHVVWWSLKFRFYAWRQQQPEDNGASLKLYLNYYDPNYQKVLVHSTALEKGRIGSVNL
                     FATRGQASQNQVVIVHELLHGFGAKDKYDLKTGQPIYPLGYAQPEKVPLYPQKRAEIM
                     GGRTPLSEQTSKMPSDLQETVIGLPTAQEVGWLK"
     gene            529482..530054
                     /locus_tag="ABZJ_RS02500"
                     /old_locus_tag="ABZJ_00481"
     CDS             529482..530054
                     /locus_tag="ABZJ_RS02500"
                     /old_locus_tag="ABZJ_00481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006580460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000859452.1"
                     /db_xref="GI:446782196"
                     /translation="MKTVGNDLVRNQLHADRKWYLILGFVLIIFGLVLFSSLPFATFS
                     VVFLFGILMMVGGVLHLIAALSVFKGGSRWLWALFGVLYLMAGYYAFSTPVTTAVVLT
                     SLLSIALIIAGVIRTINAFLLRPIAGWGWTLFSGLLTLATGILILVSKDSPFWVLGMF
                     LAVDILFQGINFLGLASAIKHLPSSSKTVS"
     gene            530171..532150
                     /locus_tag="ABZJ_RS02505"
                     /old_locus_tag="ABZJ_00482"
     CDS             530171..532150
                     /locus_tag="ABZJ_RS02505"
                     /old_locus_tag="ABZJ_00482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000050356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase PcrA"
                     /protein_id="WP_000050352.1"
                     /db_xref="GI:445972497"
                     /translation="MSLAKLINELNAQQKKAATTMAQNCLVLAGAGCGKTKTIVARAA
                     YLIDQGLPANQIQILTFTRRAASEIVARVEQHVGAQAKGLRASTFHTFCMYLLRRNPQ
                     AFGLTQFSIIDRDDQLLMFRLLRGKDKDNVLPKAAELCDLYSYARNTQSKLSEALLKQ
                     LPEAYEYKSQIAELMKTYEQRKRERNFLDYDDILSIVAVHLQNSEALTNWVAGFCQAL
                     LVDEMQDTNPLQWALLQPLIGKVKLFCVGDDAQSIYGFRGADFENIHSFKERIPDAVI
                     HTLDLNYRSTQEILDLSNWLLAHSPIDYQKQLQAHRGKGQKPQLHLFGNEFEEANWIA
                     QDLIERHQQGANWYDHMVLVRSGYSARYLEGAFIAAEIPYRFIGGVKLLESAHVKDVL
                     SLLRIVSNPQDDLAWMRFLTLWDGIGDVGASKLAQELMSISEVEERCERLERHGKVPL
                     QAILILKQLDVLQQHVEASIGLALDALSEQLEQNYKTKDWSRRARDFDLVKQLARKHA
                     SLGEFLEEYVLEPISISEIEKAGDDDLVTLITIHSAKGAEQKVCYVPHVSPNQYPYAR
                     AQGDFDEVEEERRVLYVALTRAENELILTKQNLNTWSQDTYDEQGRKIESYFLNDLPA
                     HLVQAKIHRQVPQPFAKKQWNTSRTVNLGFGIDLD"
     gene            532224..532463
                     /locus_tag="ABZJ_RS02510"
                     /old_locus_tag="ABZJ_00483"
     CDS             532224..532463
                     /locus_tag="ABZJ_RS02510"
                     /old_locus_tag="ABZJ_00483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002045355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_000699342.1"
                     /db_xref="GI:446621996"
                     /translation="MKILVRNLDRSVTEAEVLELFKAYGKVESCVVVTDKDTGKSKGF
                     GFVEMPNPREAIKAIKGLNTLKVKGYGIRVKAAEE"
     gene            532471..532638
                     /locus_tag="ABZJ_RS02515"
                     /old_locus_tag="ABZJ_00484"
     CDS             532471..532638
                     /locus_tag="ABZJ_RS02515"
                     /old_locus_tag="ABZJ_00484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017816431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_001183883.1"
                     /db_xref="GI:447106627"
                     /translation="MQQFLALSVVAPNGTRIAQRIKTLEVRSWVPAQLPLKDLFIVEN
                     QNFLKNDGDEG"
     gene            532755..533258
                     /locus_tag="ABZJ_RS02520"
                     /old_locus_tag="ABZJ_00485"
     CDS             532755..533258
                     /locus_tag="ABZJ_RS02520"
                     /old_locus_tag="ABZJ_00485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004710685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002027464.1"
                     /db_xref="GI:487953998"
                     /translation="MSRVARYHADRTNQKLYFARLACQQAEQTDHVQQVQAYREAAVF
                     HLHGAMLAFLQELVRYYRLNDLQPTLKSIEEHMAAKGQVSPEVSVLQQLAKDGFVAEL
                     KRAYRMCQYAPEPTEPTPEEETSSNLIIKVTQGPQSWLPDVKILREWHRELSHLIDGF
                     RNEMVEF"
     gene            533371..533649
                     /locus_tag="ABZJ_RS02525"
                     /old_locus_tag="ABZJ_00486"
     CDS             533371..533649
                     /locus_tag="ABZJ_RS02525"
                     /old_locus_tag="ABZJ_00486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000027402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000027403.1"
                     /db_xref="GI:445949548"
                     /translation="MSIQQLKELFGNQEAVLELVQLEGGELALRNAGSEKEPLVKIQF
                     SDELKAILGEQTPIVAQHMIQAALFGLLEKQVNEWQAEVVDEQPKFLS"
     gene            complement(533687..535396)
                     /locus_tag="ABZJ_RS02530"
                     /old_locus_tag="ABZJ_00487"
     CDS             complement(533687..535396)
                     /locus_tag="ABZJ_RS02530"
                     /old_locus_tag="ABZJ_00487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_001119808.1"
                     /db_xref="GI:447042552"
                     /translation="MPHDVDLIILLAVGFGVALFFGYIAARLRLPPLIGYLIAGIIIS
                     PNTPGVEADIHLANQLAELGVMFLMFGVGMHFSLNDLLLVRRIALPGAILQIAVATLL
                     GIGVSMLWGWSFGSALVFGLSLSCASTVVLLKALGDRGLLDSVNGKIAVGWLLVEDLV
                     MVLVLVLLPATAVLLGGKAPAGAEGNIWLTLGITLLKVIGFIAFMLIVGKRVVPIIMQ
                     FVARLGSRELFTLTVVAAAVSIAYGSYAIFGVSMALGAFFAGMVVKESDFSHRAEEET
                     LPLREIFSILFFVSVGMLFDPHILIERPLHILAVIAIIMVGKTLAAMALVLFFRYPIN
                     TALTVGASLAQIGEFSFILATLGVSLGLLTLEAQNLILAGALFSITLNSFIFSAIEPV
                     QRWIRERSHLARLLERSGDPLAMLPDEVDQSYLRDQVVIVGYGGVGRRITENLINQNI
                     KVVIAEENREIVEKLRQANIAAVSGVATEPGVLIQAHIMHARLLVISPMDILDIHRIV
                     DIAKQLNPQIQVLICAESKEEAAVIRDEHIGEVFYAKEEMAKNMSHHILNQIELAHQS
                     THH"
     gene            complement(535544..535699)
                     /gene="rpmG"
                     /locus_tag="ABZJ_RS02535"
                     /old_locus_tag="ABZJ_00488"
     CDS             complement(535544..535699)
                     /gene="rpmG"
                     /locus_tag="ABZJ_RS02535"
                     /old_locus_tag="ABZJ_00488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009766925.1"
                     /note="in Escherichia coli BM108, a mutation that results
                     in lack of L33 synthesis had no effect on ribosome
                     synthesis or function; there are paralogous genes in
                     several bacterial genomes, and a CXXC motif for zinc
                     binding and an upstream regulation region of the paralog
                     lacking this motif that are regulated by zinc similar to
                     other ribosomal proteins like L31; the proteins in this
                     group lack the CXXC motif; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_001205031.1"
                     /db_xref="GI:447127775"
                     /translation="MRDKIRLVSSAGTGYFYTTTKNKRTMPEKMEIKKFDPKIRQHVI
                     FKEAKIK"
     gene            complement(535712..535948)
                     /gene="rpmB"
                     /locus_tag="ABZJ_RS02540"
                     /old_locus_tag="ABZJ_00489"
     CDS             complement(535712..535948)
                     /gene="rpmB"
                     /locus_tag="ABZJ_RS02540"
                     /old_locus_tag="ABZJ_00489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018677334.1"
                     /note="required for 70S ribosome assembly; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_000048256.1"
                     /db_xref="GI:445970401"
                     /translation="MSKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEK
                     RFVRLRLTTKGMRIIDKLGIEKVVADLRAQGQKI"
     gene            complement(536116..537564)
                     /locus_tag="ABZJ_RS02545"
                     /old_locus_tag="ABZJ_00490"
     CDS             complement(536116..537564)
                     /locus_tag="ABZJ_RS02545"
                     /old_locus_tag="ABZJ_00490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006580455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coniferyl aldehyde dehydrogenase"
                     /protein_id="WP_001088257.1"
                     /db_xref="GI:447011001"
                     /translation="MNSQTKTNPETQVPYDVKHLHDLLEQQKIAYLRHPVPTAKERID
                     RLARLKRVLVKYQDQIAEAINLDYGNRAIMETKIGELLTCLEQIKYYSKNVTGWMKPS
                     KRHISVLHQPAKGWVQYQPMGVIGIITPWNYPLLLSVGPLICALAAGNHAMIKISSAS
                     PNFGQVLENALSEAFPQELVAVVNGGGVISDAFSHLPFDKMIFTGSTSVGKTVMAAAA
                     QNLVPVILELGGKSPALVHASVDMKDVAQRIAVGKLWNAGQTCVAPDHIFLPRGKTAE
                     FIENFKLIVAGMYPHFRNNQDYTSIINDKQYNRIQGYLENARDQGARIIEINPQNEIL
                     DDVRKIAPTLVTGVTTAMDIMQNEIFGPVLPILEYDQIEEVIEFINSRPRPLAMYYFD
                     YDQARADYISQHTHSGHFGINMVITHVAQDDLPFGGIGASGMGKYHGPEGFFGLSHER
                     SVMSNPKLYSLKYILPPFNKPIHRFISKTLLR"
     gene            537677..538369
                     /locus_tag="ABZJ_RS02550"
                     /old_locus_tag="ABZJ_00491"
     CDS             537677..538369
                     /locus_tag="ABZJ_RS02550"
                     /old_locus_tag="ABZJ_00491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002114968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_000056618.1"
                     /db_xref="GI:445978763"
                     /translation="MSLPKALKTKDRILQISLQLFNERGERSVTTNHIAAELGISPGN
                     LYYHFRNKHEIIKELMHQYQVETLEMLSLPEDRPLTTNDKINYFQVLSGQLWNYRFIH
                     RDVYHLVESNEDFKKIYPRFAGQVMQQGQRIYQAFVDAGLMKMTPSEIEALIINLWIV
                     LTNWTNFLYMSGHISDNNHLEEKWVWQALRQMVFLEGPYLMGESRATYEQLLESLGPS
                     DLFASLSSLKDE"
     gene            538444..539307
                     /locus_tag="ABZJ_RS02555"
                     /old_locus_tag="ABZJ_00492"
     CDS             538444..539307
                     /locus_tag="ABZJ_RS02555"
                     /old_locus_tag="ABZJ_00492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000205407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="WP_001057506.1"
                     /db_xref="GI:446980250"
                     /translation="MNMTTANTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYAT
                     EAQGGRYFMRVEFELDHLQSRKDALIQTFAANVAERYGMQWRLAFVNDIKKVGILVSK
                     VDHALLELLWRHARGSLPCEITHVISNHEDLREAVENFGIPFTVIKVTKDNKAEAYAQ
                     IHEMMQGNDLLVLARYMQILSEDFVSKWEMKIINIHHSFLPAFVGANPYKQAYEKGVK
                     LIGATAHYVTADLDQGPIIEQDVERVSHDYNVEQLRELGEDVERNVLARAVKWHLEDR
                     IIVDGNKTVVF"
     gene            539699..540454
                     /locus_tag="ABZJ_RS02560"
                     /old_locus_tag="ABZJ_00493"
     CDS             539699..540454
                     /locus_tag="ABZJ_RS02560"
                     /old_locus_tag="ABZJ_00493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000083585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_000083586.1"
                     /db_xref="GI:446005731"
                     /translation="MSQSSAALNSPNPMKKKVITALIAVAIGHIGVLWAVSHIKPAEL
                     KPIEKKPLQVRFVKIQEQPKPLPPKPKEPPKKPEPKKEVKEVKVVEKPVTPPKKVEKI
                     QQVKKAETPKETVKTEPKVEPKIVTPTTTVTEKVVEKPKPVVQEAPKAQPAPDPSPKR
                     VSIGGSGVQWSRSPRLTVSPKDLQGEARSVVVLIEADEKGKITNVRVTRSSGIPSLDD
                     KVVRAVRSAKFKPYMENGVAYPIKAEQPFDLTP"
     gene            540499..541119
                     /locus_tag="ABZJ_RS02565"
                     /old_locus_tag="ABZJ_00494"
     CDS             540499..541119
                     /locus_tag="ABZJ_RS02565"
                     /old_locus_tag="ABZJ_00494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004958871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbB"
                     /protein_id="WP_001011664.1"
                     /db_xref="GI:446934408"
                     /translation="MNFSIYWQHADAVSKTLYFILLAMSIATWTVFILRLMGTRQLKQ
                     QAYAQLSQAITSLKAKLQPLSFEQRKAVAEQALLRQISAEKANADKGISVLGTIASIA
                     PFVGLFGTVWGIFHALVAVGKSGQAGLAQVATPVGEALIMTGLGLAVAIPAVLAYNIC
                     VRANRGLAHDLQDQAHSLLIDTMLQQDSTVKSDVKTAQQSYVGGQA"
     gene            541119..541523
                     /locus_tag="ABZJ_RS02570"
                     /old_locus_tag="ABZJ_00495"
     CDS             541119..541523
                     /locus_tag="ABZJ_RS02570"
                     /old_locus_tag="ABZJ_00495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004738045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter"
                     /protein_id="WP_000885431.1"
                     /db_xref="GI:446808175"
                     /translation="MAFQLGEDHDSGMNEMNLIPLIDIMLVLMIIFLVTATVANPSIP
                     LTLPKTTAEIIDPPPKAITISINANGEVAWDTQVISLDELQKRFQEAGQGAVKPTVQL
                     RADKESKYDTVAQVMSRASEAGLSDIAFVSEN"
     gene            complement(541583..542104)
                     /locus_tag="ABZJ_RS02575"
                     /old_locus_tag="ABZJ_00496"
     CDS             complement(541583..542104)
                     /locus_tag="ABZJ_RS02575"
                     /old_locus_tag="ABZJ_00496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase A"
                     /protein_id="WP_001183413.1"
                     /db_xref="GI:447106157"
                     /translation="MQQALFGGGCFWCVEAVFLQIRGVEKVTSGYAGGHTTHPTYEQV
                     CQGDTQHAEVVLIDFDEQQVTYSQLLDVFFATHDPTTLNRQGNDIGTQYRSVIYYFNE
                     EQKQAAEHTIQTLKDDDLDIVTELSPAPTFYPAEDYHQNYYEKNPSQGYCNFAIPPKL
                     LKLHSKFQHLMKN"
     gene            complement(542205..543260)
                     /locus_tag="ABZJ_RS02580"
                     /old_locus_tag="ABZJ_00497"
     CDS             complement(542205..543260)
                     /locus_tag="ABZJ_RS02580"
                     /old_locus_tag="ABZJ_00497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002061717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000551512.1"
                     /db_xref="GI:446473658"
                     /translation="MHNIGTREFIIALLFGALHSLFTLFIVLSSIWVCLALWVQQPFG
                     WLGSRIIIGIWIAFALSMAGLYFNGHIISRRTDVLIYLLAFACSLVWYFSITARQDRD
                     WNPEVANMLSYEKHGDVITLHNVRNFNWHPDGTYDVRWETRTFDLNQLNGINIITSYW
                     MGPQIAHTLVSFEFKNQQPLVFSIEIRKEKTEEFSAIGGFFRKYELSLIASDEKDIVY
                     TRSNIRKEQVYNFPVNMPRSEQKALFLEYLKKADELRAEPKWYNTLTSNCTTLIFDMV
                     QAINPYQLPKDYRLIASGYLPNYLYDLKALDQNISLKQWYQIAHINPRTEHFEQFADQ
                     SSEHFSQIVRQGLPKVK"
     gene            complement(543275..543784)
                     /locus_tag="ABZJ_RS02585"
                     /old_locus_tag="ABZJ_00498"
     CDS             complement(543275..543784)
                     /locus_tag="ABZJ_RS02585"
                     /old_locus_tag="ABZJ_00498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004794794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_000312553.1"
                     /db_xref="GI:446234698"
                     /translation="MAWQNVKVVHVVAMDKNHCIGKGNALPWHISADLKHFKEITQGG
                     VVIMGRKTLESMGRALPNRVNWVITRDINWHFDGVKIAYSIEDALNAALEDAKNTEKQ
                     ALFIIGGGEIFKQTLSIADRLELTHVDLDVQGDAHYPTIPSEFHKTASEQQVDEKSGT
                     SFEFATYKK"
     gene            complement(543829..544671)
                     /locus_tag="ABZJ_RS02590"
                     /old_locus_tag="ABZJ_00499"
     CDS             complement(543829..544671)
                     /locus_tag="ABZJ_RS02590"
                     /old_locus_tag="ABZJ_00499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009393073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_001203168.1"
                     /db_xref="GI:447125912"
                     /translation="MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPL
                     LTTKKVHFRSIVIELLWFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPEHELGPV
                     YGHQWRNFGATKNADGTYNQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALP
                     PCHTLFQFFVQDNKLSCQLYQRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWT
                     GGDTHLYANHFEQAKLQLTREPLPLCQLKLNPDVKDIFDFKFEDIEIVGYESHPAIKA
                     PVAV"
     gene            complement(544793..545155)
                     /locus_tag="ABZJ_RS02595"
                     /old_locus_tag="ABZJ_00500"
     CDS             complement(544793..545155)
                     /locus_tag="ABZJ_RS02595"
                     /old_locus_tag="ABZJ_00500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000881938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000881953.1"
                     /db_xref="GI:446804697"
                     /translation="MLAYWYNVPRHIKLIFIIVVCAAIYAANQVQPLSPTYTVLSLVL
                     GSGLHFGQYLQTKIPEHSSHKLKLQFLLRIYPLIIVAIIMWLLPPQHNWIATIQALGF
                     VLVGFFLVSIYQNRAKRF"
     gene            complement(545166..545525)
                     /locus_tag="ABZJ_RS02600"
                     /old_locus_tag="ABZJ_00501"
     CDS             complement(545166..545525)
                     /locus_tag="ABZJ_RS02600"
                     /old_locus_tag="ABZJ_00501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000889268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000889270.1"
                     /db_xref="GI:446812014"
                     /translation="MLEFWFNTQVPTFKKLIILIITLLICIGLYQYQPLPLDTILMFT
                     GTGVIFLICRYFKLHFAQSNPTGLLYRLFTWVPIALLFALIFVKTMPNLLIWGVQGIA
                     FMALAAFIFSPQSLFNK"
     gene            complement(545599..546417)
                     /locus_tag="ABZJ_RS02605"
                     /old_locus_tag="ABZJ_00502"
     CDS             complement(545599..546417)
                     /locus_tag="ABZJ_RS02605"
                     /old_locus_tag="ABZJ_00502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009393202.1"
                     /note="transfers the N-acyl diglyceride moiety to the
                     prospective N-terminal cysteine in prolipoprotein; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="WP_000959084.1"
                     /db_xref="GI:446881828"
                     /translation="MLTYPNIDPVAIHLGPLQVHWYGLMYLLAFLCAWGLASYRAKQR
                     DGWTSDMVSDLVFYGALGVVLGGRIGYVLFYEFDKFLENPIWLFQVWTGGMSFHGGFL
                     GVMIAMLFWCKKYQKTWFQTLDFIAPCVPTGLMFGRIGNFIGGELYGRAVTDPNYPFG
                     MIFPTDPLHLVRHPSQIYQALCEGLLLFIILWWFSSKPRPRMAVSALFLMGYGVARFV
                     MEFFRQPDADQGFILFGWMTKGQILTVPMLLIGLWMMWYAYQKKIYDWGPQKNS"
     gene            546511..547290
                     /locus_tag="ABZJ_RS02610"
                     /old_locus_tag="ABZJ_00503"
     CDS             546511..547290
                     /locus_tag="ABZJ_RS02610"
                     /old_locus_tag="ABZJ_00503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004710677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000335024.1"
                     /db_xref="GI:446257169"
                     /translation="MCIVALAWHVLDDMPLCLISNRDEFYHRPTALLYQWEHTPIIAG
                     QDLQSGGTWMGVTPQGRWAVLTNFRDGRDKKQYETSRGHLVQAFLESDLLPIRFAQQL
                     EQQQQNFAGFNLFMGTADQAVYMSNRGEAPQVLANGVYVVSNGLMSDHWEKTRHLRTR
                     FTQEFLPMHQHKTEELSLQHAAWDILEDERKVTTALLPNTGIQPEMEELLSSTFIQSP
                     VYGTRCSNFLRMTNNEWIWLEKTQQGEHSGQIVQQQVLLNR"
     gene            complement(547339..549672)
                     /locus_tag="ABZJ_RS02615"
                     /old_locus_tag="ABZJ_00504"
     CDS             complement(547339..549672)
                     /locus_tag="ABZJ_RS02615"
                     /old_locus_tag="ABZJ_00504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002132761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="WP_000137990.1"
                     /db_xref="GI:446060135"
                     /translation="MTELTPYHEDQELDNNTSDNIHFRDILEQHISRRSLITKAASGA
                     VALTLASTLTGCNDNDDDSGSNNGGTTPVDPNKKPEKLTFTPVAKNLNDIVTVPEGYE
                     ANVIYALGDSINPRVGDWDDNNIPSGPSFQFRSGDCHDGMHYFGLNTSTNRFDETVSA
                     QGLLVMNHEYINQTFLHPKGPTKVDGRRPEDEVIRETNAHGVSVIHIKKDPTTQKVEI
                     VKNSIFNRRITASTVMEFAGAAAGSSLLATRFSPAGRQTRGTHNNCGNGYTPWGTYLT
                     TEENFIGYFQRSGSDEYARTDAEKIALKRYGLGVKKDEPYLYEKDEKGAPKKDKDGNI
                     IYLKDKNGELIPNVDEQGRQIYLGTSSRYGWETAIGQVESQDLYDRWNADVKAAQATQ
                     DYRNGPNTFGWMVEIDPFDGRQNPVKRTSLGRFAHEDSACRAVVGQPLAFYMGDDSRG
                     EYIYKFVSTAVWDTKDINGGYTAGDKYMNAGKLYVAKFNNDGSGQWVELAYGKNGLNE
                     SNTTYPFKSQADVVTFARLAADSVGATKMDRPEWCTVNPVNGEIYVTLTNNSNRGKDY
                     ATDAANPRNYTDLYAGTKEQKGNVNGHIIRFKETDDKTTAETFKWDIYLFGAEAAMAS
                     NINLSGLTDNNDFSSPDGMWFDPRGVLWIETDDGAYTDVTNCMMLAALPGQIGDGGTA
                     TTSNGQQTITGAKVTDATLRRFLVGPKQCEITGIAMTPDYKAIFINVQHPGEDSPSYA
                     KPESNWPATQKDPSNKTARPRSATVVITRKDGGVIAG"
     gene            complement(549881..552061)
                     /locus_tag="ABZJ_RS02620"
                     /old_locus_tag="ABZJ_00505"
     CDS             complement(549881..552061)
                     /locus_tag="ABZJ_RS02620"
                     /old_locus_tag="ABZJ_00505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000205452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_000205456.1"
                     /db_xref="GI:446127601"
                     /translation="MTTASNHPTRRDILKWFTGIPFLPLGAMATAATLAGCNDSDNDS
                     SIVTPSKPINFKNATFTSMPAPSTVADIATTACASKLAISWEDGSKTEYQLAYKPFFL
                     TGTEVPDGKGGKVIAGGYYDINNKPIIDKSVAGKERQFFSDCPDGSSLISFKQATGKD
                     FTDADKKALGVTGNPVFHVVQFEYLSKDQNGGDTYGKLSSPIAVLTLDQDPKTGHLTL
                     IKYHNVDTSSAHGLWITCGASLSPWGTHLSSEEYEPDAFDQKLGQSLSTLKAFSKNIY
                     GDENIANPYNYGHLPEITVNADGTGRVTKHYCLGRISHELVQVFPDNRTVLMGDDYTN
                     GGLFMFVADKEKDLSAGTLYVAKYTTVLSDTTTGQISWIRLGHATSAEIENLIKSGIK
                     GTDIFESVLQIAKYPSDATIAEKEAIDAGDKGTPEQQALAKAAKERLKLQQAAQKAEL
                     EAQGFKFTYLSKTGVYLKLKDNSDRTKLAAAFLETHRYAAYMGASMALTKNEGTTVNI
                     ADKKAYSALANIVDSMVEGGSGYLAEHNVKFPKITAGGILEHTLTGGQKDSSNVAINS
                     EWVPSQSNLLIKGKDISFDSLGNTADPEQIASPDNLKFSEKLRTLFIGEDSGNHLNNF
                     LWAYNVDTKQLIRILSTPAGAESTGLHAVDEVNGWTYIMSNFQHPGDEWNRFYKEKDG
                     VRTGISADLLAQIDTAINTNYSNKFAAAVGYITADPIAPSVVKK"
     gene            complement(552234..553004)
                     /locus_tag="ABZJ_RS02625"
                     /old_locus_tag="ABZJ_00506"
     CDS             complement(552234..553004)
                     /locus_tag="ABZJ_RS02625"
                     /old_locus_tag="ABZJ_00506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001072723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase"
                     /protein_id="WP_001072722.1"
                     /db_xref="GI:446995466"
                     /translation="MNQLPSTAVNSQENLDQMPIMNHLVVLRRHLFRIVGVTLFLFFC
                     LLPFRNHTYQLLSEPLRLQLPASSSMIATDVTATFMAPFKLNLFVALMLAMPFILYEI
                     WSFVRPALYQKERHLALPLLIGSIILFYAGVAFAYYITLPAILHFFISVSPETVAPMT
                     DINSYLSFCLKLFLVFGVTFEIPIATLLLILIGVVNTQSLAEKRRFIIVGCFFVAMFI
                     TPPDAISMVMLAIPMWLLFEIGLLFGKILEKRKTHSAE"
     gene            complement(553001..553438)
                     /locus_tag="ABZJ_RS02630"
                     /old_locus_tag="ABZJ_00507"
     CDS             complement(553001..553438)
                     /locus_tag="ABZJ_RS02630"
                     /old_locus_tag="ABZJ_00507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000887759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatB"
                     /protein_id="WP_000887761.1"
                     /db_xref="GI:446810505"
                     /translation="MLDVGMTELLCFAIIAILVLGPEKLPEAARFAGRWYVRLKRYIT
                     NLQNEIDQELRLSEFRKEMQEELNRIEALERKVQQQLEEIQKQQVSESLEATETAKTT
                     QKPIRKCTPISGHYKVPYLTKVTPLAPQTDISETSPVELKIAV"
     gene            complement(553450..553668)
                     /locus_tag="ABZJ_RS02635"
                     /old_locus_tag="ABZJ_00508"
     CDS             complement(553450..553668)
                     /locus_tag="ABZJ_RS02635"
                     /old_locus_tag="ABZJ_00508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002058628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatA"
                     /protein_id="WP_000908081.1"
                     /db_xref="GI:446830825"
                     /translation="MAGLSIWHVVIFAIVVILLFGTSKLKNIGKDVGGAVRDFKKSVR
                     EEDEAASLNSPRTIDAQVKTSESTSVKS"
     gene            553921..554796
                     /locus_tag="ABZJ_RS02640"
                     /old_locus_tag="ABZJ_00509"
     CDS             553921..554796
                     /locus_tag="ABZJ_RS02640"
                     /old_locus_tag="ABZJ_00509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001196415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_001196414.1"
                     /db_xref="GI:447119158"
                     /translation="MALLLPVLAFITGLLLAQTSISETVKPILSAWLARLLIPIVIIY
                     NMVFYQSGSLSLMLFSFGSAFIIFFAYLALFKDRLLALCVSYTNMGWLGFPFAMALFG
                     PEATAPIVALYIGMSLFGNAWAVTAVTTAPQSKLNILKKVLTSPPCISIFCAVVLRLL
                     GTQHIESPAIHWVYEVAKFAMTFAGMCVLGMWLRRTRVYAKDLIYSTKAQAFKVACGF
                     VLCGLSYRFLQIPNINQHIGVMFLMFCLPPAANIVALETHYQGTGRSAAYIASGTIVS
                     CVCIAIYAMFLHVAL"
     gene            complement(554989..555615)
                     /locus_tag="ABZJ_RS02645"
                     /old_locus_tag="ABZJ_00510"
     CDS             complement(554989..555615)
                     /locus_tag="ABZJ_RS02645"
                     /old_locus_tag="ABZJ_00510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005124785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-triphosphate diphosphatase"
                     /protein_id="WP_000106708.1"
                     /db_xref="GI:446028853"
                     /translation="MSTPHWFDQGSLVLASNNKGKVAEFEKLFEQLKLPVEIIPQGHL
                     NIPDAIEDGLSFIENAIIKARHASKISGKPAMADDSGICVPVLGGAPGIYSARYAGEH
                     GDDAANNAKLLNDLLPFRKNGEAIEGMFVCVLALVTHAEDPLPQIFQGIWHGEILEAP
                     RGENGFGYDPLFWLPELQVSSAELSKEEKNKISHRGQAMQLFRESLQK"
     gene            complement(555784..556371)
                     /locus_tag="ABZJ_RS02650"
                     /old_locus_tag="ABZJ_00511"
     CDS             complement(555784..556371)
                     /locus_tag="ABZJ_RS02650"
                     /old_locus_tag="ABZJ_00511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004836171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000751693.1"
                     /db_xref="GI:446674347"
                     /translation="MKKTLFSTLIAGLLSMQAHADYIAQPQSVASQAARFSTMGIHDL
                     QKAAQAGQAGAQFYLGTRYQYGKDVAKDDKQAFAWFKTAADQGLSPAQLNVGRMYADG
                     IGVKKDEAMARKYFEKAASNGDNRASYNLAMMEEQKKNYVGAYQWYELSTRDGMLDNK
                     VISLSEGKKTALAANLTQEQIRMARDRADKWIQAQ"
     gene            complement(556368..556961)
                     /locus_tag="ABZJ_RS02655"
                     /old_locus_tag="ABZJ_00512"
     CDS             complement(556368..556961)
                     /locus_tag="ABZJ_RS02655"
                     /old_locus_tag="ABZJ_00512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011182067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine biosynthesis protein MetW"
                     /protein_id="WP_001217230.1"
                     /db_xref="GI:447139974"
                     /translation="MRIDQQLAEKWIKPGSSVLDLGCGDGELLAHMSQKHQIRAYGLE
                     IDQEKIAIAVSRGLNIIQQDLNLGLSRFADQSFDYVVMAQALQAVDAPDVLLRDMVRV
                     GKQAIITFPNFAHWKTRSFLALKGMMPVSDALPYMWYNTPNIHLCTFKDFEALCAENQ
                     IQIINRLAVNGNQQGSLLSKHVPNLFGEVAIYRVSAL"
     gene            complement(556961..558121)
                     /locus_tag="ABZJ_RS02660"
                     /old_locus_tag="ABZJ_00513"
     CDS             complement(556961..558121)
                     /locus_tag="ABZJ_RS02660"
                     /old_locus_tag="ABZJ_00513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006582216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-acetyltransferase"
                     /protein_id="WP_000009640.1"
                     /db_xref="GI:445931785"
                     /translation="MSFPADSVGLVTPQKFQFEEPLHLECGRVLPRFELMVETYGTLN
                     ADKSNAILICHALSGHHHAAGYHHEDDKKAGWWDSCIGPGKAIDTNKFFVVALNNIGG
                     CSGSTGPTSPNPENDNRPYGPDFPLVTVRDWVKTQAMLSDRLGISVWYAVVGGSLGGM
                     QALQWSVDYPDRLQKCVVIASAPKLSAQNIAFNEVARQSILSDPDFHHGRYLENDSYP
                     KRGLILARMVGHITYLSEEAMKQKFGRDLKSGKFMYGFDVEFQVESYLRYQGEQFSRN
                     FDANTYLIMTKALDYFDPSREYGHSLTEAMSKTKCQFLIVSFTTDWRFAPSRSQEIVD
                     ALITNHKPVSYLDIDAEQGHDSFLFPIPLYVKTLRAFLGGEEHLKSTSLEAS"
     gene            complement(558204..559901)
                     /locus_tag="ABZJ_RS02665"
                     /old_locus_tag="ABZJ_00514"
     CDS             complement(558204..559901)
                     /locus_tag="ABZJ_RS02665"
                     /old_locus_tag="ABZJ_00514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="WP_000978841.1"
                     /db_xref="GI:446901585"
                     /translation="MMLADPSKKYRRMYQRVDLPDRQWPNNEITKAPIWMSTDLRDGN
                     QAIFEPMNMEQKFKMFKMLVKIGFKHIEIGFPSASQIDFDFTRMLIEENHIPDDVYIE
                     VLVQARDHLIERTFEALAGAKRAIVHIYNSNSPTFRQKVLNVDVNGAKQLAVNAAQKV
                     KEYAAQYPETDWIFQYSPECFSATELEVAKEVCDAVTEIWDARPDHKVILNLPATVEV
                     STPNVYADQIEWMHRNLARRDGVIISVHCHNDRGCGIAASELAIMAGADRVEGCVFGN
                     GERTGNVDVAAIALNMYTQGVAPELDFSNINEVIATVEECTGLPVHPRHPYAGDLVFT
                     AFSGSHQDAIKKGFEYQKNEEIWDMPYLPIDPKDLGRDYDAVIRVNSQSGKGGIAYLL
                     ESNYNVVLPRRLQIEFSQVVQQYTDENGTEISAKQIWTLFKDTYVEVKNHHYTVKNYK
                     LSDINGTQIIELEIDVEGETQQLRGEGNGPISAFLNALQLPIDVLNYEERSISSGANA
                     KALTLIELQVKGTGRGSFGAGVHDNTVTSSIEAIIACTNRLIDQGVLSTDQVVAAAV"
     gene            complement(560360..561043)
                     /locus_tag="ABZJ_RS02670"
                     /old_locus_tag="ABZJ_00515"
     CDS             complement(560360..561043)
                     /locus_tag="ABZJ_RS02670"
                     /old_locus_tag="ABZJ_00515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004757131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxylase"
                     /protein_id="WP_001984475.1"
                     /db_xref="GI:487911009"
                     /translation="MIHHIPNVLSKEQVQYFRNEMDKIEWVNGKVTAGTLSATVKRNQ
                     QLPEDHPLTHHLSNIILEALGTHPLFLSAAIPLDIIPPLFNRYENQESFGFHVDNSIR
                     RIRGTNERLRTDLSCTLFLSEPEEYEGGDLVVEDTYGYHEVKLPAGDMILYPSTSLHE
                     VTAITSGCRIASFFWVQSMVRDDAERHMLFNLDQTVQNLRMQLGDNHSEVIKLTNLYH
                     NLMRKWAEL"
     gene            complement(561148..563379)
                     /locus_tag="ABZJ_RS02675"
                     /old_locus_tag="ABZJ_00516"
     CDS             complement(561148..563379)
                     /locus_tag="ABZJ_RS02675"
                     /old_locus_tag="ABZJ_00516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005112147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel protein"
                     /protein_id="WP_000052887.1"
                     /db_xref="GI:445975032"
                     /translation="MSLIRTRKKIVSSAIASSLSMIATTAMAQEAVSQLPTIHTKATQ
                     EESLKVDQSANSKFVAPLLDTPKSVSVISKQLIEDTKVTTLADALRTVPGITLGAGEG
                     GNPNGDRPFIRGYSSESSMYIDGIRNSTSQNREMFAVEQVEVTKGSASAMGGAGSVGG
                     SINMISKVAKKGDFLEGSVAAGTDNYQRITLDGNKDFGNGIAARVAVLGHQNEKAVQS
                     NGAEYKRVGIAPSITFGLDTPTRATLSYYYLQTDDKPDSGIPYWDSSLGKAQGKPAEV
                     KQGTYYGWKDRDFQKQENHIGTIKLEHDLTDNITITNTAMYAKSKNDYVWTNPDDSKG
                     NVGKGLVWHRLNSAITDSETFTDQLALTGKFDTGFLKHRFNVGAEYSKQKTDKGGYNI
                     IDAKGNVSSTGFYSDCSDLSTNWCTSLNGPTQKPFVDRLQARPDFDATVESTSVYLLD
                     NIEITPKWLLDLGLRWDKFEAEQNFLATSSAAAYTAKNDSDFVTYQAGITFKPTENGS
