GenomeNet

Database: RefSeq
Entry: NC_017171
LinkDB: NC_017171
Original site: NC_017171 
LOCUS       NC_017171            3991133 bp    DNA     circular CON 27-AUG-2013
DEFINITION  Acinetobacter baumannii MDR-ZJ06 chromosome, complete genome.
ACCESSION   NC_017171
VERSION     NC_017171.1  GI:384141246
DBLINK      Project: 158685
            BioProject: PRJNA158685
KEYWORDS    RefSeq.
SOURCE      Acinetobacter baumannii MDR-ZJ06
  ORGANISM  Acinetobacter baumannii MDR-ZJ06
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii
            complex.
REFERENCE   1  (bases 1 to 3991133)
  AUTHORS   Zhou,H., Zhang,T., Yu,D., Pi,B., Yang,Q., Zhou,J., Hu,S. and Yu,Y.
  TITLE     Genomic Analysis of the Multidrug-Resistant Acinetobacter baumannii
            Strain MDR-ZJ06 Widely Spread in China
  JOURNAL   Antimicrob. Agents Chemother. 55 (10), 4506-4512 (2011)
   PUBMED   21788470
REFERENCE   2  (bases 1 to 3991133)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3991133)
  AUTHORS   Zhang,T. and Yu,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2010) Key Laboratory of Diagnosis and Treatment
            for Infectious Disease, The 1st Affiliated Hospital of School of
            Medicine, Zhejiang University, 79 Qingchun Road, Hangzhou, Zhejiang
            310003, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP001937.
            Acinetobacter baumannii isolates MDR-ZJ06 studied here was obtained
            from a case in a hospital in Zhejiang of China in 2006; bacteria
            are available from the Key Laboratory of Diagnosis and Treatment
            for Infectious Disease.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3991133
                     /organism="Acinetobacter baumannii MDR-ZJ06"
                     /mol_type="genomic DNA"
                     /strain="MDR-ZJ06"
                     /db_xref="taxon:497978"
                     /country="China: Zheijiang"
                     /collection_date="2006"
     gene            complement(76..468)
                     /locus_tag="ABZJ_00001"
                     /db_xref="GeneID:12114159"
     CDS             complement(76..468)
                     /locus_tag="ABZJ_00001"
                     /codon_start=1
                     /transl_table=11
                     /product="putative of cytochrome b(562) (CybC)"
                     /protein_id="YP_005523957.1"
                     /db_xref="GI:384141247"
                     /db_xref="GeneID:12114159"
                     /translation="MMSQKILASMLISCAALVSHSAFAADLEADMKTLAKSTKAFAEA
                     KDIDNAKQQLVIMRQAALSSKLSLPHKLEGLPPENVQVKEYQAGLDQLVAEIDRVTVF
                     VDKGQLDQAKTEAINLVNIRNENHKKFR"
     misc_feature    complement(79..465)
                     /locus_tag="ABZJ_00001"
                     /note="Cytochrome b562; Region: Cytochrom_B562; cl01546"
                     /db_xref="CDD:242573"
     gene            complement(506..2974)
                     /locus_tag="ABZJ_00002"
                     /db_xref="GeneID:12114186"
     CDS             complement(506..2974)
                     /locus_tag="ABZJ_00002"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_005523958.1"
                     /db_xref="GI:384141248"
                     /db_xref="GeneID:12114186"
                     /translation="MSSESQSASQTEQTNEKAYDSSSIKVLRGLDAVRKRPGMYIGDT
                     DDGTGLHHMVFEVVDNAIDEALAGHCDEIIVTIHEDESVSVSDNGRGIPTDIHPEEGV
                     SAAEVILTILHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLHLTIYRAGQIHEQEYH
                     HGDPQYPLRVIGETDNTGTTVRFWPSAETFSQTIFNVEILARRLRELSFLNAGVRIVL
                     RDERINLEHVYDYEGGLSEFVKYINEGKNHLNEIFHFTADADNGIAVEVALQWNDSYQ
                     ENVRCFTNNIPQKDGGTHLAGFRAALTRGLNQYLENENILKKEKVNVTGDDAREGLTA
                     IISVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGKIIDAA
                     RARDAARKAREMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRN
                     RKMQAILPLKGKILNVERARFDKMISSQEVGTLITALGCGIGREEYNPDKLRYHKIII
                     MTDADVDGSHIRTLLLTFFFRQMPELVERGHIYIAQPPLYKLKKGKQEQYIKDNDALE
                     TYLISNAIDELALHISADAPAITGEALAKVIQDYQVSQKSLQRLTLRYPASLLDALLE
                     VDAFKADQNHDQAYVQQWADQVREAVQRLQPSLRPEITLETFERENAQGEKSAHYWPR
                     VTVYVHNLPHAYLLDAGLLNSAEYARLLKNSKSWFKLIEDGAYLQKGDRRIQVANFHQ
                     VWQHILQDSRRGMMIQRYKGLGEMNAEQLWETTMDPENRNMLQVTIDDAIEADRMFSC
                     LMGDDVEPRRAFIEENALNADIDA"
     misc_feature    complement(512..2938)
                     /locus_tag="ABZJ_00002"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    complement(2420..2827)
                     /locus_tag="ABZJ_00002"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(2432..2434,2438..2443,2459..2461,
                     2465..2467,2573..2584,2699..2704,2708..2710,2714..2716,
                     2720..2722,2786..2788,2795..2797,2807..2809))
                     /locus_tag="ABZJ_00002"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(2795..2797)
                     /locus_tag="ABZJ_00002"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(2576..2578,2582..2584,2702..2704,
                     2708..2710))
                     /locus_tag="ABZJ_00002"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(1808..2278)
                     /locus_tag="ABZJ_00002"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    complement(2123..2125)
                     /locus_tag="ABZJ_00002"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(1931..1933,1937..1942,1949..1951))
                     /locus_tag="ABZJ_00002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(1925..1927,1931..1933))
                     /locus_tag="ABZJ_00002"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(1340..1684)
                     /locus_tag="ABZJ_00002"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(1430..1432,1436..1438,1442..1444,
                     1652..1654,1661..1666))
                     /locus_tag="ABZJ_00002"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(1442..1444,1664..1666))
                     /locus_tag="ABZJ_00002"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    complement(539..730)
                     /locus_tag="ABZJ_00002"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(3027..4109)
                     /locus_tag="ABZJ_00003"
                     /db_xref="GeneID:12114209"
     CDS             complement(3027..4109)
                     /locus_tag="ABZJ_00003"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein F"
                     /protein_id="YP_005523959.1"
                     /db_xref="GI:384141249"
                     /db_xref="GeneID:12114209"
                     /translation="MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIH
                     LLATGRSFRTHIPKNYIQYEADDAIVFAQSATEKIGMQKLASGEQLMKVNGDTVATQG
                     QLAKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHVEPEFYFAWQYYSRALKQRNTL
                     LKTRRNLSLADLEPWNKMLSNYGEILHSQRLSIVEQWNVYFQNDLSQLLPDLEIELEY
                     SPGFHTEQGLMQDLLNQHQKDIERRYTECGPHRADLRLKTPFGHADDVLSRGQKKLLI
                     IALKLSQIAMLHASNKETVVLLDDLTAELDLTAQQRLIERLSQLGSQVFMTTLDHASV
                     KKHLHDLSISYQLFSVESGQVSLAAP"
     misc_feature    complement(3042..4109)
                     /locus_tag="ABZJ_00003"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    complement(3042..4103)
                     /locus_tag="ABZJ_00003"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(3999..4022)
                     /locus_tag="ABZJ_00003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(3120..3122,3210..3215,3765..3767,
                     3996..4004,4008..4013))
                     /locus_tag="ABZJ_00003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(3765..3776)
                     /locus_tag="ABZJ_00003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(3282..3311)
                     /locus_tag="ABZJ_00003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(3210..3227)
                     /locus_tag="ABZJ_00003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(3192..3203)
                     /locus_tag="ABZJ_00003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(3114..3134)
                     /locus_tag="ABZJ_00003"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(4124..5272)
                     /locus_tag="ABZJ_00004"
                     /db_xref="GeneID:12114227"
     CDS             complement(4124..5272)
                     /locus_tag="ABZJ_00004"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_005523960.1"
                     /db_xref="GI:384141250"
                     /db_xref="GeneID:12114227"
                     /translation="MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTI
                     TGSDLEVELVASTALSEGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQRCIL
                     KSGNSRFVLGTLPAEDYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLT
                     GTLLEIDENQLRAVTTDGHRLALCEILASSTSSQLVQAIVPRKAVGELQRLLSIEDEQ
                     LTLLIGRELLNVTINTPSRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGH
                     DVFKQSLQRVAILSNEKLRGVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQNAPLEMS
                     FNAQYLLDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMRV"
     misc_feature    complement(4127..5272)
                     /locus_tag="ABZJ_00004"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    complement(4130..5272)
                     /locus_tag="ABZJ_00004"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    complement(order(4664..4666,5027..5029,5048..5050,
                     5201..5203))
                     /locus_tag="ABZJ_00004"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    complement(order(4313..4318,4409..4411,4949..4951,
                     4955..4957,5036..5038,5045..5047))
                     /locus_tag="ABZJ_00004"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    complement(order(4130..4141,4265..4267,4730..4741,
                     4745..4747))
                     /locus_tag="ABZJ_00004"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    complement(order(4130..4141,4256..4258,4337..4342,
                     4379..4381,4484..4486,4736..4741,4745..4747))
                     /locus_tag="ABZJ_00004"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            complement(5370..6767)
                     /locus_tag="ABZJ_00005"
                     /db_xref="GeneID:12114424"
     CDS             complement(5370..6767)
                     /locus_tag="ABZJ_00005"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication initiator protein,
                     transcriptional regulator of replication and housekeeping
                     genes"
                     /protein_id="YP_005523961.1"
                     /db_xref="GI:384141251"
                     /db_xref="GeneID:12114424"
                     /translation="MLWTDCLTRLRQELSDNVFAMWIRPLVAEEVEGILRLYAPNPYW
                     TRYIQENHLELISILAEQLSEGRVRQVEILVDSRPGSILSSSEQPATTTAALQTAPIP
                     QPAKVKREPEPVANTAVSSKSSKKKLLNPQFTFSLFVEGRSNQMAAETCRKVLTQLGA
                     SQHNPLFLYGPTGLGKTHLMQAVGNALLQAKPNARVMYMTSESFVQDFVSSLQKGKVE
                     EFKKNCRSLDLLLVDDIHLLAGKEASLVEFFYTFNALLDESKQIILTSDRYPKELTEL
                     DPRLVSRFSWGLSVGVEPPDIETRIEILLKKAENSGVDLPRNCALFIAQQVVANVREL
                     EGALNKVVAISRFKGAPIDLDVVRESLKDVLAIRARTISVENIQRVVSEYFRIPLKEL
                     VGPKRTRIYARPRQLAMGLARELTGDSFPEIGMAFGGRDHSTVMHACEKVVSLREEDP
                     IFDEDYKNLLRLLQS"
     misc_feature    complement(5373..6767)
                     /locus_tag="ABZJ_00005"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    complement(6582..6764)
                     /locus_tag="ABZJ_00005"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    complement(5913..6284)
                     /locus_tag="ABZJ_00005"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(6237..6260)
                     /locus_tag="ABZJ_00005"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(5967..5969,6069..6071,6234..6257))
                     /locus_tag="ABZJ_00005"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(6066..6083)
                     /locus_tag="ABZJ_00005"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(5919..5921)
                     /locus_tag="ABZJ_00005"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(5379..5648)
                     /locus_tag="ABZJ_00005"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    complement(order(5445..5450,5457..5459,5466..5480,
                     5505..5513,5529..5531,5550..5555,5577..5579))
                     /locus_tag="ABZJ_00005"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            7437..7571
                     /locus_tag="ABZJ_00006"
                     /db_xref="GeneID:12114426"
     CDS             7437..7571
                     /locus_tag="ABZJ_00006"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="YP_005523962.1"
                     /db_xref="GI:384141252"
                     /db_xref="GeneID:12114426"
                     /translation="MKRTFQPSELKRKRVHGFRARMATKAGRQVLARRRAKGRHSLTV
                     "
     misc_feature    7437..7568
                     /locus_tag="ABZJ_00006"
                     /note="50S ribosomal protein L34; Reviewed; Region: rpmH;
                     PRK00399"
                     /db_xref="CDD:179004"
     gene            7686..7994
                     /locus_tag="ABZJ_00007"
                     /db_xref="GeneID:12114428"
     CDS             7686..7994
                     /locus_tag="ABZJ_00007"
                     /codon_start=1
                     /transl_table=11
                     /product="RNase P"
                     /protein_id="YP_005523963.1"
                     /db_xref="GI:384141253"
                     /db_xref="GeneID:12114428"
                     /translation="MHQPHFLFLAKLTEQPNSRLGIVVAKKKVRRAHERNRIKRLARE
                     SFRLHQPKFESDIDVVVMPKVGIETITNAELYQQLDFAWQKLQRLAKKHSKVVPTSQN
                     "
     misc_feature    7689..7943
                     /locus_tag="ABZJ_00007"
                     /note="Ribonuclease P; Region: Ribonuclease_P; pfam00825"
                     /db_xref="CDD:250159"
     gene            8005..8325
                     /locus_tag="ABZJ_00008"
                     /db_xref="GeneID:12114430"
     CDS             8005..8325
                     /locus_tag="ABZJ_00008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523964.1"
                     /db_xref="GI:384141254"
                     /db_xref="GeneID:12114430"
                     /translation="MVRILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAI
                     KGVWLSSKRICRCHPWGGSGYDPVPPKAIRFISFHQIDSQTHHVAVPFRDRLMKQNLS
                     NHLG"
     misc_feature    8005..8322
                     /locus_tag="ABZJ_00008"
                     /note="hypothetical protein; Provisional; Region:
                     PRK14386"
                     /db_xref="CDD:172862"
     gene            8331..10091
                     /locus_tag="ABZJ_00009"
                     /db_xref="GeneID:12114157"
     CDS             8331..10091
                     /locus_tag="ABZJ_00009"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein translocase
                     component YidC"
                     /protein_id="YP_005523965.1"
                     /db_xref="GI:384141255"
                     /db_xref="GeneID:12114157"
                     /translation="MQQWARFAILGAMFVTAYLLILAWQKDYGNAATAPQQQAAAVSS
                     HEVSADLPNAKTATVASDVPQANIAQSQTTDATAPVNQQLISVQTDLYHLWINPKGGD
                     IVRIELLSHDKSKDSNQPFVMLENDAKRTYVAQSGLIGLNGPDSSRGGRPLYAVEKTS
                     YTLADAKGVQDQSGHSEKVLTVPMVFKTPEGVEIIKTFTFTQGQYPIVVKHQVVNRSQ
                     QNWQGQMFGQLKRDNSEDPGKSSQGIFTLGTFLGGAWGTPDAHYNKLKFANFSEEKLN
                     TEAKGGWVAMVQHYFVSAWIPGNLKLTQANGQPYVAKLESRQSADHMNIIGFTSPVIN
                     VPAGTSMEVDAKLYSGPKVQSELKDLAVGLNQTVDYGWLWPIAKLLFLGLQFFHSIVG
                     NWGWSIILLTIMVKMILWPLSSKSYRSMAKMRVIAPEMQRMKEEFGEDRMRFSQEMMA
                     LYKREQVNPLSGCLPLLLQMPIFLALYWVLMESVELRHAPWLGWIHDLSAMDPWFILP
                     LIMGATMFAQQMLNPQPADPMQAKVFRIMPIMFTVFMLFFPAGLVLYWIVNNSITILQ
                     QWFINKSVEKSRISKAESAS"
     misc_feature    8535..10088
                     /locus_tag="ABZJ_00009"
                     /note="membrane protein insertase; Provisional; Region:
                     PRK01318"
                     /db_xref="CDD:234942"
     misc_feature    8580..9476
                     /locus_tag="ABZJ_00009"
                     /note="YidC periplasmic domain; Region: YidC_periplas;
                     pfam14849"
                     /db_xref="CDD:258986"
     misc_feature    9507..10046
                     /locus_tag="ABZJ_00009"
                     /note="membrane protein insertase, YidC/Oxa1 family,
                     C-terminal domain; Region: yidC_oxa1_cterm; TIGR03592"
                     /db_xref="CDD:234272"
     gene            10173..11537
                     /locus_tag="ABZJ_00010"
                     /db_xref="GeneID:12115083"
     CDS             10173..11537
                     /locus_tag="ABZJ_00010"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase mnmE"
                     /protein_id="YP_005523966.1"
                     /db_xref="GI:384141256"
                     /db_xref="GeneID:12115083"
                     /translation="MNNMHSQTTIAAIATPPGRGGVGVIRLSGPKAYDIAQKLTQKNL
                     PEARLAGFRKFYDADGSIMDEGIVLCFPNPHSFTGEDVVELQGHGGPVIQNALLGRLF