                     IYTSYATSASPVGLNAGWGDNSETINANNQMIDPEEAQTFEIGTKWDFLDNHLNLTAA
                     IFRTEKQNTRVQIDPTTYANVGESKVDGFELGLNGEITDKWNISAGYTYLDSELTKNG
                     KSCRSGKCTDQSIYNGNQMPNVPKQAATLWTTYRVLPQLTVGAGAVYSDKVYGDVANT
                     KWVPSYVRYDAMARYNVNKNVDLQLNINNLSDKRYFTKAYASHYATEAEGRSAVLAVN
                     FKY"
     gene            563794..565128
                     /locus_tag="ABZJ_RS02680"
                     /old_locus_tag="ABZJ_00517"
     CDS             563794..565128
                     /locus_tag="ABZJ_RS02680"
                     /old_locus_tag="ABZJ_00517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017398159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="WP_001198432.1"
                     /db_xref="GI:447121176"
                     /translation="MQVTTEAVSGVARRLNVSVPTSRINEQFEARLKRTAKTVKINGF
                     RPGKVPANVVRREYGASIYQEVVNDIIRDSVFEAIQQEKINAVGMPNIEKVEHKEDAL
                     VFEATVEVYPEVEVKAFDGLEVERKTAEIKDADVDTMIENLQKQRQTWAVTKGMAKKD
                     MQVTFDFEGSIDGEKFEGGSAEDFKLVLGSGRMIPGFEDGIIGMKAGEEKVIDVTFPE
                     DYQAENLAGKAAQFKITVKQVEKPKLPEIDAEFLKIFGVSEEEGIEKLKADVRKNMER
                     EVRNGLRNQVKQAAFDALVAANEIEVPAAMVAQEIDRQRQQMVQQFTQQFGGAGAQSF
                     DKSMLPDELFKEQAERSVKLGVLVSKVLADAKLEVDQARVDAYIDDMASSYEDPTEVI
                     EYFKNDAQQRAQIEAVVLEDQVVDHILASAKVTDKAVSYEDLLKEQQARRMG"
     gene            565321..565926
                     /locus_tag="ABZJ_RS02685"
                     /old_locus_tag="ABZJ_00518"
     CDS             565321..565926
                     /locus_tag="ABZJ_RS02685"
                     /old_locus_tag="ABZJ_00518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004974855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="WP_000289452.1"
                     /db_xref="GI:446211597"
                     /translation="MYVPTIENALVPVVVEQSSRGERSFDIYSRLLRERVIFLTGEVE
                     DNMANLIVAQMLFLEAENPDKDIHLYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQ
                     AASMGAFLLNAGAKGKRYCLENARVMIHQPLGGFRGQASDIEIHAREILFIKERLNRL
                     MAEHSGQDYDTIARDTDRDNFMTAQAAKEYGLVDQVLSKRP"
     gene            566028..567341
                     /gene="clpX"
                     /locus_tag="ABZJ_RS02690"
                     /old_locus_tag="ABZJ_00519"
     CDS             566028..567341
                     /gene="clpX"
                     /locus_tag="ABZJ_RS02690"
                     /old_locus_tag="ABZJ_00519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003654846.1"
                     /note="binds and unfolds substrates as part of the ClpXP
                     protease; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_001289250.1"
                     /db_xref="GI:447211994"
                     /translation="MSEHPQGQKHCSFCGKTQSEVGKLIAGEDAYICNECVDVCLDLV
                     QTSQQVEAGDWASKALPKPHEIRAALDQYVIGQDLAKKTLSVAVYNHYKRLKVGQSGH
                     VSKDVEIAKSNILLIGPTGSGKTLLAQTLARLLDVPFAMADATTLTEAGYVGEDVENI
                     VQKLLQKADYDVEKAQKGIIYIDEIDKITRKSENPSITRDVSGEGVQQALLKMIEGTV
                     ASIPPQGGRKHPQQEFIQIDTSNILFICGGAFAGLEKIVQQRQEKGGIGFTADVKNKD
                     ETKKLAELFRQVEPTDLVKFGLIPEFIGRLPVIATLEELDEEALMQILTEPKNALTRQ
                     YQYLFNMENVDLVFEDSALRAVAKRALERNTGARGLRSILENVLLETMYDLPSRTDVG
                     TVFINEAVINGEAEPVYKSERQPKEAVTHESVAKADLKVIDSKSA"
     gene            567489..568205
                     /locus_tag="ABZJ_RS02695"
                     /old_locus_tag="ABZJ_00520"
     CDS             567489..568205
                     /locus_tag="ABZJ_RS02695"
                     /old_locus_tag="ABZJ_00520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005302195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_001269745.1"
                     /db_xref="GI:447192489"
                     /translation="MRYLIIALSCATLLAGCQSSSHLEKNSGELTATLPKVDVDKEPG
                     LLDQYRLGGFTVGGWVNQKLGQTFAPVKPQNEQAAVVYLYRPDTKWNRQEIAAINLFV
                     NGKRIPSLLHNHYYWIELPAGTYRISASRPLLGIHFQEPKYIDITVDAGASYYLKYDE
                     ENKMDRSEHTGPFMLMQDNIGRREIAFTELKSSSYNFVAEDASGKIRHKPQELKPAKY
                     NEKSDVHLIKPFKLWNPLTW"
     gene            complement(568230..568784)
                     /locus_tag="ABZJ_RS02700"
                     /old_locus_tag="ABZJ_00521"
     CDS             complement(568230..568784)
                     /locus_tag="ABZJ_RS02700"
                     /old_locus_tag="ABZJ_00521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016142257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_000155519.1"
                     /db_xref="GI:446077664"
                     /translation="MTIRPILKNLSISLCLSCITTSLFASPAKLSSVKELMQMSQIDY
                     LLKESINELTPYYDQQAEQIISNITGIKTLGPKEKEAAKKLGLLLKDSSNQLISSPKT
                     TQALQDIYLKTYTEEEIQANLKFLKTPEGQSITRKNVQIMGQISEYMMELGQQTFNDP
                     KARDHMQEEMLKIIAPLMKDKEKS"
     gene            complement(568926..570452)
                     /locus_tag="ABZJ_RS02705"
                     /old_locus_tag="ABZJ_00522"
     CDS             complement(568926..570452)
                     /locus_tag="ABZJ_RS02705"
                     /old_locus_tag="ABZJ_00522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752349.1"
                     /note="catalyzes the formation of fumarate from malate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="WP_000207467.1"
                     /db_xref="GI:446129612"
                     /translation="MTTIIKQDDLITSIKDALQFISYYHPQDFIQAMSRAYDREENKA
                     AKDAIAQILINSRMCAEGHRPICQDTGIVNVFLEVGLDVKFDLTMSLDDAVNEGVRQG
                     YLENSNVLRASVLADPAFGRKNTKDNTPAVIHYKLVPGNKVDITVAAKGGGSENKSKL
                     AMLNPSDSIVDWVLKTVPTMGAGWCPPGMLGIGIGGTAEKAMMLAKEALMEEINMDEL
                     LRRGPENKIEELRIEIFEKVNALGIGAQGLGGLTTVLDIKIKDYPCHAAGKPVGMIPN
                     CAATRHAHFQLDGSGVAHIQAPKLEDYPSVTWDASQSKRVNLDTITQEEMDSWKPGDT
                     LLLSGTMYTGRDAAHKRMVEMIDNGEELPVDLKGKFIYYVGPVDPVRDEVVGPAGPTT
                     ATRMDKFTRKVLEHTGLFGMIGKADRGPTAIEAIKDNKATYLMAVGGAAYLVSKAVRE
                     AEVVAFADLGMEAIYKFVVEDMPVSVAVDVNGTSIHAVAPKIWQAKIGKIPVIDAAAG
                     "
     gene            complement(570678..572822)
                     /locus_tag="ABZJ_RS02710"
                     /old_locus_tag="ABZJ_00523"
     CDS             complement(570678..572822)
                     /locus_tag="ABZJ_RS02710"
                     /old_locus_tag="ABZJ_00523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001092285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acetyltransferase"
                     /protein_id="WP_001092288.1"
                     /db_xref="GI:447015032"
                     /translation="MNTILLIPTGEGVGLTSACLGMIYALDCNGIKAGFLKPFSQVDQ
                     ENLDRTTSLFGHLFQSKTVQSISHEKLTQRIAAGEVDELLEEAVSLHRSIAADNNVII
                     VEGLLPNGQDHFASELNASLAQALDAEVVLVSTADIQNPRKTAEKVEAHLRQFGGATS
                     NRTAGVLFMRTRGLSEETAQIPVAFDPSLRPTEDIAKFTAELQKYNRYFGSSDLPIIG
                     LVPFSNTLSVPRTLDIASVIDGQWINQGEAKTRRILHSSLIASSIEYELNKFIAGELI
                     ISASERTDVLLASSLATSNGIPLAGLVLTEREAPAPKLLEFCQSAIKQGLPILHTHLN
                     TLETAQRLSDFGNEIPTDDTERAEQVTRFVSSHIDVEWLKQHSNNGAIPRLSPSAFRH
                     ELVQKSIAAKKRIVLPEGDEPRTIEAATICQARGIAHCILLAKPEAVHDVAKARGIEL
                     PAGLEIIDPDQIRDQYIAPMVELRKGKLNDLQAKEQLQDTVVLGTMMLALDHVDGLVS
                     GAVHTTANTVRPAFQLIKTAPAYSLVSSIFFMLLPDEVYVYGDCAINPDPTAEQLAEI
                     AIQSADSAKAFGIDPRIAMISYSTGTSGTGADVEKVQQATQIAQQRRPDLLIDGPLQY
                     DAASVESVGRQKAPDSRVAGRANVFIFPDLNTGNTTYKAVQRAANVVSVGPMLQGLNK
                     PVNDLSRGALVDDIVFTIALTAIQAEQQAAAK"
     gene            complement(572866..574068)
                     /locus_tag="ABZJ_RS02715"
                     /old_locus_tag="ABZJ_00524"
     CDS             complement(572866..574068)
                     /locus_tag="ABZJ_RS02715"
                     /old_locus_tag="ABZJ_00524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009500234.1"
                     /note="AckA utilizes acetate and can acetylate CheY which
                     increases signal strength during flagellar rotation;
                     utilizes magnesium and ATP; also involved in conversion of
                     acetate to aceyl-CoA; also known to act on propionate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate kinase"
                     /protein_id="WP_000236000.1"
                     /db_xref="GI:446158145"
                     /translation="MATSVLVINCGSSSIKYALVSERREDRIYGLAENLGAADARIKG
                     ITVGGEPLELSIPYADHAKALETLLARLANYKPQAIGHRVVHGGSLTKAELLTPEIVE
                     RIRAATPLAPLHNPAHLIGIEATMRLFPELPQVAVFDTAFHQTMPAHAYRYAIPKFLY
                     TEHNVRRYGFHGTSHAYVSDRGSELAGKFQKGGWLTAHLGNGSSTCAVWNGQSVDTSM
                     GLTPLEGVVMGTRSGDVDPSLHSFLAKNLGWDLAKIDKVLNNESGLLGLSQLSNDMRT
                     VIEAAENGNEDACLAIEVFSYRLAKSLAALSCGLPSIDGLIFTGGIGENSAYIREKTL
                     AYLPHFGLQLDKDQNNNLKRGTEGRIDSGTGPQIWVIPTDEEGRIAKETRQVVEVSQN
                     TSPEVSLA"
     gene            574831..576684
                     /locus_tag="ABZJ_RS02720"
                     /old_locus_tag="ABZJ_00525"
     CDS             574831..576684
                     /locus_tag="ABZJ_RS02720"
                     /old_locus_tag="ABZJ_00525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752769.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-6-phospho-D-gluconate from
                     6-phospho-D-gluconate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphogluconate dehydratase"
                     /protein_id="WP_000365484.1"
                     /db_xref="GI:446287629"
                     /translation="MDLPNPVLAKVTERVIARSQKTRSAYLQRIEHAQGKFPARGALS
                     CANLAHGFAGMEDNEKLIIKVGREPNIGIVSSYNEMLSAHAPYKTFPDIIKTAARENG
                     GVAQFAGGVPAMCDGITQGNAGMELSLFSRETIAMGTAIALSHNMFDAALCLGVCDKI
                     VPGLLIGALQFGYLPTIFVPAGPMSSGLSNDDKAKIRQQFATGQVGRDALLEAESAAY
                     HGQGTCTFYGTANSNQMLMEVMGLHLPSAAFVHPHTPLRDALTAEAAKRVLDLTAERG
                     NYTPIGHVIDEKAIINGIVALLATGGSTNHTLHLIAIARAAGILIDWDDFDELSAVVP
                     LLAKIYPNGKADVNHFQAAGGVAFLIRNLLEAGLLHNDVTTVAGKGLLHYTKEPKLID
                     GKLTWVDGVVQSLDDKVLRSIDAPFQPDGGLRLMQGRLGRGVIKISAVAPEHRKVKAP
                     AIVFDSQEAVQAAFDRGELHRDFIAVVRFQGARANGMPELHRLTPVLGVLQDQGFHVA
                     LVTDGRMSGASGKVPAVIHLSPEALLNGPIGKVQTGDMLIIDAEAGVLDIELDEQTWQ
                     SRPVAQPEHQAENEVGFGRELFGVFRAAAAPAEHGASVFGALVGEEPQGQI"
     gene            576705..577325
                     /locus_tag="ABZJ_RS02725"
                     /old_locus_tag="ABZJ_00527"
     CDS             576705..577325
                     /locus_tag="ABZJ_RS02725"
                     /old_locus_tag="ABZJ_00527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000034283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphogluconate aldolase"
                     /protein_id="WP_000034283.1"
                     /db_xref="GI:445956428"
                     /translation="MSKIEDVVKLGPVIPVLAFDSAEQGEHVSRALHAGGVKVLEITL
                     RTAAGLAAIERASQLADDIVVGVGTITKPEHCAQAKKAGAKFGVSPGLTKDLHLAAQD
                     AGLPLLPGVMTPSDLIQAIELGYDIVKFFPAQQAGGVEMLKAFYGPFPNLRFCPTGGI
                     TAETAPDFLKQPNVVCVGGSWLTPKPVVAAQDWAEITRLAQIASQL"
     gene            577521..578879
                     /locus_tag="ABZJ_RS02730"
                     /old_locus_tag="ABZJ_00528"
     CDS             577521..578879
                     /locus_tag="ABZJ_RS02730"
                     /old_locus_tag="ABZJ_00528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009518791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_000450961.1"
                     /db_xref="GI:446373106"
                     /translation="METVQGGMLLVYTLIAIVALIVMIAKFRIYPFLVLIIVSLGLAL
                     AVGMPMDGIVKSYEAGTGKTLGHLAIVIALGTMLGKMMAESGGAERIAITLIKWFGEK
                     HIHWAMMFIALIVGLPVFFEVGFVLLIPIAFNIAKRTGKSLLIVGLPMVAGLSVVHGL
                     IPPHPAALLAVQAYHADIGKTIMYSLLVGVPTAVVAGPLYALWINKYVKLPENNPLAK
                     QFVEADANNTRELPSFGITLFTIMLPVALMLVGSWADVFFAPKTFPNELLRFIGTSDI
                     ALLIAVLVSFITFGTMQGFNREQIEKFCGGCLASIAGILLIVGAGGGFGGILRDSGIS
                     NEIVSTALKANLSPLLLGWLVAALIRLATGSATVAMATACSIVAPIAAAAGVVVRPEL
                     LVLATGSGSLIFSHVNDAGFWLIKEYFGMTVGQTLKTWSVLETIISVLGLSFTLLLSA
                     VL"
     gene            578897..579409
                     /locus_tag="ABZJ_RS02735"
                     /old_locus_tag="ABZJ_00529"
     CDS             578897..579409
                     /locus_tag="ABZJ_RS02735"
                     /old_locus_tag="ABZJ_00529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005066143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconokinase"
                     /protein_id="WP_001978744.1"
                     /db_xref="GI:487905278"
                     /translation="MIVIAMGVCGTGKTLIGELLSERLACEFLDGDTLHSAANKSKMS
                     QGIPLTDEDRLPWLQAIRQAIEAKQRDGETAVFTCSSLKRMYRDILRGQDQNVKFVYL
                     KGSYELLQQRLAERSGHFFDPALLQTQLDTLEEPDVNEAIAIDIALTPEQIIEQVIQK
                     LGVTDSVCRG"
     gene            579582..581210
                     /locus_tag="ABZJ_RS02740"
                     /old_locus_tag="ABZJ_00530"
     CDS             579582..581210
                     /locus_tag="ABZJ_RS02740"
                     /old_locus_tag="ABZJ_00530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004794737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_001072699.1"
                     /db_xref="GI:446995443"
                     /translation="MNQLNNLQHKFPVVDGIPESVRLPSQIHQRVSLVDGELKLWAGA
                     TKKTLSPIWIQQPDGSLEQVELGSYPVMGEKESDEALEAAVRAYNNGRGEWPMMKVSE
                     RIACMQNFIQRMVEQRDLIIKLIMWEIGKSLADSEKEFDRTITYMRQTIDALKDLDNA
                     NSRFVIAEGTIGQIRRTPLGVVLCMGPYNYPLNETFATLIPAMLMGNTIIFKPPQFGT
                     LLFEPLLEAFRDSFPKGVINTIYAPGSLVVPHLLASGQINVLALIGSSKVADHLKKQH
                     PKSHRLRAILGLDAKNAAIILPDADLDLTVKECLLGALSFNGQRCTALKMLMVHRSIA
                     DEFVNRLTTELAKLKVGMPWEKGVSITPLPGMHRTAYMTEVIEDAVAKGAKVVNPEGG
                     EFCKTMFYPAVVYPVTEGMRLYREEQFGPVVPVAVYDDIETVLDYVTTSDHGQQVSIF
                     GSDPAQIGHLVDTLVHQVCRVNINCQCQRGPDVFPFGGRKDSAEGTLSVHDALRAFSI
                     RSMIAAKQTDDSKGMLASMVSEHYSKFVNTDFIF"
     gene            complement(581317..582582)
                     /locus_tag="ABZJ_RS02745"
                     /old_locus_tag="ABZJ_00531"
     CDS             complement(581317..582582)
                     /locus_tag="ABZJ_RS02745"
                     /old_locus_tag="ABZJ_00531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017391292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl phosphate reductase"
                     /protein_id="WP_001154159.1"
                     /db_xref="GI:447076903"
                     /translation="MQDSIEQYMQKVGQQARDASRVLTSASTSLKNHALSAIYTALEN
                     NQAAILAANQIDMEKGRSNQLDSALLDRLELTPARFKGMLQGLKDVIALVDPIGEITD
                     LAYRPTGIQIGKMRVPLGVVGMIYESRPNVTLEAASLAIKSGNAIILRGGSEALESNK
                     AIAEAVKHGLKVAGLPEHSVQVIETSDRAAVGHLITMAEYVDVIVPRGGKSLIERVTN
                     EARIPVIKHLDGNCHVFVEAQADLQKALPITLNAKTHRYGVCNAMETLLVDEKIAEVF
                     LPHIAELYAEKQVELRGCPETRRILGTTVKPATEEDWYTEYLGPILAVKVVSGIDEAI
                     DHINKYGSHHTDAIVTENYTLARQFLARVDSSSVVVNASTRFADGFEYGLGAEIGIST
                     DKIHARGPVGLEGLTSQKWIVLGDGQIRQ"
     gene            582882..584195
                     /locus_tag="ABZJ_RS02750"
                     /old_locus_tag="ABZJ_00532"
     CDS             582882..584195
                     /locus_tag="ABZJ_RS02750"
                     /old_locus_tag="ABZJ_00532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002000538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_001084481.1"
                     /db_xref="GI:447007225"
                     /translation="MNSIIQMDSEINQAYAGFGFFDIYHRDSFKQPARTTWIDGWKIE
                     YMAIADPQTIHKTPIVIVGGAFQNFNSYKYCVEQLFESGPVILIDLPSMGANQQITNR
                     DTGISAGTLELPDLSEMLGRWLDIVGIQKVSVMGMSLGSVVASCFAYHRPDLMDRMIL
                     MGVMQKTRKSWRMILEESLKLMQENRMEEFGQAVILYLVNHAKLDKTRMSPTAKKLFF
                     RQMAEFTGTERERYEINCNRLLRLTDVPIPECKTLVAAGQYDSFTLPHENANFALQCP
                     DMEFALIANADHVPQLQRRKETMSLFTSFLKGEPIQNLDGIIPMTREQMQNMERRGEE
                     RIPVLQPKTKLSHRECETEVPVMIIDVTFFGMYLKLDDVAQLEFVNEHPRDLALHLED
                     EEGAFSIECLIFEATEQGVRALFKHGSFELADRLSRFITRQKQAA"
     gene            complement(584250..585092)
                     /locus_tag="ABZJ_RS02755"
                     /old_locus_tag="ABZJ_00533"
     CDS             complement(584250..585092)
                     /locus_tag="ABZJ_RS02755"
                     /old_locus_tag="ABZJ_00533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000191928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000191928.1"
                     /db_xref="GI:446114073"
                     /translation="MTQHLSKHRHISFTAHYTGYIWYQMGISHEALATSKGKSLAYLI
                     HPLESWAEKYVGGSMRTTLKQRHTMLDHDLEKLIQENPDLQVLEIACGLSPRGWWFRQ
                     HYPSISYRELDLPDMAHTKQNALQQIEKNAPEVLSVDLFTEAFAQAFEVFDSNRPLVV
                     ISEGLINYFDKDLLKQLIQSIAHYGASFKKLHYLTDLYPEPVKNKLASIIWNSSKLLK
                     LMSRSSFSFHFKTPLEVKDFFKDAGFSQVNVEQPQIFFGQVSKNSDEEHLGDLVWTIH
                     TQLK"
     gene            complement(585177..586196)
                     /locus_tag="ABZJ_RS02760"
                     /old_locus_tag="ABZJ_00534"
     CDS             complement(585177..586196)
                     /locus_tag="ABZJ_RS02760"
                     /old_locus_tag="ABZJ_00534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004883307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-hexosaminidase"
                     /protein_id="WP_000578588.1"
                     /db_xref="GI:446500734"
                     /translation="MIGALMLDIAGTELTQEDIELLQAPQVGGMILFARNIESPQQVR
                     ALTDHMRQVRPDILIAVDQEGGRVQRLKSGFTLLPAMGRFGELYITQPQKALELAEQC
                     GWLMATEVLAVGIDFSFAPVLDLNAISDVIGDRGFSKNIEDIAPLAGAFMRGMKKAGM
                     ANTGKHFPGHGSVKADSHVAAAIDSRSYDEIYNHDMQSFIKLMPELDALMPAHVIYDQ
                     VDPNPAGFSPFWIQEVLRNRLKFNGVLFSDDLSMQAACVAGGADARIQAALAAGCDMG
                     LVCNDRSAACTALDGITNLELPNQERLERMRGRIPQIQVGETLSLGNDWQAVKTAIEE
                     FKNSL"
     gene            586389..588572
                     /locus_tag="ABZJ_RS02765"
                     /old_locus_tag="ABZJ_00535"
     CDS             586389..588572
                     /locus_tag="ABZJ_RS02765"
                     /old_locus_tag="ABZJ_00535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S41"
                     /protein_id="WP_000776304.1"
                     /db_xref="GI:446698958"
                     /translation="MKLQTIACAVAIATGGLFFSHTMNEARAATNTAAVSQSIQPTQE
                     QALVARQLATLVDRQHYLNMRLDANTSNRILDMYLDSLDPDHSLFLDAEVQNYKKLYG
                     SNFGASLKAGNLTGPFAIHQQYRERLKQFYEFMLAELKKPQNLKQPNTFIEVDREKAP
                     YFKTSAEQQNHWRKMLVSQLINLTISREEEQAKQKALKENPSLADGQDLTGPEDLTPA
                     QTLTKRYTRQLERISRVKSDDVLDKTLNAMLATYDPHSNYYPPIDAIELNRQTTLQLE
                     GIGVSIRPERGNEDYTKIETIVEGGPASKSGQVKSGDRIVGVAQEGGKMVDVVGWSSS
                     EIVGLIRGKRGTKVTLKLLGAGASMSQARNVTLVRDVIQEEDAGVRSRTVEVTRDGKK
                     HLLGVIEIPSFYFDYRSRRAGQQYRSVSEDTANAFEALKAKKVEGIIIDLRNDPGGSL
                     EEVARMLGQVIKSGPVVQIRDGNGNVSVFEDNDGGQQIYTGPLAVLVNLASASASEIY
                     SAAIQDYERGIIIGSTTTGKGTAQVQLDTLAYGQATLTQRKFYRVTGGSTQNKGVVPD
                     IKLVDIYNEEFGERKSKNALKWDTIPTAPFKREGSVQPYVAKLSQLSEQRVAVDPQFK
                     YLNKRTAIAKVTSDQKQVVLDIDKRRAELLSLEKQTLDAENERRIATGQKPFPNWESY
                     QASLDALAESRAKMKANQRPALPEEETFVNEAANVLMDYAKLQNR"
     gene            588723..590009
                     /locus_tag="ABZJ_RS02770"
                     /old_locus_tag="ABZJ_00536"
     CDS             588723..590009
                     /locus_tag="ABZJ_RS02770"
                     /old_locus_tag="ABZJ_00536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_001162111.1"
                     /db_xref="GI:447084855"
                     /translation="MQGSYATALLKQQQLPESFQFYFKQKQHLSNTQELHQLHELVRP
                     RLKIAIVTETWPPEINGVALSLLQLCQGLQKQGHKILLVRPEQKAKCHDFLPEQECLV
                     MSQAIPKYPTLQFGWPQYLKVSKAFEKFVPDVVHIVTEGPLGLTAMQAAKAKNIPVSS
                     GFHSPFQDFSRFFDLAFLVKPIQKYLCWFHNNTQVTCVPSKDTEEALRGFGITCPLVV
                     VGRGVDTTRFSPKHRSESLRQQWGVDSNTRVMLYVGRLSPEKEVQLIVESYAAMQNIQ
                     QQKTKLVVVGDGPDLARLKALPEAKNVIFTGSLRGHDLAVAYASADVFVFASQVETFG
                     NVVLEAMASGLPVIAYDYACAHQYLIHGVNGWLSPLGHKNHFIQQIYQLPSIQQLREM
                     GIQACHKVQQSGWQLPVQQLEQAFYQVVKEPSADFT"
     gene            590034..590585
                     /locus_tag="ABZJ_RS02775"
                     /old_locus_tag="ABZJ_00537"
     CDS             590034..590585
                     /locus_tag="ABZJ_RS02775"
                     /old_locus_tag="ABZJ_00537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017724795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerophosphatase"
                     /protein_id="WP_000669567.1"
                     /db_xref="GI:446592221"
                     /translation="MKFKNAKIKILDLDLRGCLYLNNFSHSQRVALFFKIISRAGDGP
                     FWYLMLAIVWGMQGITYSLQIIYLLLGGSVGTAIYKFLKHKTTRPRPYQVHQVIVLGE
                     RPLDHFSFPSGHTLHAVMVTIVLGYIQPVLLAAMLPFMVLVALSRMVLGLHYPSDVIV
                     GALIGAAVASLIIFVAPLLSIAL"
     gene            590685..590885
                     /locus_tag="ABZJ_RS02780"
                     /old_locus_tag="ABZJ_00538"
     CDS             590685..590885
                     /locus_tag="ABZJ_RS02780"
                     /old_locus_tag="ABZJ_00538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000524328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000524329.1"
                     /db_xref="GI:446446474"
                     /translation="MGLRWTDTIDIAIELSEAHPEVDPQWIRFTDLHAWVCALPDFSD
                     DPNKSTEGLLEAIQMAWLDEVR"
     gene            590999..591430
                     /locus_tag="ABZJ_RS02785"
                     /old_locus_tag="ABZJ_00539"
     CDS             590999..591430
                     /locus_tag="ABZJ_RS02785"
                     /old_locus_tag="ABZJ_00539"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B7H073.1"
                     /note="catalyzes the formation of nucleoside triphosphate
                     from ATP and nucleoside diphosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="WP_000963851.1"
                     /db_xref="GI:446886595"
                     /translation="MAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQ
                     ADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGT
                     IRADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR"
     gene            591553..592785
                     /locus_tag="ABZJ_RS02790"
                     /old_locus_tag="ABZJ_00540"
     CDS             591553..592785
                     /locus_tag="ABZJ_RS02790"
                     /old_locus_tag="ABZJ_00540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000093081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S rRNA methyltransferase"
                     /protein_id="WP_000093084.1"
                     /db_xref="GI:446015229"
                     /translation="MSSAVVVSSENLDGQQQSSSTPASPAAEKVNLLGMSRAELEKFF
                     EDIGEKKFRAGQVMKWIHQYFVTDFAEMTNISGKLRAKLEQICEIKAPEVVHRHYSKD
                     GTRKWVFRVGEGSGSLVETVLIPAEDKTGSRKTLCISSQVGCALDCSFCSTGKQGFQR
                     DLTPDEIIGQLWMANYSYMEEVPVAERERSVTNVVMMGMGEPLLNYDAVLSSMHIMLD
                     DFAYGMSKRRVTLSTSGVVPKIDQLAKDIDVALAISLHAPNDELRNELVPINKKYPLA
                     QLIAACQRYIAKDGNESARKHVTIEYVMLEGVNDQPEHAQQLLKLLKNLPSKINLIPF
                     NPFPHAPYGRSSRNRIISFQKTLSDAGFVCTIRQTRGDDIDAACGQLVGQVADRTRRA
                     EQWQKKVAQRQEILRTQG"
     gene            592834..593601
                     /locus_tag="ABZJ_RS02795"
                     /old_locus_tag="ABZJ_00541"
     CDS             592834..593601
                     /locus_tag="ABZJ_RS02795"
                     /old_locus_tag="ABZJ_00541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000882433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilW"
                     /protein_id="WP_000537695.1"
                     /db_xref="GI:446459841"
                     /translation="MGVAVALLTSGCQTSQTVKKDPEKAVKVRTQLAAEYIRSGDLDS
                     AKRSLDQALSVDSRDATANMMMGILLQQEGSKPNLEKAEHYFKRAISSEPDNAQARNN
                     YGTYLYQMERYNDAIEQFRIAGATLGYDQRYQALENLGRIYLKLGDIASAEKTFKQAL
                     LANRDSYISMLELAEIFYLQQQIPAATQMYEQYVRTVGQKNQGARALWIGLRVARANA
                     DKMGMQVLVNQLRALFPESPEYQRYLQLQYSTEAVWK"
     gene            593592..594383
                     /locus_tag="ABZJ_RS02800"
                     /old_locus_tag="ABZJ_00542"
     CDS             593592..594383
                     /locus_tag="ABZJ_RS02800"
                     /old_locus_tag="ABZJ_00542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000405160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_000405164.1"
                     /db_xref="GI:446327309"
                     /translation="MEINPNSQQPTGSSLPTSALGNIQRPGEYLRQIRVSQKKELEQV
                     SSDLNMPLKTLNALEQDDYKSLPEATFIKGYYRSYAKYLNTDATAIIQRFDEIYANDT
                     GLLPNHALNNSPIKIMGKLPGSNSDRNKKWLKRALLAILIIAVVSLIVMGVQKWTSNK
                     GDAELPKANQSNVEVLPMKGNTSATAGDQLVLNFNRPTSVHIVDATGKVLATGRQAST
                     LTLNGESPFQIRLDDATAVSLSLNQEQISLSPYTVNGKAEFRLSR"
     gene            594405..595520
                     /locus_tag="ABZJ_RS02805"
                     /old_locus_tag="ABZJ_00543"
     CDS             594405..595520
                     /locus_tag="ABZJ_RS02805"
                     /old_locus_tag="ABZJ_00543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017388396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase"
                     /protein_id="WP_000572095.1"
                     /db_xref="GI:446494241"
                     /translation="MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATV
                     AQIERCVDAGADIMRVSVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGAD
                     CLRINPGNIGSDQKVREVVAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESA
                     LRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVK
                     SAIALGGLLMEGIGDTMRISLAAEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQE
                     FNVIQVMQALEERLEDIRTPMDVSVIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEK
                     SHLIDTNQLVDEIETMVRQRVQELEEAKSKEIIRSSS"
     gene            595517..596809
                     /locus_tag="ABZJ_RS02810"
                     /old_locus_tag="ABZJ_00544"
     CDS             595517..596809
                     /locus_tag="ABZJ_RS02810"
                     /old_locus_tag="ABZJ_00544"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2I3E6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="WP_000095264.1"
                     /db_xref="GI:446017409"
                     /translation="MSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPI
                     VEQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCVRALVEHNLLRGA
                     TPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIEAEVILMTARLWKRMGVAH
                     MVQLELNTLGEKEERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQK
                     ILENAPKLYDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTA
                     LGSQGTVCGGGRYDGLVGQLKGKADQSVPAVGFGMGMERLLLLIEQVEQAEIVRDCEA
                     FLVAEPAYQSKALVLAEQLRDQLEAANSNIRIKTGSQGSMKSQMKKADQAGAVYAIIL
                     GEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK"
     gene            596838..597536
                     /locus_tag="ABZJ_RS02815"
                     /old_locus_tag="ABZJ_00545"
     CDS             596838..597536
                     /locus_tag="ABZJ_RS02815"
                     /old_locus_tag="ABZJ_00545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000058787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000058788.1"
                     /db_xref="GI:445980933"
                     /translation="MSLSDEEQFDSLKSFAKKYGSAMISGILIALIAFFGWEYWQKRN
                     LATSQTETAKVQQLMDEANATADNPNALASITASADKIVKDDIDSVQAIQTQFVLAKL
                     AYEKQDYAAAEKALKKVENSKVKDEGLIQVVKLRLADAQLAQNKYDEALKTLSGDVDP
                     AFKATVEELRGDIFVAKKDIDSAKKAYQAAWDSLLERKQERQILQIKLESVGVLVEDP
                     QIERPILETQVEES"
     gene            597536..598681
                     /locus_tag="ABZJ_RS02820"
                     /old_locus_tag="ABZJ_00546"
     CDS             597536..598681
                     /locus_tag="ABZJ_RS02820"
                     /old_locus_tag="ABZJ_00546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004794711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001072119.1"
                     /db_xref="GI:446994863"
                     /translation="MNQKFKLPLAIAIASAVLVGCSSNKVKEAKPNPLPKLTESNKSL
                     VPVFSRSVSSTNKADPLRLQLDASEGVVFTLDPKGEVAAYRGKQRLWEKKVSKLGLSS
                     GVEAAEGIVVVGNSKGQLFALDQATGEQKWTAQLSGALLSPSLVQSGRVITIANDGTV
                     FAHDVSSGQQVWAYKLPNVQFSLRGQPSPVSLDPRTVLIASANAYVYAIDTISGIPRF
                     QRRVAVSEGRSDIQRLIDIDGDPVVAGQLMVTTSFQGQVTVTDLASQRVVWSEDSSST
                     KRPEVYDNKVFVSSTDGKLTAYDLTTGEQLWQNDSLLNRHLSNPVVLGSDLIVGDLDG
                     VLHLIDPTTGKLIGRSKTSGEVNTLRVIENQLYVSTRKGDLSIWQNR"
     gene            598869..600278
                     /locus_tag="ABZJ_RS02825"
                     /old_locus_tag="ABZJ_00547"
     CDS             598869..600278
                     /locus_tag="ABZJ_RS02825"
                     /old_locus_tag="ABZJ_00547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated GTPase EngA"
                     /protein_id="WP_000805592.1"
                     /db_xref="GI:446728279"
                     /translation="MKPVIALIGRPNVGKSTLFNQITKSRDALVADFAGLTRDRKYGD
                     ATYQNKSFIVVDTGGIGESEGGIDNYMAEQSKTAINEADIIIFVVDARAGLLASDEQI
                     ARELRTLGKKIYLVANKVDGVHAEAALVEFYKLGMGEPLQVAASHGRGVQQMLEDVLQ
                     DIPEDENPEEHDKDTGLRLAIIGRPNVGKSTLVNRLLGEDRVVAFDQPGTTRDSIYIP
                     FEREGRKYTLIDTAGVRRKGKVDEMIEKFSIVKTLQAMKDAHVVVVVVDAREGIVEQD
                     LHLIGYALEAGRAMVIAINKWDNMSEYDRKQCKLDVERRFDFIPWARIHLISALHGTG
                     VGELYPSIHRAYESANLKVSPAKLTQILNDATDQHQPPTVQGRRIKMRYAHMGGQNPP
                     TIVIHGNKVDKTPADYRRYLENVFRKVYKLEGTPVKIEFKTSENPFEGRKSQVDERTA
                     ARRRRYIQKFKKAEKKFKR"
     gene            600475..601089
                     /locus_tag="ABZJ_RS02830"
                     /old_locus_tag="ABZJ_00548"
     CDS             600475..601089
                     /locus_tag="ABZJ_RS02830"
                     /old_locus_tag="ABZJ_00548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005044852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl synthase"
                     /protein_id="WP_000258012.1"
                     /db_xref="GI:446180157"
                     /translation="MVTLHLAHLTLTHAQPSYAALECIPAMQRRRLSPLAKLALNTAI
                     SSLDGRSADYIVWVSKYGDEAKTLNILQDVLNDQTPSPTQFSTSVHNAISGLYSILCQ
                     DDTPSTSLSCSWTEGLIEAYALLKSMPEIKRVLVVAYDEPLPNIYAEAINFPAYAMAA
                     VVTLEQPNLQITAWTHTDEADAPAFAHFWQDADQLTSAFGWNKC"
     gene            601083..601877
                     /locus_tag="ABZJ_RS02835"
                     /old_locus_tag="ABZJ_00549"
     CDS             601083..601877
                     /locus_tag="ABZJ_RS02835"
                     /old_locus_tag="ABZJ_00549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014208347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_000933374.1"
                     /db_xref="GI:446856118"
                     /translation="MLNLKNLKQKSNYCWRVAATGFSFASFGLGGIAIASVIAPVLNA
                     TTSDPQKRQQRAQNVIKHSFKGFTDMMVKLGIMTYSVEGLEKLQNSRQELVIANHPTL