                     ELGAIAAKAGEFSMRAFENGKMDLVQAEAIADLIDATSQAAARSAVRSLQGAFSTKIN
                     TVLEKLIHLRLHVEAAIDFPEEEIDFLADGKILALLEDVQQSVHAVQTSARQGQLLRE
                     GLQVVIAGKPNAGKSSLLNALAGVERAIVTDIAGTTRDVLHEKISLNGLPITLTDTAG
                     LRETGDVVEKEGIRRAIKEIEQADLLLLVYDLNQGDDPLKLAQEYFAEHIEPRRLMLI
                     GNKCDLTGQSAEISDYQGFRHITVSAKQEMGVQGLVDAITAHAGFHPEEDTFIARTRH
                     LDAMKRTQLYLAEAREQLVVFNAGELVAESLRLAQNALGEITGDFSADDLLGKIFGSF
                     CIGK"
     misc_feature    10182..11534
                     /locus_tag="ABZJ_00010"
                     /note="tRNA modification GTPase TrmE; Reviewed; Region:
                     trmE; PRK05291"
                     /db_xref="CDD:235392"
     misc_feature    10197..10541
                     /locus_tag="ABZJ_00010"
                     /note="GTP-binding protein TrmE N-terminus; Region:
                     TrmE_N; pfam10396"
                     /db_xref="CDD:204472"
     misc_feature    10821..11306
                     /locus_tag="ABZJ_00010"
                     /note="trmE is a tRNA modification GTPase; Region: trmE;
                     cd04164"
                     /db_xref="CDD:206727"
     misc_feature    10848..10871
                     /locus_tag="ABZJ_00010"
                     /note="G1 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    order(10857..10859,10863..10874,11178..11183,11187..11189,
                     11247..11255)
                     /locus_tag="ABZJ_00010"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206727"
     misc_feature    10893..10943
                     /locus_tag="ABZJ_00010"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206727"
     misc_feature    10932..10934
                     /locus_tag="ABZJ_00010"
                     /note="G2 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    order(10986..11018,11022..11066)
                     /locus_tag="ABZJ_00010"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206727"
     misc_feature    10989..11000
                     /locus_tag="ABZJ_00010"
                     /note="G3 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    11178..11189
                     /locus_tag="ABZJ_00010"
                     /note="G4 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    11247..11255
                     /locus_tag="ABZJ_00010"
                     /note="G5 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    11313..11525
                     /locus_tag="ABZJ_00010"
                     /note="Catalytic cysteine-containing C-terminus of GTPase,
                     MnmE; Region: GTPase_Cys_C; pfam12631"
                     /db_xref="CDD:257176"
     gene            complement(11583..11846)
                     /locus_tag="ABZJ_00012"
                     /db_xref="GeneID:12115084"
     CDS             complement(11583..11846)
                     /locus_tag="ABZJ_00012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523967.1"
                     /db_xref="GI:384141257"
                     /db_xref="GeneID:12115084"
                     /translation="MSHIGQDKKIVNRVKRLKGQINSIENAIEQPESSCIDILQQVAA
                     IKGAINGLMSELMEQHLHHHVLKGAEVDQNELDEFLKVLKRYG"
     misc_feature    complement(11586..11843)
                     /locus_tag="ABZJ_00012"
                     /note="Transcriptional regulators RcnR and FrmR, and
                     related domains; this domain family was previously known
                     as part of DUF156; Region: RcnR-FrmR-like_DUF156; cd10153"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(11655..11657,11667..11669,11742..11744,
                     11841..11843))
                     /locus_tag="ABZJ_00012"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(11595..11624,11628..11630,11652..11654,
                     11661..11669,11673..11681,11685..11690,11697..11702,
                     11709..11714,11718..11723,11727..11735,11739..11747,
                     11751..11753,11757..11765,11772..11777,11781..11786,
                     11793..11795,11802..11807,11814..11819,11826..11828))
                     /locus_tag="ABZJ_00012"
                     /note="putative homotetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(11595..11606,11613..11615,11667..11669,
                     11679..11681,11688..11690,11697..11702,11709..11714,
                     11718..11723,11727..11735,11739..11747,11751..11753,
                     11757..11765,11772..11777,11781..11786,11793..11795,
                     11802..11807,11814..11819,11826..11828))
                     /locus_tag="ABZJ_00012"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(11607..11612,11616..11624,11628..11630,
                     11652..11657,11661..11666,11673..11678,11685..11687))
                     /locus_tag="ABZJ_00012"
                     /note="putative homodimer-homodimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197388"
     misc_feature    complement(order(11613..11615,11667..11669))
                     /locus_tag="ABZJ_00012"
                     /note="putative allosteric switch controlling residues;
                     other site"
                     /db_xref="CDD:197388"
     gene            11838..12902
                     /locus_tag="ABZJ_00011"
                     /db_xref="GeneID:12115085"
     CDS             11838..12902
                     /locus_tag="ABZJ_00011"
                     /codon_start=1
                     /transl_table=11
                     /product="putative metal transporter"
                     /protein_id="YP_005523968.1"
                     /db_xref="GI:384141258"
                     /db_xref="GeneID:12115085"
                     /translation="MTHLFSLVQFNILVGSILGLNFMQDYSVSRHHQHQFDEGNPLAQ
                     KRILIATILTASMMVLEVFGGWFFNSMALLADGWHMSSHMLALGLAYFAYRAARHYSN
                     DHRFSFGTWKIEILAGYSSAILLMVVAIFMAFQSIQRLFNPVEIFYNEAIPIAILGLV
                     INLICAWLLHDDGHHHHHHHHHHHHHHHHHHHHHEHSHGHHHHDLNQKAAFLHVVADA
                     VTSVFAIVALFAGKYFGWDFLDALLGILGAILVAKWSFGLMKETGKTLLDAEMDHPVV
                     DEIREVIAEFPKHVEITDIHVWKVAKGKFSCILALETDDISLNADQIRDALSIHDEIV
                     HISVEINTLKPVYVPRETLA"
     misc_feature    11928..12863
                     /locus_tag="ABZJ_00011"
                     /note="Co/Zn/Cd efflux system component [Inorganic ion
                     transport and metabolism]; Region: CzcD; COG1230"
                     /db_xref="CDD:224151"
     gene            12998..13696
                     /locus_tag="ABZJ_00013"
                     /db_xref="GeneID:12115086"
     CDS             12998..13696
                     /locus_tag="ABZJ_00013"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-disulfide isomerase"
                     /protein_id="YP_005523969.1"
                     /db_xref="GI:384141259"
                     /db_xref="GeneID:12115086"
                     /translation="MIKKLGILALFSLTTSLSFANVDTVRENIKKQYPNLKISNIQKT
                     EMPGLYSANLDQQIIYLGEDGQHMFVGSIIRLKDQKNLTKDLVLGQNSIDWKQLPLKD
                     AIKTVKGNGQHVLAVFSDPNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVW
                     CAPNQSYSWKKLIEQGVKPTVASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGAR
                     SAEEIQAVWKELGL"
     misc_feature    12998..13675
                     /locus_tag="ABZJ_00013"
                     /note="Protein-disulfide isomerase [Posttranslational
                     modification, protein turnover, chaperones]; Region: DsbG;
                     COG1651"
                     /db_xref="CDD:224565"
     misc_feature    13103..13672
                     /locus_tag="ABZJ_00013"
                     /note="DsbA family, DsbC and DsbG subfamily; V-shaped
                     homodimeric proteins containing a redox active CXXC motif
                     imbedded in a TRX fold. They function as protein disulfide
                     isomerases and chaperones in the bacterial periplasm to
                     correct non-native disulfide bonds...; Region:
                     DsbA_DsbC_DsbG; cd03020"
                     /db_xref="CDD:239318"
     misc_feature    order(13103..13129,13136..13219)
                     /locus_tag="ABZJ_00013"
                     /note="dimerization domain [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239318"
     misc_feature    13196..13219
                     /locus_tag="ABZJ_00013"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239318"
     misc_feature    order(13364..13366,13373..13375)
                     /locus_tag="ABZJ_00013"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239318"
     gene            complement(13749..14000)
                     /locus_tag="ABZJ_00014"
                     /db_xref="GeneID:12115087"
     CDS             complement(13749..14000)