                     IDVVVLIGMMQQANCVVKQSLWSNPFTKGPVQSAGYILNAGSQQFVEDCVKRLKENNA
                     ASLLIFPEGTRTEKGMTLNEFQRGAANIAIRANVPIRPVIITCTPSTLTKNEKWYHVP
                     SQPFHIEVKVLDAVQVSDLLDDLTVGPKQVRQLSRSFYKIFDEELS"
     gene            601879..602139
                     /locus_tag="ABZJ_RS02840"
                     /old_locus_tag="ABZJ_00550"
     CDS             601879..602139
                     /locus_tag="ABZJ_RS02840"
                     /old_locus_tag="ABZJ_00550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009390745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_000067033.1"
                     /db_xref="GI:445989178"
                     /translation="MSNLADELKQMIIDVLALEDITIADIDTEAPLFGEGLGLDSIDA
                     LELGLALKKRYNIHLNAESDETKQHFKSIQSLVALVEAQQKS"
     gene            602151..602399
                     /locus_tag="ABZJ_RS02845"
                     /old_locus_tag="ABZJ_00551"
     CDS             602151..602399
                     /locus_tag="ABZJ_RS02845"
                     /old_locus_tag="ABZJ_00551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000951071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_000951071.1"
                     /db_xref="GI:446873815"
                     /translation="MLSQEQVLTKLREWMEDLFEIEPETVQLDSNLYSDLDVDSIDAV
                     DLVVKIKELTGKQVKPEDFKNVRTVLDVVTVIQNMTAE"
     gene            602396..602950
                     /locus_tag="ABZJ_RS02850"
                     /old_locus_tag="ABZJ_00552"
     CDS             602396..602950
                     /locus_tag="ABZJ_RS02850"
                     /old_locus_tag="ABZJ_00552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000125719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000668777.1"
                     /db_xref="GI:446591431"
                     /translation="MKFILKGIMTALFVLYPFIVGWSLSHGQFVWVSALLIGLGVIRL
                     FSKGNSLLWPLTGFAIVCGSLSLLSHDHAWLKLYPVGMSLGALIIFALTLIKPPSMIE
                     RFARLVEPDLPASGVQWTRQVTKVWCVFFFCNALIALSTVLFTSTQVWVIYNGFISYV
                     LMGILFLGEFILRKRHQRLHSSNH"
     gene            602960..604618
                     /locus_tag="ABZJ_RS02855"
                     /old_locus_tag="ABZJ_00553"
     CDS             602960..604618
                     /locus_tag="ABZJ_RS02855"
                     /old_locus_tag="ABZJ_00553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017816400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_000271578.1"
                     /db_xref="GI:446193723"
                     /translation="MYCHFQKFIDSAQPLCIDGTLNSTSFNQFWQDVALQAAAIAQME
                     NLTWALWEADSYEFLVLFFAALLAKKQILLPPNRVRELEQDFSAQQIYFLKRQEIGEV
                     VPLSLTLDDTFLEQAQLYFYTSGSTGEPKKIPRTLRQLLNEVQGLSQSFSFDEHATAI
                     ATVSHQHIYGLLFKLLLPLARGRSFYNPQMAFPEDVVQAQKQLETMGLSNYLISSPAL
                     LKRWTTDVVLQHCQMVFSSGGKLESDVRPLLNRPIIEVLGSSETGGIAHRAKDEDAWT
                     AFSNVAIRIEDQQLMVKSNHAYENDWITTGDGAAWTDATCQIFKLLGRTDRIVKLEEK
                     RLSLDAIEQSIQALDVVKQCHVLVFEHEQRQMLGCIVVLTEQAREQLQQQGKSAFVSH
                     LKQQLKDGLETIAIPRQWRFLSQLPQNTQSKLNKNYLKTLFKPMLQPVVLSQSQNSDD
                     HIWELEFPPELACFKGHFPTQPIYPGVGQIGFLQHFAKSIWSDLSWCQGYEQLKFQNL
                     IRPYAVVQLKLARKEHKVSFELRDSEHILASGRLLFALQTEVED"
     gene            604621..605361
                     /locus_tag="ABZJ_RS02860"
                     /old_locus_tag="ABZJ_00554"
     CDS             604621..605361
                     /locus_tag="ABZJ_RS02860"
                     /old_locus_tag="ABZJ_00554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017816399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_001191645.1"
                     /db_xref="GI:447114389"
                     /translation="MQSNYGFVVPVYNHPHYLADLISYLDSFHLPIVLVNDGSDDACS
                     QILKALAEQYSQIHLIEHEVNKGKGQAVMTGLRAAYELGLSHALQLDSDGQHCWDDIP
                     KFIEQSHQHPDAMVIGQPYFDASIPKKRLYGRYITHFWVWLNSLSFEIKDSMCGFRVY
                     PLESTIKVLNSAKFQPRMGFDSEILVRLKWENTPFINVPTPVVYPEQGISHFHAWRDN
                     LGLSKAHATLFMGMLIRLPKLLKQKLQG"
     gene            605364..606290
                     /locus_tag="ABZJ_RS02865"
                     /old_locus_tag="ABZJ_00555"
     CDS             605364..606290
                     /locus_tag="ABZJ_RS02865"
                     /old_locus_tag="ABZJ_00555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002017237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_000132215.1"
                     /db_xref="GI:446054360"
                     /translation="MTDSASPKWNDIKERGGMLPLMLMLWFYRFGGRWLCKLVMYFVI
                     MWYWLFATTARQASLLYLQKLHHFAGSKSPFNYQPNWSNSYAHFMQFGECILDKIEGW
                     LGNIPEQELQVFGHENFSQHYQKGALIIVSHFGNIELLRAIKSEHPQKINVLVYQKHA
                     TKFNEFLKKINDKADVCLLSVDELGIETAMLLQDKMQQGEWVIVAADRVPVQSDRVQH
                     VDFLGESAAFPQGAWILANLLKVPVIAVFCYRVQQQFQVHIHSIAEQINLPRANRIES
                     MQTITKTYVAVLEQHCLRAPYQWFNFYNFWTK"
     gene            606292..607827
                     /locus_tag="ABZJ_RS02870"
                     /old_locus_tag="ABZJ_00556"
     CDS             606292..607827
                     /locus_tag="ABZJ_RS02870"
                     /old_locus_tag="ABZJ_00556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001265373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="WP_001265376.1"
                     /db_xref="GI:447188120"
                     /translation="MRVLTVGEQPLSIEDVVSVARGECQVALPETSEWRELIQKGADF
                     LDQLLEEEGVIYGVTTGYGDSCLVEVPLHQVNELPLHLSRFHGCGLGENLDVITARAV
                     VVTRLCSLARGYSGVSIALLERLVWLLNENVIPVIPSEGSVGASGDLTPLSYIAGTLV
                     GERDVYIDGQIVPVAQVYAEKNMLPLTLRPKEGLALMNGTAVMTAIACLNYKKAEQIA
                     LASTLITALNVLALEGNPSHFDEVLFAQKPHPGQQHIAKQLRDWLNSEVQTAHQSPRL
                     QDRYSLRCAPHIIGVFEDSKVWLRQFIENELNSSNDNPLIDPVGMRVLHGGHFYGGHI
                     AQAMDSLKIMIANIADLMDRQIAQLVDHKMNHGLPRNLTGATAERLPLNHGFKAVQIG
                     VSAWTAEALKNTLAASIFSRSTECHNQDKVSMGTIAARDASRVITLTQQVIAALCCAS
                     VQAIHLKGLTTQLSPTLQTFMQWTLQSFAFVEEDRPLQTELQQIVNRLDQLELFNQPE
                     FMG"
     gene            607837..608265
                     /locus_tag="ABZJ_RS02875"
                     /old_locus_tag="ABZJ_00557"
     CDS             607837..608265
                     /locus_tag="ABZJ_RS02875"
                     /old_locus_tag="ABZJ_00557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003654902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_000542808.1"
                     /db_xref="GI:446464954"
                     /translation="MHADVIIEIPFHDVDTMNVVWHGHYLKYFEIARCKLLDQFHYNY
                     MQMKESGYAWPVIESHVRYAYGIEFEQKIRVRAILKEWENRLKIDYLIFDAESGKRLT
                     KGYTTQVAVNIEAREMCFQSPQVLFDRLNAWSEFQPKRNA"
     gene            608265..608894
                     /locus_tag="ABZJ_RS02880"
                     /old_locus_tag="ABZJ_00558"
     CDS             608265..608894
                     /locus_tag="ABZJ_RS02880"
                     /old_locus_tag="ABZJ_00558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000032762.1"
                     /db_xref="GI:445954907"
                     /translation="MSKFIKTLGLGAAVWMSSLSAVYAAPTQIIQIFQQLSQSPTVRA
                     DFEQQKKLPSLNKTFVSNGSLLFSKSYGVAWQIKRPVQADLIVTPTKLVQKTQRTFSQ
                     IQVDQSPYSSVATLFLQLMSGNEQALAKNFNVVSANYSPAGWSMSLTPKSSLFKKLFV
                     RVDAQGQQYVNQIVITEKANNLTTIRFSHQTSQPTTLTAAEHAIFQLAK"
     gene            608869..611184
                     /locus_tag="ABZJ_RS02885"
                     /old_locus_tag="ABZJ_00559"
     CDS             608869..611184
                     /locus_tag="ABZJ_RS02885"
                     /old_locus_tag="ABZJ_00559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017816395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001212574.1"
                     /db_xref="GI:447135318"
                     /translation="MRFSNWQNKFTALWLIALLLVAVGLGVTWLNKDIHIQTNIFALL
                     PKVQQDPELARTQQYMNEQLNNKVFVVVDAKDEAAIQQATHFLKAQAKQSALWQPLKP
                     QLDFDQFAKQLYQHRAGLLSTQDQALLQKKDYAALTEQSLMQMMSPGMPVTAESLKQD
                     PLLLFPRYAMQLATPSQQDIEMEQGFATIHHEQGISRLFVLQLTQSPYNIDYQEQTST
                     WIEQTKQKLAAMGLKSHWTGTILFSNFGTQSAKQEISTIGVGSTLGLIFLVWFGFRSL
                     RPLATEFIAVSTGSFVAFAVTHWVFGEIHLMTLVFGASLIGVCVDFSFYFMAMQSQHR
                     KLGGFQILKPLLPSLFMGLMTTLVAYIFLSFTPFPGFKQIAVFSIVGLTAAWISSVLL
                     LPRLPALNAQPAIQALSWIGQARLWFQQRTKVRSGLIAIILAVGTSSLFYLKSNDDIR
                     NLQGMDASLKLQDQAVREQFGQQQSSDYFVVRAASANEMQQQEQQLIGQLQQLQTNGK
                     ISAFQALGQWVPPLAEQQNNLQLLRNIPKATLQQYAQSMGLNVTDVLQWQQQLAAQPL
                     LDFSVFKDHPLAFLQPQANERLVMVTGVKQPDALKQLQNEHIHFQQPITAMSQMFAEH
                     RVQAQHLLIYALIGLAVGLALIYGLSSIVPLVLPVSLALLSTFAVQAWLGVEINLFSI
                     MATFLIIGIGVDYAIFYRHGHDHPQVVGMALFLCMMSTLLGFGLLSFSHTYAIHCFGL
                     TVLFGVIFSFIYATLLTPADEKHIVNLQDHS"
     gene            611214..612509
                     /locus_tag="ABZJ_RS02890"
                     /old_locus_tag="ABZJ_00560"
     CDS             611214..612509
                     /locus_tag="ABZJ_RS02890"
                     /old_locus_tag="ABZJ_00560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017391273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_000103766.1"
                     /db_xref="GI:446025911"
                     /translation="MSTIEKIDVVIIGAGPSGSSAAALLRKKGYTVTVIEKQHFPRFS
                     IGESLLPQSMVFLEEAGLLETVREHVEQYAFQFKNGAAFLRGKQRSFYDFTEKFTDGP
                     GTTWQVRRADFDDLLAKQAQAYGADIRFGHEVLDVDVASEQPVLTVLDKEQQRYKIQT
                     KFLLDASGFGRILPKLLDLESPSNFPVRRALFTHIEDGITDDPEFDRNKILITVHEKD
                     HRAWYWLIPFADGRASFGVVAEQDFFDKYMVENAEDNEPEAMFKRILADEPSLSHVLR
                     RAKFDTPVRTLVGYSANVKHLAGHNYALLGNAGEFLDPVFSSGVTIALKSSSLAVPLV
                     ERVLQGQQVDWLEEYEKPLRRGIQVFRAYVESWYEDEFQDVVFSQNQNEGIRRMISSL
                     LAGYAWDEKNPIHKNAKRRLSTLAEYCREGLAQEQVLEG"
     gene            612512..613057
                     /locus_tag="ABZJ_RS02895"
                     /old_locus_tag="ABZJ_00561"
     CDS             612512..613057
                     /locus_tag="ABZJ_RS02895"
                     /old_locus_tag="ABZJ_00561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009390803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001189187.1"
                     /db_xref="GI:447111931"
                     /translation="MQRKWATILLSSLIFLNGCQIMPHAKGLQSPLWQAQTYQRQDQV
                     EVQWKQQSFSFLLYQQQKGAVLDMVALSLTGQQLFKLQFDGHRVHVEQRIDQMRLLPF
                     EFVVRDLLFATYPQFSHLGQQAVEMKQQADKQVVYIEKQPVLQLKQGQGSIELINEQV
                     PYTMMLSSIENTLQTEESPTP"
     gene            613054..614256
                     /locus_tag="ABZJ_RS02900"
                     /old_locus_tag="ABZJ_00562"
     CDS             613054..614256
                     /locus_tag="ABZJ_RS02900"
                     /old_locus_tag="ABZJ_00562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000681797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_000681797.1"
                     /db_xref="GI:446604451"
                     /translation="MKHLPSENAAPMAVGIQFSVGLSALGCELNQIKQALQQPQQTLS
                     LRDDLIADRDVWVGQYTHPLCSSVPDAMRSVDSRNLRFALTALSKIETELKAYTASFE
                     NKRLAIVVGTSTSGIADNELLLKQYFQGQTDLSISHYPQEMSCLAKALQQYLGWEGPA
                     YTISTACSSSAKALAAGQRLLHADLADVVLVGGVDTLCKLTLNGFNSLESLSAHICQP
                     CGISRDGINIGEAAAFFVLSKEQAPVMLMGAGETMDAWHISAPHPEGKGAALAMQRAL
                     DMAHISAQEVGYINLHGTATPQNDAMEIKAVRQVFGVYQVALSSTKHKTGHCLGAAGA
                     IEAFICEQVLKDQSWLPLHQNVEIDPDLVDQNYVQEAELTQPIRYVMSNSFAFGGSNI
                     SLVFGVKP"
     gene            614256..614681
                     /locus_tag="ABZJ_RS02905"
                     /old_locus_tag="ABZJ_00563"
     CDS             614256..614681
                     /locus_tag="ABZJ_RS02905"
                     /old_locus_tag="ABZJ_00563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014208359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxylacyl-ACP dehydratase"
                     /protein_id="WP_000762338.1"
                     /db_xref="GI:446684992"
                     /translation="MKLDAIQYIPHEQPMVFIDHLTEVAEGRAQAELTITPELMFCEA
                     EGLPTWASIEIMAQTISAYSGWQGQQSKQAPKVGFLLGTRKLNLPIPYFSLGSQLIIQ
                     IEQQYFHEGLGQFSCEIQYAEHCIQATLSVFEPTESPFE"
     gene            614717..615430
                     /gene="fabG"
                     /locus_tag="ABZJ_RS02910"
                     /old_locus_tag="ABZJ_00564"
     CDS             614717..615430
                     /gene="fabG"
                     /locus_tag="ABZJ_RS02910"
                     /old_locus_tag="ABZJ_00564"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014648836.1"
                     /note="Catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_031944513.1"
                     /db_xref="GI:690969603"
                     /translation="MLVTGSSRGIGKAIALQLAKAGFDVTVHARSRQAEAEQVVQEIQ
                     ALGQNSHYLMFDVNERQTVQQILEQDVEQHGGFYGVVLNAGLTHDGAFPALTDQDWDE
                     VISTSLDGFYNVLKPLIMPMIHLRKGGRIVTLSSVSGIMGNRGQVNYSAAKAGLIGAT
                     KALALELAKRKITVNCVAPGLIETEMVTDEVKEHALKMIPLQRMGQVDEVASVVKFLC
                     SDEASYVTRQVISVNGGLI"
     gene            615430..616656
                     /locus_tag="ABZJ_RS02915"
                     /old_locus_tag="ABZJ_00565"
     CDS             615430..616656
                     /locus_tag="ABZJ_RS02915"
                     /old_locus_tag="ABZJ_00565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003654919.1"
                     /note="FabB; beta-ketoacyl-ACP synthase I, KASI; catalyzes
                     a condensation reaction in fatty acid biosynthesis:
                     addition of an acyl acceptor of two carbons from
                     malonyl-ACP; required for the elongation of short-chain
                     unsaturated acyl-ACP; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_000832751.1"
                     /db_xref="GI:446755495"
                     /translation="MKRVVVTGMAGITSLGETADDIFARFEAGKSGIRYMPEWEQYVD
                     LRTKLAGPVETFHIPKHFNRKVTRGMGRVALMSVVCAETALQNAGLLGHEILSSGEAG
                     VAFGSSAGSVDAVGEFASMLLHQSMSKINATTYIRMMAHTSAVNMTVYFGLKGLTLPT
                     SSACTSGSMAIGQAYEAIKYGKQQVMIAGGAEELSAAGAAVFDVLFATSGMNDQPEKT
                     PRPFDAKRDGLVIGEGAGCLILEEYEHAKARGAHIYAEVIGYGSNTDGQHVTRPESEM
                     MGRCMELALKDASVEAKDIAYVNAHGTSTDQGDVAESQATAKVLGYKPISSLKSYFGH
                     TLGACGAIEAWLSIEMMNRGRFIPTLNLDEIDSLCGELDYIVQQPRNLDADIIMSNNF
                     AFGGINTSLIFKRVKQ"
     gene            616668..617102
                     /locus_tag="ABZJ_RS02920"
                     /old_locus_tag="ABZJ_00566"
     CDS             616668..617102
                     /locus_tag="ABZJ_RS02920"
                     /old_locus_tag="ABZJ_00566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013198963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000932716.1"
                     /db_xref="GI:446855460"
                     /translation="MLNKKLLFVAMLSAGFTATVQAGDEVHQLNFKEAVDRAVADGTL
                     DGSVKFYLKGTKSGGKIIQKDAVTNKKTNGFGKSAATSCDWVLRSALIQMQNNAKAQG
                     ANAVTNIVSYFKANETTSTTTYDCYKGAMMAGVALKGDVVKF"
     gene            617127..617783
                     /locus_tag="ABZJ_RS02925"
                     /old_locus_tag="ABZJ_00567"
     CDS             617127..617783
                     /locus_tag="ABZJ_RS02925"
                     /old_locus_tag="ABZJ_00567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016144320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACP synthase"
                     /protein_id="WP_000044274.1"
                     /db_xref="GI:445966419"
                     /translation="MSKRKIEVYTQALSQLLLKSKQDFPDFRSFNHYKKQQIQSVRNR
                     LIAEKLQFNSTELEFAKHEHGKPYLLNHTLHFNHSHSQQYYALAMSEHVKDIGVDVEE
                     LDRKVRLDSLAQHAFHPDEYATWQSLEQDREYWFKVWTTKEAVLKASGLGIRLDLNTL
                     NTQAHPTNHGGLCSHELIGTFAYQNFVLGNMILTVAWRSEQSCRGFQFPSIQIHSLDR
                     "
     gene            complement(617852..618310)
                     /locus_tag="ABZJ_RS02930"
                     /old_locus_tag="ABZJ_00568"
     CDS             complement(617852..618310)
                     /locus_tag="ABZJ_RS02930"
                     /old_locus_tag="ABZJ_00568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016139275.1"
                     /note="molecular chaperone that is required for the normal
                     export of envelope proteins out of the cell cytoplasm; in
                     Escherichia coli this proteins forms a homotetramer in the
                     cytoplasm and delivers proteins to be exported to SecA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecB"
                     /protein_id="WP_001288260.1"
                     /db_xref="GI:447211004"
                     /translation="MSEEQQVQPQLALERIYTKDISFEVPGAQVFTKQWQPELNINLS
                     SAAEKIDPTHFEVSLKVVVQANNDNETAFIVDVTQSGIFLIDNIEEDRLPYILGAYCP
                     NILFPFLREAVNDLVTKGSFPQLLLTPINFDAEFEANMQRAQAAAVEGQA"
     gene            complement(618338..618595)
                     /locus_tag="ABZJ_RS02935"
                     /old_locus_tag="ABZJ_00569"
     CDS             complement(618338..618595)
                     /locus_tag="ABZJ_RS02935"
                     /old_locus_tag="ABZJ_00569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009390671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_000729828.1"
                     /db_xref="GI:446652482"
                     /translation="MAANVIVYSTSVCPYCVRAKQLLERKGVAYKEVNLSVEAPEVRA
                     ELMQRTNHRTVPQIFINDQFIGGFDQLYALEREGKLDELLA"
     gene            complement(618607..619023)
                     /locus_tag="ABZJ_RS02940"
                     /old_locus_tag="ABZJ_00570"
     CDS             complement(618607..619023)
                     /locus_tag="ABZJ_RS02940"
                     /old_locus_tag="ABZJ_00570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016142222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese"
                     /protein_id="WP_000443006.1"
                     /db_xref="GI:446365151"
                     /translation="MERWLEFMGNHPILFGTLGVLIVLFFIFEGQRNGRKISPQSLGI
                     LVKAKNALLIDLRDSKDFREGHISGSRNIPYSQIASHADELKASDRPLVFICNLGQVA
                     GSALQKVAHHDSYRLDGGISNWKAQGLPLVKSKPKA"
     gene            complement(619121..620179)
                     /locus_tag="ABZJ_RS02945"
                     /old_locus_tag="ABZJ_00571"
     CDS             complement(619121..620179)
                     /locus_tag="ABZJ_RS02945"
                     /old_locus_tag="ABZJ_00571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001173999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase"
                     /protein_id="WP_001174001.1"
                     /db_xref="GI:447096745"
                     /translation="MALIRKRRLTEQQQRRIEKQHKTRQEEVDTSQDLDGLVVQHYGR
                     QLEVQALSVPDHHPEKPQVAEGEPEPFWKPIELNSVWRCHTRTNLELLVTGDRVKWQA
                     DPNTGLGIITAIHPRTSLLTRPDRYHKVKPVAANISLIVIVFAPLPEPAPTLIDRYLV
                     ACADANIPALLVLNKSDLLTENDPILDMLKEYENLGYEVMICHSKGDISALSQRLDGE
                     TVAFVGQSGVGKSSLINVLIPDAEQKTNIISENSALGQHTTTSTRLINFGRNGALIDS
                     PGIREFGLWHLDLDKIRMGFPEIEAHLGSCQFRNCTHTHEKNCGLKQAVEAGEILPRR
                     LDSFLRLIDEIQEAQQKN"
     gene            620305..620871
                     /locus_tag="ABZJ_RS02950"
                     /old_locus_tag="ABZJ_00572"
     CDS             620305..620871
                     /locus_tag="ABZJ_RS02950"
                     /old_locus_tag="ABZJ_00572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002053300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoribonuclease"
                     /protein_id="WP_000099436.1"
                     /db_xref="GI:446021581"
                     /translation="MSSTLNTRLIWIDLEMTGLDTDNDQIIEIATIITDDHLNVLAEG
                     PVLAIHQPDRILNAMDEWNTRQHGQSGLIERVRRSKLTARDAELQTLEFLKKWVNPKV
                     SPMCGNSICQDRRFLHRLMPELEQYFHYRNLDVSTVKELSKRWRPEIMSGLKKNASHL
                     AMDDIRDSISELKYYREYFFIMNTDGKD"
     gene            621027..621758
                     /locus_tag="ABZJ_RS02955"
                     /old_locus_tag="ABZJ_00573"
     CDS             621027..621758
                     /locus_tag="ABZJ_RS02955"
                     /old_locus_tag="ABZJ_00573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019458086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001191562.1"
                     /db_xref="GI:447114306"
                     /translation="MQSNNPILTRVETVSDYSQPMTVQGAIQKSVMLTIIAAAVGVAL
                     FFYAAFTANVGIAYAASIVGAIGGLVLALITTFKPTTAPTLAIPYALFEGAFLGGISF
                     TFQLKYPGVPLQALLATFVTTLVMFGLYKFQIIRATEKFKSVVISASLAIFIVFIVQM
                     VMRLAFGSSIPYIFESNWLGIGFAAFVAVIASLNLILDFDLIETNAAYRAPKFMEWLC
                     GIALLATLVWMYISFLRLLGLLSDD"
     gene            621895..622698
                     /locus_tag="ABZJ_RS02960"
                     /old_locus_tag="ABZJ_00574"
     CDS             621895..622698
                     /locus_tag="ABZJ_RS02960"
                     /old_locus_tag="ABZJ_00574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009390813.1"
                     /note="Catalyzes a key regulatory step in fatty acid
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-ACP reductase"
                     /protein_id="WP_002027450.1"
                     /db_xref="GI:487953984"
                     /translation="MTQGLLAGKRFLIAGVASKLSIAYGIAQALHREGAELAFTYPNE
                     KLKKRVDEFAEQFGSKLVFPCDVAVDAEIDNAFAELAKHWDGVDGVVHSIGFAPAHTL
                     DGDFTDVTDRDGFKIAHDISAYSFVAMARAAKPLLQARQGCLLTLTYQGSERVMPNYN
                     VMGMAKASLEAGVRYLASSLGVDGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAP
                     LKRNVTIEEVGNAALFLCSPWASGITGEILYVDAGFNTVGMSQSMMDDE"
     gene            complement(622768..624174)
                     /locus_tag="ABZJ_RS02965"
                     /old_locus_tag="ABZJ_00575"
     CDS             complement(622768..624174)
                     /locus_tag="ABZJ_RS02965"
                     /old_locus_tag="ABZJ_00575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002000548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_000010504.1"
                     /db_xref="GI:445932649"
                     /translation="MSFSMTKLSAALLLTSSLVGCAAVVKTPYQAPAVQVPGSFQYDK
                     AKAKTASVEQYSDRWWTLFGDAQLNQLVTNVLERNSDLAVAGITLKQARLQADLTANK
                     QGLRTNSSVSTGHSFDLNSGDDSAKGLSMSAGVSYELDLFGKLARQTEASKWEALATE
                     QDLQATGQSLIATTAKLYWQLGYLNERYATAQQSLATSQKLYQLVQTQYKAGAVSGLD
                     LTQAEQSVQSQKASLSQIEQQLVETRTAIAVLLHEPVQQLNIQEPQRLPRTALPAIGA
                     GLPADILSRRPDLQAAELRLRKALATKDATKASYYPSISLTSSLGSSSTSLTELLRNP
                     ALTLGASLSLPFLQYNDMKKDIAISNLDYEKAIIQYRQTLYQAFADVENALSSRTELD
                     KQVALQERNVELAEKTERLTEVRYRYGAVALKTLLDAQQTTRTARLSLVETKQSQYNA
                     YVTLMQALGGSPVKELPQ"
     gene            complement(624185..626179)
                     /locus_tag="ABZJ_RS02970"
                     /old_locus_tag="ABZJ_00576"
     CDS             complement(624185..626179)
                     /locus_tag="ABZJ_RS02970"
                     /old_locus_tag="ABZJ_00576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005044812.1"
                     /note="with MacA is involved in the export of macrolide;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide ABC transporter ATP-binding protein"
                     /protein_id="WP_000165904.1"
                     /db_xref="GI:446088049"
                     /translation="MTKQALLEVSNLVREFPAGESTIQILKGIDLTIYEGELVAIVGQ
                     SGSGKSTLMNILGCLDRPTSGSYKVNGQETGKLEPDQLAQLRREYFGFIFQRYHLLGD
                     LSAEGNVEVPAVYAGVTPADRKQRATALLTELGLGTKTQNRPSQLSGGQQQRVSIARA
                     LMNGGDVILADEPTGALDSHSGVEVMRILRELNAAGHTIILVTHDMQVAKNATRIIEI
                     SDGEIISDRPNVPDQSLEEVKSDPDAAPALQNKQKKGKSISAWRSTLDRLSEAFQMAL
                     LSMNAHRMRTFLTMLGIIIGIASVVTVVALGNGSQQQILSNISSLGTNTITVFQGRGF
                     GDNSKTANFKTLVPADADALMTQPYVSAVSPMVSTSKTMRYQQNEANATINGVSNDYF
                     DVKGLVFKDGQTFDQRSVRDRSQDVVIDTNTQKQFFSDGTNPIGQVVLLGSVPARIIG
                     IVEPQTSGMGSDDTLNVYMPYTTVMSRMLGQAHVRNIIVRINDKYSTSAAENAIVNLL
                     TQRHGAQDIFTMNSDSIRQTIEKTTSTMTLLVSAIAVISLVVGGIGVMNIMLVSVTER
                     TQEIGVRMAVGARQSDILQQFLIEAILVCLIGGVLGVLLSLGLGQLINKFAGGNFAVA
                     YSTTSIVAAFVCSTLIGVVFGFLPAKNAAKLDPVAALSRE"
     gene            complement(626182..627522)
                     /locus_tag="ABZJ_RS02975"
                     /old_locus_tag="ABZJ_00577"
     CDS             complement(626182..627522)
                     /locus_tag="ABZJ_RS02975"
                     /old_locus_tag="ABZJ_00577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001124223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HylD"
                     /protein_id="WP_001124214.1"
                     /db_xref="GI:447046958"
                     /translation="MPKIKPIKLVIIVVCIAIIAVLAWKFLKPKQQQPQYITAEVTRG
                     DIENNVLATGTLDATKLISVGAQVSGQVKKMYVQLGDQVKQGQLIAQIDSTTQENSLK
                     TSDANIKNLEAQRLQQIASLNEKQLEYRRQQQMYAQDATPRADLESAEAAYKTAQAQV
                     KALDAQIESAKITRSTAQTNIGYTRIVAPTDGTVVAIVTEEGQTVNANQSAPTIVKIA
                     KLQNMTIKAQVSEADIMKVEKGQQVYFTTLGDETKRYATLRQIEPAPDSISSESNSTT
                     SSTTSSAVYYNALFDVPNTDGKLRIDMTAQVYIVLNSAKNALLVPSSALSSKQFSGQR
                     KQGQSADKASSTPSAERKHQGNGVRLERLNLTPEQKQLIEQGKATLSVVRVLQADGTT
                     KPTQILVGINNRVNAQVLAGLKQGDQVVIADSSENSAASANSGNNRRRSGPMGM"
     gene            complement(627630..628619)
                     /locus_tag="ABZJ_RS02980"
                     /old_locus_tag="ABZJ_00578"
     CDS             complement(627630..628619)
                     /locus_tag="ABZJ_RS02980"
                     /old_locus_tag="ABZJ_00578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000762835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta"
                     /protein_id="WP_000762831.1"
                     /db_xref="GI:446685485"
                     /translation="MKLDYLQALKRIPEARGAWILHGQEPLLEQNLLDTFRKSWQQQD
                     IERQRYDISSVSDWKNVFNALNSLSLFSQQLAIEVHGNIKPDANGLKQLKSYIQHNET
                     NLLLIVLPKQDSSSLKSAFFQVVEANGVVVALTANYPQDRQRILAAEAEKLEIQLDND
                     AWQWLMQHHEHNLLAAKNSLMRVRDTFPDQKLIQIEQLYACLQDQSRYTTYDLSDALL
                     EGNLAQSIKIFQYLIGSGEPESLILWTLSKEMRLLMQLFEQPHNALQLGIWKTKVSLY
                     QQALRRLNPQQFLGWSALLLQIDAAIKGMSNENAQHLMQQAIAELCGKTLFIH"
     gene            complement(628639..629148)
                     /locus_tag="ABZJ_RS02985"
                     /old_locus_tag="ABZJ_00579"
     CDS             complement(628639..629148)
                     /locus_tag="ABZJ_RS02985"
                     /old_locus_tag="ABZJ_00579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004794663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000549819.1"
                     /db_xref="GI:446471965"
                     /translation="MHLAQRLAAVVLTLGLSAGLVGCGFHLKGTNPTATPLVYKKLSL
                     ELPAKTDDLETQLKVYLTANGVQLSNDNDAYVLRVLEYTPRRQLLNGKLTEVLLRLTV
                     TFQIEDRQGNKITEPRTLTAARSYQYDLATVNTENQQESYLQRIVIDDLAQQITRQIS
                     ANRLPKAQP"
     gene            complement(629176..631800)
                     /locus_tag="ABZJ_RS02990"
                     /old_locus_tag="ABZJ_00580"
     CDS             complement(629176..631800)
                     /locus_tag="ABZJ_RS02990"
                     /old_locus_tag="ABZJ_00580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017482043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl-tRNA synthetase"
                     /protein_id="WP_000155773.1"
                     /db_xref="GI:446077918"
                     /translation="MTISHIDPEYQANTIEPSVQQDWENRKVFKVADTVEGKHRYILS
                     MFPYPSGKLHMGHVRNYTIGDVISRFYRLKGETVLQPMGWDAFGLPAENAAIAHKVAP
                     AKWTFENIAYMRDQLKKLGLSVDWDREFATCTPEYYHWEQWLFVQLYKKGLIYRKLST
                     VNWDPVDQTVLANEQVENGRGWRSGALVEKRDIPMYYFRITDYAQELLDDLDTLQDGW
                     PQQVLTMQRNWIGRSTGMEITFPSANTEIYADGLTVYTTRADTLMGVTYVAVAAEHPL
                     ALKAAENNPELAAFIEECRMGSVAEADLATAEKKGMATGLFVKHPVTGEELPVWIANY
                     VLMSYGSGAVMAVPAHDERDFEFANKFNLPIKQVIDAKGADDADYSATEWQEWYGSKE
                     GKLVNSGEFDGLEFQAAFDAFLAKLEPQGLANSKVQFRLRDWGVSRQRYWGCPIPMIN
                     CDTCGQVTVPEDQLPVVLPTDVVPDGSGNPLNKMPEFYETKCPCCGGDARRETDTLDT
                     FVESSWYYARYASPDFTGGMVKPEAAKNWLPVNQYIGGVEHAILHLLYARFFHKLMRD
                     EGVVQGNEPFTNLLTQGMVLADTFYREAENGKKTWFNPADIELERDEKGRIISAKYSG
                     DGQEVIIGGQEKMSKSKNNGIDPQAIIDQYGADTARVFMMFAAPPDQSLEWSDAGVEG
                     ANRFLKRVWRLVASFLEKGNSATAIDKANLSKDAQDLRRKTHETIQKVSDDIERRHAF
                     NTAIAALMELLNASNKFEAKDDNDVAVEREAITTLLTLLAPFAPHLSQTLLAQFGTDL
                     TEATFPEVDASALTRNTQTIVVQVNGKLRGKLEVSVDISKDELLAQAKALPEVQQFLT
                     GPTKKEIVVPNKLVNLVV"
     gene            complement(631987..632316)
                     /locus_tag="ABZJ_RS02995"
                     /old_locus_tag="ABZJ_00581"
     CDS             complement(631987..632316)
                     /locus_tag="ABZJ_RS02995"
                     /old_locus_tag="ABZJ_00581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001054470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001054470.1"
                     /db_xref="GI:446977214"
                     /translation="MNLSYLKTSLYTAATTAILLCSSQSQAQQYYKWMDQSGSTHYTT
                     TPPPKGAKHLNKVSTYGSQPLLKNPTSNLEQPSQDKVVQEVTNVAVEKGAPAVPVPPA
                     PSVSAPR"
     gene            632821..634545
                     /locus_tag="ABZJ_RS03000"
                     /old_locus_tag="ABZJ_00582"
     CDS             632821..634545
                     /locus_tag="ABZJ_RS03000"
                     /old_locus_tag="ABZJ_00582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017816391.1"
                     /note="catalyzes the formation of 2-acetolactate from
                     pyruvate, leucine sensitive; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_000422094.1"
                     /db_xref="GI:446344239"
                     /translation="MELLSGGEMLVRALADEGVEHVFGYPGGAVLHIYDALFQQDKIN
                     HYLVRHEQAAGHMADAYSRATGKTGVVLVTSGPGATNTVTPIATAYMDSIPMVVLSGQ
                     VASHLIGEDAFQETDMVGISRPIVKHSFQVRHASEIPAIIKKAFYIASSGRPGPVVVD
                     IPKDATNPAEKFAYEYPEKVKMRSYQPPSRGHSGQIRKAIDELLTAKRPVIYTGGGVV
                     QGNASALLTELAHLLGYPVTNTLMGLGGFPGDDPQFIGMLGMHGTYEANMAMHHADVI
                     LAIGARFDDRVTNNPAKFCPNSKVIHVDIDPATISKTIMAHIPIVGAVEPVLQEMLAQ
                     LKQLNVSKPNPEAIAAWWSQINEWRKVHGLKYENPSDGTMKPQQVVETLYKVTNGDAI
                     ITSDVGQHQMFGALYYKYKRPRQWINSGGLGTMGVGLPYAMAAKLAFPDQQVVCITGE
                     ASIQMCIQELSTCKQYGLNVKILCLNNRALGMVKQWQDMNYEGRHSSSYVESLPDFAK
                     LMEAYGHVGIQINHADELESKLAEAMAINDKCVFINVMVDRSEHVYPMQVAGQSMRDM
                     WISKGERI"
     gene            634545..635036
                     /locus_tag="ABZJ_RS03005"
                     /old_locus_tag="ABZJ_00583"
     CDS             634545..635036
                     /locus_tag="ABZJ_RS03005"
                     /old_locus_tag="ABZJ_00583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001215919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_001215920.1"
                     /db_xref="GI:447138664"
                     /translation="MRHIISVLVENEAGALSRLVGLFSQRNYNIETLNVAPTEDPTLS
                     RLTLTTYGDDHKIEQITKQLNKLVEVVKVVDLSEGSHIERELMLIKVKALGASRAEIK
                     RTADIFRAQIVDVTPTTYTIQIAGTTEKLDGFIDALAENTILEVVRSGVSGIARGEKV
                     LAI"
     gene            635068..636084
                     /locus_tag="ABZJ_RS03010"
                     /old_locus_tag="ABZJ_00584"
     CDS             635068..636084
                     /locus_tag="ABZJ_RS03010"
                     /old_locus_tag="ABZJ_00584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004672686.1"
                     /note="catalyzes the formation of
                     (R)-2,3-dihydroxy-3-methylbutanoate from
                     (S)-2-hydroxy-2-methyl-3-oxobutanoate in valine and
                     isoleucine biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="WP_001165443.1"
                     /db_xref="GI:447088187"
                     /translation="MQIFYDKDCDLSIIQSKKVAIIGYGSQGHAHALNLKDSGVDVTV
                     GLRAGSASWKKAENAGLKVAEVPAAVKQADLVMILTPDEFQSQLYRDVIEPNIKEGAT
                     LAFAHGFSVLYNQVVPRKDLDVIMVAPKAPGHTVRSEFQRGSGVPDLIAIHQDASGNA
                     RNVALSYASGVGGGRTGIIETSFREETETDLFGEQAVLCGGAVELVKMGFETLVEAGY
                     APEMAYFECLHELKLIVDLMFEGGIADMNYSVSNNAEYGEYVTGPEVINEQSREAMRN
                     ALKRIQSGEYAKMFIQEGALNYPSMTARRRQNAAHGIEQTGAKLRAMMPWIQANKIVD
                     KEKN"
     gene            636414..638468
                     /locus_tag="ABZJ_RS03015"
                     /old_locus_tag="ABZJ_00586"
     CDS             636414..638468
                     /locus_tag="ABZJ_RS03015"
                     /old_locus_tag="ABZJ_00586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000510210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_000510213.1"
                     /db_xref="GI:446432358"
                     /translation="MGHVDYDSTLIVGSFIAAGAICYIVISMEQLIFKQTYKKIEPFI
                     LLLNGLLLAAAISIVHIVGMHAYHLFEAASSNVPLITLAFGISAVLSSVAIWLTSRFT
                     LPIFRLILSSVIMGIGISASYYVSMLGWNIDIYKKDYTSFLILFSVLIAMSGSGLAFL
                     LAYKLKESERHRISLKLAFAVMMTLSIMGMHYTALISTNITDKFVSQYQAEHDLLLFT
                     IILVTCLVLVASFIVAVLEQRLNQRNLELRKANKELANLSIQDNLTKLPNRLYLVDYA
                     EVLLSDHRYKDQKIAFLYIDLDRFKSVNDAFGHHIGDQLLIQMANRLHWQLNEKCKLL
                     RIGGDEFLLIAENTDTEEAMQLAEKVLHLIQDSYQISGKEINISASLGIALFPEHGQN
                     VQDLLMNADAAMLMSKEQGRNTYTVFSYSTHQQETRSQSKLINDLYKAVEEKQFVLYY
                     QPKFNTNLEICGVEALIRWNHPSLGMLTPHMFIGGAEKTGLIIPMGYWALEQACQQIQ
                     EWERSNTQFYPIAVNLSALRFENKKLFSTLEGLLKKYQIQPHHLIIEITESTAMRHID
                     LSIRACERLRDMGIRVAIDDFGTGHSSFLYLKDLPVDELKIDRGFIVDLKPGSKEEVI
                     LESIIHLAKKLGLTVTAEGVETQQQVEILTRLGCQQFQGYLLGMPVNVGQLIQSQGAH
                     FV"
     gene            639073..639636
                     /locus_tag="ABZJ_RS03020"
                     /old_locus_tag="ABZJ_00588"
     CDS             639073..639636
                     /locus_tag="ABZJ_RS03020"
                     /old_locus_tag="ABZJ_00588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000122215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_000122215.1"
                     /db_xref="GI:446044360"
                     /translation="MSYSDLSFRALSVLHKSRYLFNKHGFHNVGVDRIVREAEVPKAS
                     FYNYFHSKERLIEMCLHFQKDVLKEQVRSIIYIQKDLILREKLKKIFFLHTNLDGYYH
                     LLFRAIFEIEKLYPAAYQVVVQYRHWLTTEVYKLLLTVKKDTTKSDSDMFLFTLDGAI
                     IQLLDETRGDTRELLFAYILKGIFLKD"
     gene            complement(639854..640426)
                     /locus_tag="ABZJ_RS03025"
                     /old_locus_tag="ABZJ_00589"
     CDS             complement(639854..640426)
                     /locus_tag="ABZJ_RS03025"
                     /old_locus_tag="ABZJ_00589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002067233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_000043984.1"
                     /db_xref="GI:445966129"
                     /translation="MSKRETIITTAMTLFNQKSYTSIGVDKIIAESKVAKMTFYKYFS
                     SKEVLIEECLRRRILEVQTSLLDKVNSADDPLNKLKSIFNWYIDWINTEDFSGCLFKK
                     ATIEVLQLYPSIKKQVNKYREWIYSLVLSIFLELEIEDPKVLSSLFLNIIDGLIIDGT
                     INKPEINSEETWSYINKLIELETKQKYEAA"
     gene            640757..641620
                     /locus_tag="ABZJ_RS03030"
                     /old_locus_tag="ABZJ_00590"
     CDS             640757..641620
                     /locus_tag="ABZJ_RS03030"
                     /old_locus_tag="ABZJ_00590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002017518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000037366.1"
                     /db_xref="GI:445959511"
                     /translation="MSKKFEDFNNPREKALQGMKDSIPASQWEENLLFLKQLRNKIAQ
                     LPVSKHPAIEILNNGYLDKQTLTRIHLEYRHAIVQIFTDALLKAQFLTKQLEPKLHSG
                     AKMFPRVLLSLNILDEFGFRPGLDKDNYYLGNPEYAHYPLYEDLLNDYGLTEADRRNY
                     KPSKIADQVRTFLEASYDRYINVVALLAVAEEEVILFSPPLRQATKFVNIDVEGGGYY
                     HVHGVSTDETAEAADDDHQDDLWFALAQAITKDDYESLTQLCLDYCALWTEFWDAQIA
                     DVQFIEEKKLA"
     gene            641825..643417
                     /gene="prfC"
                     /locus_tag="ABZJ_RS03035"
                     /old_locus_tag="ABZJ_00591"
     CDS             641825..643417
                     /gene="prfC"
                     /locus_tag="ABZJ_RS03035"
                     /old_locus_tag="ABZJ_00591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006580422.1"
                     /note="stimulates the release of release factors 1 and 2
                     from the ribosome after hydrolysis of the ester bond in
                     peptidyl-tRNA has occurred; GDP/GTP-binding protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="WP_000008538.1"
                     /db_xref="GI:445930683"
                     /translation="MSFKDELAAQVAQRRTFAIISHPDAGKTTMTEKLLLWGKAIQVA
                     GMVKSRKSDRAATSDWMEMEKERGISITTSVMQFPYKGHTINLLDTPGHEDFSEDTYR
                     TLTAVDSALMVIDGAKGVEERTIKLMEVCRMRDTPIISFVNKMDREIREPLELLDEIE
                     NVLNIRCVPITWPLGMGRDFAGVYNILEDKLYVYKAGFGSTITDIEVRDGYNHADIRE
                     KVGELAWASFEESLELVQMANEPLDRELFLQGKQTPVLFGTALGNFGVDHVLDAFMNW
                     APEPKAHPTQERMVEAKEEGFSGFVFKIQANMDPKHRDRIAFMRICSGKYEKGLKMNH
                     VRIGKEVRISDALTFLAGEREHLEEAWPGDIIGLHNHGTIQIGDTFTSGENLHFTGIP
                     HFAPEMFRRVRLKDPLKSKQLQKGLKELSEEGATQVFMPQISNDLIVGAVGVLQFDVV
                     AYRLKEEYKVDCVYEPVSVNTVRWIHCDDEKILNEFKKKAHDQLSIDGGGHLTYLAPS
                     RVNLQIMQERWPDIEFRSTREH"
     gene            643487..644329
                     /locus_tag="ABZJ_RS03040"
                     /old_locus_tag="ABZJ_00592"
     CDS             643487..644329
                     /locus_tag="ABZJ_RS03040"
                     /old_locus_tag="ABZJ_00592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004565812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001054081.1"
                     /db_xref="GI:446976825"
                     /translation="MNLSKKTIIALVVAAIALILAICVFVWKKPQSSSSSQENSASTQ
                     DHPVEKAEVLPYLNLTETKASYAVPFCEKKNCIDVDIQTIKTQDAWLNSWIEKNQAKV
                     IQAQINLKKDLSLQQAINAYVKKSDEWQDKYSKNRAYELHIRTRIASQRNQYVLLQLA
                     LDSKQEEITIKDRYYFFVADRKLHKNLTLLDVLKKDQQPTVHQIVQTAYQDWLKKQTA
                     DVNKQAPKTLYWGQADWFFDGEGVGLHYQANQITKDAPQLDIYLTTEQTKKILQPQVY
                     EQMF"
     gene            644417..645358
                     /locus_tag="ABZJ_RS03045"
                     /old_locus_tag="ABZJ_00593"
     CDS             644417..645358
                     /locus_tag="ABZJ_RS03045"
                     /old_locus_tag="ABZJ_00593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017816300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000958109.1"
                     /db_xref="GI:446880853"
                     /translation="MLTSKASLRLTLLASAIFLVACQPKSDPKESEDQQKPAVVEQKP
                     VELTLKGETVPSKVTLPDCDGKTCPEFTVERLQSNFPFIDKIIDQQVLKALGQILEIA
                     EPDAKAAQADKKTEASVAAATEQQDSFDAQVQRYANSFIDLDNELKALSSNHQINLLV
                     KPKIIQSQGKVVTVVVNSSSYLGGAHGSAAQQYYNFDLKKEKQVKLEDLLRPEKKAAL
                     EKLAHEAFKAWVTDSKLANSVSEYEQAWPFKLTENFLLGDQGLILQYGEYEIGPYVVG
                     LPRLVIPYDQLQEVLKEEYLPQPKAKPASTPAAKSAS"
     gene            645358..646170
                     /locus_tag="ABZJ_RS03050"
                     /old_locus_tag="ABZJ_00594"
     CDS             645358..646170
                     /locus_tag="ABZJ_RS03050"
                     /old_locus_tag="ABZJ_00594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017386618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_000549986.1"
                     /db_xref="GI:446472132"
                     /translation="MHLFDTHTHFDVADFDEDRHQLALEAKKVGVDALVLIGFLQSRF
                     DDLVQTHHQLKQWDNVPTSYLAPGLHPFYIEQHKPEHLSHLEQILQQEDCVAIGEIGL
                     DTFLKEHKQPDIYAKQKQYFGDQLDLATQYQKPVLLHIRKAHGDVLALLKAHKFKLGG
                     IAHAFSGGVEEAKGLIKLGFKIGVTGQITNPNAKKLHTVVQAIGAEHLVIETDCPDMT
                     PLCCQTSTEQRTRNTPVNLPYVLKSLAENLNMAESELADLLWKNSLSALKLS"
     gene            646295..649051
                     /locus_tag="ABZJ_RS03055"
                     /old_locus_tag="ABZJ_00595"
     CDS             646295..649051
                     /locus_tag="ABZJ_RS03055"
                     /old_locus_tag="ABZJ_00595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001151964.1"
                     /note="Catalyzes the conversion of citrate to isocitrate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="WP_001151979.1"
                     /db_xref="GI:447074723"
                     /translation="MAKYSNINSFNALQTLTVGSSNYQIFSLTQAEKKLGDIAKLPKS
                     LKVLLENLLRFEDQLSVKTEHIYALAEWLKTRTSDQEIQYRPARVLMQDFTGVPAVVD
                     LAAMRAAMAEAGGDPEKINPLSPVDLVIDHSVMVDHFADDQAFEENVQIEMQRNGERY
                     QFLRWGQSAFNNFSVVPPGTGICHQVNLEYLAQAVWLGEDNGQTFAFPDTLVGTDSHT
                     TMINGLGVLGWGVGGIEAEAAMLGQPISMLIPEVIGFKLTGKLQEGITATDLVLTITQ
                     MLRQKGVVGKFVEFYGDGLADLPLADRATIANMAPEYGATCGFFPIDEVTLGYLKLTG
                     RQSDRIALVEAYSKAQGLWRNAGDEPVFTDTLSLDMSTVQASLAGPKRPQDRVLLSEV
                     PKTFNALMELTLKPAKEAKERLENEGGGGTAVEATKANIQHESPSCVIEGQEYPLNHG
                     DVVISAITSCTNTSNPSVMLAAGLLAKKAIEKGLQRKPWVKSSLAPGSKVVTDYLLAA
                     GLTPYLDELGYNLVGYGCTTCIGNSGPLPEPIEDAIQCHDLNVASVLSGNRNFEGRVH
                     PLVKTNWLASPPLVVAYGLVGNIRTDLTTQPIGQGKDGQPVYLKDIWPSQAEIDAVLQ
                     KVNTDMFHKEYAAVFDGDESWQAIQIPKSKTYEWADDSTYIRHPPFFEGIGEPPKPIK
                     NIEQARILAVLGDSVTTDHISPAGNIKKDSPAGRYLQEQGVEPKDFNSYGSRRGNHEV
                     MMRGTFANIRIKNEMLGGEEGGNTIHVPSGEKLAIYDAAMRYQQEHTPLVIIAGKEYG
                     TGSSRDWAAKGTNLLGVKAVIAESFERIHRSNLVGMGVLPLQFVDGQTRQSLNLTGHE
                     VISIRGLSDGIQPHEILEVDVKGPNGVASHFNVLCRIDTLNEVEYFKAGGILHYVLRN
                     LIAS"
     gene            649172..649645
                     /locus_tag="ABZJ_RS03060"
                     /old_locus_tag="ABZJ_00596"
     CDS             649172..649645
                     /locus_tag="ABZJ_RS03060"
                     /old_locus_tag="ABZJ_00596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000532213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="WP_000532213.1"
                     /db_xref="GI:446454358"
                     /translation="MGRDTVFLKVESRLGYDFSGDIKIGGKYTSLIEHAGLVFISGQI
                     PRVGDTVQICGKVGLDVDLSDAQLAASISTMRALAILKQHYGTLDVIGKVLQMNVFVH
                     STSSFIQQSEVADGASEILYEILGLDTGRHTRTSVSVYQLPKNASVEINFIFALK"
     gene            649770..650534
                     /locus_tag="ABZJ_RS03065"
                     /old_locus_tag="ABZJ_00597"
     CDS             649770..650534
                     /locus_tag="ABZJ_RS03065"
                     /old_locus_tag="ABZJ_00597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006582186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-binding enzyme"
                     /protein_id="WP_001281716.1"
                     /db_xref="GI:447204460"
                     /translation="MSDLPQNDEYDRRFAGVAKIYGDSSFQHYEQSHVMVIGIGGVGS
                     WAVEALARTGIGEITLVDMDVVAASNVNRQLPAMTSTLGCEKVEIMAERCRQINPRIK
                     VNIIDDFLTPENVAELLNPVPDIVLDCIDDVKAKLALMLHCRFNKIPLIVSGGAGGKL
                     DPLKIRVADLSKTEQDPMLAKLRSQLRARGICKKPKEKFGITCIYSIDNPFSSADVCP
                     SAGLRCGGYGSAVVVTSSFAMIAVAEVLKKLDLKKA"
     gene            650822..651715
                     /locus_tag="ABZJ_RS03070"
                     /old_locus_tag="ABZJ_00599"
     CDS             650822..651715
                     /locus_tag="ABZJ_RS03070"
                     /old_locus_tag="ABZJ_00599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000956776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000956775.1"
                     /db_xref="GI:446879519"
                     /translation="MLTLKQFQYFIKIVEEGSFTAASEKLFIAQSALSRQMKLLEEEI
                     DFQLFDRTDKRARLTPAGEVFYKKIKDNLLYLNEIIDLSKSVSEGKNRQIKIAHSSSI
                     VVDNTKVQILKEVSLTQQLSFEINTLSSEQQILALLNGEIDIGLIRPPVRHTLDGINT
                     LKLYEEPLMVAVHIDHAKFAKSEKVYLKDLKDECFVSTPHAERGGLSYLVANLCLAAG
                     FTPQKASIQSRKISQLQLVAANLGVGIVPAEFQQILPANVKLIPLEDSLSLSEVLLVY
                     RKGHDEIIQHCAEQIHQMFLS"
     gene            complement(651723..652232)
                     /locus_tag="ABZJ_RS03075"
                     /old_locus_tag="ABZJ_00600"
     CDS             complement(651723..652232)
                     /locus_tag="ABZJ_RS03075"
                     /old_locus_tag="ABZJ_00600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004698691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000587862.1"
                     /db_xref="GI:446510362"
                     /translation="MIIYDGQVADNYMYQDSNQAAIVVSHSTPSLPYPFTMKPNNHST
                     ETNTPPAIDVEKFVAKLESITSRRSKARCARSIRIALESAGADVENHPIAASDWGDTL
                     KKIGYKEINPAFDEPQEGDIYIIHRTRNHIYGHIAGYTGSEWVSDFKQSSYDVYKDDN
                     VTYTYYRLG"
     gene            complement(652568..653572)
                     /locus_tag="ABZJ_RS03080"
                     /old_locus_tag="ABZJ_00601"
     CDS             complement(652568..653572)
                     /locus_tag="ABZJ_RS03080"
                     /old_locus_tag="ABZJ_00601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004836108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase A"
                     /protein_id="WP_001191173.1"
                     /db_xref="GI:447113917"
                     /translation="MQSLQSLQPRISVAPMMDWTTKDYRFFARLFNPNVVLYTEMVTT
                     GAILFGDAKRHLGYNAQEHPIVLQLGGSNPQELATCTKMAEDWGYDEVNLNVGCPSDR
                     VQNNKIGACLMAEPDLVAECIHSMQKVVNIPVTVKHRIGIDDMQSYEEMLHFVDTVAA
                     TGCTHFVVHARIAILKGLSPKENREVPPLRYEDVYRLKQERPHLTIEINGGIKTFAET
                     QAHLQHVDGVMIGREAYHNPYLLAELGQLWNLEAPDRFDIMEQMLPYIEQRLAEGAPL
                     SIITRHILGLFQNLPGARKWRQALSGGNAKTLTDVENAIHNMQAAIIRTEEYLKEHQF
                     "
     gene            complement(653721..654905)
                     /locus_tag="ABZJ_RS03085"
                     /old_locus_tag="ABZJ_00602"
     CDS             complement(653721..654905)
                     /locus_tag="ABZJ_RS03085"
                     /old_locus_tag="ABZJ_00602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004842483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_000106691.1"
                     /db_xref="GI:446028836"
                     /translation="MSTPEDISQNKPLLWLMAAACGLCAGVNYYCQPLIHSIQQDFAV
                     TQAQAALTVTFAQVSYALGLLFIVPMGDIVNKAKAIPFLMMLCAVGLFTSAFAVNLPM
                     LWIGTILAGLFSVAAQVLIPLATMTVKPEKTGEIIGFLMSGLLVGILLSTSLAGLFSN
                     LFHWKVVYAISGILMLLLAYTLKSRLPYVMRMKLNYGQIFVSMAQLLKQEKRLLLRAL
                     TGAFAFASVSILYSTIALLLTSAHHLPDLFIGLVPLVGIFGALSTRYIGKYADQGYTR
                     LLTWMGCGLFLVSWICFYFGQTLLSAYVIGFALIQLALALVHTSNQSIIFRLRPDAKS
                     RINAIYMTTYFIGGAAGSALGIFAWNRGGWTMTCLAGVGLVVFCILFSMIDAFLQKKQ
                     MA"
     gene            complement(654924..655331)
                     /locus_tag="ABZJ_RS03090"
                     /old_locus_tag="ABZJ_00603"
     CDS             complement(654924..655331)
                     /locus_tag="ABZJ_RS03090"
                     /old_locus_tag="ABZJ_00603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001031019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjgF family translation initiation inhibitor"
                     /protein_id="WP_001031013.1"
                     /db_xref="GI:446953757"
                     /translation="MNKEIFKIINPSTLYDPTPNAYSHIAVVSNFNNIIHIAGQGGED
                     QQGQLSSHFSEQVLQAFENIKYALVAANAELTDIAVLRILVVDHSVEKHEILIKIMKD
                     LWKNHPFPACTLIPVPRLALEHMLIEVEATAYT"
     gene            complement(655399..656325)
                     /locus_tag="ABZJ_RS03095"
                     /old_locus_tag="ABZJ_00604"
     CDS             complement(655399..656325)
                     /locus_tag="ABZJ_RS03095"
                     /old_locus_tag="ABZJ_00604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000703574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_000703577.1"
                     /db_xref="GI:446626231"
                     /translation="MKISLSSFQIGSFFALCSAFLFSTKAIFIKQTYALSPLVDGTVL
                     MALRMLSALPFFLLICWFNRHHNQGIKKKDWLILIFAGLLGYYFASWLDFMGLMFISA
                     SLERIILFLYPTLTVIASSLLYKQKLDVKSLFAIFLSYGGTVLVMLQEHNNAPIQGNF
                     WLGTSFVFASAVAFAGYLLLTPPLIKKFGSWNFTGLALTVACIGTLTHYTLSTPHPFQ
                     LLLQLPSSVIWYGIGLGFLVTVLPTVMLMQSIERLGASQSAMIASIGPVLTILLAVAF
                     LNEHLNIWQWVGCFLNIVGVMMITLRKKRLKH"
     gene            656565..657692
                     /locus_tag="ABZJ_RS03100"
                     /old_locus_tag="ABZJ_00605"
     CDS             656565..657692
                     /locus_tag="ABZJ_RS03100"
                     /old_locus_tag="ABZJ_00605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001165463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_001165468.1"
                     /db_xref="GI:447088212"
                     /translation="MQIGIPTETVVGENRVAATPETVKKLISAGHSVVIERGAGVKAA
                     YIDSAYEQVGATITDDAYTGSQIILKVRAPQGGEIQKLAANTTVVAMFDPYRNTELDQ
                     FANQQVSAFALELLPRTLSRAQNMDVLSSQANLAGYKSVLLAAAEYQRMFPMLMTAAG
                     TVKPARVVIMGVGVAGLQAIATAKRLGAIVEATDLRPTAKDQVESLGGKWLDVPMSEE
                     EQQRAADAAKNGYGWMPGEQYIKDQAAIVDKAVSNADIVITTALLPGRDAPRLIKAET
                     VAKMKPGSVILDMAVETGGNVEGSKVGETVVTENGVKILGIPNIPATVATEASALYAR
                     NVFNFVETLFDKEKNFAINQEDEIQKALLVTHGGQVLLKRG"
     gene            657704..658018
                     /locus_tag="ABZJ_RS03105"
                     /old_locus_tag="ABZJ_00606"
     CDS             657704..658018
                     /locus_tag="ABZJ_RS03105"
                     /old_locus_tag="ABZJ_00606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004664154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_000230434.1"
                     /db_xref="GI:446152579"
                     /translation="MVETITIFVLAIFVGYYVVWGVTPALHTPLMAVTNALSSIIVVG
                     AMLQTVGLPVLGVDANVAFQSVNVVSVLGAIAVFLASINIFGGFAVTARMLEMFKPKQ
                     KK"
     gene            658031..659485
                     /locus_tag="ABZJ_RS03110"
                     /old_locus_tag="ABZJ_00607"
     CDS             658031..659485
                     /locus_tag="ABZJ_RS03110"
                     /old_locus_tag="ABZJ_00607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016142195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit beta"
                     /protein_id="WP_000394402.1"
                     /db_xref="GI:446316547"
                     /translation="MEFIQANANWLYLVGAILFILTLRGLSGPKTAIQGNRYGMIAMA
                     IAVVTTFFVANNPVIWMIGGAMVLGAIVGIARARTVPMTQMPETVALMHSLVGLAAVL
                     IAVAAILHNNQLTALFAQNEAALTAAGVQHAHMSKVHLFELFVGCFVGAITFTASVFA
                     YGKLAAKKWAKTISGAWVKPVQALIFVAMLACGFYFFTTGNMTAFWAMTALALAFGWV
                     WIAPVGGGDMPVVVSLLNSFSGWAAAGIGFTLENNMLIVAGSLVGSSGAILSYIMCKA
                     MNRSIINVLFGGAMGGAAVSTAAKGEQVQRNYRSGSADDAGFLMSNADSVVIVPGYGM
                     AQGRAQNAVKELCEILKEQGVRVRFAIHPVAGRMPGHMNVLLAEADVAYEDILEMDEI
                     NSDFPATDVVLVIGANDVVNPAAKDDPGSPIYGMPILEAHKARTIMVIKRSMATGYAG
                     LDNDLFYNEKTMMIFGDAKKVVEDMTKAINGTGH"
     gene            complement(659536..660357)
                     /locus_tag="ABZJ_RS03115"
                     /old_locus_tag="ABZJ_00608"
     CDS             complement(659536..660357)
                     /locus_tag="ABZJ_RS03115"
                     /old_locus_tag="ABZJ_00608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000697832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_000697821.1"
                     /db_xref="GI:446620475"
                     /translation="MKILITGANTGIGFATAEQLVKQGQHVILACRNPQKAQEAQNKL
                     RSLDQGQVDVVSLDLNSLELTQKAAEEIADKYGSLDVLINNAGLFSKTKQLTVDGFEQ
                     QFGVNYLGHFLLTQKLLPVLKQSPQARIIHLASIAHWVGSIKPNKFRAEGFYNPLFYY
                     GQSKLANLLFSNALAEQLADNSITNNALHPGGVASDIYRDLPKPVYAAMKVGLVPTSV
                     PAKLITEMATGDTWQNRNGEYVSAHMPDWKSSHAKNQQLARDLYQQSMTLVEKFL"
     gene            complement(660610..661011)
                     /locus_tag="ABZJ_RS03120"
                     /old_locus_tag="ABZJ_00609"
     CDS             complement(660610..661011)
                     /locus_tag="ABZJ_RS03120"
                     /old_locus_tag="ABZJ_00609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001047580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001047580.1"
                     /db_xref="GI:446970324"
                     /translation="MNLEPSPSVSNSHDFAMNTSNKDVQACLKVVHDALVDVKAKDIL
                     QLDVSSISNVADAIVIASGTSTRHVKALADNVAEEARKAGFRPIGVEGERDAEWILID
                     LGFVVVHVMLPTARKFYDLESLWRTAPESVA"
     gene            complement(661093..661887)
                     /locus_tag="ABZJ_RS03125"
                     /old_locus_tag="ABZJ_00610"
     CDS             complement(661093..661887)
                     /locus_tag="ABZJ_RS03125"
                     /old_locus_tag="ABZJ_00610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006581375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate isomerase"
                     /protein_id="WP_000532984.1"
                     /db_xref="GI:446455129"
                     /translation="MGRLAVNLSMIFTEVPLIERFALAHAEGFEHVEIQFPYELAISD
                     IQDQLERYNLNLCLINVPAGDLMQGGNGLAGIPGQEAAFREALQLAIRYATALKVPRV
                     NILAGKQPQDSDLLPCLKTLASNLKLACDLLTEHDIEPVFEMINGTDMPRFLVQNIAQ
                     AQEMLEAVNHPALKMQYDCYHMAMMGEDVLEGLQENIHQIGHIQFADCPGRHEPDTAQ
                     IPYEQIFSWIKQSAYEGYIAAEYKPKNGSNQSFTWKKKYFSDDVNI"
     gene            complement(661904..662770)
                     /locus_tag="ABZJ_RS03130"
                     /old_locus_tag="ABZJ_00611"
     CDS             complement(661904..662770)
                     /locus_tag="ABZJ_RS03130"
                     /old_locus_tag="ABZJ_00611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005129652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-3-oxopropionate reductase"
                     /protein_id="WP_001008365.1"
                     /db_xref="GI:446931109"
                     /translation="MNFDRNTPIAFLGIGLMGSRMASRLIQAGFQVAVWNRTASACEE
                     LIDIGAHALDLSNIGQYPLILTCLADDKAVQAVFDQIQTNLKAGQVIVDFSSLSVAAT
                     KALAQAAASQDVIWIDSPVSGGTAGAEQGTLVIFAGGDAQTIEALSPVYNVLSQRVTR
                     MGDTGTGQATKICNQLIVAANSALIAEAVALADRAGVDTTLLAPALAGGFADSKPFQI
                     LAPRMATHTFEPVQWKVQTLSKDLNNAVTLANNVNLDIPVAQKALLQLQTHQKNGFAE
                     KDLATMIQVVEQ"
     gene            complement(662781..663569)
                     /locus_tag="ABZJ_RS03135"
                     /old_locus_tag="ABZJ_00612"
     CDS             complement(662781..663569)
                     /locus_tag="ABZJ_RS03135"
                     /old_locus_tag="ABZJ_00612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004698630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_001196725.1"
                     /db_xref="GI:447119469"
                     /translation="MALLRIEKNNGIATVYLNRPDKRNAMSFALLKELVTTAKAIQKD
                     RDIRCVILTGEAQVFSAGIDLSDLNNPKNSAFAIWELVKPGQSLFQKAFLIWQNLPVP
                     VIAALEGYCFGAGMQLALAADIRIAHPDIKMSIMESRWGLVPDMGLTRSLKGLIGVDL
                     AKELTLTARVFDGNYAKDIGLVTHLSENPLEKANAIASEMLQRSPDALTAAKRVLDAM
                     EHQPEKSLRLEKIWQLKLLLGKNSKLARKKDKHPEVKFLPRQYR"
     gene            complement(663666..666473)
                     /locus_tag="ABZJ_RS03140"
                     /old_locus_tag="ABZJ_00613"
     CDS             complement(663666..666473)
                     /locus_tag="ABZJ_RS03140"
                     /old_locus_tag="ABZJ_00613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002067255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_000064534.1"
                     /db_xref="GI:445986679"
                     /translation="MSNFNKTLSKRLRLNHAYGQLIALIFVPIMILTCVGAFLVLTET
                     SRSAKQQQLHHASAILARYNQIAKDLYTLVELQPDEYDHAQHIMQSMFSEKNLKRAAL
                     IDSNGQTYLSIGYRDNRYWPNFTQNNNFFGPISYNHNNIYGVRIIDTAGKPPVWLLIE
                     MDNQPLELARYRILIALVITGLMTLLLLLLCLNFYSRRWIAPMYEIRMQLQRLNADTL
                     DQHIVINSSGELRLLQRDIANVVKRLHFSFLELKEHTEQTEEDLRRTLDTLEVQNITY
                     RQARDQAISSNQAKSVFLANISHELRTPLNSIDGFIHLLLRQQNLSNEQNLYLQTIRK
                     SSAHLLALINDVLDFSKIDAGKLELETAPFDLEEAVFDVMDMLSPLAAQKHIAMAFYY
                     ADNIPQQVIGDALRFKQILTNLISNAIKFTPDGEIIVRVRMEHDDIGQCLLHFSVQDS
                     GIGLSGTDRKKLFESFSQGDASVTRQFGGTGLGLAISKQLVHLMHGQIGFEDNQERAP
                     TEKGSTFWFTAQFAVDEEHEIEHPHFEHLQVVSYLAHPATASVLRYYLENYQVPHIET
                     QSILDLFSRLKHLDQKDNTWLIVDHSGDTEALLKEIRSRYQGNLAVYGYQMTLEPNML
                     TEYRARPLYQPLSRSGLIQLLSDQPIFEEEQQDFNGQGLHILAVDDHLPNLIVLEALL
                     GELNVKTTKALSGQEALNIIQERIDQKLKPFDLVFMDIQMPVMSGIDTTRAIRSLEST
                     LDGEMQLPIIALTAHALADEKQKLLKVGMNDYVTKPIQMEQIIQILTQWTKNNFTAQN
                     LAKDHHVVAEALDPEILNWQQSLQLAANKEDLAQDLLKMLVDSFPTELEEMQQLIELE
                     DFPQLEHVLHRLYGATRYVGTPKLQQVTGDFEQFISTLRKERRRADDGFIEEVMRRFD
                     ELGLVIKEVESAAHQILVIPD"
     gene            666646..667560
                     /locus_tag="ABZJ_RS03145"
                     /old_locus_tag="ABZJ_00614"
     CDS             666646..667560
                     /locus_tag="ABZJ_RS03145"
                     /old_locus_tag="ABZJ_00614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000072603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="WP_000072604.1"
                     /db_xref="GI:445994749"
                     /translation="MSNTQPDFLADEFLLDHYVGKTPLVRLQRLACHTQATVLAKLEG
                     NNPAGSVKDRPAYNMIMQAEKRGQIKPGDTLVEATSGNTGIALAMVAAMRGYKMKLIM
                     PGNSSQERKDAMRAYGAELIEAPNMEAARDMALQMQAEGLGLVLNQFGNPDNVEAHYL
                     TTGPEIWKQTGGKITHFVSSMGTTGTIMGVSKYLKEQNPDIQIIGLQPSEGSNIAGIR
                     RWPQEYLPTIFEPKRVDQIMDIPQIEAEKTARRLAREEGISAGTSSGGAVWASVKIAE
                     ENPDAVIVCIICDRGDRYLSTGLFSVQD"
     gene            667583..668401
                     /locus_tag="ABZJ_RS03150"
                     /old_locus_tag="ABZJ_00615"
     CDS             667583..668401
                     /locus_tag="ABZJ_RS03150"
                     /old_locus_tag="ABZJ_00615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="WP_001212164.1"
                     /db_xref="GI:447134908"
                     /translation="MRFPTLVFDIETLTDLKAGAHLYHLDLPEADVEQALTKIRRQES
                     GMDFQRLPLHEIVCISGLWIDESGFRLFSFSREHYSEAEILQKFLSIFDKRHPTLVSW
                     NGSQFDLPVILFRAMYHGLSAPGLFDQGELDSQKRFNNYQNRYHHRHIDLMDVMAMFN
                     GRNFQKLDDVACILGLPGKRGESGYHVPEYVRTEQWLKLTSYCEGDVLNTWFIYLRWL
                     LLKGQMNIDEHNHWISSSIEYLQTMPQQADFLEVWQRTSKHTEFTSHYFNPLNF"
     gene            668411..669802
                     /locus_tag="ABZJ_RS03155"
                     /old_locus_tag="ABZJ_00616"
     CDS             668411..669802
                     /locus_tag="ABZJ_RS03155"
                     /old_locus_tag="ABZJ_00616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002132730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="WP_000813062.1"
                     /db_xref="GI:446735806"
                     /translation="MKQQAKSRKPQQPEYIFQVETLSHEGRGIAHYGSHPDHPADKHG
                     KKVFIRYALPGETVKAQITHEAKRLEEAEMVALLAEPSANRVEAVCPHYGICGGCSMQ
                     HIHPDEQICLKQNVLQSHLQHFAGIQPEQWLEPIRSLQSDYRRRARIGVRYLPKQDRL
                     ILGFREHHSNRLTSIHTCSVLDKKLSDSLPELRNLLQSLKGKAHIGHVELAKGDYETS
                     LLVRHIEKLNNADVNQLRQFALHKGWQLYLQPKGPESLRRIDEEQGAMRLHYALNAFD
                     VNFAFSPLDFTQVNATVNEQMVQLACELLQLQQGERVLDLFCGLGNFSLPLARCVGAK
                     GQVVGVEASEEMVQRATDNAKRNNLVQASFFSQDLTKDFSHHSWANQGFDALLIDPPR
                     AGAYEIMQYVPNFGAKRIVYVSCNPATLARDAGVLVQHGYQLKKAAVMDMFTHTEHVE
                     SIALFEKIQEIND"
     gene            669833..672139
                     /locus_tag="ABZJ_RS03160"
                     /old_locus_tag="ABZJ_00617"
     CDS             669833..672139
                     /locus_tag="ABZJ_RS03160"
                     /old_locus_tag="ABZJ_00617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP pyrophosphokinase"
                     /protein_id="WP_000259109.1"
                     /db_xref="GI:446181254"
                     /translation="MVTVREQLPEQLTELSEETTVEHAAETQVGLASWLDRVREILDG
                     AELKQLEEVAHLTLQKELDSTVNHRSNTFATGVGMADILAHLHVDEDTLSAAMLYRSV
                     REDITDIEEVKRKFGEQVYNLVKGTLAMGKLSELIEKNKRLEDHFNNNQREHLSGIYK
                     MLISVTEDVRVVLIKLAERTYSLRELANSSRERQERVAREILTIYSPLAHRLGIAQLK
                     WELEDLAFRYLAPDRYKEIASLLNEKRLEREHYIQFVIDRLKSELAAHGIEAEITGRA
                     KHIYSIYRKMKSKNLSFDQLYDIRALRVLVNSVPECYHSLGIVHQIWRHIPHQFDDYI
                     TNPKANGYRSLHTAVIAENKSLEVQIRTHEMHDEAELGVCSHFNYKEGSKNTDHSFNH
                     RLHSLRAVLEHYQERNETTVHQNEDETEGFDQLQDFEGFEKIYVFSRDGDIKELPRGS
                     TVLDFAYHVHTEVGNKCYAARVNQRYVPLTYTLKTGEQVEILTKKDREPNRDWLVNSL
                     GYIKTARARDKLRHWFRQQDRSKNLEVGRELLNKELSRLAIHPKSIDLNDYSSHFNVK
                     TGDDILVSLVSGDISLHALINQINRQMHLDQDEPELVLKPTLNPRASHTLSAHGILID
                     GLDNVELHIAQCCQPVHGESIAGYITLNRGVSIHKVLCSDYQRMIKQEPERAVEADWE
                     MQPTRGQSVQIVVEAYDRRGLLKDLTQVIFSDQINIRQVNTISEADGIANMKLLIEVK
                     GLAQLSRLLARLEQQPGIISARRMIQGV"
     gene            complement(672184..672957)
                     /locus_tag="ABZJ_RS03165"
                     /old_locus_tag="ABZJ_00618"
     CDS             complement(672184..672957)
                     /locus_tag="ABZJ_RS03165"
                     /old_locus_tag="ABZJ_00618"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002125966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_000682841.1"
                     /db_xref="GI:446605495"
                     /translation="MKHSILISGAAQGIGAEIARVFYQRGYKVGIYDINESLAQNLAQ
                     ELGPNACAGYLDVSDYSQWQHILKEFTDWAGELNILVNNAGILYSGAFENIDIKSHQR
                     TININVNGVINGCHAALPYLKQASFARVINLSSASAIYGQADLISYSASKFAVRGITE
                     GLDVEWKKYGIRVLDVMPLFVQTAMVNNMDAGSIQNMGVDLTPNDIAQQVLSLVEKKA
                     HFWTPTHTPVGIKTKLLYQLSTISPQFLNRLTNIYLSRK"
     gene            673069..673875
                     /locus_tag="ABZJ_RS03170"
                     /old_locus_tag="ABZJ_00619"
     CDS             673069..673875
                     /locus_tag="ABZJ_RS03170"
                     /old_locus_tag="ABZJ_00619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000359484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate pyrophosphohydrolase"
                     /protein_id="WP_000359483.1"
                     /db_xref="GI:446281628"
                     /translation="MDKLLKIMQELREKCPWDQEQTPMSLTKYAIEEAYEVEAAIRQG
                     DINEIRNELGDLLLQVVFQSQMFSEQGAFNFQDVVEAISEKLVRRHPHVFQADQFNNL
                     TPEQVSELWEQIKQQEKQGKPQSRLDEIKHGPALSQAQEIQKNVAKVGFDFETVEDAY
                     TKLEEELDEFKQALKNQNSNEIQDEFGDCLFSLVNVGRKLGISSESSLLSTIHKFRSR
                     FAFIEEQAIKQQRTLEDMTLSEMDELWNQAKRQLKSGEKPHAIQHEILEK"
     gene            673844..674254
                     /locus_tag="ABZJ_RS03175"
                     /old_locus_tag="ABZJ_00620"
     CDS             673844..674254
                     /locus_tag="ABZJ_RS03175"