                     /locus_tag="ABZJ_00014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523970.1"
                     /db_xref="GI:384141260"
                     /db_xref="GeneID:12115087"
                     /translation="MWSLIVAIVVGFFAGLIARALHPGDDKAGFIVTTLIGIAGSLLA
                     TYGGRLLGLYGENSAAGFIASVIGAVIILFIYNLIARKS"
     misc_feature    complement(13755..13994)
                     /locus_tag="ABZJ_00014"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2261"
                     /db_xref="CDD:225170"
     gene            complement(14173..14700)
                     /locus_tag="ABZJ_00015"
                     /db_xref="GeneID:12115088"
     CDS             complement(14173..14700)
                     /locus_tag="ABZJ_00015"
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="YP_005523971.1"
                     /db_xref="GI:384141261"
                     /db_xref="GeneID:12115088"
                     /translation="MTVAMSIMISTEEIQAKVKELGEQINSHYANSDKELVLIGLLRG
                     SVIFMADLCRTITKPHELDFMTVSSYGGGTTSSRDVKILKDLDGEIRGKDVLVVEDII
                     DSGNTLSKVVEMLQTREPNSIQLCTLVSKPSRREIDLEVKFLGFEVEDKFIVGYGLDY
                     DQKYRHLPFIGEIGL"
     misc_feature    complement(14272..14649)
                     /locus_tag="ABZJ_00015"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(14308..14310,14380..14394,14398..14406,
                     14569..14571,14575..14577))
                     /locus_tag="ABZJ_00015"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(14914..16260)
                     /locus_tag="ABZJ_00016"
                     /db_xref="GeneID:12115089"
     CDS             complement(14914..16260)
                     /locus_tag="ABZJ_00016"
                     /codon_start=1
                     /transl_table=11
                     /product="guanine deaminase"
                     /protein_id="YP_005523972.1"
                     /db_xref="GI:384141262"
                     /db_xref="GeneID:12115089"
                     /translation="MKIYRLSMSLIANTTVVRGRFLDIQQTVSEPADIPNQVRYLEDG
                     VLISEHGKIKWFGAWEDAQQHLPAGVEVQHYPEQLIVPGFIDTHIHFPQTEMVGAYGE
                     QLLSWLNTYTFPTEIQFQDKTYASEIAQFFVQELLKHGTTTALVFCTVHPVSVDALFE
                     AAERVQMRLIAGKVLMDRNAPEALCDTPETAYSDTKALIEKWHGKGRALYAITPRFAP
                     TSTPEQLERAGQLKQEFPDVYVHTHLSENKDEIAWVKSLFPEQAGYLDVYQHYGLTGK
                     RSVFAHCVHLEDEEWQCMHDTQSAIAFCPTSNLFLGSGLFPLKKTWEKQVKVGLGTDI
                     GAGTSFSLLQTVNEAYKVQQLQGDKLSAYEALYHATLGGAKALDLQDQLGNFNVGKEA
                     DFVVLNLKPTALQELRQSKSKSVEDSLFALFTLGDDRNIEATYIYGNCAYQKETAK"
     misc_feature    complement(14929..16227)
                     /locus_tag="ABZJ_00016"
                     /note="guanine deaminase; Provisional; Region: PRK09228"
                     /db_xref="CDD:236419"
     misc_feature    complement(14947..16212)
                     /locus_tag="ABZJ_00016"
                     /note="Guanine deaminase (GDEase). Guanine deaminase is an
                     aminohydrolase responsible for the conversion of guanine
                     to xanthine and ammonia, the first step to utilize guanine
                     as a nitrogen source. This reaction also removes the
                     guanine base from the pool and...; Region: GDEase;
                     cd01303"
                     /db_xref="CDD:238628"
     misc_feature    complement(order(15262..15264,15415..15417,15523..15525,
                     15532..15534,15991..15993,15997..15999))
                     /locus_tag="ABZJ_00016"
                     /note="active site"
                     /db_xref="CDD:238628"
     gene            complement(16296..17351)
                     /locus_tag="ABZJ_00017"
                     /db_xref="GeneID:12115090"
     CDS             complement(16296..17351)
                     /locus_tag="ABZJ_00017"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylpropionate dioxygenase"
                     /protein_id="YP_005523973.1"
                     /db_xref="GI:384141263"
                     /db_xref="GeneID:12115090"
                     /translation="MNAIPTLTPLAMPCNSSFEAKDWEILSSHWYPVARIQDVFNAPQ
                     RVTLLDVNMALYKTKSGEIHLVRDICPHRGVPLTKGWVDGEEIVCPYHGLRYNTEGKC
                     TQIPAQPELTKISDRFSLIKFPVVQRYGLIWTSIHGRDIDKANIPVLDTWDDAEHQAI
                     LPPFVDIGGSSGRQLEGFIDVAHFAWVHHNAFANRDNPVVPKYHTERTNYGLKTVYIS
                     NVSNYPHELKHLEPEGFLWKRTFEVYPPFSAVLTVDFPESGILKILNACCPISSNKTR
                     LFVPLTRNFDQTGDLEKVYAFNAQIFAEDQDMVESQKPEELPLDLMMEAHFEADRSST
                     TYRRILAEWGLSKRYTV"
     misc_feature    complement(16305..17342)
                     /locus_tag="ABZJ_00017"
                     /note="Phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit
                     [Inorganic ion transport and metabolism / General function
                     prediction only]; Region: HcaE; COG4638"
                     /db_xref="CDD:226985"
     misc_feature    complement(16941..17264)
                     /locus_tag="ABZJ_00017"
                     /note="Rieske non-heme iron oxygenase (RO) family,
                     N-terminal Rieske domain of the oxygenase alpha subunit;
                     The RO family comprise a large class of aromatic
                     ring-hydroxylating dioxygenases found predominantly in
                     microorganisms. These enzymes enable...; Region:
                     Rieske_RO_Alpha_N; cd03469"
                     /db_xref="CDD:239551"
     misc_feature    complement(order(17070..17072,17076..17078,17085..17087,
                     17133..17138,17142..17144))
                     /locus_tag="ABZJ_00017"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239551"
     misc_feature    complement(16323..16829)
                     /locus_tag="ABZJ_00017"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cl14643"
                     /db_xref="CDD:265438"
     misc_feature    complement(order(16425..16427,16434..16442,16449..16454,
                     16455..16463,16509..16511,16515..16517,16521..16523,
                     16527..16529,16545..16547,16551..16553,16557..16562,
                     16605..16607,16611..16613,16617..16619,16623..16625,
                     16629..16631,16695..16697,16701..16703,16707..16709,
                     16713..16715,16740..16742,16815..16820,16824..16829))
                     /locus_tag="ABZJ_00017"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            complement(17641..18801)
                     /locus_tag="ABZJ_00018"
                     /db_xref="GeneID:12115091"
     CDS             complement(17641..18801)
                     /locus_tag="ABZJ_00018"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523974.1"
                     /db_xref="GI:384141264"
                     /db_xref="GeneID:12115091"
                     /translation="MKRKIFTPRPDWQVEHQNIGFDYFNLPSLDGSIYWSEGVAYEFT
                     LKQIEQLEDAANELHQMCLSVVGDLIQRGNYPTYFQIPETAINHIEHSWKQNAPMLYG
                     RFDFAYDGRNIKMLEYNADTPTGLLEASVAQWLWIEQVSGIANRDQFNSIHEDLIKHW
                     KTILPRGSHVHFAACQEAGREDWGNLEYLMDTAYQAHLQVSELSMENIGWNGQDFVDL
                     HNQPIQNIFKLYPWEWIWEEAFSQYIHPQTQWIEPCWKMLLSNKAILVELWKCYPNHP
                     LLVETHTYDSQQSLSGKWVKKPILAREGANIRVLQDGHDQGAASGSFYFDDYDKYGYV
                     VQKWVDTPLFSGQLPTLGLWMVGHQCAGMSIREDCYDIIGNDAHFAAHYFVE"
     misc_feature    complement(17644..18801)
                     /locus_tag="ABZJ_00018"
                     /note="Glutathionylspermidine synthase [Amino acid
                     transport and metabolism]; Region: Gsp; COG0754"
                     /db_xref="CDD:223825"
     gene            complement(18823..19188)
                     /locus_tag="ABZJ_00019"
                     /db_xref="GeneID:12115092"
     CDS             complement(18823..19188)
                     /locus_tag="ABZJ_00019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523975.1"
                     /db_xref="GI:384141265"
                     /db_xref="GeneID:12115092"
                     /translation="MRSKKINLVVVPLLLTACSHNDGPLVQDVYNNQYDCARDWNNET
                     CKQENSSSGHGSSYVGSRYLGPAYYQNNREVSYHGNTLHPYSNLSVGRPIISSTAKSA
                     SSSSPIRGGFGRSGFSFGG"
     gene            complement(19377..20363)
                     /locus_tag="ABZJ_00020"
                     /db_xref="GeneID:12115093"
     CDS             complement(19377..20363)
                     /locus_tag="ABZJ_00020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523976.1"
                     /db_xref="GI:384141266"
                     /db_xref="GeneID:12115093"
                     /translation="MPNCRMYGGFMETIGNLWLYVAFFGIVIVMLLIDFLGFKQKQGQ
                     DVSIKQAAYWSVAWVSVAALFGGGLWLYLQQTVGVTLANQKTMEYFAGYLLEKSLAID