                     /old_locus_tag="ABZJ_00620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005112082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_002017231.1"
                     /db_xref="GI:487943765"
                     /translation="MQYSMRFWKNKYFVLIILCLGVISPSVYAQSFDQNFQEWKAKQQ
                     MYDQKLNITKSSHSNGSKISQTKNFNDSTGQIHLNQANVNEFQQLKGVGEKKAQAIVE
                     YRQKNGSFKNIDEIKNVKGIGPAIFEKNKSRLAL"
     gene            674379..675842
                     /locus_tag="ABZJ_RS03180"
                     /old_locus_tag="ABZJ_00621"
     CDS             674379..675842
                     /locus_tag="ABZJ_RS03180"
                     /old_locus_tag="ABZJ_00621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001194205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="poly(A) polymerase"
                     /protein_id="WP_001194207.1"
                     /db_xref="GI:447116951"
                     /translation="MQTLRASKCGLSTAQLPSSILDVIDSLTKAGYEAYIVGGGVRDL
                     MLGLNPKDFDAVTNATPSQIKEVFGRRCRIVGRRFELAHVYSGRELIEVATFRAPPKK
                     AVTSASGMILRDNNWGTIEQDFARRDFSINTLYYQPRKGIVLDFCKAIDDVKSKTLRL
                     LGDPVQRFEEDPVRMLRTLRFAAKLNFKIDSAILDIFDVEMTQLLRDVSPHRLYDESQ
                     KLFTMGHLARVLPMLIDFGVWKQLFADIRPDLTPFIQRAAKNTDQRIQVGKTINPAFF
                     YAVLLWQPFLERCDFYLSKGVVPAEARAQAGLDVLKRQATRTVIPRFAETFIREVWEM
                     QTRLLNPKPQQIEALASHARFRAGFDFLLLREKSGDDTTQGMGSWWEAYQEMSNDEKE
                     AAISQYNRQKAKSRRKVAAEPVESNKVDTEIEPLVDVPESRSRRGKKERARQEQSIDR
                     FIEKSSAAQTNVMSDHPILKRKRVQRDLSQVIFGPTQ"
     gene            675839..676321
                     /locus_tag="ABZJ_RS03185"
                     /old_locus_tag="ABZJ_00622"
     CDS             675839..676321
                     /locus_tag="ABZJ_RS03185"
                     /old_locus_tag="ABZJ_00622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000219221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="WP_000219213.1"
                     /db_xref="GI:446141358"
                     /translation="MTVTTYIGLGSNLGDSRQILSEAIAKLKSLGEVKVSKLYQSPPM
                     GPQDQPNYLNAVAQLKTELLPLDLLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNE
                     KIQNERLTVPHVGILQRDFVVIPLLDLDADLHINDQPLKNLELIQQPTLTVLADESWA
                     "
     gene            676367..677176
                     /gene="panB"
                     /locus_tag="ABZJ_RS03190"
                     /old_locus_tag="ABZJ_00623"
     CDS             676367..677176
                     /gene="panB"
                     /locus_tag="ABZJ_RS03190"
                     /old_locus_tag="ABZJ_00623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004698602.1"
                     /note="catalyzes the formation of tetrahydrofolate and
                     2-dehydropantoate from 5,10-methylenetetrahydrofolate and
                     3-methyl-2-oxobutanoate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="WP_000624763.1"
                     /db_xref="GI:446547417"
                     /translation="MISLSDLRKFKAEGRKFSCLTCYDASMAKAMELAEIDTILIGDS
                     LGMAIQGRDSTLPVTVEDMAYHTAAVRRGNQHALIMTDLPFMSYATLNDALQNAKTVM
                     QAGAQMIKIEGGAWLSETVQVLTRNGVPVCVHLGLTPQSVHVFGGYKLQARTREAADQ
                     LIADCTAVVEAGAAVLLLECVPAQLGQEIAELFPNTPVIGIGAGNATDGQVLVVQDML
                     GLTFGRVARFVRNFMKEQSGETAILDAFKAFHAAVQDQSFPAKEHTFQVEL"
     gene            677180..678028
                     /locus_tag="ABZJ_RS03195"
                     /old_locus_tag="ABZJ_00624"
     CDS             677180..678028
                     /locus_tag="ABZJ_RS03195"
                     /old_locus_tag="ABZJ_00624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004698600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="WP_000846362.1"
                     /db_xref="GI:446769106"
                     /translation="MKTETTIQGLAASLNPARAARKIIGFVPTMGNLHEGHLTLVREA
                     KKLCDVVVVSIFVNPTQFGPGEDFDNYPRTLEQDSRLLADVGCDIIFAPSVEQMYGTQ
                     PRLTNISVSQITDDLCGSSRPGHFDGVALVVTKLFNIVQPNYAFFGQKDYQQLAVIRQ
                     FVQDLNIPLEVIGVPIVRAEDGLALSSRNGYLTPEQRQVAPVIYQGLKQAEEQLHQGK
                     DLQQVLADLKTLLTDNGFVVDYVEARQPNLLAASQFDRDIVLFVAAKLGGTRLIDNLQ
                     VAFTPQ"
     gene            678051..678902
                     /locus_tag="ABZJ_RS03200"
                     /old_locus_tag="ABZJ_00625"
     CDS             678051..678902
                     /locus_tag="ABZJ_RS03200"
                     /old_locus_tag="ABZJ_00625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002000564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glmZ(sRNA)-inactivating NTPase"
                     /protein_id="WP_000821671.1"
                     /db_xref="GI:446744415"
                     /translation="MKRILIVTGQSGSGKSSALQVLEDLGYYCIDNLPLALLPEIVAK
                     LDHENNLEQLALGVDVRSTRADMQEFDHVFEQLQKHGTVDVIYLTTQDQDLIARFSAS
                     RRPHPLANRFKSLLQCIHEEKQLLIPIQFRATVHIDTTDKSVHDLKHILLSKLGQSDN
                     LIVILQSFGYKHGIPLDADYVFDVRHLPNPHWDLELRRFSGLDEPVKQFLEASPQANE
                     MFEDILHFLKKWLPAFAEGHRHYMTISIGCTGGQHRSVYMVDRLKQALEAEWSVQVLH
                     REMKHWS"
     gene            678899..679168
                     /locus_tag="ABZJ_RS03205"
                     /old_locus_tag="ABZJ_00626"
     CDS             678899..679168
                     /locus_tag="ABZJ_RS03205"
                     /old_locus_tag="ABZJ_00626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000567533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphocarrier protein HPr"
                     /protein_id="WP_000567533.1"
                     /db_xref="GI:446489679"
                     /translation="MIDTTVDVINKLGLHARASGKLIEVTTKFRSSIQIGKGDHLVDA
                     KNIMSLLMLGAGKGTTLRLVIDGTDEEQALNEVQALFAAKFYEAD"
     gene            679171..679707
                     /locus_tag="ABZJ_RS03210"
                     /old_locus_tag="ABZJ_00627"
     CDS             679171..679707
                     /locus_tag="ABZJ_RS03210"
                     /old_locus_tag="ABZJ_00627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004748281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000124014.1"
                     /db_xref="GI:446046159"
                     /translation="MARRPKRYTEEDFDSLEGRASKTEQKKAVQRMAALGEQLAQLSI
                     KQIQKLPVDERLIDALLEVQNISSFEARRRQFQRVGKLLRNEDETVILSYLTPQQGAK
                     KQAQLMRWVDRMIEQGDPAINEFSKIYNASERHTLRQHVLRINRDKTQQVAEADLEAT
                     KMKFINYVQQVALLSDQG"
     gene            complement(679769..681397)
                     /locus_tag="ABZJ_RS03215"
                     /old_locus_tag="ABZJ_00628"
     CDS             complement(679769..681397)
                     /locus_tag="ABZJ_RS03215"
                     /old_locus_tag="ABZJ_00628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000253063.1"
                     /note="activates fatty acids by binding to coenzyme A;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_000253052.1"
                     /db_xref="GI:446175197"
                     /translation="MVSAYNELPRTPANFVALSPLRYLERAAYIYPDQASIIHGNRQI
                     SWKQTYQRCRQFASQLQQLGIVKNDTVSVLLPNVPAMIEAHFAVPMAGAVLNTLNTRL
                     DAKTIAFMLEHAETKVLLVDPEFVNLAREALSLIPNQHIIVIDVADEEYEGENQFLGS
                     FEYEEWLAQGDANFEWQLPEDEWDAISLNYTSGTTGNPKGVVYHHRGAYLNAASNILA
                     CGMKPRAVYLWTLPLFHCNGWCFAWSIAASGGTNICLRKVDPELVMQLIAKHKVDYFC
                     GAPIVLSMIINLPKEKQPSIEHHVEVMVAGAAPPVAVIEGMRNIGINVNHVYGLTETY
                     GPSALCASQAGWSDLSITEQAQLHSRQGVPYPLQDSMRVLDPETMQPVPNDGETMGEI
                     MFRGNIVMKGYLKNPKATEEAFAGGWFHTGDLAVCHPDGYAKITDRSKDIIISGGENI
                     SSLEVEDVLYKHPAVLTAAVVAKPDERWQEVPCAFIELKTGASVTPEEIIEHCQKELA
                     RFKVPKDVVITEIPKTSTGKLQKFILREWAKERA"
     STS             680382..680862
                     /standard_name="D1S3689"
                     /db_xref="UniSTS:474267"
     STS             680382..680807
                     /standard_name="D1S3689"
                     /db_xref="UniSTS:474267"
     gene            681809..683731
                     /locus_tag="ABZJ_RS03220"
                     /old_locus_tag="ABZJ_00629"
     CDS             681809..683731
                     /locus_tag="ABZJ_RS03220"
                     /old_locus_tag="ABZJ_00629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017402730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="WP_001121792.1"
                     /db_xref="GI:447044536"
                     /translation="MPIITLPNGDQKSFDHPVSVMEVAQSIGPGLAKNTVAGRVNDRL
                     VDACDLITEDSTLQIITPKDEEGLEIIRHSCAHLVGHAVKQLFPEAKMVIGPVIEEGF
                     YYDIWMPRPFTLDDMAAIEERMKKLIDQDYDVIKKMTPRDEVIKVFTDRGEEYKLRLV
                     EDMPEEKAMGLYYHQEYVDMCRGPHVPNTKFLKSFKLTKISGAYWRGDAKNEQLQRIY
                     GTAWADKKQLAAYIKRIEEAEKRDHRKIGKALDLFHMQEEAPGMVFWHANGWTIYQVL
                     EQYMRKVQQDNGYQEIKTPQIVDFTLWEKSGHAANYAENMFTTHSESRNYAVKPMNCP
                     CHVQVFNQGLKSYRDLPIRLAEFGSCHRNEPSGSLHGIMRVRGFTQDDAHIFCTKEQI
                     GKEVADFIKLTLDVYKDFGFEEVQMKLSTRPEKRVGDDALWDLAEKSLADALDAAGLE
                     WELQPGEGAFYGPKIEFSLKDCLGRVWQCGTIQCDFNLPVRLDASYVTEENERDQPVM
                     LHRAILGSFERFIGILIEHYAGFMPPWLSPVQACVMNITDSQAEASEQVVAKLKENGL
                     RAISDLRNEKIGFKIRERTLERIPYLLVLGDREVEEGTVNVRTRSGKNLGTMSVDAFI
                     DLVKSAVAERGRYIVE"
     gene            683875..684288
                     /locus_tag="ABZJ_RS03225"
     CDS             683875..684288
                     /locus_tag="ABZJ_RS03225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018677531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="WP_031944406.1"
                     /db_xref="GI:690969496"
                     /translation="MRAAEDADLDLVEIVANAEPPVCKIMDYNKHLFDLKQKQKDAKK
                     KQHQVQVKEIKLRPATDVGDYQVKLRAILKFLEEGNKVKITLRFRGREMAHQQLGLAQ
                     LQKIEADVAELGVVEQAPKMEGRQMGMLLGPKKKK"
     gene            684495..685115
                     /locus_tag="ABZJ_RS03230"
                     /old_locus_tag="ABZJ_00630"
     CDS             684495..685115
                     /locus_tag="ABZJ_RS03230"
                     /old_locus_tag="ABZJ_00630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017393486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_000566573.1"
                     /db_xref="GI:446488719"
                     /translation="MIDLYYWGTPNGHKITIALEEMGLDYTLYPINILENDQFQPDFL
                     KISPNNKIPAIVDQDGPRGEPISVFESGAILQYLGRKTGLFYPKDEQERVEVEQWLMW
                     QMGGLGPMLGQNHHFNRFAPEKIPYAIDRYVNETKRLYGVLNKQLIGQKFVAGEYSIA
                     DMAILPWILRYEWQGIQLEDYPYVQEYIVRLTARPAVQKALSIKVI"
     gene            685168..685596
                     /locus_tag="ABZJ_RS03235"
                     /old_locus_tag="ABZJ_00631"
     CDS             685168..685596
                     /locus_tag="ABZJ_RS03235"
                     /old_locus_tag="ABZJ_00631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016804444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000954155.1"
                     /db_xref="GI:446876899"
                     /translation="MLSYFLLFLSAFGAATLLPLQSEAVLAALLLKNQHSAFLLILIA
                     TFGNVLGSCINWWLGLKIEQFKHKKWFPVSEKRLEQAQRFYHKYGFYSLLLSWTPVIG
                     DPITLVAGLFKENFWRFLFMVLIAKAGRYIFIYWVITGFI"
     gene            complement(685636..686886)
                     /locus_tag="ABZJ_RS03240"
                     /old_locus_tag="ABZJ_00632"
     CDS             complement(685636..686886)
                     /locus_tag="ABZJ_RS03240"
                     /old_locus_tag="ABZJ_00632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001169061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_001169063.1"
                     /db_xref="GI:447091807"
                     /translation="MQKHDAFAALRYRDFSIVTINQFCLTLAILIQEIIVAYSLYQIT
                     KDPLTLGLIGLAEAIPFIALSLWGGYFADKFNKQVIMKICLFFSVPLPLVLWLLFHLH
                     GLGHISVNFLSWGIYAVIFGLGTIRGFYNPSATSLKPFLIPRELYANGATWTTIGWQS
                     GVIIGPMLGGFMLAYLGRETSLFSVAGLLTICFILINLLHKRSFPKIETANVLESLGD
                     GFRFIWKTKIVLWAISLDLASVLFGGVIALLPIFAEDILKVGPEGLGYLRAAPSIGAL
                     ITMIALTRFPPTQHAWRNMLLAVAGFGVFTILFAFSNNMWLSLFALAMTGACDSISVV
                     VRQTILQIFPPENMRGRVAAVNGMFVSSSNELGAFESGLAAKYLGTIAATIFGGCMTL
                     AVVTFCWLKTNDLFKVDITKSSED"
     gene            687135..687329
                     /locus_tag="ABZJ_RS03245"
                     /old_locus_tag="ABZJ_00633"
     CDS             687135..687329
                     /locus_tag="ABZJ_RS03245"
                     /old_locus_tag="ABZJ_00633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004842459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="WP_001096359.1"
                     /db_xref="GI:447019103"
                     /translation="MAKLKTRRGAAKRFKATANGFKRKQAFKRHILTKKSAKRIRQLR
                     GCVMVHVSDVASVRRMCPYI"
     gene            687341..687699
                     /gene="rplT"
                     /locus_tag="ABZJ_RS03250"
                     /old_locus_tag="ABZJ_00635"
                     /note="50S ribosomal protein L20; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            687790..688347
                     /locus_tag="ABZJ_RS03255"
                     /old_locus_tag="ABZJ_00636"
     CDS             687790..688347
                     /locus_tag="ABZJ_RS03255"
                     /old_locus_tag="ABZJ_00636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002002533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000650943.1"
                     /db_xref="GI:446573597"
                     /translation="MKDEKFLNDLIQKIQQGHQFKYLYFWGHTPKKANLIDKSCFSQW
                     FPAQFNVEGIEYFTAEHYMMAQKAKLFNDKEIFAQILQVKHPNEAKQLGRKVRNYNEQ
                     IWQEKRFDIVVQANFAKFSQHPELKKFLLATKDRILVEASPVDKIWGVGMAQDHPHIQ
                     DPSLWQGLNLLGFALIHVRELLLTE"
     gene            688406..688909
                     /locus_tag="ABZJ_RS03260"
                     /old_locus_tag="ABZJ_00637"
     CDS             688406..688909
                     /locus_tag="ABZJ_RS03260"
                     /old_locus_tag="ABZJ_00637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000803552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone acetyltransferase"
                     /protein_id="WP_000803551.1"
                     /db_xref="GI:446726238"
                     /translation="MKPLNDTDIRIASFKDALSIAEVHVQSWKETYTGMIKQEILNEL
                     NVLDKQQLWKEISRSPDHKLFIYTENGVVKGFLDGYLNPENNIAEIRAFYLLREIQRK
                     GVGRALFQKFYQCALNQGYAFIRLEVFNKNPSRFFYEKMGAKLTGEAELPEFGLGITE
                     LFYEWQL"
     gene            complement(688916..689917)
                     /locus_tag="ABZJ_RS03265"
                     /old_locus_tag="ABZJ_00638"
     CDS             complement(688916..689917)
                     /locus_tag="ABZJ_RS03265"
                     /old_locus_tag="ABZJ_00638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001256591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001207245.1"
                     /db_xref="GI:447129989"
                     /translation="MALNQIWKQQLTLVTYGNEYLRQNLSFSQWRQHHIFDQHSFQFR
                     DLISQHLLAQHFQVWLEALKKQGTTQISLHLSTILNEEQNPNNNVELLPYAHFIVSHQ
                     NNKKIAWIFGHELAEWYSNDNEFEPPLTQRSDLRLETFWRFELNEKLSKKVEADLKAP
                     QWDEISDFMETELFRSKYAAGFEEPEFQKKYFDGSTHQISVEHQPTLALIPESYPADC
                     AHQLLYRTQALSDYLEQKKRTANDPLGEDLDQEQIINLRNFTHKTDDLFAKLIVKAAN
                     HYQTAQLKPVEKPSPFDTTNESATHLKAPHHKAGGTGVIKLIVLTIIICALAYYFGL"
     gene            690075..691055
                     /locus_tag="ABZJ_RS03270"
                     /old_locus_tag="ABZJ_00639"
     CDS             690075..691055
                     /locus_tag="ABZJ_RS03270"
                     /old_locus_tag="ABZJ_00639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005804291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit alpha"
                     /protein_id="WP_000050953.1"
                     /db_xref="GI:445973098"
                     /translation="MSLEALTTEALAAIAAAQDLVALDQVRVQFTGKKSQLAEQSKAL
                     GKMDPEERKVQGAAIHAVRETINNALTERQTALQQAALAQKLASETIDITLPGRGQRV
                     GTVHPVTQVQERICQFFTKAGFTVATGPEVEDDYHNFEALNIPGHHPARAMHDTFYFD
                     ANHLLRTHTSGVQIRTMETSQPPIRIVCPGRVYRCDSDQTHSPMFHQIEGLYVAENTS
                     FAELKGLLINLLNEFFEKDLKVRFRPSYFPFTEPSAEVDIMDERGRWLEVLGCGMVHP
                     NVLRAAGIDPDKYKGFAFGLGVERFAMLRYGINDLRMFYQNDVRFLRQFA"
     gene            691089..693470
                     /gene="pheT"
                     /locus_tag="ABZJ_RS03275"
                     /old_locus_tag="ABZJ_00640"
     CDS             691089..693470
                     /gene="pheT"
                     /locus_tag="ABZJ_RS03275"
                     /old_locus_tag="ABZJ_00640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011858377.1"
                     /note="catalyzes a two-step reaction, first charging a
                     phenylalanine molecule by linking its carboxyl group to
                     the alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; forms a tetramer of
                     alpha(2)beta(2); binds two magnesium ions per tetramer;
                     type 2 subfamily; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="WP_000703074.1"
                     /db_xref="GI:446625728"
                     /translation="MKISENWLRTWVNPAIDSDTLSDQLTMLGLEVDELAPVAKPFTG
                     VVVGEVLTVEQHPDADRLRVTTVNIGSGEPLQIVCGAPNVRAGMKAPVATIGAILPGD
                     FKIKKGKLRGVESQGMLCGASEIDLEDKIDGLLELPDDAPVGVNIREYLKLDDNVIDI
                     SITPNRGDCFSIRGIAREVAVINQLQMNEPEIKSVDATITDEKKVVINTDGAPRYLGR
                     VIKNVNVKAATPEWMEQALARSGIRTHSILVDVTNYVLMELGQPMHAFDLAKIEGTVH
                     VRQAQPQEKLQLLNDQEVELQDDVMVIADDQKALAIAGIMGGLASSVTDDTTDIFLES
                     AFFAPLAIAGRARRFGLHTDSSQRYERGVDFELPLIAMNRASQLIQELAGGEFGPITV
                     VEKSDLLPKREAIELKQAQVDQLLGYKVAAEFITDALTRLGCEVTVQANGEWSVVPPS
                     HRYDMAIYQDLIEEVARIDGYDNIQISLPSMDVQLAKYQDRFEIAQLRQTVVTLGYQE
                     AISFSFADAKLEKQLNPQVSPLMLANPISSDLAVMRSTLLSSLIPCVQYNLNRQQSRV
                     RFFELGLRFDYQNANSIQDLKQIPTLALVAVGSREPESWHAKPQPMDFFDFKGEVEEI
                     LAAGRVKVEYVRSERPWLHPGQSAEILVDGQSIGYLGRLHPSLENELDLSTTWVAELD
                     QAAVLQSYVSNFTELSRFPSVRRDIALLISDNINVRDIQQLIEKTGGELLDSTWLFDV
                     YTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIQVLENTYQATLRAS"
     gene            693467..693763
                     /gene="ihfA"
                     /locus_tag="ABZJ_RS03280"
                     /old_locus_tag="ABZJ_00641"
     CDS             693467..693763
                     /gene="ihfA"
                     /locus_tag="ABZJ_RS03280"
                     /old_locus_tag="ABZJ_00641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005016170.1"
                     /note="This protein is one of the two subunits of
                     integration host factor, a specific DNA-binding protein
                     that functions in genetic recombination as well as in
                     transcriptional and translational control; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor subunit alpha"
                     /protein_id="WP_000126166.1"
                     /db_xref="GI:446048311"
                     /translation="MTALTKADMADHLSELTSLNRREAKQMVELFFDEISQALIAGEQ
                     VKLSGFGNFELRDKRERPGRNPKTGEEIPISARRVVTFRAGQKFRQRVGNEQID"
     gene            complement(693933..694178)
                     /locus_tag="ABZJ_RS03285"
                     /old_locus_tag="ABZJ_00642"
     CDS             complement(693933..694178)
                     /locus_tag="ABZJ_RS03285"
                     /old_locus_tag="ABZJ_00642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004738193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000897685.1"
                     /db_xref="GI:446820429"
                     /translation="MLFKKFAVAAAVAATLAFVGCSKKEEAPAAGAASEAVAAASEAT
                     AAASEAAVAVDAAASETAAAASDVAAAASDVAASAAH"
     gene            complement(694593..695861)
                     /gene="rho"
                     /locus_tag="ABZJ_RS03290"
                     /old_locus_tag="ABZJ_00643"
     CDS             complement(694593..695861)
                     /gene="rho"
                     /locus_tag="ABZJ_RS03290"
                     /old_locus_tag="ABZJ_00643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752801.1"
                     /note="An RNA-DNA helicase that actively releases nascent
                     mRNAs from paused transcription complexes; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_001054522.1"
                     /db_xref="GI:446977266"
                     /translation="MNLTELKKKPIGELIKIAEFMGLEGMARNRKQDIIFAILKRHAM
                     NGEEIFGDGVLEILSDGFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIR
                     PPKEGERYFALLKVNQINYDTPENSRNKILFENLTPLFPTEQLVMELGNGTTEDLTAR
                     VVDLVAPIGKGQRSIIVAPPKAGKTMLLQNIAQSIVRNNPEVFLIVLLIDERPEEVTE
                     MERTVRGEVVASTFDEAPARHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNT
                     VIPSSGKVLTGGVDAHALERPKRFFGAARNIEEGGSLTIISTALIETGSKMDDVIYEE
                     FKGTGNQEITLDRRIAEKRVFPAMNIKKSGTRREERLMDEDKLRKVWILRKLLHPMDE
                     LAAMEFLLDRMKETKTNDDFFDQMKRKAST"
     gene            complement(696183..696509)
                     /locus_tag="ABZJ_RS03295"
                     /old_locus_tag="ABZJ_00644"
     CDS             complement(696183..696509)
                     /locus_tag="ABZJ_RS03295"
                     /old_locus_tag="ABZJ_00644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005804292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_001276875.1"
                     /db_xref="GI:447199619"
                     /translation="MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLE
                     DLSSEYAGKVKIVKVDVTSCEETAVKYNIRNIPALLLFKNGEVVAQQIGAVPRSKLVS
                     FIDENV"
     gene            696789..698309
                     /locus_tag="ABZJ_RS03300"
                     /old_locus_tag="ABZJ_00645"
     CDS             696789..698309
                     /locus_tag="ABZJ_RS03300"
                     /old_locus_tag="ABZJ_00645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolyphosphatase"
                     /protein_id="WP_001279274.1"
                     /db_xref="GI:447202018"
                     /translation="MSDFLIDEELLAAIDMGSNSFHLAIARVDHGEVKKVASMSEKVQ
                     LAAGLDENKNLTEAAQQRGLACLARFVGRLGSVQPNRLRIVATNALRQAKNGHEFIQK
                     AAEILPKPIEIIAGREEARLIYLGVSHTMANGGRRLVVDIGGGSTEFIIGEEFEPIYT
                     ESLQMGCVAYTKAYFADGEITQKAFDKAVVAARKELSAIATTYKMEGWDTVVGSSGTI
                     KACRQIMVNMGLSDEQENVTREGLHKLKDKLLKFKNISEIDFEGLREDRRAVLPAGLA
                     ILYAVFEVLEIERLAYSDGALREGVMYDLLGRFKHEDIRDRSVQALMGRYNADPKQAE
                     RVVNTAQYLFDSVAKPLNLTSEDSDLLRRAAYLHEIGLAISHGGYHRHGAYLLQHSDI
                     PGFSQIDQNHLSHLVAHHRRKLRNDVKNEVLKAGGHKLVYLSLLLRLAVLLNHSRSDQ
                     MLPAIELTIINDQQWQLSVSGDAKQWPLLVADLHDEQEQFKHWDIELNIQSEKFID"
     gene            698328..699149
                     /locus_tag="ABZJ_RS03305"
                     /old_locus_tag="ABZJ_00646"
     CDS             698328..699149
                     /locus_tag="ABZJ_RS03305"
                     /old_locus_tag="ABZJ_00646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000710402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase subunit alpha"
                     /protein_id="WP_000710404.1"
                     /db_xref="GI:446633058"
                     /translation="MKKATQSKAWTTVQIARHPERPQFLDYVGEIFTEFDALHGDRLF
                     GDDGAMVGGLARFDGQPVMVIGQHRGRSTREKLKHNFGMCNPEGYRKSQRLLDMAERF
                     NLPVFTFIDTMGAYPGVGAEERGQAEAIATSLAQLSSLKVPVIATVLGEGGSGGALGI
                     GVADRVIMLSHSIYSVISPEGCASILWKTAEKAAQASEALGLTADKLQSLGIVEYVVD
                     EGEGAHLDPERVMQNLKVVLKQALDELLPMDANERCEARYQRLMKFGSENLGVAS"
     gene            699206..700488
                     /locus_tag="ABZJ_RS03310"
                     /note="tRNA(Ile)-lysidine synthetase; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            700466..701296
                     /locus_tag="ABZJ_RS03315"
                     /old_locus_tag="ABZJ_00647"
     CDS             700466..701296
                     /locus_tag="ABZJ_RS03315"
                     /old_locus_tag="ABZJ_00647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004735917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="WP_000179688.1"
                     /db_xref="GI:446101833"
                     /translation="MATAVNCNICFIGGGNMAQALIGGLISRGLPPTRITVSDPVEQI
                     RQLLQEKEVHVTQDNTAAIQNADVVVLAVKPQVLANVLRPLKGLLSDKLVISIIAGAE
                     IKTISNLIDSERIVRVMPNTPALVQTGAHGIYATDVVGASDRELTSQILAATGLTIWV
                     NSEAQIDAVTAVSGSGPAYFFYLMESMIRAGKNLGLDEKVATALTLQTALGAAQMAIT
                     SSNTPSELRKNVTSPNGTTQAALEVFDRAQISQNIQSALAAAQKRSQELAQELSDSAK
                     "
     gene            701318..701887
                     /locus_tag="ABZJ_RS03320"
                     /old_locus_tag="ABZJ_00648"
     CDS             701318..701887
                     /locus_tag="ABZJ_RS03320"
                     /old_locus_tag="ABZJ_00648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004836086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000501183.1"
                     /db_xref="GI:446423328"
                     /translation="MGANSALIFGILINVAILLVFFRFLMQLAAVSPYNPVVLSTVKA
                     TKIVDIFGRIFPTVAKGRFNLAALVLLIILYLLKIFGVMYLSGSMPNSPVHLVILTFV
                     TMIQDLIRFCRYLIFATIILSWVVMFTQSRSPYIEVIQDLAEPLLAPFRRLLPNMGMI
                     DLSPILAFLALYIAEILMNEVAKVLLTGL"
     gene            complement(701947..704718)
                     /locus_tag="ABZJ_RS03325"
                     /old_locus_tag="ABZJ_00649"
     CDS             complement(701947..704718)
                     /locus_tag="ABZJ_RS03325"
                     /old_locus_tag="ABZJ_00649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001134666.1"
                     /note="has 3'-5' exonuclease, 5'-3' exonuclease and
                     5'-3'polymerase activities, primarily functions to fill
                     gaps during DNA replication and repair; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_001134660.1"
                     /db_xref="GI:447057404"
                     /translation="MPPFVLVDGSYFLFRAYHALPPLTTSTGLHTNAIRGAISAIQKL
                     MRRMQPTHMAVIFDTPEPTFRHKLSPIYKGDRPTMPEELSQQIPYLHALIKAQGIPLY
                     SLPGAEADDIIGTLAKRAVKEGHHVLISTGDKDMAQLVNDYVKLEDSFKDRVLDTDGV
                     FEKFGVWPNQIIDYLTLMGDASDGIMGVPGVGAKTAAKLLTEYGTLDNIIANVDQLKG
                     KLSQNIKDNLDNIKLDHQLASIVCDLPLELDWHELKLTDPNVDALRNLYTELEFRNQL
                     QSLDHPNNPNSSSYKQQASQTIVQNEVKPAQTIETEDQASLTSQDDQLGTANYHTVLT
                     QEAWDQLWQRMQNADHFAIDTETTSLDYRIAEMVGFSIAFDAKDAYYVPLAHNYENAP
                     QQLDREQVLAQIKPILENEAVKKIGHHLKYDAHIFANHGIELKGWYFDSMLASYVLNA
                     AATRHGMDDVARVYLSHLTTTFEQIAGKGAKQKTFNQIEIEVAAHYAAEDAHVTYRLY
                     EVLSNKLKAHPELENILYNIEMPVARILSGMEEDGIRLDHAFLDKLSVEFAKTMEDLE
                     NQAMEIAGETFNIASPKQVGEILFDKLGIKGGKKTATGQYSTSESVLEKIEHPLTEII
                     LEHRGLAKLKSTYTDRLIEQSHNDTHRVHTSYHQALTATGRLSSSDPNLQNIPIRRQI
                     GRQIRKAFIAPEGRVLLAADYSQIELRLMAHFSQDDALVHAFQHGQDVHRRTAAEVLG
                     IAIEDVTNDQRRQAKAVNFGLLYGMSEFGLIRQLGFTREESQNYIKQYFQRYPGIYEY
                     MQRTRQVASEQGFVETILGRRLYTPDIDARNVMVRKAAERAAINAPLQGSAADIIKLA
                     MIEVDKILPKDQAKLLLQVHDELVFEVDSNIADELSKQIADVMQSVLEISVPLVVEVG
                     QGKNWDDAH"
     gene            704873..707680
                     /locus_tag="ABZJ_RS03330"
                     /old_locus_tag="ABZJ_00650"
     CDS             704873..707680
                     /locus_tag="ABZJ_RS03330"
                     /old_locus_tag="ABZJ_00650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017816313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000276857.1"
                     /db_xref="GI:446199002"
                     /translation="MYKKDKQGMIIVLIALTLFLAISIGFKFQSAVVALSIAFTVILV
                     QSLSSLHQRLTHLEQQFSHQTTPLYSIHMQRTVIYTAALVALVAYINHWMWIAGGALL
                     VLLLCLIQTISAFHTRLLFLETAKQTVNVNESIHTEVITPVLGQVDPNNITEPALPGT
                     IALNQEKQTVRTQTTAWWQPAVDWMIHGNPILRVAVAVLMVGVVLLLRFASEHWQLSL
                     GVKLGFIAIAGGVLTAFGYTLQKKNQLFAVALQGVGLAVVFLTLVFSHHFGVITSLTT
                     ASILFTILLAITVFLSLKQQAIYLAILALGMAYAAPLVIPQYRPDVVFLFSYYLVINL
                     AVAAVNFIQPWKILNQIAFFATMFIGGSAIVFYAEPAKFDTLDWILWLHIALFIWLSV
                     RYSQNISRVSEHEKQEGIRLPPLLDVGLIFSVPVLGFTLHAYLVHESTQALTIGAAVL
                     AGIYAVLTFWIKKTHPQLSVLAKSFFILAVAFFALIFPLAKGAHWTAIGWVAQGTALI
                     VWGVTERYRLSRYIGVILVLLSSLALFYQVWANEEFPTLSTSIYAIAQFISAFYLLQY
                     NSKEQRYFSASLFSGIFLCLGMYAGAVAGVEIMAWHHHALSPYLMFAIALIAIFSAIV
                     HYKLRVQWQSLQLILISLLLLLVLGEAFASQVFTLFKWVDSLQQTTFLVSTIILSGLF
                     IMAQPQSSHLGYVKVWAGLSWLALAIVGVAIFPKMPIVALAFVPVIYSLWAYKTHKTT
                     LLHQIPVWCLSLSWLLVVSVDVHSAEYLYFVPLFNLTDFLSIVVFAGLLFIIYQHAFD
                     QDKSLEWTFKITTILVGLLVFSSVVVRGLHHYWATPLWSASIWTNGVVQLSLTLLWVI
                     LAFVLTTYSSRKMIRQLWFVGAALLGIVVLKLILLDLSQSATLTRVISFIGAGGVMLI
                     IAYLAPLPPSSSVQKNQEPKL"
     gene            complement(707670..708587)
                     /locus_tag="ABZJ_RS03335"
                     /old_locus_tag="ABZJ_00651"
     CDS             complement(707670..708587)
                     /locus_tag="ABZJ_RS03335"
                     /old_locus_tag="ABZJ_00651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000785635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein"
                     /protein_id="WP_000785635.1"
                     /db_xref="GI:446708289"
                     /translation="MADSSIPKDIADSLKSIFTNINTERISEILVGVVLCFIGFVLAR
                     IISNTFIRTVGSRFNAHQRLVWRRGIFYFIFLLFIMTSLKEAGFKLSVFLGAAGILTV
                     ALGFASQTSASNLISGLFLIGEGSFEVGDTIQITLIRGNTIEGEVISIDLLSVKLLTL
                     DNVYIRLPNEQLIRAPVHNLSKYPIRRIPITLAINFHEDIIKVREVLLNVAANYPLVL
                     DDPKPAVTVTAFRESSIELLFAMWCRQENSLKVRDEMQERIRNGFLDNQIEIPVPKMG
                     LIDRPSTAFAEDDIDQYSNQKELKREPKA"
     gene            complement(708597..709418)
                     /locus_tag="ABZJ_RS03340"
                     /old_locus_tag="ABZJ_00652"
     CDS             complement(708597..709418)
                     /locus_tag="ABZJ_RS03340"
                     /old_locus_tag="ABZJ_00652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000462728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000462729.1"
                     /db_xref="GI:446384874"
                     /translation="MFENNEYQPHPQNSLKWWGEQHFEINQSKAWQFGSMLFRLTRGI
                     KEWRIEYYRPTLQDDNEQDWHIITDANFGFPHSVQVERYMFRKTNPKFLLMPRLADRS
                     VVIKPVDPIYIPAGQRGTLYISTPLWIAGLVESQHEPLFEIPVIQPKDTWFGPNAQQG
                     EICYATSVDGRTDLNLLTPRAFRAVTPIDFHNTSNHQLRFDRMNVPVTALPLFYSEST
                     GRLWTSQIKVYYEGSDRPARIRIENRTPPLAGEVTYVHPPRSPGGALFNMFDSFF"
     gene            709515..711005
                     /locus_tag="ABZJ_RS03345"
                     /old_locus_tag="ABZJ_00653"
     CDS             709515..711005
                     /locus_tag="ABZJ_RS03345"
                     /old_locus_tag="ABZJ_00653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006581348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system protein E"
                     /protein_id="WP_001166319.1"
                     /db_xref="GI:447089063"
                     /translation="MQILKQIQVPYSFAKRHGVLFRYDGDQVFIVRRQNTEKIALQEA
                     RRILGKPAHYQLCTEQEFNSLLSTSYAGDTGESQQVAAGLEDHPDLLSLADQVPETED
                     LMDQEDDAPIVRLINALLSEAIRVGASDIHIEAFEKKLSVRLRVDGQLREIVQPRREL
                     APLLVSRIKVMAKLDIAEKRVPQDGRISLRLAGREVDVRVSTLPSSHGERVVMRLLDK
                     QAGRLNMTHLGLMANDYERLTQLVHRPHGIILVTGPTGSGKTTTLYAALSDLNDNTRN
                     ILTAEDPIEYQLEGIGQTQVNTKVDMTFARALKAMLRQDPDVVMVGEIRDLETAEIAV