                     NVFVWLMIFAAFAIPAALQRKILLYGVLGAIVLRTLFIFIGAWFVQEFSWVLYIFGAF
                     LVYTGFKFLKGQEEETNIEDIKLLKWLRNHMRITPQLEGDKFFVRQNGLLWATPLFLV
                     LILVEASDVIFAVDSIPAIFAVTSDPFIVLTANLMAILGLRAMFFLLAGAATKLHYLP
                     YGLGIILLFIGAKMLLLDVFHMPIWISLSFIVIVLAITAYLSLRHNKKQLQS"
     misc_feature    complement(19392..20318)
                     /locus_tag="ABZJ_00020"
                     /note="integral membrane protein, TerC family; Region:
                     R_switched_Alx; TIGR03718"
                     /db_xref="CDD:234327"
     gene            complement(20652..21248)
                     /locus_tag="ABZJ_00021"
                     /db_xref="GeneID:12115094"
     CDS             complement(20652..21248)
                     /locus_tag="ABZJ_00021"
                     /codon_start=1
                     /transl_table=11
                     /product="PAP2 superfamily protein"
                     /protein_id="YP_005523977.1"
                     /db_xref="GI:384141267"
                     /db_xref="GeneID:12115094"
                     /translation="MSLETLNLSLFHVINGAQDASQFIIRLAIFFANDLLYILLFILT
                     FLWFYGDQDLKNRVIKSVFLTCVSLLVGYVISLFYHHPRPFVMGVGTTFIEHAPTASF
                     PSNHMLIFSTIALSYLFAQRKIIGIILLFLSFVVAWSRIYLGVHFPLDMLGAFIVALL
                     VNTAGYYFWNVYGTPLTAFFIHLYQIICKPLLDRGLIK"
     misc_feature    complement(20739..21221)
                     /locus_tag="ABZJ_00021"
                     /note="Membrane-associated phospholipid phosphatase [Lipid
                     metabolism]; Region: PgpB; COG0671"
                     /db_xref="CDD:223743"
     misc_feature    complement(20748..21176)
                     /locus_tag="ABZJ_00021"
                     /note="PAP2_like proteins, BcrC_like subfamily. Several
                     members of this family have been annotated as bacitracin
                     transport permeases, as it was suspected that they form
                     the permease component of an ABC transporter system. It
                     was shown, however, that BcrC from...; Region:
                     PAP2_BcrC_like; cd03385"
                     /db_xref="CDD:239480"
     misc_feature    complement(order(20799..20801,20811..20813,20829..20831,
                     20931..20939,21000..21002))
                     /locus_tag="ABZJ_00021"
                     /note="active site"
                     /db_xref="CDD:239480"
     gene            21384..22634
                     /locus_tag="ABZJ_00022"
                     /db_xref="GeneID:12115095"
     CDS             21384..22634
                     /locus_tag="ABZJ_00022"
                     /codon_start=1
                     /transl_table=11
                     /product="Bacterial low temperature requirement A protein
                     (LtrA) family protein"
                     /protein_id="YP_005523978.1"
                     /db_xref="GI:384141268"
                     /db_xref="GeneID:12115095"
                     /translation="MRVRSVNIKVLTCWHFIRERYFMTTQEKQKKLSLRPLSPRDPEQ
                     PHRAATPLELLFDLIFVVAIATAGQQLHHAIIENHLWHALPSYLMVFFALWWAWMNFS
                     WFASAYDNDDALYRCLTFVQIVGSLVMAAGIPDVFHSQDFDIIIVGYVIMRLALVTQW
                     LRAAKHDPERRITAYRYAIGIVLVQIGWLVANFAHALSIPLFLLLVVVELFVPIYAEK
                     YSPTPWHPHHIVERYALLTIIVLGESIVGSFNAIRDALAAQSINIPAVFLMIGGLMLM
                     FAMWWAYFDRSEQHHHVKGVRPFVWGYGHYFVFVSVAAVGAALAAAVDVTTHHAHISD
                     LYMGVIVAVSVVLYTSCIWILYEFQCLSGITKWFYPITALIILCIPFICNNVGYSVFA
                     MGIVYTLRLFISNKFMENIEPKQV"
     misc_feature    21519..>22304
                     /locus_tag="ABZJ_00022"
                     /note="Bacterial low temperature requirement A protein
                     (LtrA); Region: LtrA; cl01754"
                     /db_xref="CDD:261054"
     gene            complement(22704..24077)
                     /locus_tag="ABZJ_00023"
                     /db_xref="GeneID:12115096"
     CDS             complement(22704..24077)
                     /locus_tag="ABZJ_00023"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate-alanine ligase"
                     /protein_id="YP_005523979.1"
                     /db_xref="GI:384141269"
                     /db_xref="GeneID:12115096"
                     /translation="MHLHILGICGTFMGSLALLARDLGHKVTGSDSNVYPPMSTQLEN
                     AGIELMQGYDRSHLQPHPDLVIVGNAMKRGIDAVEYMLNEGLPYISGPQFLADHVLQG
                     KHVLGVAGTHGKTTTTTMLAWVLDQAGLNPGFLIGGVPLGFSESARLGGGKYFVVEAD
                     EYDSAFFDKRSKFVHYHPKTAILNNLEFDHADIFDDLAAIQKQFHHLVRTIPSEGRII
                     APITETHIDEVLEMGCWTPVIRTSLEANEKAALSAELISIDGSHFKVLENGNVVGEVK
                     WSMTGQHSVANALATIAAAQHVGVSLEKACEALSNFGGVKRRMELLGTINGIEVYDDF
                     AHHPTAIDTTLDGARKRLGERRLWAIIEPRSNTMRMGSHKDGLAHSARLADEVIWYQP
                     EGLDWDLQPVIEAATNHAQVSRSLDEIIERIVNEAGEGDAVVIMSNGGFGGLHQKLMS
                     ALKAKAA"
     misc_feature    complement(22719..24074)
                     /locus_tag="ABZJ_00023"
                     /note="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase; Region: mpl; TIGR01081"
                     /db_xref="CDD:130153"
     misc_feature    complement(23787..24074)
                     /locus_tag="ABZJ_00023"
                     /note="Mur ligase family, catalytic domain; Region:
                     Mur_ligase; pfam01225"
                     /db_xref="CDD:250458"
     misc_feature    complement(23223..23756)
                     /locus_tag="ABZJ_00023"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    complement(<23004..23135)
                     /locus_tag="ABZJ_00023"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            24313..24681
                     /locus_tag="ABZJ_00024"
                     /db_xref="GeneID:12115097"
     CDS             24313..24681
                     /locus_tag="ABZJ_00024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523980.1"
                     /db_xref="GI:384141270"
                     /db_xref="GeneID:12115097"
                     /translation="MMMKDVPLSPTVLAFVLLIISNCFMTLAWYGHLKFLHHAPFWQA
                     ILFGWTIALLEYSFMIPATRLLSDQGWTLGEMKITQEVVTLIVFVPFMVLLFKQPFKL
                     DYVWAMLCLFGCVYFVFRSQ"
     misc_feature    24328..24675
                     /locus_tag="ABZJ_00024"
                     /note="Protein of unknown function, DUF486; Region:
                     DUF486; cl01236"
                     /db_xref="CDD:242381"
     gene            complement(24668..24880)
                     /locus_tag="ABZJ_00026"
                     /db_xref="GeneID:12115098"
     CDS             complement(24668..24880)
                     /locus_tag="ABZJ_00026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523981.1"
                     /db_xref="GI:384141271"
                     /db_xref="GeneID:12115098"
                     /translation="MRPRSLAFPKRKNGKNSTCTKPSMREKDEANIIAVFSLTPKPKF
                     MWKKHDSDGFNNDLSENPISYNFTGF"
     gene            24859..25377
                     /locus_tag="ABZJ_00025"
                     /db_xref="GeneID:12115099"
     CDS             24859..25377
                     /locus_tag="ABZJ_00025"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase, mutase
                     subunit"
                     /protein_id="YP_005523982.1"
                     /db_xref="GI:384141272"
                     /db_xref="GeneID:12115099"
                     /translation="MPMNAVATDTQPLVGIIMGSQSDWATLEHTANMLKQLGVPFEAE
                     VVSAHRTPDRLFEYAETARDRGIQVIIAGAGGAAHLPGMCAAKTDLPVLGVPVKSSIL
                     NGVDSLLSIVQMPAGIAVGTLAIGPAGATNAAIMAAQILGLTRPEIAKNVADFRAAQT
                     DKVASNNIPGQV"
     misc_feature    24892..25347
                     /locus_tag="ABZJ_00025"
                     /note="AIR carboxylase; Region: AIRC; pfam00731"
                     /db_xref="CDD:250092"
     gene            25387..26508
                     /locus_tag="ABZJ_00027"
                     /db_xref="GeneID:12115100"
     CDS             25387..26508
                     /locus_tag="ABZJ_00027"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit"
                     /protein_id="YP_005523983.1"
                     /db_xref="GI:384141273"
                     /db_xref="GeneID:12115100"
                     /translation="MDKTIGIFGGGQLGRMMAQAALPLNIQCTFFEANTDCPAGVLGQ
                     VFSSQDEQGLKQFIESADVFSLEFENTPVADVDVLTQTKTLHPPRIALATAQNRLSEK
                     ALFDELAIPVAPYRAVDSLESLKKAVAELGLPIVLKTATGGYDGKGQFVLRSEDQIDT
                     AWAELGPAKSLVAESFVKFSREVSIIAVRGQNGEVKTWPLAENHHHNGILSHSIVPAP
                     NSEALQPVAQDYITRLLNHLNYVGVLTLELFVTEQGLCANEMAPRVHNSGHWSIEGAV
                     CSQFENHIRAVAGLPLGSTDVVRPTVMINIIGQHPKTEDVLALNGAHLHLYNKSERAG
                     RKLGHITLMPVDSNELTNLCRQLAKILPEPLALTDDMII"
     misc_feature    25387..26463
                     /locus_tag="ABZJ_00027"
                     /note="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit; Reviewed; Region: PRK06019"
                     /db_xref="CDD:235674"
     misc_feature    25699..26211
                     /locus_tag="ABZJ_00027"
                     /note="ATP-grasp domain; Region: ATP-grasp; pfam02222"
                     /db_xref="CDD:251165"
     gene            27137..28429
                     /locus_tag="ABZJ_00028"
                     /db_xref="GeneID:12115101"
     CDS             27137..28429
                     /locus_tag="ABZJ_00028"
                     /codon_start=1
                     /transl_table=11
                     /product="lytic murein transglycosylase family protein"
                     /protein_id="YP_005523984.1"
                     /db_xref="GI:384141274"
                     /db_xref="GeneID:12115101"
                     /translation="MRRFSCIVGSVFLAMTQAQAELVINGSTISSNATVPVTNSDTYT
                     PNNNFQSCLANLRSQAIAAGVSGSTYDRYTQNLTPDYSVIDKLNYQPEFSTPIWDYLS
                     GLVDEERVALGKQKLAQHRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQA
                     LGTLSCEGRRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAV
                     DFDGDGRRDLVSSTADALASTANFLNKAGWQTGMPWGFEVQIPAGMSIDGEGRRSKKP
                     LSSWSARGVTRIDGSPLIQGPLSGSTPAGLMAPAGPSGPVFLVFKNFDAIYSYNAAES
                     YGLAIAHLSDRLRGAGPFVSSWPTDDPGTSRAERREIQQFLINRGYDIGAVDGLIGDK
                     TRVAIRQEQTRLGLNPTGRAGQQILRAFRQEQARKMMQ"
     misc_feature    27278..28180
                     /locus_tag="ABZJ_00028"
                     /note="lytic murein transglycosylase; Region: MltB_2;
                     TIGR02283"
                     /db_xref="CDD:233810"
     misc_feature    27722..>27904
                     /locus_tag="ABZJ_00028"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    order(27761..27763,27860..27862)
                     /locus_tag="ABZJ_00028"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    28226..28393
                     /locus_tag="ABZJ_00028"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_1; pfam01471"
                     /db_xref="CDD:250643"
     gene            complement(28479..28865)
                     /locus_tag="ABZJ_00029"
                     /db_xref="GeneID:12115102"
     CDS             complement(28479..28865)
                     /locus_tag="ABZJ_00029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523985.1"
                     /db_xref="GI:384141275"
                     /db_xref="GeneID:12115102"
                     /translation="MEIKMSYYHILIEVNDHISTIEQTRDIELFDIIELKPYLHSILL
                     PYFNEQEIELEDENIEYKDILHLEVKQTLLPIEHLIEEEQKQLPSDTDVTITAYEIFN
                     DRDLSQDVTSVIFDILEAVKLDQSIV"
     gene            complement(29008..29976)
                     /locus_tag="ABZJ_00030"
                     /db_xref="GeneID:12115103"
     CDS             complement(29008..29976)
                     /locus_tag="ABZJ_00030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523986.1"
                     /db_xref="GI:384141276"
                     /db_xref="GeneID:12115103"
                     /translation="MRHKSHYFVEIVYFLIDFSFYILIIRFFSNLPPLIMRLTSLLLG
                     MAFAFSNFQANANLATPLHTQVQQKNVQHLTYKIAEVDPRFGLSQEQLIQITQQAADI
                     WKEGTGKNYFTYDPNAKLEIRLVYDDSQNRSTERQKIASQFKQDQQRVIDEQQQIKQL
                     KQNLSQTQSDLENKKQILNEKLKNFDQQMMQFKEGKLAPEYTAKSLSKTQKDLQKQTV
                     ALKKDIAAYNQQAADLNKKVTHFNQINDEFNQSLNQFKQNAQADVFKKGIYNGKQIMI
                     YEYSSIDDLRLTIAHELGHALGLKHSDQPGALMYSVRKDSDKKVIF"
     misc_feature    complement(<29068..>29334)
                     /locus_tag="ABZJ_00030"
                     /note="Dual-action HEIGH metallo-peptidase; Region:
                     Peptidase_M57; pfam12388"
                     /db_xref="CDD:152823"
     misc_feature    complement(29047..>29127)
                     /locus_tag="ABZJ_00030"
                     /note="Zinc-dependent metalloprotease. This super-family
                     of metalloproteases contains two major branches, the
                     astacin-like proteases and the adamalysin/reprolysin-like
                     proteases. Both branches have wide phylogenetic
                     distribution, and contain sub-families, which...; Region:
                     ZnMc; cl00064"
                     /db_xref="CDD:260167"
     misc_feature    complement(order(29074..29076,29092..29094,29101..29106))
                     /locus_tag="ABZJ_00030"
                     /note="active site"
                     /db_xref="CDD:238124"
     gene            complement(30058..30975)
                     /locus_tag="ABZJ_00031"
                     /db_xref="GeneID:12115104"
     CDS             complement(30058..30975)
                     /locus_tag="ABZJ_00031"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="YP_005523987.1"
                     /db_xref="GI:384141277"
                     /db_xref="GeneID:12115104"
                     /translation="MKKFLWWGISLYFSISLQVAAFAQSNLSNISFNQPLKYRMDYID
                     PRFKLTKEQFIQIGKEAAEIWQKETGKTYFIYDSQAELTINLVLDNQQATQNERKNSI
                     NELLKQQEEWREKNKAILLFKQQIDQETSLLNKEKENLNYKFEQYQKDVSLFNQGNYG
                     QFTQSSLNKRQAELSQLSLELQTKFSQHSNKIEMLNRQIKQINQQQNLLNQSIEQFNL
                     STTSGSKTFHKGLFSQNQIQIYGFTSFDDLRLTLAHEFGHSLGLKHTDDPKSLMYPLL
                     REQDIHNFKLTNSDLDLLATLYGSNDENH"
     misc_feature    complement(30079..>30237)
                     /locus_tag="ABZJ_00031"
                     /note="Zinc-dependent metalloprotease. This super-family
                     of metalloproteases contains two major branches, the
                     astacin-like proteases and the adamalysin/reprolysin-like
                     proteases. Both branches have wide phylogenetic
                     distribution, and contain sub-families, which...; Region:
                     ZnMc; cl00064"
                     /db_xref="CDD:260167"
     misc_feature    complement(order(30184..30186,30202..30204,30211..30216))
                     /locus_tag="ABZJ_00031"
                     /note="active site"
                     /db_xref="CDD:238124"
     gene            complement(31307..33247)
                     /locus_tag="ABZJ_00032"
                     /db_xref="GeneID:12115105"
     CDS             complement(31307..33247)
                     /locus_tag="ABZJ_00032"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="YP_005523988.1"
                     /db_xref="GI:384141278"
                     /db_xref="GeneID:12115105"
                     /translation="MAKIIGIDLGTTNSCVAVLEGDKVKVIENAEGARTTPSIIAYKD
                     GEILVGQSAKRQAVTNPKNTLFAIKRLIGRRYEDQAVQKDIGLVPYKIIKADNGDAWV
                     EVNDKKLAPQQISAEILKKMKKTAEDYLGETVTEAVITVPAYFNDAQRQATKDAGKIA
                     GLDVKRIINEPTAAALAFGMDKKEGDRKVAVYDLGGGTFDVSIIEIADLDGDQQIEVL
                     STNGDTFLGGEDFDNALIEYLVEEFKKEQNVNLKNDPLALQRLKEAAEKAKIELSSSN
                     ATEINLPYITADATGPKHLVINVTRAKLEGLVADLVARTIEPCKIALKDAGLSTSDIS
                     DVILVGGQSRMPLVQQKVQEFFGREPRKDVNPDEAVAIGAAIQGAVLSGDKNDVLLLD
                     VTPLTLGIETMGGVLTPIIEKNTTIPAKKSQVFSTAADNQPAVDISVYQGERKMAQQN
                     KLLGNFQLGDIPPAPRGVPQIEVSFDINADGILKVSAKDKSTGKEQSIQIKANSGLSD
                     AEIEAMIKDAEANAEEDRKFEELAKARNEADALISSSNKAVKDLGDKVAEDEKTAVNT
                     AVSELEAATKENDVEAIKAKTEALQNILMPITQRAYEQAQQAGGAEGFDPNAFQGGDA
                     GQQKADDGVVDAEFTEVKDDKK"
     misc_feature    complement(31313..33247)
                     /locus_tag="ABZJ_00032"
                     /note="molecular chaperone DnaK; Provisional; Region:
                     dnaK; PRK00290"
                     /db_xref="CDD:234715"
     misc_feature    complement(32105..33247)
                     /locus_tag="ABZJ_00032"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     misc_feature    complement(order(32228..32230,32660..32671,32738..32740,
                     33203..33205,33209..33211,33215..33226))
                     /locus_tag="ABZJ_00032"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            complement(33401..33988)
                     /locus_tag="ABZJ_00033"
                     /db_xref="GeneID:12115106"
     CDS             complement(33401..33988)
                     /locus_tag="ABZJ_00033"
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp 24 nucleotide exchange factor"
                     /protein_id="YP_005523989.1"
                     /db_xref="GI:384141279"
                     /db_xref="GeneID:12115106"
                     /translation="MFKNPFKRRSSMANEQNEQAQDIQNEQVEQSNEQTQAEGVEQAN
                     DVTVESLQAQITKLEENLKLEKARTANAVYEAQKSVERIQRESEKHKETVLEKFAKEL