                     QASLTGHLVLSTLHTNTAIGAVTRLKDMGIEPFLLSSSLIGVVAQRLVRTLCPHCMTW
                     READTFEKQVFQHIFHEPSLKLPEAQGCDQCSHLGFNGRTAIYEIVPIDEPMRRLIHG
                     NAAEFELENHARQYSGSIRDDGLRKVLSGKTTLEEVLRVTNEASEA"
     gene            complement(711060..711491)
                     /locus_tag="ABZJ_RS03350"
                     /old_locus_tag="ABZJ_00654"
     CDS             complement(711060..711491)
                     /locus_tag="ABZJ_RS03350"
                     /old_locus_tag="ABZJ_00654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003655074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Organic hydroperoxide resistance protein"
                     /protein_id="WP_000051124.1"
                     /db_xref="GI:445973269"
                     /translation="MSLEKVVYRAKAKATGGRDGRATSSDGVLDVQLGVPKEMGGAGG
                     AVTNPEQLFAAGYSACFLGALKFVANRDKFNISKDAYVEGEVGIGPIPTGFSIEVTLN
                     VYLIGMDREEAEKLVAAAHIVCPYSNATRNNIDVTFNIVTE"
     gene            complement(711680..712015)
                     /locus_tag="ABZJ_RS03355"
                     /old_locus_tag="ABZJ_00655"
     CDS             complement(711680..712015)
                     /locus_tag="ABZJ_RS03355"
                     /old_locus_tag="ABZJ_00655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002006184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_002006184.1"
                     /db_xref="GI:487932718"
                     /translation="MDQDCQNLKLENQLCFLIYSTNLALNQLYRKLLTPLGITYPQYL
                     VMLVLWEKDEITVSEIGSKLFLESSTLTPILKKLEALQLLNRTRSKEDERQVIITLSE
                     KGKNLKNRP"
     gene            complement(712176..712553)
                     /locus_tag="ABZJ_RS03360"
                     /old_locus_tag="ABZJ_00656"
     CDS             complement(712176..712553)
                     /locus_tag="ABZJ_RS03360"
                     /old_locus_tag="ABZJ_00656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002054542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000266123.1"
                     /db_xref="GI:446188268"
                     /translation="MWKYLFSIFCLGANIHCYATDFGTTNNFVSPNLQLKQNVLPPTP
                     KNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQ
                     QRNENNPTAKYRARLMKKIADLW"
     gene            complement(712568..713392)
                     /locus_tag="ABZJ_RS03365"
                     /old_locus_tag="ABZJ_00657"
     CDS             complement(712568..713392)
                     /locus_tag="ABZJ_RS03365"
                     /old_locus_tag="ABZJ_00657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-nitrogen hydrolase"
                     /protein_id="WP_000177091.1"
                     /db_xref="GI:446099236"
                     /translation="MTLVSVVQMNSQDDIESNFQVIESLIQQSKAQNASLIVFPENFV
                     CFAAGKQRETAEQFESIQQRLEKLAHQYQIWIVAGTLPCPFRPDGSIIQDGRVRTVSL
                     CISPERTEARYDKIHLFDVQVGDAVGGYQESRFFEPGTDVVVTSTPFGNIGLMVCYDL
                     RFPELALTLRQQGAHLLTAPAAFTYTTGQMHWQLLLQARAMDSQCYVLGAAQQGWHGE
                     KRQTWGHAGATDSRGQVLSMIGYEGNGLITVPFDLAAQELVRTSMPLMMHRKLIHY"
     gene            complement(713419..713940)
                     /locus_tag="ABZJ_RS03370"
                     /old_locus_tag="ABZJ_00658"
     CDS             complement(713419..713940)
                     /locus_tag="ABZJ_RS03370"
                     /old_locus_tag="ABZJ_00658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005239579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-anti-sigma factor"
                     /protein_id="WP_000103064.1"
                     /db_xref="GI:446025209"
                     /translation="MSTGHVEYASLNGTHIFKLIGEVRAHSCISLDKLLNRIEQQENV
                     VGAIVDLTQTTFIDSTVLGILAKLGLKLKQTHHIQAVMLSTNPDITTLANSMGLGQVF
                     VILNYCGDPNVCTLTLNDEHITHNAMLRTVLDAHKTLMKLNANNQNMFEPLVKQLQKE
                     QDTLEQVSDKQNA"
     gene            complement(714043..715011)
                     /locus_tag="ABZJ_RS03375"
                     /old_locus_tag="ABZJ_00659"
     CDS             complement(714043..715011)
                     /locus_tag="ABZJ_RS03375"
                     /old_locus_tag="ABZJ_00659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000465110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stage II sporulation protein E"
                     /protein_id="WP_000273589.1"
                     /db_xref="GI:446195734"
                     /translation="MYFIKPTRSIPFVEQALEALPDLQVIHIDDLDLYDPTIIAIADV
                     QDFLTYKWRLPTIVIAFEHEGSALAQAWEAGALAGWVWNQLPKDLNKALTRIDAQYKR
                     NQDSRDLPSAAELQKRLLPNPIDLLNYEVETFFQPSAYLSGDWYDYWKLNDKEVLFYL
                     ADVSGHGVTSSLLTSWMAAFHGRSKTPRQLIKKLNGMLVQENIEKHITIVVGILNLET
                     HSLRWSSAGHYPPPIIFEPNQPPKILTTSSFPLGLTDELEVEEHVCTLNRHARFIICS
                     DGALEPFDGGLNDQFQQLVQHLQNQSFQAPDHVADDIAIFSLCRMN"
     gene            complement(715123..716025)
                     /locus_tag="ABZJ_RS03380"
                     /old_locus_tag="ABZJ_00660"
     CDS             complement(715123..716025)
                     /locus_tag="ABZJ_RS03380"
                     /old_locus_tag="ABZJ_00660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001109857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001109857.1"
                     /db_xref="GI:447032601"
                     /translation="MNYSNLLLSSLLTVGLYTSAHAQENLTEESAASSEDVTSTQTQH
                     SRPHLQIIKDLKGIKVKDLKINANAAQPDTVKDPLQSLNRPIYSFNDMLDRHVLRPVA
                     VEYREKTPEDVRGSYRQFRKNLGEPWNAVNQLIQGRPGRAAKTLGRFTINTLTTLGLA
                     DPASRLGLPPEEESFGVTLGYYGVPSGPFLMLPFFGPSTLRDGVGLAVDAQARPQKYI
                     MDDQDGLYWSTNLLQAVDTRAQYLDLDQTIQGDQYAMIRDLYLQRKAFQIAEKKGDSA
                     DVSFIDDDESEDVPEDNTDKTENN"
     gene            716595..718138
                     /locus_tag="ABZJ_RS03385"
                     /old_locus_tag="ABZJ_rRNA7"
     rRNA            716595..718138
                     /locus_tag="ABZJ_RS03385"
                     /old_locus_tag="ABZJ_rRNA7"
                     /product="16S ribosomal RNA"
     gene            718193..718269
                     /locus_tag="ABZJ_RS03390"
                     /old_locus_tag="ABZJ_tRNA16"
     tRNA            718193..718269
                     /locus_tag="ABZJ_RS03390"
                     /old_locus_tag="ABZJ_tRNA16"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:718227..718229,aa:Ile,seq:gat)
     gene            718325..718400
                     /locus_tag="ABZJ_RS03395"
                     /old_locus_tag="ABZJ_tRNA17"
     tRNA            718325..718400
                     /locus_tag="ABZJ_RS03395"
                     /old_locus_tag="ABZJ_tRNA17"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:718358..718360,aa:Ala,seq:tgc)
     gene            718734..721650
                     /locus_tag="ABZJ_RS03400"
                     /old_locus_tag="ABZJ_rRNA8"
     rRNA            718734..721650
                     /locus_tag="ABZJ_RS03400"
                     /old_locus_tag="ABZJ_rRNA8"
                     /product="23S ribosomal RNA"
     gene            721818..721932
                     /locus_tag="ABZJ_RS03405"
                     /old_locus_tag="ABZJ_rRNA9"
     rRNA            721818..721932
                     /locus_tag="ABZJ_RS03405"
                     /old_locus_tag="ABZJ_rRNA9"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            722182..723630
                     /locus_tag="ABZJ_RS03410"
                     /old_locus_tag="ABZJ_00661"
     CDS             722182..723630
                     /locus_tag="ABZJ_RS03410"
                     /old_locus_tag="ABZJ_00661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000778201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-54"
                     /protein_id="WP_000778202.1"
                     /db_xref="GI:446700856"
                     /translation="MKLSVGLKVANSLSLTPQLQQAIRLLQLSSLELEQEIQIQLDSN
                     PLLEKVEDESLAESLSTLEHKETDDLTTELNADHLPDDLPVDTEWDDIYTHQSTALGT
                     PEFEEREDNRQVHLTLKEHILEQVNLLHFSKIDQLIAYCIVDALDDKGFLDAELEEII
                     LAVQHLLSEMDIDEEVEEDEVLVVLKHIQRLDPIGIGARNLAECLKVQLEFLPRETEY
                     LKEARSLLQYYELLIANDLNKLLKQTGLSKEQLKFAVDLLKTLKPYPGMDFEKQESEY
                     QIPDVVVAKKDLHWQVQLNPDVMPKLRINSFYSSMIRRADQSDDNLYLRNQMLEAKNF
                     IKSIDERHKTLLKVATCIVEHQKAFLEIGPEAMKPLVLRDVAEEVELHESTVSRVTTN
                     KYMLTPRGLFELKYFFSSHVGTTTGGEASSTAIRAMIKKLVSNENPRKPLSDNAIAAL
                     LKEEGIEVARRTVAKYRESLHIPSSSERKVLI"
     gene            723799..724086
                     /locus_tag="ABZJ_RS03415"
                     /old_locus_tag="ABZJ_00662"
     CDS             723799..724086
                     /locus_tag="ABZJ_RS03415"
                     /old_locus_tag="ABZJ_00662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002008683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome hibernation promoting factor"
                     /protein_id="WP_002008683.1"
                     /db_xref="GI:487935217"
                     /translation="MQITIRGHHLAITPAIEENIKAKFNQLTKHLDQVNSMQIKLTKD
                     HQIDKRSHKGSSNHVAEAIVRLPGIELFAQATADDMYTSIKKLTEKLKNNC"
     gene            724276..724527
                     /locus_tag="ABZJ_RS03420"
                     /old_locus_tag="ABZJ_00663"
     CDS             724276..724527
                     /locus_tag="ABZJ_RS03420"
                     /old_locus_tag="ABZJ_00663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018678006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001083680.1"
                     /db_xref="GI:447006424"
                     /translation="MNSEQLTQILKEAFPEAEVVVSGQAGKFDLRIVDDQFEGKRTVA
                     RQQAVYAPLNTYIASGEVHAVTIRAMTKDEWRKASLFGA"
     gene            724534..725790
                     /locus_tag="ABZJ_RS03425"
                     /old_locus_tag="ABZJ_00664"
     CDS             724534..725790
                     /locus_tag="ABZJ_RS03425"
                     /old_locus_tag="ABZJ_00664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000357156.1"
                     /note="adds enolpyruvyl to UDP-N-acetylglucosamine as a
                     component of cell wall formation; gram-positive bacteria
                     have 2 copies of MurA which are active; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="WP_000357156.1"
                     /db_xref="GI:446279301"
                     /translation="MDKFLITGGVKLEGEVRISGAKNAALPLLAAMILADSPITLTNV
                     PNLKDVNTLVKLIGGLGVTISYENDTVKADTSTLDNQFAPYELVKTMRASILVLGPLL
                     ARYGNAKVSLPGGCAIGSRPVDQHLKALEALGAHIEVENGYVHATVDGRLKGGEVVFD
                     MVTVGGTENILMAAALADGVTTIRNAAREPEITDLAQMLIKMGAKIEGLDTDTLVVTG
                     VESLHGCEYAVVADRIETGSYLAAAAITGGRVKTTHTDPSLLEAVLDKFEEMGAEVTR
                     GDDWIELDMLGKRPKAVSFRTLPHPEFPTDMQAQIMAVNAIGRGFATISETIFENRFM
                     HVPELSRMGANIQVEGHDAVVTGVEKLQAAPVMATDLRASFSLVLAALVAEGDTLIDR
                     IYHIDRGYEHVEEKLQGLGAKIKRVS"
     gene            725790..726473
                     /gene="hisG"
                     /locus_tag="ABZJ_RS03430"
                     /old_locus_tag="ABZJ_00665"
     CDS             725790..726473
                     /gene="hisG"
                     /locus_tag="ABZJ_RS03430"
                     /old_locus_tag="ABZJ_00665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005071248.1"
                     /note="short form of enzyme; requires HisZ for function;
                     catalyzes the formation of N'-5'-phosphoribosyl-ATP from
                     phosphoribosyl pyrophosphate; crucial role in histidine
                     biosynthesis; forms heteromultimer of HisG and HisZ;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="WP_001000724.1"
                     /db_xref="GI:446923468"
                     /translation="MNDVRNDDPNFNVMGNFDHGLTLALSKGRILKETLPLLATAGIN
                     LLEDPEKSRKLIFPTTHKQVRILILRASDVPTYVENGAADLGVAGKDVLMEHGAQHVY
                     ELLDLQIAKCKLMTAGKVGMERPKGRLKIATKYVNLTRQYYASLGEQVDVIKLYGSME
                     LAPLVGLGDYIVDVVDTGNTLRANGLEPLEEICKVSSRLIVNKASFKRKQVLLNPIIS
                     QLEQAVQSR"
     gene            726579..727868
                     /locus_tag="ABZJ_RS03435"
                     /old_locus_tag="ABZJ_00666"
     CDS             726579..727868
                     /locus_tag="ABZJ_RS03435"
                     /old_locus_tag="ABZJ_00666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006581685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="WP_001253721.1"
                     /db_xref="GI:447176465"
                     /translation="MRRLSTQDQNFKQVFAELLAFETVNDPNLVQTVDQIIADVRQHG
                     DDHVLKLTQQFDRHPAHQFSDLELSQQQLKAAFDGLNQEIREALKLAADRIRTFHEAQ
                     KQDSWTYVDDLGNTLGQKVTPLDRVGIYVPGGLASYPSSVLMNAVPAHVAGVPEIIMV
                     VPAPNGELNPLVLAAAYLAGVSRVFTIGGAQAVAALAYGTQTVPRVDKITGPGNRFVA
                     AAKRAVFGQVGIDMIAGPSEILVYAEGVNNAEWLAMDVLSQAEHDTVAQAIFITPDEA
                     LLEAVESAIEKHLNELPKAEIARTSIKNRGALVLVKDRAEAVDLINQVAPEHLELCLD
                     DAEAMSQDIRHAGAIFMGRYTPEAIGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSS
                     LIMCSKDGVKTLAKTADVLAVQENLDAHARSARYRYQ"
     gene            727938..729023
                     /locus_tag="ABZJ_RS03440"
                     /old_locus_tag="ABZJ_00667"
     CDS             727938..729023
                     /locus_tag="ABZJ_RS03440"
                     /old_locus_tag="ABZJ_00667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009516953.1"
                     /note="catalyzes the formation of L-histidinol phosphate
                     from imidazole-acetol phosphate and glutamate in histidine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="WP_000218892.1"
                     /db_xref="GI:446141037"
                     /translation="MTVSTAQMRFWSPEVRELEPYVPGEQPKIQNLLKLNTNENPYPP
                     SPKVVEAVQEVLHEQADVLRLYPDPDATVLKQAIAKQQNIDVSQVFVGNGSDEVLAHI
                     FKAFFLQDGPILYPDITYSFYPVYSQFFGTKTKEIPLNENFEIDVRDYTQPNGGVIIT
                     NPNAPTSIALSLAEIEQVLQANPDRVVVIDEAYVDFGAESAVSLINRYENLVVCQTTS
                     KSRSLAGLRVGFAIAQSHLIAALEAVKNSFNSYPIDRFAIAAAVASFEDQAYFEEQCQ
                     KVITSREKLVRDLTELGFNVLPSKANFIFATHSQHDAGQLAQKLREQGIIVRYFNKPR
                     INQFLRITVGTNEQNARLVQTLKQDIL"
     gene            complement(729027..730415)
                     /locus_tag="ABZJ_RS03445"
                     /old_locus_tag="ABZJ_00668"
     CDS             complement(729027..730415)
                     /locus_tag="ABZJ_RS03445"
                     /old_locus_tag="ABZJ_00668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001134892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="p-aminobenzoate synthetase"
                     /protein_id="WP_001134889.1"
                     /db_xref="GI:447057633"
                     /translation="MPPLPNSHMFKMSHLKKKISLESYYSAADILKKLEELTGLVYLQ
                     DDNNPVIGFLPKNYLITQNNQNFLFTKTDLNKYKFSSYIENLLDFTQFQSQELKNSNR
                     EKISFKGGYIGFISYDFSAHQFINNQSHKQPSLFIGSYYSFIKKINNEWYFFSDENNA
                     FEIFNYLSDLLNKPANKLQKNNFKLEQNIHPRWSKNTYLTAFHKIQEYIKAGDCYQIN
                     LTQEFKANFTGSLLNKADELWNLTNAPYSGYLKLTEFELLSCSPELFIEFNVNKQIKT
                     RPIKGTMPRYENKEQDLLSKQTLKNSKKDQAENVMIVDLLRNDLSIYANTGSVKTTKL
                     FEIESFNQVHHMVSEITATLKNDINPMQMLLTALPGGSITGAPKIRAMQIIEELEGAP
                     RGAYCGTLGYFNFDGTGRWNILIRSFQQYQNQLSIWAGGGITIASEAEAEYQESLDKI
                     SAMLNLMNSTAE"
     gene            730734..731582
                     /locus_tag="ABZJ_RS03450"
                     /old_locus_tag="ABZJ_00669"
     CDS             730734..731582
                     /locus_tag="ABZJ_RS03450"
                     /old_locus_tag="ABZJ_00669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000781580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein FilA"
                     /protein_id="WP_000781580.1"
                     /db_xref="GI:446704234"
                     /translation="MKMFTKLALVSSLAISANAMAMQSMDDAALSAATGQDGINIGIA
                     LGSGGITIDKLYLHDNDGLATSTGITGASGTAGAIAISGVTVTQKGTGNLLDLAIDTN
                     GASGSNGAFLNVAATVGAVDVHVGSIGVGTSGTLNQTTAVRGITETAPTEIISGLDLS
                     LGQISANVQLGSTPQGAMIKVNSSLQGGLTLSNFGINDAAGGGKIVLDKVMVRGAGNT
                     TGDLDVNADISVVPTGLRIQNNSTQGMNVYAQGVHLGAAGNASIGDLEIQGLNVGKST
                     ITISGH"
     gene            731883..732716
                     /locus_tag="ABZJ_RS03455"
                     /old_locus_tag="ABZJ_00670"
     CDS             731883..732716
                     /locus_tag="ABZJ_RS03455"
                     /old_locus_tag="ABZJ_00670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014466048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_024434409.1"
                     /db_xref="GI:638879712"
                     /translation="MLEIVLGSALMYYFATEAFEIEKKPPGTVYYTETADSRNLSFHR
                     NHIEPVTIKPAVEDQFRGIVRQAYDYSCGSAALTTLLNGYVGTSLTEQQTMSGLLQYG
                     EYQRIIERRSFSLLDMKRFVTAIGLESGGYRGEFSDLVKLGWPAIVPISYAGFKHFVV
                     YKAYKDGRVYVADPALGNISFDEGRFKEIWDNNTLFVISVPASQRKDLLALKDADMRH
                     VEDATVNRYAFVDVQYPAFNYDRLANKASTMRRVLDNDNHSATYGQPIETYMRLYYKR
                     K"
     gene            732782..733942
                     /locus_tag="ABZJ_RS03460"
                     /old_locus_tag="ABZJ_00671"
     CDS             732782..733942
                     /locus_tag="ABZJ_RS03460"
                     /old_locus_tag="ABZJ_00671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000114390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide protein"
                     /protein_id="WP_000114388.1"
                     /db_xref="GI:446036533"
                     /translation="MSVLALSMSAITGTIYAEDQVQSTQVSDSNQSVEANENSGASDT
                     ASSSEATTDSTTQTSNVSETNNVVPASNSEAHQAASALQKKEGDASQETNLQEVFTSN
                     ERQYSLIKKGVISSYYDLDYTYYRDTRIDLALSDNSSQLNRLRVEEDANHTLTNSFTL
                     QYGVLDNLTLSATLPFVAKSEIIRDTTTAGLGDISFGARWEPFPLKQGRLPLVLFGSL
                     STKTGDSPYEIGLDELSTGKGYYSVGVGASTRKYIDPVVLFASASANYGFKESGLNQA
                     RGSRTLTSFDPGISGGFSFGFAYSFNYDVSLTMSYQQSFNMDAEFQFENGESYKSPDQ
                     SSAMLSFALGVRVSPETIVNGTVGIGLTEDAPDISLGLSFPLDILGFNKKQK"
     gene            733949..735619
                     /locus_tag="ABZJ_RS03465"
                     /old_locus_tag="ABZJ_00672"
     CDS             733949..735619
                     /locus_tag="ABZJ_RS03465"
                     /old_locus_tag="ABZJ_00672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001197447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein FilD"
                     /protein_id="WP_001197438.1"
                     /db_xref="GI:447120182"
                     /translation="MQVKYPKLCPLTAAIVISGFSSFANAQLGQNLAVDIRSLSMGNA
                     VTADPPGISAVHFNPAALAKIDGLQTDVQGILANFDIQREFSAPPGYNIFGYSDDPLV
                     CNDGPEVSANICTDFKGSVHGDVEYASLYVPILKKMVDLGAGYPLVAPTAGIAYKPPG
                     SKVTYATAMYAPLVAGFGAENGNPGNYMGQQVAVERITYLSPSFGYQVNDHLSIGASV
                     GMSYNAIALKTDLRFPNEMIGVLRMVDDVVCAPFKDNNDMITDLLLLGICNAKEGMNP
                     FNKMGALQVSLEQSLSPSYNLGLLWEPTDDFGFGMVYQSAAKMRLKGKYMIDNAKAPQ
                     ELVRGLNSSATGQILAAILGLPGYVPDIESGLVAMDLEYPAHFQAGIKYKILPDLQLN
                     LDVGWTDYSAWNKFKFEFDRQITLLKVAKLLSNDVTDNSLALPLKFTSPWSWGIGLEY
                     SATDRLKLRAGYEPRASSIPNDKRNTMVPINNAQLFGLGVGYRFDADTDLDLSVGFLR
                     SRDNIPACTSTLSNKCGVDNILLNPYSGLDVKTNTKVTVLGLSYRTKW"
     gene            735613..736908
                     /locus_tag="ABZJ_RS03470"
                     /old_locus_tag="ABZJ_00673"
     CDS             735613..736908
                     /locus_tag="ABZJ_RS03470"
                     /old_locus_tag="ABZJ_00673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000240750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000240750.1"
                     /db_xref="GI:446162895"
                     /translation="MVKQYKGIFRPKVAITTLCVAIASISVSYADGFYTIIGPDGRPM
                     IVPSKRIDQKKQPIPKIEERKPQTQQNPLIVDSVQKTSKEKEQIKNSPKKLEQHVQEK
                     LNTAPTAPTAPTAPTAPTAPTAPTAPTAPTAPTAPQKTQKNTKTVSVVSDDLKTSPEK
                     NKIIESGNAPSVSNNEWQKKLVLVPPPIKSTSQAAPSSDSSLDKSKFTTIDGVEYVNN
                     EYLEDQEFNLEGKKRFYLMPDGLGRTESVERKKGVSRSTLDQLFNRQTQDQDSTVVLA
                     PTYMRLSSQELEAAFEQDKCFIKDYKKSIKTLSINKEVNLWPRKPLKEKFEYELVQLN
                     PSVQHLKVISFASSNEKPLYYWPLVVFLDDKGCILEGVSGFKSKSYPSTMLQHASIQG
                     VLKVPPSAHYIMMTPLSSAVDVTEKELTNQGQIQISVLR"
     gene            736928..738877
                     /locus_tag="ABZJ_RS03475"
                     /old_locus_tag="ABZJ_00674"
     CDS             736928..738877
                     /locus_tag="ABZJ_RS03475"
                     /old_locus_tag="ABZJ_00674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001035105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein FilF"
                     /protein_id="WP_001035103.1"
                     /db_xref="GI:446957847"
                     /translation="MNKKILWPFALTTIALMLNGCGGGSSTINEDPNSGTNNGNLTSG
                     SCTPTTSDNGAEDSTCLQFALDYPIAGINFDCSSATNFHYATKISGNAVIGSCKVGDT
                     ARFYIQSKDNKKVFLGNVNLDTIGKFTAVNGKSKEINPIYLRVLDLASGITGKAPTTL
                     DKNDETIKVAIALIKIFQSIGVENGDNLIGDIQPTQLTDIKKDQLTKISQSVTATEFQ
                     NGAYASILKPWLDVNQISDDDAYKLLVQTTNLSNAGVFQSFNLFINSTILQNYQVFNG
                     CNRSTQEECLNNTINLRHSTDDLYLLSDRQGYTLGYGLQWKGSAIVIDNKVQNPYLLT
                     TKVKPAKLNVNAQNNWLNPVSREIQSTTPLRLSFSNNPNEDLQIYQGKFFNDYGVAGT
                     EAFYKYLTKLSTGNPQHYGLWRQNVDGDNYNGVLSIIKSNPISYLERNVFKTSGNVKT
                     GEKYIFPLYATLTFNFSDTTIQPVNLGIVIDEHGDIRTDIKPNSTTTDMSGQCATVSD
                     ASLIDNNGMQQYRIGTTAATFNDPLNGDQSVYVRMILSNPKFANIDGVMVGVTFVGVS
                     PGPAKLNLFNLLANKVDSTSINFDNNTAWFNQHAAAQESYNMLKDVPAPTAADKALAQ
                     RKFGTVTIKLADQSIPACKAIKTKS"
     gene            complement(738933..739481)
                     /locus_tag="ABZJ_RS03480"
                     /old_locus_tag="ABZJ_00675"
     CDS             complement(738933..739481)
                     /locus_tag="ABZJ_RS03480"
                     /old_locus_tag="ABZJ_00675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004794465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="WP_000006663.1"
                     /db_xref="GI:445928808"
                     /translation="MSFCVACGHKTEQKIPLGDHKVRRVCTHCGNIHYENPKVICGAL
                     ALWEDKVLLCRRAIEPRYGLWTLPAGYMELFETMEQGAARETREEAEAEIEIEQLYCM
                     YNIPRIGQIYVLFKAQLKDGIFGAGEESIECRLFEEHEIPWGELAFPSVEHTLRHYFE
                     DRKQQVFPTHLETLGTRLDHTG"
     gene            739605..740222
                     /locus_tag="ABZJ_RS03485"
                     /old_locus_tag="ABZJ_00676"
     CDS             739605..740222
                     /locus_tag="ABZJ_RS03485"
                     /old_locus_tag="ABZJ_00676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016804855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_000390984.1"
                     /db_xref="GI:446313129"
                     /translation="MEEHLLTQKLQQRLRFSTRIQEAQAAVLIAITNENNPKVLLTRR
                     SIHMNNHAGEVSFPGGKRDPSDTSNIVVALREAQEETALNPFDVQLLGDLPMQRARSG
                     LSVKPIVGLIPPEVTLIPQPTEIDRIFFVPLQQLIETRPTPYEVRYAHQSLYFPSLQI
                     DNEIIWGLTARMLIALFKYGLGYQKEWPFLLNAPTFGMPKFSHKK"
     gene            740242..740772
                     /locus_tag="ABZJ_RS03490"
                     /old_locus_tag="ABZJ_00677"
     CDS             740242..740772
                     /locus_tag="ABZJ_RS03490"
                     /old_locus_tag="ABZJ_00677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000990383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anhydratase"
                     /protein_id="WP_000990384.1"
                     /db_xref="GI:446913128"
                     /translation="MMYSYQGQHPKALHEPWDGWVAPTATLIGQVELGRQVSIWFGAV
                     VRADNCVVRIGNFSNIQENSVLHTDAGLELNIGEYVTVGHKVMLHGCTIGDNSLIGMN
                     AVILNRAVIGKNCIIGANALIPEGKVIPDNSVVMGSPGKIVKTLDEEGAAKIRLSALH
                     YAEHFKSYTDLKEFHF"
     gene            740905..741570
                     /locus_tag="ABZJ_RS03495"
                     /old_locus_tag="ABZJ_00678"
     CDS             740905..741570
                     /locus_tag="ABZJ_RS03495"
                     /old_locus_tag="ABZJ_00678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000770261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_000770261.1"
                     /db_xref="GI:446692915"
                     /translation="MKLLALETANEQCSISLIDETQELFFQLDTRAKAQTQTILPMIE
                     QGLQQTGLDVAGLDAIAFSRGPGSFSGVRINAAVAQALAWSQDLPVVPVSTLQALAQA
                     AYRLEGLEQVTAVLDARMNEVYIASFVLDERGIMQCIDEEKLMNYEQAAAYAKHCLIG
                     SGAKLLQTDAEYQTITATAQDIASIARVYAAQKQWVDAEHALPVYLRDDAWKKIADQG
                     KTN"
     gene            741582..742373
                     /locus_tag="ABZJ_RS03500"
                     /old_locus_tag="ABZJ_00679"
     CDS             741582..742373
                     /locus_tag="ABZJ_RS03500"
                     /old_locus_tag="ABZJ_00679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000551171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_000548447.1"
                     /db_xref="GI:446470593"
                     /translation="MHIYFEVDFQEQAQHYQAVLYSRGVTVDLQPIEKLNARFLRLNP
                     DLALCVDENGLWLSANGMKMQPDWKAEIPRLKRASLKSEMIARACQLGEKPVLVDATA
                     GLGHDSLLMAYLGAQIQLVERHPILFTLLEDSKAQAQRDPFLSQFMDRIQLLFADSAS
                     YLQQLDQEAKTVDVVYLDPMFPQRDQNQQAIKKQAQVKKQMQLLHLLLPEDGEMDLGD
                     HLLELAKKVAKRVIVKRPRHAIFLANQEPAHQWQGDACRFDAYFQ"
     gene            742510..743961
                     /locus_tag="ABZJ_RS03505"
                     /old_locus_tag="ABZJ_00680"
     CDS             742510..743961
                     /locus_tag="ABZJ_RS03505"
                     /old_locus_tag="ABZJ_00680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000566249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000566255.1"
                     /db_xref="GI:446488401"
                     /translation="MIDLKPSINFWHDFKSNQLAGMWLFLGSRRSLQIVHPSILQLIV
                     WGVLGGCTNSLYSWLVAGQIGDFNSQGLIGYALWPFIALIVGIFLSQRINQPRLMLVP
                     ALLWLVLDTNILLIQCLIQYLGSNGYLNFIPDAIYNGILPGLFVALFVWQSLAVIWVF
                     SRELKWPWWERALVMVATIATMVVWQLSVKDQPIWKVEDSPPTFAEDAFYAQSKLLHD
                     ALEQVQYGELAKSHWYFLGVAGDSYQDVFKSEVVRIKEQFDTRFGTVGRSMMLVNNPD
                     TRTEIPIASKTSIELALRRMGQQMNRDSDVLFLYMTSHGEQNHFEIENAPLDLGQVDP
                     KWLRETLDKAGIRWRVIVISACYSGSFIPALQSPDTLIITASAADKTSFGCNNEADYT
                     YFGRAFFDLAMREQSSMKDSFNAAKQTVTKWEVAQGVEPSEPQWMIGKNMELMLPQLE
                     KYLFPQPNTGSVNIAQTQTEAKNDATPAKKPLL"
     gene            743930..744775
                     /locus_tag="ABZJ_RS03510"
                     /old_locus_tag="ABZJ_00681"
     CDS             743930..744775
                     /locus_tag="ABZJ_RS03510"
                     /old_locus_tag="ABZJ_00681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005124681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_001176409.1"
                     /db_xref="GI:447099153"
                     /translation="MQLLQKNRCFEGEQRIYQFDSQLLKGSTKFGVYLSPAALEGKPC
                     STLFYLAGLTCTEETFAIKAHAQHMAAQLSLILITPDTSPRGEQVAVGDNWDLGQGAG
                     FYINATQAPWSEHYQMESYLIDELYPLILKSFPVNAQQVGIFGHSMGGHGALTLAFKY
                     PEKFKSVSAFAPICAPTECAWGEKAFSHYLGTDRESWLAHDATALVSKNGAVFNEILV
                     DQGLDDQFYEQLHPEKFKQACLKAGQPLTLRQHAGYDHGYYFIQTFMDEHLQFHAIQL
                     EKVSG"
     gene            complement(744781..745053)
                     /locus_tag="ABZJ_RS03515"
                     /old_locus_tag="ABZJ_00682"
     CDS             complement(744781..745053)
                     /locus_tag="ABZJ_RS03515"
                     /old_locus_tag="ABZJ_00682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000843456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000843456.1"
                     /db_xref="GI:446766200"
                     /translation="MKSTTHLLTNDGKRIAKRLVNHWKHKFEVQETEQDFKILMPTAT
                     ITLAPETEQLNVAIDSQLDDHNHLEKVVLDHLNRMAQQEFQVEWQH"
     gene            745238..745924
                     /locus_tag="ABZJ_RS03520"
                     /old_locus_tag="ABZJ_00683"
     CDS             745238..745924
                     /locus_tag="ABZJ_RS03520"
                     /old_locus_tag="ABZJ_00683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005803358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribulose-5-phosphate 3-epimerase"
                     /protein_id="WP_000043044.1"
                     /db_xref="GI:445965189"
                     /translation="MSKPYLIAPSILSADFARLGEDVDKVLAAGADVVHFDVMDNHYV
                     PNLTFGAGVCKALKNYGITAPVDVHLMVSPVDRIIGDFLEAGADIITFHPEASHHIDR
                     SLQLIKSGGAKAGLVFNPATPLHYLDYVLDKVDQILLMSVNPGFGGQKFIPMTLEKLR
                     EARKIIDASGRDIRLEVDGGVGPANIREIAEAGADMFVAGSAIFGQPDYKVVIDQMRA
                     ELAKVGSVDA"
     gene            746281..747102
                     /locus_tag="ABZJ_RS03525"
                     /old_locus_tag="ABZJ_00684"
     CDS             746281..747102
                     /locus_tag="ABZJ_RS03525"
                     /old_locus_tag="ABZJ_00684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000216412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_000216425.1"
                     /db_xref="GI:446138570"
                     /translation="MTVKILAVDMDGTFLNSKKQYNKARFLKQYEQLKQNNIRFVVAS
                     GNQLAKLVTYFPEINHEIAFIAENGAHVVDAGQELAFAHLSKEQFVEILNAIDPVYTS
                     KMVICGKQSAYVHSSMNAEDYAKVARYFEKLTVIDDFYALDDLVCKITFTAQENESFT
                     IFEHFQKQSFVKDKVLVPVSSGFNFIDLILPDQHKAHGLKLLLQKWQVQPDQVVAIGD
                     NNNDIQMIKAAGYGFAVENAVEALKAVAPYTTANNEQEGALQVIDLVLQHQPPFA"
     gene            747204..747599
                     /locus_tag="ABZJ_RS03530"
                     /old_locus_tag="ABZJ_00685"
     CDS             747204..747599
                     /locus_tag="ABZJ_RS03530"
                     /old_locus_tag="ABZJ_00685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000174917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000174927.1"
                     /db_xref="GI:446097072"
                     /translation="MTLQHLRKYAWFVFLMTLVIGWSGVSIAQTPMQHDLHTMPCHSE
                     QMKHHSMHIQADEQATCHQSMSQVSHQHGKHCQDCNPVHCQMVNLALQQAIPDIESSF
                     IPIPSQFSSIYQAQHLAGYWQEILRPPKA"
     gene            747640..749574
                     /locus_tag="ABZJ_RS03535"
                     /old_locus_tag="ABZJ_00686"
     CDS             747640..749574
                     /locus_tag="ABZJ_RS03535"
                     /old_locus_tag="ABZJ_00686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002067786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper oxidase"
                     /protein_id="WP_000018555.1"
                     /db_xref="GI:445940700"
                     /translation="MSHKTISSLVAVFGLLVSPWTLAAIKEYHLNINEQQVNVTGKPL
                     KRITVNGKFTAPLLEFEEGDEAVIRVHNQLKNQDTSLHWHGLLLPGLMDGVPGFNNFK
                     GIAPNGDFVYRFKVKQNGTYWYHAHSKGQEQDGLYGPLVIYPKGKIPVAAHEKTDRDY
                     VVMLSDFHDSSSDSIMKNLKKSAEYYQNRRETVSDVWKQVKAQGLKATWQDRSMWNQM
                     RMLKTDMSDVTGYTFLVNGKTPQQNWTANFKAGDKVRLRFINASAMSFFDVRIPNLKM
                     TVVSADGQPVKPVAIDEFRIGTAETYDVIVEPKQPNYQIEAESIDRSGFAIGTLHNEN
                     TQAVGPVQMPIPRPRALLTMDDMGMSHGDGSNEHAGHQMNMQHDMSAMPEMKKETSQA
                     NHDHTVMKMDHDMKNMSSGEHDHSMMHMKHDMSAMSEMKHDMQAMSSSEHDHTMMNMN
                     HEMPAQSENKSKKDEPVYGWANASTPAGMKALQYSDLQSLTPQPDTRAPERELVIRLG
                     GNMERYIWTINGKKFSDTIPLQVKYGERIRLKFVNDSMMAHPMHLHGMFMQLENGQQA
                     ENLPNKHTIIVPPGKTVTALLTADALGEWAIHCHLLYHMSAGMMNKLIVAQVNDGQQP
                     AQSQPTVQSENEKGASHAHH"
     gene            749561..750316
                     /locus_tag="ABZJ_RS03540"