                     LDSVDNLERAIQAAGDEETPVLEGVKLTLKSLLTTLEKFGVVEADTQNGFNADLHQAV
                     GIDPNAKANEIGTVLQKGYTLNGRLLRPAMVMVGQ"
     misc_feature    complement(33410..33745)
                     /locus_tag="ABZJ_00033"
                     /note="nucleotide exchange factor GrpE; Region: GrpE;
                     cd00446"
                     /db_xref="CDD:271355"
     misc_feature    complement(33650..33745)
                     /locus_tag="ABZJ_00033"
                     /note="2-helical coiled coil; other site"
                     /db_xref="CDD:271355"
     misc_feature    complement(order(33566..33571,33587..33589,33596..33604,
                     33608..33613,33653..33658,33662..33676,33680..33688,
                     33695..33700,33704..33709,33716..33721,33728..33733,
                     33740..33742))
                     /locus_tag="ABZJ_00033"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:271355"
     misc_feature    complement(order(33410..33412,33419..33421,33425..33427,
                     33437..33439,33464..33466,33506..33520,33524..33529,
                     33533..33535,33647..33649,33656..33658,33722..33724))
                     /locus_tag="ABZJ_00033"
                     /note="Hsp70 (ATPase domain) interactions [polypeptide
                     binding]; other site"
                     /db_xref="CDD:271355"
     misc_feature    complement(33566..33613)
                     /locus_tag="ABZJ_00033"
                     /note="2-helical coiled coil; other site"
                     /db_xref="CDD:271355"
     gene            complement(34119..35012)
                     /locus_tag="ABZJ_00034"
                     /db_xref="GeneID:12115107"
     CDS             complement(34119..35012)
                     /locus_tag="ABZJ_00034"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005523990.1"
                     /db_xref="GI:384141280"
                     /db_xref="GeneID:12115107"
                     /translation="MDTLKAIQVFVSIAQHGNLTKAAEHLNYSRAMVSRYLEHLEHTF
                     STRLFQRNTRKISLTPAGEKALLYCENILQQQQLLQELAAPEQHNGTIRFTCGLFLFE
                     LGVAECIRQFKRQHPHIQFDVYLTESTMDLIDAQVDLALRITQKVADGLIARPVCQIE
                     SVFCAHPDYLKQHSPLLHPRQLIQHECIAHHSQHQFWTLFDNEQQPQNYPLNVTFKSN
                     DVNALYDMCLHAQGVAMLPTLLVEKDLKEKRLKALFKNFTAPELSLSVVYASRQHLPR
                     ITQEFIAFMIENLDFYLKPQN"
     misc_feature    complement(34146..35006)
                     /locus_tag="ABZJ_00034"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(34824..35003)
                     /locus_tag="ABZJ_00034"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(34158..34745)
                     /locus_tag="ABZJ_00034"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(34221..34223,34302..34304,34353..34355,
                     34536..34538,34542..34544,34584..34586,34701..34703,
                     34713..34715))
                     /locus_tag="ABZJ_00034"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(34326..34328,34335..34340,34359..34373,
                     34455..34457,34638..34658,34662..34664,34674..34676,
                     34683..34688,34692..34697,34707..34712))
                     /locus_tag="ABZJ_00034"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            35120..35986
                     /locus_tag="ABZJ_00035"
                     /db_xref="GeneID:12115108"
     CDS             35120..35986
                     /locus_tag="ABZJ_00035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523991.1"
                     /db_xref="GI:384141281"
                     /db_xref="GeneID:12115108"
                     /translation="MKLFKLSASALATATALTMAQSALAQDLKIQSFLAKPEHFGVTS
                     TLIEGDKEVLLVNAQFSKSEALRIAANILDSGKTLKTIFVSYGDPDYYFGLDVFKQYF
                     PNVQIIATPETVKHIQDTQALKVKYWGPQMGANAPSQIIVPQAYTAKTLKLENESIEI
                     KGKKELTYLWVPSAKAVVGGIPVSSGIHLWMADTPKTKDRVEVIQSLESIKALQPKIV
                     VPAHMVEGAPQGLDAVNFSISYLNSYEKAAKATKNATELSKLMQKQYPTLQSVDSLEL
                     GAKVVKGEMQWP"
     misc_feature    35225..35842
                     /locus_tag="ABZJ_00035"
                     /note="Zn-dependent hydrolases, including glyoxylases
                     [General function prediction only]; Region: GloB; COG0491"
                     /db_xref="CDD:223565"
     gene            36380..36610
                     /locus_tag="ABZJ_00036"
                     /db_xref="GeneID:12115109"
     CDS             36380..36610
                     /locus_tag="ABZJ_00036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523992.1"
                     /db_xref="GI:384141282"
                     /db_xref="GeneID:12115109"
                     /translation="MKKLGLISVVLAGVAFTAVGCASEAGLNASGSAQTSASPSGVQA
                     GVGVDAGVSGQAQPGQVDAGASGSVSGSATAQ"
     gene            complement(36786..37112)
                     /locus_tag="ABZJ_00037"
                     /db_xref="GeneID:12115110"
     CDS             complement(36786..37112)
                     /locus_tag="ABZJ_00037"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523993.1"
                     /db_xref="GI:384141283"
                     /db_xref="GeneID:12115110"
                     /translation="MSAKLVVTLLATSLLTVGCVAYTDDPYYRGGYGYHDHDDDRYDR
                     NDGRRYSEWERKRWEERKRLYEQQRKDIREQQKDRREWEKRHREWEKKRLEDRDHDHR
                     DYRHDD"
     gene            37323..38393
                     /locus_tag="ABZJ_00038"
                     /db_xref="GeneID:12115111"
     CDS             37323..38393
                     /locus_tag="ABZJ_00038"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase/lipase"
                     /protein_id="YP_005523994.1"
                     /db_xref="GI:384141284"
                     /db_xref="GeneID:12115111"
                     /translation="MTAFNQKIQTLLDKGQGPAARALDRLPRLAQESLAKILGYSYQY
                     PDLDSFTKCMMAVQIKQGRVGFIGSDPLESRRAFDAQMQAIRQKPTDIELVEDIRLPL
                     QSGTIFARHYHPAPNKKLPLIVFYHGGGFVVGGLDTHDEVCRLLAKYAKVQVLSIDYP
                     LAPEVSPQHLIQSCEDALAWVYQNRRQLKILKSRIAVAGDSAGGNISTVVAQRSVNKA
                     YAPQAQLLIYPTVDFKSRHPSFYAYNEGLVLTNTDIDYVTQYYATHHNVELDDPIISP
                     TYGNLKKNPPAFVITAGHDVLHDEAKIYSHKLRQNGVKMHYEEFPDQTHGFINLTPIS
                     RKAKRYTIEISKNFRKFWDKNS"
     misc_feature    37608..38333
                     /locus_tag="ABZJ_00038"
                     /note="Esterases and lipases (includes fungal lipases,
                     cholinesterases, etc.)  These enzymes act on carboxylic
                     esters (EC: 3.1.1.-). The catalytic apparatus involves
                     three residues (catalytic triad): a serine, a glutamate or
                     aspartate and a histidine.These...; Region:
                     Esterase_lipase; cl21494"
                     /db_xref="CDD:271914"
     misc_feature    37689..38309
                     /locus_tag="ABZJ_00038"
                     /note="alpha/beta hydrolase fold; Region: Abhydrolase_3;
                     pfam07859"
                     /db_xref="CDD:254474"
     gene            38537..39094
                     /locus_tag="ABZJ_00039"
                     /db_xref="GeneID:12115112"
     CDS             38537..39094
                     /locus_tag="ABZJ_00039"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_005523995.1"
                     /db_xref="GI:384141285"
                     /db_xref="GeneID:12115112"
                     /translation="MKKLLMLLCLGVSSHSVWANTLVEMQTNLGNIEIELYDDKAPMS
                     VNNFKGYIKSGFYKETIFHRVIPGFMAQGGGMTANMQEKTTRAPIKNEAGNGIANTRG
                     TLAMARTSNPDSATSQFFINVADNNFLNRSPGNPGYAVFGKVVKGMDVVDRIVQAPTS
                     NYGMHQNVPKQPIKIVDIKIKNSQK"
     misc_feature    38606..39061
                     /locus_tag="ABZJ_00039"
                     /note="cyclophilin_EcCYP_like: cyclophilin-type A-like
                     peptidylprolyl cis- trans isomerase (PPIase) domain
                     similar to the cytosolic E. coli cyclophilin A and
                     Streptomyces antibioticus SanCyp18. Compared to the
                     archetypal cyclophilin Human cyclophilin A, these...;
                     Region: cyclophilin_EcCYP_like; cd01920"
                     /db_xref="CDD:238901"
     misc_feature    order(38726..38728,38732..38734,38741..38746,38750..38752,
                     38855..38872,38894..38896,38918..38923,38948..38950)
                     /locus_tag="ABZJ_00039"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238901"
     gene            39493..41017
                     /locus_tag="ABZJ_rRNA1"
                     /db_xref="GeneID:12115113"
     rRNA            39493..41017
                     /locus_tag="ABZJ_rRNA1"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:12115113"