                     /old_locus_tag="ABZJ_00687"
     CDS             749561..750316
                     /locus_tag="ABZJ_RS03540"
                     /old_locus_tag="ABZJ_00687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001223264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance protein B"
                     /protein_id="WP_001223261.1"
                     /db_xref="GI:447146005"
                     /translation="MRITKLFSQMICCGAFSGISVFAFAQEPLTHDHLREHGGQVYQA
                     TKIDTGWTQNEEGESSFSSELESWVGTDENKLFIKAHVEKAESEDANYGGSLLYSRNV
                     ADYWDVQAGVNYERLQREDEKEDRWAGVVGLHGMAPYFFETDAYLYVGEDKLWKLSLE
                     TERDLLFTQKLIGKPYLKADVVLQDESRYASKTGLSSLQAGFQTRYEINKKVMPFVDV
                     GYGYEKGLKQTAWQTGTDSEHGWYYGAGLTLKF"
     gene            750345..751340
                     /locus_tag="ABZJ_RS03545"
                     /old_locus_tag="ABZJ_00688"
     CDS             750345..751340
                     /locus_tag="ABZJ_RS03545"
                     /old_locus_tag="ABZJ_00688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005120476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_001131884.1"
                     /db_xref="GI:447054628"
                     /translation="MPLVYTDGIVFCVSYGAKMALEKQENQINVNKSCSSCGCSNVAA
                     QDFSVASEPRVNKTQWVSYYHIPRMDCAAEEQMVRMALASYAEHIQELYFDLPARHLA
                     VYHSTQDEKITQCLQRLGLGAELQQTQPHYEPIEKPKKVRPSSSTNAAQKQVLQWLLL
                     INGVMFVIELMAGIIASSTGLIADSLDMFADAAIYGIALFVVGKNLDAQLKAAHLSGW
                     LQFGLAIIVLIDVLRRFIYGSEPVSILMILIGGLALAANISCLYLMSDHKESGAHMKA
                     SYIFSANDVIVNLGVIIAGILVAITGSRYPDLIIGLIIVLFVLNGARKILQLKNE"
     gene            751490..751810
                     /locus_tag="ABZJ_RS03550"
                     /old_locus_tag="ABZJ_00689"
     CDS             751490..751810
                     /locus_tag="ABZJ_RS03550"
                     /old_locus_tag="ABZJ_00689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000312236.1"
                     /note="member of the SMR family of proton-dependent drug
                     efflux transporters; quaternary ammonium compound efflux
                     pump; confers resistance to cetylpyridinium,
                     cetyldimethylethyl ammonium and cetrimide cations; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone transmembrane protein"
                     /protein_id="WP_000312237.1"
                     /db_xref="GI:446234382"
                     /translation="MAWAILILAGVFEVIWAYSMKMSEGFTRLTPSIITVVFMILSVV
                     LLSISMKTLPLGTAYTVWTGIGAIGSFLVGIFFLHEPIGAMRMIAAVLIVSGLVLMKI
                     SSPS"
     gene            751822..752301
                     /locus_tag="ABZJ_RS03555"
                     /old_locus_tag="ABZJ_00690"
     CDS             751822..752301
                     /locus_tag="ABZJ_RS03555"
                     /old_locus_tag="ABZJ_00690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000927478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ogt"
                     /protein_id="WP_000927482.1"
                     /db_xref="GI:446850226"
                     /translation="MLLSYKYINSPVGQLKLVANENALVAVLWDNENPKRVRLAELVE
                     QLEHPVLLKTEQQLQEYFEGKRREFTLPLDFEGTAFQKQVWTALLTIPYGETRSYKDI
                     AVQIGNEKAVRAVGAANGKNPISIIAPCHRVIGAGGALVGFAGGLDKKDILLRLEQK"
     gene            752438..753658
                     /gene="argJ"
                     /locus_tag="ABZJ_RS03560"
                     /old_locus_tag="ABZJ_00691"
     CDS             752438..753658
                     /gene="argJ"
                     /locus_tag="ABZJ_RS03560"
                     /old_locus_tag="ABZJ_00691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017387487.1"
                     /note="bifunctional arginine biosynthesis protein ArgJ;
                     functions at the 1st and 5th steps in arginine
                     biosynthesis; involved in synthesis of acetylglutamate
                     from glutamate and acetyl-CoA and ornithine by
                     transacetylation between acetylornithine and glutmate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate synthase"
                     /protein_id="WP_000268130.1"
                     /db_xref="GI:446190275"
                     /translation="MAVGDVTMPQMHVVKGVKIGSTEAYVRYPNRRDLVIFEFAEGSN
                     VAGVFTQNAFCAAPVHVSKAHLAEGNPRYLVINTGNANAGTGPTGLKNAQDTCAKLAE
                     LAGVNSFEVLPFSTGVIGEQLPMERLLAGLQPALNSVQDAAWSDAASGIMTTDTVPKG
                     ASEQFELDGMTYTMTGISKGAGMIRPNMATMLSFVATDAPIRRDLVQKLLKTTVEHSF
                     NRITIDGDTSTNDSCIFVATGQAGGAEITSESDVRYAKVLEVLARVMNRLAQLIVRDG
                     EGATKFITVAVEGGANTQECCDIAYSIAHSPLVKTALFASDPNWGRILAAIGYAGVKD
                     LDVSKIQVWLDDVQICKDGGAAEDYTEEAGARVMAQTEITIRVDLGRGQAKDTVYTCD
                     LSYDYVKINADYRS"
     gene            753805..754869
                     /locus_tag="ABZJ_RS03565"
                     /old_locus_tag="ABZJ_00692"
     CDS             753805..754869
                     /locus_tag="ABZJ_RS03565"
                     /old_locus_tag="ABZJ_00692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016142127.1"
                     /note="3 different subfamilies; catalyzes the formation of
                     quinolinate from iminoaspartate and dihydroxyacetone
                     phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinolinate synthetase"
                     /protein_id="WP_001278262.1"
                     /db_xref="GI:447201006"
                     /translation="MSDATLIANDAKNIVQAHLDRLGEPKDNRLSEEAKQQKFAQIEA
                     ELKKRDAVLVAHYYCDPDVQELAEKTGGCVSDSLEMARFGRDHAASTLVVAGVKFMGE
                     TAKILSPEKTILMPTLEATCSLDLGCPVDEFTAFCDQHPDHTVVVYANTSAAVKARAD
                     WVVTSSCAVEIVEHLDSLGEKIIWAPDQHLGRYIQKKTGADMLLWDGACIVHEEFRAR
                     GIANMKALYPDAAVLVHPESPESVVEIADAVGSTSQLIKAAQTLPHQRLIVATDRGIF
                     YKMQQAVPDKILVEAPTAGEGATCRSCAHCPWMAMNELDGILEVLQKGDQEIHVDPAL
                     AERAKMPLDRMLAFSASLKR"
     gene            755012..755088
                     /locus_tag="ABZJ_RS03570"
                     /old_locus_tag="ABZJ_tRNA18"
     tRNA            755012..755088
                     /locus_tag="ABZJ_RS03570"
                     /old_locus_tag="ABZJ_tRNA18"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:755046..755048,aa:Pro,seq:tgg)
     gene            755145..755221
                     /locus_tag="ABZJ_RS03575"
                     /old_locus_tag="ABZJ_tRNA19"
     tRNA            755145..755221
                     /locus_tag="ABZJ_RS03575"
                     /old_locus_tag="ABZJ_tRNA19"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:755179..755181,aa:Arg,seq:tct)
     gene            755255..755330
                     /locus_tag="ABZJ_RS03580"
                     /old_locus_tag="ABZJ_tRNA20"
     tRNA            755255..755330
                     /locus_tag="ABZJ_RS03580"
                     /old_locus_tag="ABZJ_tRNA20"
                     /product="tRNA-His"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:755288..755290,aa:His,seq:gtg)
     gene            755335..755411
                     /locus_tag="ABZJ_RS03585"
                     /old_locus_tag="ABZJ_tRNA21"
     tRNA            755335..755411
                     /locus_tag="ABZJ_RS03585"
                     /old_locus_tag="ABZJ_tRNA21"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:755369..755371,aa:Pro,seq:tgg)
     gene            complement(755644..756639)
                     /locus_tag="ABZJ_RS03590"
                     /old_locus_tag="ABZJ_00693"
     CDS             complement(755644..756639)
                     /locus_tag="ABZJ_RS03590"
                     /old_locus_tag="ABZJ_00693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000629029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_000629041.1"
                     /db_xref="GI:446551695"
                     /translation="MITKTLPLTDIHRHLDGNIRIQTILELGQQYNLDLPAYDIESLR
                     PHVQVMDNQPDLLSFLSKLDWGVKVLASLDACKRIAFENMQDAAQQGLDYVELRFSPG
                     YMGMTHQLPLEGVVEAVIAGIKEGSQAYGVKANLIGIMSRTFGQEACEKELNALLAHK
                     NDIKALDLAGDELGFPGNLFIDHFKKARDAGWHITVHAGEAAGPESIWQAIEELGAER
                     IGHGVKAVQDLKLLDYLAKHQIGIESCLTSNIQTNTVPSLAEHPLKTFLEHGVLATIN
                     TDDPAVEGIEIQHEYLTAAPLAGLSPEQIYTAQENGLKIAFLSHQEKDELRQKYQ"
     gene            757041..758216
                     /locus_tag="ABZJ_RS03595"
                     /old_locus_tag="ABZJ_00694"
     CDS             757041..758216
                     /locus_tag="ABZJ_RS03595"
                     /old_locus_tag="ABZJ_00694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016804360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding dehydrogenase"
                     /protein_id="WP_000843791.1"
                     /db_xref="GI:446766535"
                     /translation="MKSVLCHQATLQVVDQPNLTPAKGQVLLEVVRCGICGSDLHMQH
                     HCDHMHDLAARVGFNGLAKSTDPFVLGHEFCGKVLDYGPKTRHKFKADTLVCAMPLLN
                     VDQHGYLSTGLSPNASGGYAEQVLAQSSLMFEVPNGLDADSAAMTEPMAVALHAVRRS
                     RVKTSEPAIVIGCGPVGLGVILMLKAAGVKTVVASDFSPNRRKLAEQCGADIVVDPKE
                     TSPFANWKEFGLLGNVSDAINMGMGLFDKLQATRLPWWHGWRMIDKLGALPKRPVIFE
                     CVGVPGVLQQIIEGAPLFSRIVGVGVCMQSDKIEPALAINKELEIQFVLGYTPLEFRD
                     ALHMIAEGKVNCSPLITGVVGLEGVTNAFEALRDPEQHAKILIDPKRSGSDIQLMSH"
     gene            complement(758321..759266)
                     /locus_tag="ABZJ_RS03600"
                     /note="LysR family transcriptional regulator; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            759512..760732
                     /locus_tag="ABZJ_RS03605"
                     /old_locus_tag="ABZJ_00695"
     CDS             759512..760732
                     /locus_tag="ABZJ_RS03605"
                     /old_locus_tag="ABZJ_00695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016144412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_001016269.1"
                     /db_xref="GI:446939013"
                     /translation="MNHMVTTKKAKVQFNWQDPFLIEQQLSPDERMIRDAAHAYCQER
                     LQPRVLEQFRHETTDPSIFREMGELGLLGPTIPEQYGGAGLNYVSYGLVAREIEYVDS
                     GYRSMASVQSSLVMVPIHEFGTEEQKQKYLPKLATGEYIGCFGLTEPDHGSDPGSMIT
                     RAKKVDGGYRLTGAKMWITNSPIADVFVVWAKEVSAEGNVGDIRGFILEKGWEGLSAP
                     AIHGKVGLRASITGEIVMDNVFVPEENAFPEIRGLKGPFTCLNSARYGIAWGAMGAAE
                     FCWHTAHQYTMDRKQFGRPLAANQLIQKKLADMQTEIALGLQAALRFGRMKDEGIASV
                     EGTSLIKRNNCGKALDIARMARDMMGGNGISDEFGVARHLVNLEVVNTYEGTHDVHAL
                     ILGRAQTGIAAFSN"
     gene            760958..762280
                     /locus_tag="ABZJ_RS03610"
                     /old_locus_tag="ABZJ_00696"
     CDS             760958..762280
                     /locus_tag="ABZJ_RS03610"
                     /old_locus_tag="ABZJ_00696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002057295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_001058259.1"
                     /db_xref="GI:446981003"
                     /translation="MNNDVQVISKELRNTFPSNLGTYERIGPHTWKWALLFAYFAMVV
                     DGIDIMLLSYSLTSLKAEFGLTTFQAGALGSASLAGMGIGGILGGWACDKFGRVRTIA
                     NSVTFFSVATCLLGFTQSFEQFMALRFIGALGIGALYMACNTLMAEYVPTTYRTTVLG
                     TLQTGQTVGYIAATLLAGAIIPDYGWRVLFFLTVVPAFVNIFLQRFVPEPKSWQLTKI
                     ESLQGNRQPKERVVAEKPKSSSIYKQIFNNFKHRKMFLLWMTTAFFLQFGYYGINNWM
                     PSYLETEVHMNFKNLTSYMVGSYTAMILGKILAGYLADKFNRRAVFVFGTIASAVFLP
                     IIIFFNTPDNILYLLITFGFLYGIPYGVNATYMAESFSTDVRGTAIGGAYNIGRVGAA
                     IAPAIIGFLASGGTFTMAFIVMGAAYFVAGVLPGLFIKDRQYDPQRQS"
     gene            762333..763562
                     /locus_tag="ABZJ_RS03615"
                     /old_locus_tag="ABZJ_00697"
     CDS             762333..763562
                     /locus_tag="ABZJ_RS03615"
                     /old_locus_tag="ABZJ_00697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000501124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cag pathogenicity island protein Cag19"
                     /protein_id="WP_000501144.1"
                     /db_xref="GI:446423289"
                     /translation="MGALQGIRVLDLSRVLAGPWCGQILADLGAEVIKIERPRVGDDT
                     RMWGPPWMPDQDGNMTRESGYFQCTNRNKYSVAVDITTPEGQALIYEIAKTADVVIEN
                     YKTGSLAKYGLDYASLSELNPNIVYCSITGFGQDGPRAEEPGYDFIIQGMSGLMSITG
                     EPDDVTGGGAQKVGVAVVDIQTGLYSTIAIQAALIARSHTGRGQYIDMSLLDVQVAAL
                     ANQGMNYLASGKAPQRMGNQHPSIVPYQTFKAKDKEFIIACGNDKQFKDLCIAIGYPE
                     LLENEKFVRNQDRVKYRNELIPLLSEHFLRKTAKEWVDMIHALKVPVGVINSIEDALA
                     EPQIVHRNLVVNIPHRLNENFQTIGSPIKLSDTPVEYRHAPPELGEHTTQILSRFKTA
                     EELATLKEKGIIDGKIA"
     gene            complement(763667..764800)
                     /gene="tcuB"
                     /locus_tag="ABZJ_RS03620"
                     /old_locus_tag="ABZJ_00698"
     CDS             complement(763667..764800)
                     /gene="tcuB"
                     /locus_tag="ABZJ_RS03620"
                     /old_locus_tag="ABZJ_00698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002124071.1"
                     /note="with CitA (TcuA) catalyzes the oxidation of
                     tricarballylate to cis-aconitate; originally thought to be
                     involved in citrate utilization; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tricarballylate utilization protein B"
                     /protein_id="WP_000994352.1"
                     /db_xref="GI:446917096"
                     /translation="MNASTKALIPVVQLSDHEQEVQRALQICNACRYCESFCAVFAAM
                     TKRLEFNQADIHYLANLCHNCGACLHACQYAPPHEFGVNIPKAMAQVRLETYQEFATP
                     QPLGQLYKSVGIPFVSTLTLIFFFCMLAVVWWKGTDLFAGYQGNFYAIFPHNFLALLF
                     GATFTVAIVLLGIGISKFWRQTSKVIHGKVEKPDLVQATQNVLTLKYLDGGHGKGCNE
                     QDDRYTQIRRVFHHLTFYGFMLCFAATGVATLYHYFLDLHAPYPIFSLPVILGTLGGI
                     GLVVGPAGLLYLNLKRHPLHGDREQKPVDRGFIFLLLIVSASGLVLMAFRNTPYMALL
                     LIFHLATVMTFFITMPFGKFAHGFYRSASLLKFAIEERISKKS"
     gene            complement(764790..766196)
                     /locus_tag="ABZJ_RS03625"
                     /old_locus_tag="ABZJ_00699"
     CDS             complement(764790..766196)
                     /locus_tag="ABZJ_RS03625"
                     /old_locus_tag="ABZJ_00699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000543960.1"
                     /note="catalyzes the oxidation of tricarballylate to
                     cis-aconitate; FAD-dependent; required for the utilization
                     of tricarballylate as a carbon and energy source by S.
                     enterica; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tricarballylate dehydrogenase"
                     /protein_id="WP_000543965.1"
                     /db_xref="GI:446466111"
                     /translation="MHDVIVIGGGNAALCAALTAKESGASVLVIEAAPKEWRGGNSQH
                     TRNLRCMHDAPQDVLVDAYPEEEYWQDLLKVTAGKTNEHLARLVIRSTATCRDWMRKH
                     GVNFQPPLSGALHVARTNAFFMGGGKALINAYYRSAQELGIEILYNTKIKDLKLNQGY
                     FEAAIAEDGRVFKAKSCVLAAGGFESNLEWLREAWGQNENGEWPADNFIIRGTRFNQG
                     NLLKFMIDQGADIIGDPSQSHCVAVDARAPLYDGGICTRIDCVSLGIVVNNKAERFYD
                     EGEDFWPKRYAIWGRLVAKQPQQIAYSIIDSKAIGRFMPPVFAGVKANSIQELAEKIG
                     LDAKTLYHTVEEFNQACVQGTFNHTVLDDCTTENIVPNKTHWAVPLDQPPFYAYALKP
                     GITFTYLGLKVEDDAAVRFNNKPSRNLFVAGEMMAGNVLGQGYTAGVGMSIGTTFGRI
                     AGKNAAHYALSQGVEHEC"
     gene            complement(766300..767229)
                     /locus_tag="ABZJ_RS03630"
                     /old_locus_tag="ABZJ_00700"
     CDS             complement(766300..767229)
                     /locus_tag="ABZJ_RS03630"
                     /old_locus_tag="ABZJ_00700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000421143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000421125.1"
                     /db_xref="GI:446343270"
                     /translation="MELKQLKYFIAVIESGSLGKAAKNLDIGTSALSQQISKLESELS
                     IRLLQRTALGTVPTPAGLAFFQQVQLALRHLDHAIDSAHSSRLSGHVTVGFSPSVAAV
                     IGTHFLKLMRNRYPDIKVRLIEGLSGDLKALVNARQLDVAIIFSDDVDPQWAIQPLVK
                     EQMFLISPKEVLGQYHLESCIDTQTITHLQLKELPLILPSQRHGLRLLLEQKIHQLKV
                     AYEIDGLHLLMESISQLEMATIQPAGASLNSRQDLCLLRVVEPAIERINYLISLSEEE
                     LSPATLATKVVIRACITNLINEKRWSGAELINT"
     gene            complement(767362..768156)
                     /locus_tag="ABZJ_RS03635"
                     /old_locus_tag="ABZJ_00701"
     CDS             complement(767362..768156)
                     /locus_tag="ABZJ_RS03635"
                     /old_locus_tag="ABZJ_00701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004710436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="substrate-binding protein"
                     /protein_id="WP_000749503.1"
                     /db_xref="GI:446672157"
                     /translation="MKKSPIFITICLAGAGLGSTFANADTLEVISSGGFYSSMEKLIP
                     IFEKQTGHTVHLSSGSSMGESPTAIPNRLNRGERFDIVVLAAPELSKLAEKGYVDPNS
                     QSALVNSSIGMAVPKGAPKPDISSAAKFEKVLLNAKHIGYSASASGTHLEKDVFPSFP
                     PVEYKVISSKAEKVVGDRVAKRIAEGQFDIGFQQISEIKPFTGKYGQVELVGPIPAPY
                     QKVTVFAAGIGKNSEHAKVAKELIKFVKSPQATQIIEEQGLEQVKE"
     gene            complement(768249..769559)
                     /locus_tag="ABZJ_RS03640"
                     /old_locus_tag="ABZJ_00702"
     CDS             complement(768249..769559)
                     /locus_tag="ABZJ_RS03640"
                     /old_locus_tag="ABZJ_00702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752822.1"
                     /note="is involved in the uptake of citrate and the
                     transport of protons into the cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate:proton symporter"
                     /protein_id="WP_000383637.1"
                     /db_xref="GI:446305782"
                     /translation="MDVVNNRRATFKKILNVTSGNFLEQYDFFLFGFYATYIAAKFFH
                     SDNEYVSLMMTFTVFAAGFLMRPLGAIFLGAYVDKVGRRKGLIVTLSLMAIGTILITF
                     VPGYETIGIIAPILVVIGRLLQGFSAGVESGGVSIYLAEIATDKNRGFITSWQSGSQQ
                     IAVVFAALLGYWLNTILTHAQVGEWGWRIPFLIGCLIIPLIFLFRRTLEETEDFKAQK
                     THPSSKEIFSTLVSNWRIVLAGMMMSAMTTTTFYFITVYTTVYAKRTLEMSVTDSLLA
                     TVFVGLSNFFWLPMGGLLSDKIGRRPVLVGITTLAIFTSYPVLSWLVSDISFSNLLIT
                     LAYFSFFFGMYNGTMVATLAEVMPKRVRTVGFSLAFSLAAAIFGGMTPMACTFLVENT
                     GNASTPAFWLMLAAVCSLISSLYLCRGSKQKDPDTIAEPAKVSA"
     gene            complement(769838..770767)
                     /locus_tag="ABZJ_RS03645"
                     /old_locus_tag="ABZJ_00703"
     CDS             complement(769838..770767)
                     /locus_tag="ABZJ_RS03645"
                     /old_locus_tag="ABZJ_00703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000403829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000403826.1"
                     /db_xref="GI:446325971"
                     /translation="MEIKQIKYFLTVVESGSIGKAAQKLDVGASAISQQISKLEQELS
                     IRLLQRNAFGVTPTPAGLAFLKHSQLILRQVNFAIDAAHSARLSGHVSLGFPPTITAL
                     IGIPLMKLMSERYPDIRLEIVETLSGNLIQSINSRQLDIAIIFTNEIDKQWSIQPLVR
                     EQMYLMARKEVLEKYGLSECIKSGIIQSQQIGDIPLVLPRQRHSLRKLLEHKIGQLNV
                     VYEIDGLHLLMDSLIHLDLASVRPGSACLQEYKHKLQLLKVVDPEVERINYLVSLAEE
                     ELSPAALAAKSAIKACVKELIQNQIWPCSEIIL"
     gene            771067..772452
                     /locus_tag="ABZJ_RS03650"
                     /old_locus_tag="ABZJ_00704"
     CDS             771067..772452
                     /locus_tag="ABZJ_RS03650"
                     /old_locus_tag="ABZJ_00704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001012244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid transporter"
                     /protein_id="WP_001012244.1"
                     /db_xref="GI:446934988"
                     /translation="MNFVVNKKIFILGIASICTSTLHAAAFDKTGQSVAAFLQLGNYF
                     EASLGITDADLSGVESGTNPSHHSISDIANTDYRPTAALKLQLALQYSFGLLYDQPFG
                     ADTEYSGVNGFVATPKDTVMLPGITTTGLASATLGHAPTGNAKSEFDIQNLSFILGYQ
                     PTKNWNLYAGPVYQTFKSQVELRGNVFSLYNGYDFHTKTVSDLGWLAGLAYQIPEKAV
                     KVSLTYRSAITHKVNATENAPLIDMLSTQQGRDLVNQHLDYMISIGQMTPQKKAYLNQ
                     IIANLPEQEDTGTTKFKSPDSVNLEFQTGLRQGTLLFGSLRWVNWSDLALQPYRFGEI
                     SKVVGVLSTPSRPEGFNLVRYYDDQWSLNLGLGQRFSPKWLGSVSVGWDSGAGDKVST
                     GGPTKGYYNLGVGAQYSPTSQYFISGGVKYYWLGDAKAQLGAQAGSDYYVGEFKDNHS
                     VSYGLKIGYKF"
     gene            772486..773853
                     /locus_tag="ABZJ_RS03655"
                     /old_locus_tag="ABZJ_00705"
     CDS             772486..773853
                     /locus_tag="ABZJ_RS03655"
                     /old_locus_tag="ABZJ_00705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_001033443.1"
                     /db_xref="GI:446956187"
                     /translation="MNKIIKNGMFLGLSTLISGYGTLLHAEASPTNLPVVSQKALTII
                     DGQTEWLNKVYKDIHEHPELGFMEKRTSAIVAKELKSLGFDVKTGIAKTGVVGILKNG
                     EGPTVMYRADMDANTVEEATGLPYASKVRVKLDDGTETPVAHMCGHDAHMTWMLSMAK
                     TLVALKKEWNGTVILVAQPAEEPITGAKAMVTDGLWTKYNLPKPDYFFAVHTTPAPVG
                     VVINAPGPRMAGTDQLDVLFKGVGGHGSLPMLTKNPISMAANAVTQYQTIMGNAVDPQ
                     QAAVLSIGSIQAGNSNNVIPSTALVKMNLRWFDPKVRETMLNNIKSMSEGAAQMQGMG
                     KDQLPTFTFKGSSTPVVNNKEFSARLNGPLKALLGDKHVLTEYPAVMGSEDVHHLLGD
                     QKDIPFNFMFIGVADPVVFANAVKQGKPVPYIPHSPNYIVDLKALPVGAKVTTVSMLE
                     LLTKK"
     gene            complement(773910..774917)
                     /locus_tag="ABZJ_RS03660"
                     /old_locus_tag="ABZJ_00706"
     CDS             complement(773910..774917)
                     /locus_tag="ABZJ_RS03660"
                     /old_locus_tag="ABZJ_00706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000083777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_001136630.1"
                     /db_xref="GI:447059374"
                     /translation="MPQTATALASWVKAIQKALEKAGVDSQPLLEQAGLDIQALSNPD
                     ARYSLKQTANLWKLAVQKTQDSCFGLKVASQVNQNTFHVLGHSLITSTTLKEMFLRII
                     RYFRVVTDIPELEFYGQGNNHYFVIHVPDEVQPESIDAFISVFIRSSRALQGSVFSPL
                     RIELRRSEPEDLETFQNILKAPIVFNAPKDMIVFDTATIEQPLEGANPTLTQEYDEII
                     NRYLARFDKENILARVKVKLIEKLSTGDFQQQEIAKSLGLSIRSLQRKLSAENTSYSE
                     LLDDTRHELALSYIKNTGHSVTEIAYILGFTDVSSFTRAFRRWTDLSPIHYREKYLAC
                     S"
     gene            775103..776158
                     /locus_tag="ABZJ_RS03665"
                     /old_locus_tag="ABZJ_00707"
     CDS             775103..776158
                     /locus_tag="ABZJ_RS03665"
                     /old_locus_tag="ABZJ_00707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000221131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="WP_000221139.1"
                     /db_xref="GI:446143284"
                     /translation="MTYIYKNPAGMTDSEKTEHIKKVVTAEGVALRKRHPILNHQNAI
                     GAMILFISLVGMIATAVLYINHQLSAWFAIPIIAFFASLTHELEHDLIHWMYFRKKPW
                     AHHLMMGLVWLARPSTINPWKRRELHFNHHKNSGTEVDLEERALTNGEQWSIRRLIAI
                     GDNGLAVLFRIISASNWTVRKVIFKRAFMAYFPLGIIHWSLWYIFLGFHAVDAVLSWA
                     NAPIAWSATTLNIMHVVNILTVVWVAPNVLRTFCLHFVTSNMHYYGDVELGNVIQQTQ
                     VLKPWWMMPFQLFCFNFGSTHAIHHFVVKEPFYIRQMTAPVAHKVMRDMGVRFNDVGT
                     FKRANRWNINDLSESKS"
     gene            complement(776260..776868)
                     /locus_tag="ABZJ_RS03670"
                     /old_locus_tag="ABZJ_00708"
     CDS             complement(776260..776868)
                     /locus_tag="ABZJ_RS03670"
                     /old_locus_tag="ABZJ_00708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016803244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_000807285.1"
                     /db_xref="GI:446729972"
                     /translation="MAEFIAVILITILAVISPGADFAIVTKNSYLYGRKIGVFTSLGI
                     SLGVLVHVTYTLVAVAFVMTYTPQILNIVKYIGALYLIYIGYKTFTQKPVLDSAALNS
                     IGTLQAIKYGFFTNALNPKTTLFVISTYTQIVSLTTPKTILLAYGFFMSFAHFVWFSL
                     VAVLFSSILLRQKMLAKQVQINRVIGSILCVLGVILLFTKFQ"
     gene            777124..777996
                     /locus_tag="ABZJ_RS03675"
                     /old_locus_tag="ABZJ_00710"
     CDS             777124..777996
                     /locus_tag="ABZJ_RS03675"
                     /old_locus_tag="ABZJ_00710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_000572816.1"
                     /db_xref="GI:446494962"
                     /translation="MIERISLNSLKFFYFVAKYGSVTLAAKKLFVTQSAVSKQIYNLE
                     EALNTTLFDRKNKTLVMTEQGETLLSCCHQVFGQLDECLIQLSQPKTQNKQLVLSCEP
                     TLSMKWLIPRLSKFKKLGHDFEVVLLTAGGVVDFEKDNIDIAIRRNDFDWGEHIYSEK
                     IADEYIALVQATKPSETNDLLISTSRPNFFKNMSRIAELKQSLKGYTKVELEHFYLCL
                     EGCLAGLGATVISIYMIEKELEWNLLQKNSPIVQDGSAYFLLSHRAFEEDPRKTLFLE
                     WLKAEMNESQHTLL"
     gene            778363..779349
                     /locus_tag="ABZJ_RS03680"
                     /old_locus_tag="ABZJ_00711"
     CDS             778363..779349
                     /locus_tag="ABZJ_RS03680"
                     /old_locus_tag="ABZJ_00711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005124641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000031355.1"
                     /db_xref="GI:445953500"
                     /translation="MSKEFTFTIKSICFDENYRPADNTRITTNFANLARGMSREENLR
                     NTLRMIDNRFNALAHWDNPKGDRYGVELEIISVEMNIDAENRTSGLPLIEILKTNIVD
                     KKTNERIEGIVGNNFSSYVRDYDFSVLLLDHNKNKSTFSTPEKFGELHGNLFKSFINS
                     ETYKANFKKAPVICLSVSTSKVYHRTENEHPVLGVEYKQEDYSLTDEYFQKMGLKVRY
                     FMPPHSVAPLAFYFTGDLLSDYTNLELISTISTMETFQKIYRPEIYNANSVAGKSYQP
                     SLKHQDYSLTRIVYDREERSRLAIEQGKFVEEQFIKPYQAILEQWSANYAPN"
     gene            779371..780414
                     /locus_tag="ABZJ_RS03685"
                     /old_locus_tag="ABZJ_00712"
     CDS             779371..780414
                     /locus_tag="ABZJ_RS03685"
                     /old_locus_tag="ABZJ_00712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002059143.1"
                     /note="catalyzes the formation of
                     tetrahydropteroyl-L-glutamate and methionine from
                     L-homocysteine and
                     5-methyltetrahydropteroyltri-L-glutamate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="WP_000735356.1"
                     /db_xref="GI:446658010"
                     /translation="MKKLLPTSTAGSLPKPSWLAEPEKLWSPWKLENEGLVEGKKDAL
                     RLALHEQKLAGIDIVSDGEQTRQHFVTTFIEHLNGVDFEKRETVRIRDRYDASVPSVV
                     GAVSRQKPVFVEDAKFLRQQTDQPIKWALPGPMTMIDTLYDGHYKSREKLAWEFAKIL
                     NQEAKELEAAGVDIIQFDEPAFNVFFDEVNDWGIATLERAIEGLKCETAVHICYGYGI
                     KANTDWKKTLGSEWRQYEEAFPKLQTSNIDIISLECHNSRVPIDLLELIRGKKVMVGA
                     IDVATNQIETPEEVANTLRKALQFVDSDKLYPCTNCGMAPLSREVARGKLNALSAGAE
                     IVRRELTGYDLTA"
     gene            780600..781091
                     /locus_tag="ABZJ_RS03690"
                     /old_locus_tag="ABZJ_00713"
     CDS             780600..781091
                     /locus_tag="ABZJ_RS03690"
                     /old_locus_tag="ABZJ_00713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002067861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase"
                     /protein_id="WP_000249482.1"
                     /db_xref="GI:446171627"
                     /translation="MVQATDFRNAMSLLTSAVSVVTTAGMSGRFGFTASAVCSVTDTP
                     PTLLVCMNQAASSHAHFLDNKILTVNVLGAHHEHISKAFSSKLTPEERFKHGEWIELE
                     TGAPVLEDALVSFDCEIEQIQQVGTHTIFICPIVAIKQSQHDQSLVYFNRAYHQVGQT
                     ETV"
     gene            781669..782328
                     /locus_tag="ABZJ_RS03695"
                     /old_locus_tag="ABZJ_00715"
     CDS             781669..782328
                     /locus_tag="ABZJ_RS03695"
                     /old_locus_tag="ABZJ_00715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001989618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_001989618.1"
                     /db_xref="GI:487916152"
                     /translation="MCQAPSYGFAVPFFSQKGTGFLSHLETTRIYNGKTMPTLEIPSK
                     KLQVVQTAIQLFTTHGFHNAGVDLIIKEAKIPKATFYNYFHSKERLIEMCIAFQKSLL
                     KEEVLSIIYSSRYYTQKDKLKEIIVLHTNLNSLYHLLLKAVFEIKRLYPQAYRMAVEY
                     RKWLHRELFDLIFSCETRAFKFDADMVLNLIDGLMLQVLSSKNLDERDVVLEKFWGQV
                     L"
     gene            782504..785191
                     /locus_tag="ABZJ_RS03700"
                     /old_locus_tag="ABZJ_00716"
     CDS             782504..785191
                     /locus_tag="ABZJ_RS03700"
                     /old_locus_tag="ABZJ_00716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001019260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_001019260.1"
                     /db_xref="GI:446942004"
                     /translation="MNIEICTPNSATTKDKGDLLEKLSKNMLEAQNYHVDEEVRKTGS
                     ELDLLCKHNVSKKKIYVECKAYRDKKIDATIIRQLLGTVVFEDYDEGWLIGTSDFSKD
                     AKGLCEELPNRPHGNRVIIYTPKDIVQSLQSSRIISNIPKEHLESYIDLNKVGEWYLL
                     ITSFGIFWAVTILNAGIPTNVICYHAKTGTLVEDQALLDNIASTDCSLSKLDFSKLIN
                     TKKDIKSSLDSQIEVVEVQRGEDWNDYRPARPQDFVGRTKDIKEIFDFFKKIREKEIG
                     TRIFAITGNSGLGKSSLIITLSEKAKNLHQKKKLFLYAIDVRAAKSPDYIYSALLKTL
                     KEAQKKGFGNSKIDLQITNVNHPLESESIAEYLNSLNTSKQLIVLVFDQFEELFSKPD
                     LLELFNNASNILLDAASLKANLCIGFAWKTDSTMPSEHNAYFFWHRLSDYRIVRKLNP
                     FSDRESHAVINKFEEVIGEKIHSDLRHNLIVSSQGYPWLLKKLCIHLHEKILSGQKQE
                     DLLDNKLDISSLFASDLEELNSNEIKALKFIAQKAPVDLVDTIDTCGEDIVTSLLHKR
                     LIIKSGIRLNIYWDIFREYILTETVPIISLRYLPSNDFSTIWNVVKYLSKKPISIQQL
                     QEKTDFSEGTIQNIGTDVLLFGLATRENSQYVLSEDLLEEENTQENILNIIREKFKKH
                     IITLHLKDLSSGTLLTITNFIDLMKETYPDNKYADKTWRSYTIRLIRWLELTGFLQPA
                     TEPNTWIYKDLGSPKTSVMSRRRTSNFFVPRITPQLFISIYPQIAGKNLQELINDGRT
                     NKALEILKKFELIDNEFILDIKDFESVVYAKANSEFSIQAMLEIKELYSADKLSGQAL
                     GKLLKEKYDLKWTDVTTQYSGNKLNSWAKWVKSYEVKNE"
     gene            785320..785589
                     /locus_tag="ABZJ_RS03705"
                     /old_locus_tag="ABZJ_00717"
     CDS             785320..785589
                     /locus_tag="ABZJ_RS03705"
                     /old_locus_tag="ABZJ_00717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000947692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000947692.1"
                     /db_xref="GI:446870436"
                     /translation="MLSEKFYKIFSYIVISSITSSFFVLIESFFDSIVEVYKLENSSF
                     RTFITFFVAFLTNFWFQDLFKERIREACLINFLTYRLNFEIFKSK"
     gene            complement(785773..786636)
                     /locus_tag="ABZJ_RS03710"
                     /old_locus_tag="ABZJ_00718"
     CDS             complement(785773..786636)
                     /locus_tag="ABZJ_RS03710"
                     /old_locus_tag="ABZJ_00718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004748203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_001103908.1"
                     /db_xref="GI:447026652"
                     /translation="MNWDDTKILLAIGRTGGLSRSAKLLGISVSTVHRRAVELEKSLN
                     AVLFSRDSDGYTLTHVGKHFFALAEKAEEHLIAMERYNDQGQQSLFRIALPELIGQQL
                     LQSKLTALQLKHPDLQLEISTSVVPVDFSRREADIILRLVRPESGRYIIRRLGQLEYG
                     LYCSKDYLASFTKHAETADDLLNHRIIGWDRSLQYTFLAQWMRELTQDAAPALSFDNM
                     HSQLLAVIEGQGITALPCFVAKALGLVPILPMQTLKQDVWLMRHLDTKDSDYSTLISE
                     TIEKELQEYLL"
     gene            786861..787754
                     /locus_tag="ABZJ_RS03715"
                     /old_locus_tag="ABZJ_00719"
     CDS             786861..787754
                     /locus_tag="ABZJ_RS03715"
                     /old_locus_tag="ABZJ_00719"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000208331.1"
                     /db_xref="GI:446130476"
                     /translation="MTTIYVVDAFTTKPNTGNRAGVVLDADHLTTQEMQDIAAFAGYS
                     ETAFVLSPKDQSHDIHVRYFTPTHEVPICGHATIATHFLRATTGHQSDYPLIAKTGAG
                     HLPVSIFGSSKELLVKMTQGRVEFLSPFNESQRTELASALGVSESDFADLPIQVVTTG
                     HSKVMVPMLSRNKLDELIPNNKKLKAISAEIGCNGFFPFVLEGSRQEPITYGRMFAPA
                     IGINEDPVTGNANGPAGAYLVHHDLIECDQKVSYWGYQGLAIKKPGRVLVTVEKIDSI
                     LHVSIAGQAILVGSVLYSGKD"
     gene            complement(788069..790993)
                     /locus_tag="ABZJ_RS03720"
                     /old_locus_tag="ABZJ_00721"
     CDS             complement(788069..790993)
                     /locus_tag="ABZJ_RS03720"
                     /old_locus_tag="ABZJ_00721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000470107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000470118.1"
                     /db_xref="GI:446392263"
                     /translation="MFIKSILSSITSIIPLPENSNTSSNLGNGSGDGLLNGISSGNGE
                     HNYGIGNGIADDASITAPITIPLNLSGNSITLIGNSSSSSVNSSPTTTSNNVNDNDVT
                     NNGNGSTIGSGTGNGSGDGLLNGAASGNGEHNYGIGNGIADDASITAPLSIPINLAGN
                     SITLIGDSSSSSVNNSATNTSNTVNDNDTTYNGNGSGAGNGSGDGLLNGIGSGNGEQN
                     YGIGNGIADDASITAPITLPINLSGNSITLIGNSSASSVNSSPTTTSNTVNDNDTTYN
                     GNGTGDSGVNALGGSGNGSGDGAGNGIASGNGEHNYGIGNGNGDDVDITAPITGVLNI
                     SGNSFTLIGNSSSSSVNTAPTTTSNTVNDNDTIDNGNSGGTGSGSGNGSGDGLLNGAA
                     SGNGEHNYGIGNGNGDDVDITAPITGVFNFSGNSFSLIGNSSSSSINTAPTTTTNTVN
                     DNDVTDNGNNGGGLLGGSSGNGSGDGLLNGAASGNGEHNYGIGNGNGDDADFTFPLTG
                     VLNFSGNSLSGFGSSSSESVNVAPTTATNTVNDNDTIDNANTGGLGGGSGNGSGDGLL
                     NGAASGNGEHNYGIGNGNGDDADFTLPFTGGLNILGNALSGIGGSSTDSINISPTTTS
                     NTVNDNDTTNNGNTSGGVIGSGDSGNGSGDGLLNGISSGNGEHNYGIGNGNGDDVDVV
                     APITTPLNVLGNSFSFIGGEGTGDILGPITGIIGGIGGDGDILSPITGIIGGIDGDGD
                     ILSPITGIIGGIGGIGGDLGDNPLTGIIQSGIDVLQNLESLKTGLINTGIDTIAGTII
                     GVFPDAEHPVGDFADLGKLLFETSRDSVNGTLEAISDLAGADLEGASGSITGVIDTLI
                     TNGSTASTIIQHIVGDDLVTENGGLLGSITTIIGGVDSGDGGLLGGLDGLISINYGDS
                     DNSNSVDVEDILGNILGSVGSNQGIAVGEPDPTGGSLIHTISLNTVNQLTDQLLHALP
                     TV"
     gene            792058..792417
                     /locus_tag="ABZJ_RS03725"
                     /old_locus_tag="ABZJ_00722"
     CDS             792058..792417
                     /locus_tag="ABZJ_RS03725"
                     /old_locus_tag="ABZJ_00722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001083481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001083481.1"
                     /db_xref="GI:447006225"
                     /translation="MNSDKLGLKKEFLNLYLHAVLAHFTAIVVFILGSKHIVNSYDKL
                     PDFIPLISSYYFNIIMLLMGVFFFFYMLFEVYLKRMIQILNAAKFSAPFYIFSIFGFI
                     GLGVFPFFGAFSSISSL"
     gene            792457..793302
                     /locus_tag="ABZJ_RS03730"
                     /old_locus_tag="ABZJ_00723"
     CDS             792457..793302
                     /locus_tag="ABZJ_RS03730"
                     /old_locus_tag="ABZJ_00723"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000830090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000830090.1"
                     /db_xref="GI:446752834"
                     /translation="MAEPINFATNFAIKIILSIFGPILKKPIEWITKFLFLDAYKVST
                     AYRTSRDLQLLWRKDLGGFVNYSINWNQIFLGKQQTNCTLWVKANNDQHYSKVIFCVT
                     ASLSNLKYQSVIEIHDLTSKPCVLALPSIPIRNLEWRNGQLYEPYNEFKIELKEVFDK
                     DNTYINLKNNTKSIFNPVDNLGFLQGKKSYVYRWGQWWNLDFLESEKDEFLLTYKAYA
                     FRAKFDKSNNASLFSARAWLLSNRLLLNVFFWSKNIFKAKHLRVAFDKYLKDIEEAAG
                     FKLVD"
     gene            complement(793488..795899)
                     /locus_tag="ABZJ_RS03735"
                     /old_locus_tag="ABZJ_00725"
     CDS             complement(793488..795899)
                     /locus_tag="ABZJ_RS03735"
                     /old_locus_tag="ABZJ_00725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000102827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose dehydrogenase"
                     /protein_id="WP_000102827.1"
                     /db_xref="GI:446024972"
                     /translation="MSTEYTAPSERAGSKVYRFFVILLHVLIALFLIIQGGKLVSLGG
                     SSYYLIAGIAYLLIAILYTFRKVASLWLSILTFIATVIWAVSEVQVFDFWQYIPRLVV
                     PTVLFVLSLWASRSLITLSTEKVTFANRVGLVGFIACVIALISAFFPHGKTLNQVNIA
                     QDRNLTKPTAENPDNWEYFGRSGSGTRFAPYTDITPDNVKNLQIAWTYHTGRPKNIGV
                     DENTPIQIGSTLYSCTPTNIITALDGDSGKALWKYDPKAKTAEHITCRGVGYYDATQD
                     KTLSKADLQTPSIQACPQRILTSTVDGRLIALNAKTGALCPQFGVNGQVDLLNDMGPT
                     EKSKRYHPTSTPLIAGHVAILGGWVRDITHGEPSGVVRAYDVRTGKLAWAWDVGNSEL
                     SGQPKNGFTLETPNMWTIPTYDKDLNLVYLPTGNGPPDYWGGDRNAAKEKFGSAVVAV
                     DATTGKTKWSYQIVHHDVWDYDLPSQPVLYNVTNDKGEQIPALIQTTKMGQIFVLDRR
                     TGQPITKVIEKPVPTTGHAEGEKLSPTQPYSVGMPQIGNDTLREKDMWGISTFDQLNC
                     RIQFKDSAYQGLYTPPSEKPYIEWPSLLGGMNWGGISIDESTGLMFVNDMRMPLRMSL
                     VRKEDMGKYKISTDEVPGFMGTVRPQFAGPYAGVKIDIMQSALGVPCNRPPFGTMSAI
                     DLKTKKLVWQVPLGTAEQLGPLGIKSHLPMPLGMPTLGGPTSTASGLVFFAGTQDYYL
                     RALDSKTGKEVWKAKLPVAAVAAPLIYKSPKTGKQYVVISAGGASHSKDVGDYIIAFA
                     LPDQK"
     gene            796204..796548
                     /locus_tag="ABZJ_RS03740"
                     /old_locus_tag="ABZJ_00726"
     CDS             796204..796548
                     /locus_tag="ABZJ_RS03740"
                     /old_locus_tag="ABZJ_00726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000999624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000999624.1"
                     /db_xref="GI:446922368"
                     /translation="MNDQLNRELSLIKIGSWPGGHDDFIHFFKFTIAIRRSKSSTSSF
                     SKLRPVTAIASKSCFELIGFNSRYIDIAGLDTIHAPMDNKLNSPGIGPDILNIDQYVE
                     FIFCHELNSHFY"
     gene            797204..798208
                     /locus_tag="ABZJ_RS03745"
                     /old_locus_tag="ABZJ_00727"
     CDS             797204..798208
                     /locus_tag="ABZJ_RS03745"
                     /old_locus_tag="ABZJ_00727"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000820340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000820340.1"
                     /db_xref="GI:446743084"
                     /translation="MKRGYFNNKIKDSIFFKENSKKWVLSIEYSTPIWYDLIMDECEE
                     YKEFYKEILNDQVEASKDCNEKEFIYFFTSRPKVRFDLSRKIKIGKNIGEIFLNLIIN
                     CSEKRKVNIDHDYWRDFKKIIINEKFITFKFDEDVKITWPIHVFLYEYNVELGLESEV
                     HYIGKTKDPVSRTMTREHRGYSDMLYYLLHLKEKRDIFLNVLIFKVSVISPPHNSIGI
                     FSTNSVLDHIPKELEIFVIEYCLIYYFKSSIQKGDMDTSWSKFVNYFRDFQKEGINAL
                     YFKLEMKESTEYNNLGTPNLAAKKSHYFSWQLNENGLQMERFYESKDLDEEVFKDFFV
                     "
     gene            complement(798441..798716)
                     /locus_tag="ABZJ_RS03750"
                     /old_locus_tag="ABZJ_00729"
     CDS             complement(798441..798716)
                     /locus_tag="ABZJ_RS03750"
                     /old_locus_tag="ABZJ_00729"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001165351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001165351.1"
                     /db_xref="GI:447088095"
                     /translation="MQIEILKNLPNILFTTYSPIWLVVWFTSIYQIINITIKIDDLIS
                     KKLNNRQYIKTSLNSILIFLKNYLLLYKNLFNYQMILSLGQKRYLLQ"
     gene            799040..799219
                     /locus_tag="ABZJ_RS03755"
                     /old_locus_tag="ABZJ_00730"
     CDS             799040..799219
                     /locus_tag="ABZJ_RS03755"
                     /old_locus_tag="ABZJ_00730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001090935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin"
                     /protein_id="WP_001090935.1"
                     /db_xref="GI:447013679"
                     /translation="MNTEFDPIEFEFDSSDHEAQYNAWFKDKVEASQADQRLGIPQDQ
                     VVARLKKRREERNQL"
     gene            complement(799294..801300)
                     /locus_tag="ABZJ_RS03760"
                     /old_locus_tag="ABZJ_00731"
     CDS             complement(799294..801300)
                     /locus_tag="ABZJ_RS03760"
                     /old_locus_tag="ABZJ_00731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001156616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excisionase"
                     /protein_id="WP_001156616.1"
                     /db_xref="GI:447079360"
                     /translation="MQEKPLIPAIPTPFPDETAGSFLIRLIKLNGHIHSSTFYRSRID
                     LKYKETLSSITTHDYLFLNILKKFQLPDYLKELSLKRHCSTLRGNVIWKNKLVISNYF
                     FSNDVERFCPLCLKEIPYWRKVWLVKPYYACLKHQIRLHTTCPRCQSTLSSLRSEIYI
                     CSKCLGDIRNCEIEAVSDEQIKHIRWFLEFIETEEQEKFNLLKIFWSTLKKFSAHDPV
                     PPSIELLLEITYLFFMDCDSSIERMVDWISQRSHQVHPRIQLVPFLIVDTRYFGQYTK
                     KILEQLPVSTELAPEHLFHLLTIKESCQILDICYSTIQRWIENNKLQYVVSKDIPKNR
                     KFLSSRDIEYFLVQKALHPSPKKLKHPPRKDGQRLTITNVAAKLNVHYENIRYLIRTR
                     YLKAEKLLVRFRCAYFINSKDLEEFNEKYILVGSLAKKLKVIPQNLTEKLASIDIHPI
                     SGPHIDGEFNNIFLQESVRHLTKKDIEKIINYPTLTGRYPSFEEQLPKPPPTYLSLNE
                     AAKKLHISPNKTARLVEKGVLEKDTSHNLSISISIQSLNMLIANLHNPKFISVKQALI
                     QLNCSANWFHEYWVETGFIHIHDFLYWHFVERNELNKVLRLKKSYLTGTEASTLLGMH
                     KSHVTNLESQGLIEPVYFGTPKIIKLFKREDVIKLKELGYGAIK"
     gene            complement(801300..802250)
                     /locus_tag="ABZJ_RS03765"
                     /old_locus_tag="ABZJ_00732"
     CDS             complement(801300..802250)
                     /locus_tag="ABZJ_RS03765"
                     /old_locus_tag="ABZJ_00732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001988216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001037101.1"
                     /db_xref="GI:446959845"
                     /translation="MNKLDALELSKKLNNMVITSSEFTKAYDGITSCSAQTKAYQKPI
                     GSLLIAEGGLGKMTLSQSILKKNPCYEKQEDGYTKRVVPVFYIQIPSPATVKSVAGMM
                     LKALNDPAPLSGTTAQMTERLCYLLKLCETELILMDEFHHLFDMQKVSRKMNIDVCNW
                     IKTVTDSTNISSCLIGLPEFAPLLQIDSQLARRFPLTFKLSRLNIGSTQSPGTLYGFL
                     SQVEQNIEKRLTLKFLPRLIDPLFVLQIYASTKGYHHYIISLIREAMLFALLADSDVI
                     TQQHFSLAWDKGITSYTNMTTQNPFHMDTSKLVQRMKGDH"
     gene            complement(802243..804129)
                     /locus_tag="ABZJ_RS03770"
                     /old_locus_tag="ABZJ_00733"
     CDS             complement(802243..804129)
                     /locus_tag="ABZJ_RS03770"
                     /old_locus_tag="ABZJ_00733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000154902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000154902.1"
                     /db_xref="GI:446077047"
                     /translation="MTIPDFIPQVGLRFSFKDTNFEVTYVHNNVVRFSAVDGGKTSNI
                     PINSFSERYKTGEIQCTSSPHKLLLNGQLLDKTRRAENYIKVIITTLDDYFSHKKIGA
                     VIPEIAKKIDDPFPPSTSTVIRWIRRYIENDYNLLNIYKVKIGNRFFRFSPEMEQIIS
                     NTIEQIIKDKNIALTHKNIQIYIYQKMLEHDIQENPPSRRTIQRRLKQYDPYKLIKAT
                     EGTRIANQTLKAAGRKMKSPFILAIVEIDTHILDIIIIDSTTNLPLGRPYLSCAIDVH
                     TRAIVGYYISMLPPSATTTLALLKNMLLRPSQNLPGGIPSLIVPDNGVEFKNTALSHI
                     CNHLKITIQPAQNRNPDNKPHIERFFGTLTFGLIQQLQGTTFSNPEARGDYDSRKHAS
                     VTLENLKSYVDEWIHNIYHCSIHSMTGRAPMLFWEDASQSCPPLTISTDEVDIIARRP
                     ISRKIHKGQVKFEYLTYFSHALATLEANGLTDVIVMIDELNLEHVYIKHSSIDEVIRA
                     DSTEPDYTKNLSLQEHLEIRKELKLVSQADKQRLGKHRVWYARWKLYERIQKDACSKN
                     KKLKQLKLELPQTLKNLLDQDIHTVSQPIDPSASTFISSSEMDLLNQSNLDDDFGTLE
                     FDDE"
     gene            complement(804131..804832)
                     /locus_tag="ABZJ_RS03775"
                     /old_locus_tag="ABZJ_00734"
     CDS             complement(804131..804832)
                     /locus_tag="ABZJ_RS03775"
                     /old_locus_tag="ABZJ_00734"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001020417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_001020416.1"
                     /db_xref="GI:446943160"
                     /translation="MNIFTTDAWDNFPDSLHPQIVDAFNKKPDLDGVLHGQRHISQGS
                     VGKRTGLFSSYKNNGMIPYESQLELAHAIQLERNPSVKYYRTQALKIPISHNQFLYPD
                     FLIKYTNEEIAFHEVKHSKRFLDQKDIERYQRLKILLAPSGITFDIVDRHDLYSDAEA
                     KVLLHYNRRSHARNWSSFEIQFALSLLTRSTSLVKNQLMSILKNNGLPLELGEFLIFH
                     KYIKLNTPNNKQGGI"
     gene            complement(805040..805267)
                     /locus_tag="ABZJ_RS03780"
                     /old_locus_tag="ABZJ_00735"
     CDS             complement(805040..805267)
                     /locus_tag="ABZJ_RS03780"
                     /old_locus_tag="ABZJ_00735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000986488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000986488.1"
                     /db_xref="GI:446909232"
                     /translation="MMRTSQEVRSELQKRGLSIADWARQNGFTPELVHQVLNSNKIPV
                     RGKSHQIAVKLGLKDGIIEPDFTFEKMKETQ"
     gene            805596..806540
                     /locus_tag="ABZJ_RS03785"
                     /old_locus_tag="ABZJ_00736"
     CDS             805596..806540
                     /locus_tag="ABZJ_RS03785"
                     /old_locus_tag="ABZJ_00736"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001033777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001033777.1"
                     /db_xref="GI:446956521"
                     /translation="MNKINFPSTMKPMFSGHETFPLRQLWLKKAYHQVFKFYEADSDY
                     APKTVFSAPDAIERFGVGKNMVAAIKHWALACDVIREHTDKNGFEIGEIGYLLFDEKS
                     GVDQYLESEATLWLLHWLLAGRARRTATIYSIYNFIQNQTFTELEVKKLISDLALSNQ
                     KGRSDVTLSTDITTSMKCYFSSHDTEDNIEPLLAGIGLLSEISKGQYRFNRGNQYSLP
                     DQVFAFALLDFWEQWELITNTSQKTLSFNLIAHDYGSPGRVFKLDESAVGDRLSRISE
                     ITNNYLQWTDSSGIRQVSRIGTETWGSVKMRILRGAYE"
     gene            806533..809841
                     /locus_tag="ABZJ_RS03790"
                     /old_locus_tag="ABZJ_00737"
     CDS             806533..809841
                     /locus_tag="ABZJ_RS03790"
                     /old_locus_tag="ABZJ_00737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000038711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_000038711.1"
                     /db_xref="GI:445960856"
                     /translation="MSKKLSELVSVHRNFLRSIRLDTDLGRADAISGYILQSPAKQLL
                     DITGSYLLESQQKAFTWTGPYGGGKSSLALTLASCVNEKKDIRDLSRSILGDEINVGI
                     KQYFYTDEPWIVLPIVGKKTSIESQIQATLNSIDEQYKSLINQEDSVINQLVKLAEVL
                     PKKSGVLLLIDELGKFLEYAAYSGEDIGFYQDLAEAAARCKGNLVIIGILHQSFEQYA
                     AKLGSNVQQEWAKVQGRYIDIPLVTNTDETLELIGKAIHVETQYEEARKVAENVSKVI
                     HKRRPSAVSNLSVLLEACWPLHPVMAVMLGPASRKKFGQNERSIFSFLTSVEPLGFSE
                     VLQGMDGEIFDYYWPHQFWDYLRGNFEQAILASVDGHRWSISVDAIERAEAIFSNVHV
                     NLVKTIALIEIFRNGSGLVAEDQLLNCSVPNASITEIHDALNDLARASILIFRKHIGA
                     WGVYAGSDFDIEAALNTATSNVLDVDYKELKNTLAFTPITARRHYWNTGAMRWLNCSI
                     ISEREVKKHIDSFQTQGSAFGEFLLVIPDIIVKDKDEIGKNEQLVSKAFAKGVLIGFP
                     KNGDNIQGLAKELASLEFIRNNSLKLHSDSIAMREVLARIQLVKQTLNDELKYAFNNC
                     LWQWGKQTFTGSLSKIASDLADQIFNLSPKVSSELVNRNTLSASAVKAQKDLLRALLA
                     NDNIENLGFENMSAAASLYRTTIKAFNIHRYQNDTWQICAPEAEFDPCNIVGVWNGIK
                     DFIRKAKGVVNLSEIFDLLSKAPFGVKKGLQPILVWAFFISYKQYIAVYTDGMFTPDL
                     NETSIDEWLQSPKRISWRFVELKTSEKKMLKLLANSLSSQLSYPVKVEPLDSARALVS
                     IVFGLPAWTRKTNSLSKEAKVIRDMLLHASDPHKVLFTDLPAVFESTNAELIVERTSE
                     VINELISIFEIRLRKIEKNLLTALDQQNINLDLLHLRAKNISGIGAEFRLEAFITRMA
                     SYSGYTHELEGLLMLALGKPSDTWTDHDIDAGELQLIAWATEFRRLEVFASIREREPT
                     RQAIGIVLGGKQTITGSFDVSEHDANDIEGLSKQLIKALENGQYKKEVFLAALVDAGS
                     KVIQELQHINGGEA"
     gene            809838..810680
                     /locus_tag="ABZJ_RS03795"
                     /old_locus_tag="ABZJ_00738"
     CDS             809838..810680
                     /locus_tag="ABZJ_RS03795"
                     /old_locus_tag="ABZJ_00738"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000134740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000134740.1"
                     /db_xref="GI:446056885"
                     /translation="MTEHHVLGLSGGKDSAALAIYMRQNFPELKIRYFFTDTGKELPE
                     VYEFLAKLEGFLGQKIEYINGDRDFDFWLRQYNNFLPSAQTRWCTRQLKLTPFKKWIK
                     PWLDQGDKVYSYVAIRADEDHRQGLVSQHKNLEVKLPFREHGIDKPGVYDLLESSGIG
                     LPAYYEWRSRSGCTFCFFQQKIEWARLKERHPKAFEDAKAYEKTAIDSGSPFTWTRGE
                     SLSDLEKPERLAQIYKDYELRKQRAMHRKPVNPLRPQRIDTIDIDDLYLEDEGAGACL
                     VCHK"
     gene            complement(810683..812596)
                     /locus_tag="ABZJ_RS03800"
                     /old_locus_tag="ABZJ_00739"
     CDS             complement(810683..812596)
                     /locus_tag="ABZJ_RS03800"
                     /old_locus_tag="ABZJ_00739"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000805411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000805411.1"
                     /db_xref="GI:446728098"
                     /translation="MKPTSQPSKKKILIIDDEIEGISLKKALTTAKTFFEALRDPDSE
                     IREEMDNFLNKHQNQFQNKLETDGTVHEAFFKEVILSDSFKNSLSTVSLTYKSLSSLY
                     QENEWLLRIKGLITKAFPTDVYDVKYLENVDNINIDELDQFDLLIVDWFLENGYSQSS
                     DLLLKLSEKDNLPAIILLTSHENILESNTKSDFYIKTRISGAGLTILIKKEIRAESFG
                     YIGLRMLAEKAIKQRPIANASRHYIKQWENVLESAKQNTIKSLWQLDTFIMKSIHTDA
                     ISDSQPYSNHFHDFISREHSWHMETNTTLNTYAENLGTALNEHNYNDLLTHHSNEDSI
                     TLHRELLQHYSFQGGVNTFKIHDITKDELQQKILEKLPFGAVLVHGDNSTSDSYEAFV
                     NITQPCDLSGLIRNQPNNSLIFMTLSLKKRLVKNSMFFDTSTYHIYGLTLNDTLYDMI
                     PKNKQLVGINFNEFYQKFNNYKLVGVLRNDITMSLQQSTAASIIRPSQPRTNRPCFGL
                     AKLFLISCSSTGEKKCISFPNEIEFLGSTYKLDKTKNLIQIIGNNLASAAFWVCQELE
                     FQDNSDEFNNTYRLFHESIDISKPSNISHQTTVRMLPVDSFDDHSQAIQGIQDKIHRN
                     KNTICLTYEKFHD"
     gene            complement(812598..814937)
                     /locus_tag="ABZJ_RS03805"
                     /old_locus_tag="ABZJ_00740"
     CDS             complement(812598..814937)
                     /locus_tag="ABZJ_RS03805"
                     /old_locus_tag="ABZJ_00740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017284616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_000019725.1"
                     /db_xref="GI:445941870"
                     /translation="MSHSFKVAARTLRHLGGELITSDEMALNELIKNAFDAGSKRVKV
                     FINYPMNLAVLSKTLEDFTSLKINKNKALELIEINTKLYINPLNTAPLSTFLTYIDQV
                     LNTINEQNKPNILSEIKDNFYNIKICDTGHGMTESELESVFLTIGTPSKLSQKSNGDR
                     ILLGEKGIGRLSMMKLGNKATVITKTIDDQICNSISFNWQDFDNPDLYLDEITIETQK
                     INYPETFITGTQIHITELLSDWSLKKTEIFVKEYIQRLRSPFREGKSDFPIDILLNDT
                     RLNITPIPSWLKEQSSLQAEYIFEPSQINSALHGSLIWKDSSAPDIRSWSIDDLSRIL
                     NTSSSQLNLLGPLKIKFLWFNRKDLIGTIERSLKNIKEELNLWVGGFSIYRDGFRIGF
                     TGGLNDDWLKMDSKALKSQGYTFNRYQTVGEISISKIKNPNLKDTASRQSLVNNNEFE
                     LLQDLISEIIIKDTKSRIEDRKKILEIVATDAFIKSLDKSDESYKKASEALNTLSKNG
                     SQEDKDIIDMAQNVMKNQNELINQLNAKMEKAFETNTDILELANLGQMVDIIAHELAR
                     ITENTSNLLIRLKNSEDNKEETSNIMNELRKQIIATEKRIRSIDVLSPAVRQRKESYD
                     ITAQFKTILEGYAPKLQRHNINYKITVDDSSELKPVQVTMVRGLVAQIMENLLTNSVY
                     WLDQGLKIGEKEKLIELNIESDTKIIYIRDNGPGVDPAYHLDIFKPYFTNRRGGKGLG
                     LYIAAEIAKYHESKLYLSNEIEQDGKLRTFIIELPKSSI"
     gene            complement(815203..815514)
                     /locus_tag="ABZJ_RS03810"
                     /old_locus_tag="ABZJ_00741"
     CDS             complement(815203..815514)
                     /locus_tag="ABZJ_RS03810"
                     /old_locus_tag="ABZJ_00741"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001199906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter"
                     /protein_id="WP_001199906.1"
                     /db_xref="GI:447122650"
                     /translation="MQYNYKSLWLIAAIAFFAIFVLNLPFPLIVLTAGLTGYFTSKKY
                     PELFSSNAGHKKSQKDYGIALIDDDTLTPDHAKFRGLHLVKILIIAALLWFIPVLGLD
                     R"
     gene            complement(815742..817025)
                     /locus_tag="ABZJ_RS03815"
                     /old_locus_tag="ABZJ_00742"
     CDS             complement(815742..817025)
                     /locus_tag="ABZJ_RS03815"
                     /old_locus_tag="ABZJ_00742"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020752838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     beta"
                     /protein_id="WP_000025829.1"
                     /db_xref="GI:445947974"
                     /translation="MSILSWDDFEDDSQKPAAPEHKSAPVNPEKTPDSQNVSATQPSS
                     QSVAAPQSTGTHSVRSTNPTDSMARASEALEHLDVAPGLEELEMGAQRVQVDDKAMIN
                     CRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDIALWKSENGLTEDERTIVMR
                     SLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEAIHTHAYQYCIESLGMDE
                     GEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRLLRNLIAFYCVLEGIF
                     FYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQ
                     QEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGV
                     TNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW"
     gene            complement(817163..817297)
                     /locus_tag="ABZJ_RS03820"
                     /old_locus_tag="ABZJ_00743"
     CDS             complement(817163..817297)
                     /locus_tag="ABZJ_RS03820"
                     /old_locus_tag="ABZJ_00743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016654362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000465010.1"
                     /db_xref="GI:446387155"
                     /translation="MFFHLSHNYMLGVGILIFAFIFFYTPMVYAFFKIRKQQRKQNKL
                     "
     gene            complement(817353..820187)
                     /locus_tag="ABZJ_RS03825"
                     /old_locus_tag="ABZJ_00744"
     CDS             complement(817353..820187)
                     /locus_tag="ABZJ_RS03825"
                     /old_locus_tag="ABZJ_00744"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004703519.1"
                     /note="Catalyzes the rate-limiting step in dNTP synthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     alpha"
                     /protein_id="WP_000111540.1"
                     /db_xref="GI:446033685"
                     /translation="MSVITSTPGQIQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQS
                     ADSSRIHDRITQLTEMVLNTFTRRLPSGGTIHIEEIQDQVELALMRTGEHKVARAYVI
                     YRDQRASARKDTNSNHHPTLQVTDANGQLQPLDLSALQATVNRAAEGLEGIDVQAIID
                     ETVKNLYNGVKESDIATTMMMATRTRIEQEPNYTYVTARLLRDELVSTGLAFLGLPAD
                     TAENNALEAFLKKGVELDLLSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFI
                     HSNGVRFELPQLFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLR
                     PQLSSCYLTTIGDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQG
                     VVPFLKVANDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNT
                     ANWVPDLFMQRVFEDGEWTLFTPSETPDLHDLTGAEFAERYAYYESVAKEQNMLHKKV
                     RAKDLWRKMLSMLFETGHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIA
                     VCNLGSINLVQHVKGGVLDREKLARTVKTAVRMLDNVIDINYYAVPQAKNSNLKHRPV
                     GMGIMGFQDALYEMGMAYGSDEAVNFADESMEVISYYAIQTSSDLAVERGAYSTFKGS
                     LWDQGILPIDSLEIVAKSRPERMFEVDRTQRLDWDSLRAKVQKDGMRNSNVMAIAPTA
                     TISNICGVSQSIEPTFQNLYVKSNLSGEFTVINPYLVRALKERGLWDTVMVNDLKHFE
                     GSVQKIARIPEELKAIFATAFEVEPRWIVDAASRRQKWIDQAQSLNLYISGANGKKLD
                     ITYKMAWLRGLKTTYYLRALGATSAEKSTINTGALNAVKPATVEAAAPAAAPVVEAKK
                     PEAVEEDGFTQAAPVPMACSIDNPDCEACQ"
     gene            820517..820723
                     /locus_tag="ABZJ_RS03830"
                     /old_locus_tag="ABZJ_00745"
     CDS             820517..820723
                     /locus_tag="ABZJ_RS03830"
                     /old_locus_tag="ABZJ_00745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000143214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000143214.1"
                     /db_xref="GI:446065359"
                     /translation="MTFKNNKQIIKIPENSKINKMQQNMVVMYQFGERLLVYNVNVCI
                     LQMINECICKIFKIHVMRFIGAMI"
     gene            820720..821436
                     /locus_tag="ABZJ_RS03835"
                     /old_locus_tag="ABZJ_00746"
     CDS             820720..821436
                     /locus_tag="ABZJ_RS03835"
                     /old_locus_tag="ABZJ_00746"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004655457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_000076440.1"
                     /db_xref="GI:445998585"
                     /translation="MSQEEKLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAI
                     RRIISEQPDLVVLDVMLPGADGLTVCREVRPHYHQPILMLTARTEDMDQVLGLEMGAD
                     DYVAKPVQPRVLLARIRALLRRTDKTVEDEVAQRIEFDDLVIDNGGRSVTLNGELVDF
                     TSAEYDLLWLLASNAGRILSREDIFERLRGIEYDGQDRSIDVRISRIRPKIGDDPENP
                     KRIKTVRSKGYLFVKETNGL"
     gene            821469..823118
                     /locus_tag="ABZJ_RS03840"
                     /old_locus_tag="ABZJ_00747"
     CDS             821469..823118
                     /locus_tag="ABZJ_RS03840"
                     /old_locus_tag="ABZJ_00747"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004748195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_000472465.1"
                     /db_xref="GI:446394610"
                     /translation="MFKHSIFLRIYAGLVILVVLVAVFGYLLVQIINYQRAQEYRESL
                     TDGISYVISEGVARQPGKQQKIDWISDASDLLELPIYYTDASKVELSRTEKKRIEAQK
                     SVVRYDASNSIAYVIIGLRDDPQHYLSIKVDKITERQMKALPIFVLDYLMFYPGQEQE
                     YLAKIQKHFSYPINIQNIQDVNLDSEQIGRLRQDQSVMLYKDSATVRGTTISIVSPIP
                     NHPAQVLVLGPVPMFNWMPLQLSAGITLFSLFLLSLGVYGLILPLERKIRQVRYALNR
                     MKSGDLSLRVPIEGSDEMANLASSYNNMSDHIQRLIEAQRELMRAVSHELRTPVARIR
                     FGTEMLAEEDDYNHRMHQVDMIDKDIEALNTLIDEIMTYAKLEQGTPSLDFAEIVLFE
                     VLDQVAVETEALKTQKEIELIPPPLYVKVDAERRYLHRVVQNLVGNAVRYCDNKVRIT
                     GGIHNDGMAFVCVEDDGPGIPEQDRKRVFEAFARLDDSRTRASGGYGLGLSIVSRIAY
                     WFGGEIKVDESPSLGGARFIMTWPAHRFKQPPLKTNKKAPA"
     gene            complement(823141..823494)
                     /locus_tag="ABZJ_RS03845"
                     /old_locus_tag="ABZJ_00748"
     CDS             complement(823141..823494)
                     /locus_tag="ABZJ_RS03845"
                     /old_locus_tag="ABZJ_00748"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001047856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001047855.1"
                     /db_xref="GI:446970599"
                     /translation="MNLEYTHKPDYYLFAQLLVRHIESYIHKHPDADNAIFDLRDVYE
                     IFRQDFASTTTNLEGILHIADSYRVETLNGDQPLIQKYQIDAKNNSLLIDFNTDALNS
                     LRSGKPILEPDATQL"
     gene            complement(823587..825008)
                     /locus_tag="ABZJ_RS03850"
                     /old_locus_tag="ABZJ_00749"
     CDS             complement(823587..825008)
                     /locus_tag="ABZJ_RS03850"
                     /old_locus_tag="ABZJ_00749"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005133066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_001147032.1"
                     /db_xref="GI:447069776"
                     /translation="MPYSLREFSFSTSLKFFLLFTIIITLCCFIGIASRPLSFLAFFW
                     PANSVFLGLLLRFPQTRQIGSFAGAFTGYMIADLVNGTPLFLTLILTISNYLYVVTTL
                     ALAILFNRHIKAAYQGYSYLLLFALCGIGSITGALFAATFVPMFNTKFMIGSFWAEFG
                     YWVTSELQNALLLLPIILNIPPYLKIKNHLKGNRIYIKAIDFLPLFAVLISIGVSYYD
                     SGPGSLLYPIAALIWCAIRYKPIIVALITSFTSAYIIYHVSGHYLLLYPQDYLGNTIS
                     IRIGLIMMTVAPLTVSSISALHSELIQKLQHAIAHDELTSSLTRRQFLQSVRLLQEKV
                     QKENKTSAFFMLDVDHFKKVNDSYGHLIGDRALQTCVTTIQNILHPHDLLGRFGGEEF
                     AIFIPDTTREAAFELAERIRIQISQQPIYVYGKLPIFVQVSIGISLYSPSYHRSIESL
                     FKEADDALYQAKRQGRNRVFISL"
     gene            825436..825987
                     /locus_tag="ABZJ_RS03855"
                     /old_locus_tag="ABZJ_00750"
     CDS             825436..825987
                     /locus_tag="ABZJ_RS03855"
                     /old_locus_tag="ABZJ_00750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016144448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase subunit A"
                     /protein_id="WP_001274550.1"
                     /db_xref="GI:447197294"
                     /translation="MSAITPYDWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQ
                     FESGVVSAGGARIRLSAKFYLVAIFFVVFDLEALYLYAWSTSVREVGWLGYTTVVIFV
                     VDLLIALVYAFSVGALSWAPADRRKLAGEKIKVGSPTMNIAEITRFNSIEELVTDPTG
                     QIPAQSSGRVKSKTTPALSSEKE"
     gene            825994..826671
                     /locus_tag="ABZJ_RS03860"
                     /old_locus_tag="ABZJ_00751"
     CDS             825994..826671
                     /locus_tag="ABZJ_RS03860"
                     /old_locus_tag="ABZJ_00751"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004655450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase subunit B"
                     /protein_id="WP_000878003.1"
                     /db_xref="GI:446800747"
                     /translation="MKYTLTRANPDADQYPLQDRQIVTDPLEEEVNKNVFMTRLEDVL
                     HTAVNWGRKNSLWPFNFGTSCCYVEYATTLTGVHDLSRFGAEVIRASPRQADLMIVAG
                     TCFVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYSVVQGVDKIIPVDVYVPGC
                     PPRPEALIQALMLLQDQIQLERRPLSAVIGDDLQPVYKPKMMPERDRKNAQRIAVKNL
                     RSMDEIK"
     gene            826756..828543
                     /locus_tag="ABZJ_RS03865"
                     /old_locus_tag="ABZJ_00752"
     CDS             826756..828543
                     /locus_tag="ABZJ_RS03865"
                     /old_locus_tag="ABZJ_00752"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004770766.1"
                     /note="NuoCD; NDH-1 shuttles electrons from NADH, via FMN
                     and iron-sulfur (Fe-S) centers, to quinones in the
                     respiratory chain; subunits NuoCD, E, F, and G constitute
                     the peripheral sector of the complex; in Escherichia coli
                     this gene encodes a fusion protein of NuoC and NuoD that
                     are found separate in other organisms; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional NADH:ubiquinone oxidoreductase
                     subunit C/D"
                     /protein_id="WP_000852150.1"
                     /db_xref="GI:446774894"
                     /translation="MAETDIAMPESTPVDSRPAFAIVEELKTKFGENFYVQATFEEFP
                     TVWVERARVQEVLMFLRKVERPYVMLFDLSAMDERLRQHRDGLPASDFTVFYHLLSLE
                     RNSDIRIKVALNENDLNLPTATNIWPNANWYEREAYDMFGINFEGHPMLRRILLPTYW
                     EGHPLRKEYSARATEYTPYMQDKAKQDFEQEHLRFVPEDWGLKRGNADEDFMFLNLGP
                     NHPSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDYLGG
                     CAQNMPYVMAVEQLAGIKVPERAQVIRVMLNELFRINNHLLYCGTAIQDAGGMTPVFY
                     MFADRQKVYDIVEAITGYRMHPAWFRIGGTAHDLPNNWQKLVKELLDWMPKRLNEYYT
                     AAFKNSVFIGRTRNVAQYDAKSALAWGVTGTGLRATGIDFDVRKYRPYSGYENFDFEV
                     PVEYEGDAYARVLVHFREIEQSLKIIKQCLDNMPSGPYKADHPLAVPPPKDKTLQDIE
                     TLITHFLSVSWGPVMPAGEASFMTEVVKGASTYYLTSDKATMSYRTRIRTPTFTHLQQ
                     IPSVINGSLVSDLIIYLATIDVVMADVDR"
     gene            828557..829066
                     /locus_tag="ABZJ_RS03870"
                     /old