     gene            41082..41158
                     /locus_tag="ABZJ_tRNA1"
                     /db_xref="GeneID:12115114"
     tRNA            41082..41158
                     /locus_tag="ABZJ_tRNA1"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:12115114"
     gene            41214..41289
                     /locus_tag="ABZJ_tRNA2"
                     /db_xref="GeneID:12115115"
     tRNA            41214..41289
                     /locus_tag="ABZJ_tRNA2"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:12115115"
     gene            41632..44521
                     /locus_tag="ABZJ_rRNA2"
                     /db_xref="GeneID:12115116"
     rRNA            41632..44521
                     /locus_tag="ABZJ_rRNA2"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:12115116"
     gene            44708..44821
                     /locus_tag="ABZJ_rRNA3"
                     /db_xref="GeneID:12115117"
     rRNA            44708..44821
                     /locus_tag="ABZJ_rRNA3"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:12115117"
     gene            44858..45292
                     /locus_tag="ABZJ_00040"
                     /db_xref="GeneID:12115118"
     CDS             44858..45292
                     /locus_tag="ABZJ_00040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005523996.1"
                     /db_xref="GI:384141286"
                     /db_xref="GeneID:12115118"
                     /translation="MFFYMGKQSIKNYLNIELQIIFGCLLDTMDIMRRFFIFGVPVKI
                     NSFSPIPEDDEELSLPELIYWASLGDLEQVKQLLIDGEDPNQTDDEGYSALQAAAEND
                     HLDIVKLLVEKGAHVPYKSEYTALQLAEMAGNTDIVNYLKSL"
     misc_feature    45053..>45280
                     /locus_tag="ABZJ_00040"
                     /note="ankyrin repeats;  ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    45053..45190
                     /locus_tag="ABZJ_00040"
                     /note="Ankyrin repeats (many copies); Region: Ank_4;
                     pfam13637"
                     /db_xref="CDD:257947"
     misc_feature    45128..45280
                     /locus_tag="ABZJ_00040"
                     /note="Ankyrin repeats (many copies); Region: Ank_4;
                     pfam13637"
                     /db_xref="CDD:257947"
     gene            complement(45338..45880)
                     /locus_tag="ABZJ_00041"
                     /db_xref="GeneID:12115119"
     CDS             complement(45338..45880)
                     /locus_tag="ABZJ_00041"
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="YP_005523997.1"
                     /db_xref="GI:384141287"
                     /db_xref="GeneID:12115119"
                     /translation="MLVYIIVGSVREGRTAIKIANWLETTIPSFNLKDFQTEVIDLKE
                     WNLPLFSGSHPPATGIYDQPKQQEWADKIAQADAFIFISPEYNHGYSPALKNAIDYVG
                     KEWSGKPAAFIGYGSTNGSRSISQIRQVTSSLSIVDPNAVIEIRDIFKRNKDEKFEAN
                     EFEVKGLQSIVEKLQKYHLS"
     misc_feature    complement(45479..45880)
                     /locus_tag="ABZJ_00041"
                     /note="NADPH-dependent FMN reductase; Region: FMN_red;
                     pfam03358"
                     /db_xref="CDD:251896"
     gene            complement(46015..46506)
                     /locus_tag="ABZJ_00042"
                     /db_xref="GeneID:12115120"
     CDS             complement(46015..46506)
                     /locus_tag="ABZJ_00042"
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_005523998.1"
                     /db_xref="GI:384141288"
                     /db_xref="GeneID:12115120"
                     /translation="MHNMTEIIQPNEEIRITDGSKVDLHFSVAIENGVEIDNTRSREE
                     PVSLTIGDGNLLPGFEKALLGLRAGDRRTVHLPPEDAFGPWNPENIQTFDTVKFEQRP
                     IPGHMIEFEDKAKATLFGVVKSVNDDITEIDFNHPLAGKNITFEVEIFKVTPAGQQGI
                     KIM"
     misc_feature    complement(46042..46497)
                     /locus_tag="ABZJ_00042"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Region: FKBP_C; cl19519"
                     /db_xref="CDD:267872"
     misc_feature    complement(46024..46464)
                     /locus_tag="ABZJ_00042"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerases 2
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: SlpA; COG1047"
                     /db_xref="CDD:223976"
     gene            complement(46499..47029)
                     /locus_tag="ABZJ_00043"
                     /db_xref="GeneID:12115121"
     CDS             complement(46499..47029)
                     /locus_tag="ABZJ_00043"
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein signal peptidase (Signal
                     peptidase II.)"
                     /protein_id="YP_005523999.1"
                     /db_xref="GI:384141289"
                     /db_xref="GeneID:12115121"
                     /translation="MPNSQAKKGLFQFYPHNLIWLGLSVLAIVLDQWTKWIASTHLNY
                     ADPVPVLPFLNWTLLHNYGAAFSFLSDAGGWQRYFFTSLAGLVSILFVFWLLRMPKKM
                     VVLPVAIALILGGALGNLIDRITLGYVVDFIHVYYQNHHFPAFNIADSAITLGTILLL
                     IDTFFLEKQRPKNSDA"
     misc_feature    complement(46523..46987)
                     /locus_tag="ABZJ_00043"
                     /note="lipoprotein signal peptidase; Reviewed; Region:
                     lspA; PRK00376"
                     /db_xref="CDD:234739"
     gene            complement(47022..49859)
                     /locus_tag="ABZJ_00044"
                     /db_xref="GeneID:12115122"
     CDS             complement(47022..49859)
                     /locus_tag="ABZJ_00044"
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucyl-tRNA synthetase"
                     /protein_id="YP_005524000.1"
                     /db_xref="GI:384141290"
                     /db_xref="GeneID:12115122"
                     /translation="MSDKQTTENAVDYKATLNLPDTQFAMKANLAVREVKWLEEWYTD
                     NIYQQIRASRIGKKKYILHDGPPYANGTIHLGHAVNKVLKDIIVKSRTLAGFDAPYVP
                     GWDCHGLPIELKVEEKVGKVGEKVDAATFRKHCREYALKQIDLQRTDFKRLGILGDWD
                     NPYLTMNYKQEADIVRALGLIQKNGHIQPGLKPVNWCMDCGSALAEAEVEYEDKKSDA
                     IDVGFGVVDLKDLSARVNVEVQDPTDIVIWTTTPWTLPANQAVALHAEIEYQLVQVTT
                     ERGKQNFILAKDLVASAIERYKLENPVVLADFTGSALENLTLQHPLLTDRQVPVILGE
                     HVIATSGTGAVHTAPGHGADDYKVGLQYNLKVENPVGGNGVYLPTAPIFAGEHIYKAN
                     PKIIEALGAVGRLWAHQPIKHSYPHCWRHKTPIIFRATPQWFISMDQKGLRDGALNAI
                     ENDIEFVPNWGKNRIESMIEGRPDWCISRQRTWGVPIPFFVHKDTNELHPRTPELIEE
                     VAKLIEKEGIDAWFNRDAKDFIGEDAEQYNAVRDTLDVWFDSGTTHYAVLEQRDELES
                     PADLYLEGSDQHRGWFQSSLLTSMAIHNRAPYKALLTHGFTVDENGRKLSKSLGNYIP
                     LEEIIKHLGADGLRLYVASSDYRYEIAASKEIFSRVSDSYRRIRNTLRFLLANLNGFK
                     PSTDALAVDDLIALDQYILQRANEVQQTIIAAYEEMNFHVVCSALTSFCINDLGGFYL
                     DIIKDRQYTTKADSQARRSAQTALYHIVQAFVRWMSPILSFTAQEAWPLIPEQTEKYV
                     FTAEWYDLPVSSKANLLSEADWQTLISVKSAVNKQIEAARNAKLVGSNLSAKVELWAN
                     ESLQTVLNQLADELRFVLITSQVVVHPFAEQGEATEMEGLRVQVSAAEGEKCARCWHV
                     LPDVNTHVDHPGLCGRCIVNVTGRGEVRKYA"
     misc_feature    complement(47049..49826)
                     /locus_tag="ABZJ_00044"
                     /note="isoleucyl-tRNA synthetase; Reviewed; Region: ileS;
                     PRK05743"
                     /db_xref="CDD:235588"
     misc_feature    complement(<49272..49688)
                     /locus_tag="ABZJ_00044"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:260139"
     misc_feature    complement(49629..49640)
                     /locus_tag="ABZJ_00044"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    complement(49629..49640)
                     /locus_tag="ABZJ_00044"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    complement(order(49629..49631,49638..49640))
                     /locus_tag="ABZJ_00044"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    complement(<48741..>48938)
                     /locus_tag="ABZJ_00044"
                     /note="Leucyl-tRNA synthetase, Domain 2; Region:
                     tRNA-synt_1_2; pfam13603"
                     /db_xref="CDD:257918"
     misc_feature    complement(47913..>48590)
                     /locus_tag="ABZJ_00044"
                     /note="catalytic core domain of isoleucyl-tRNA
                     synthetases; Region: IleRS_core; cd00818"
                     /db_xref="CDD:173909"
     misc_feature    complement(order(48009..48026,48036..48050,48117..48119,
                     48123..48125,48129..48143,48210..48212,48219..48221,
                     48468..48470))
                     /locus_tag="ABZJ_00044"
                     /note="active site"
                     /db_xref="CDD:173909"
     misc_feature    complement(48006..48020)
                     /locus_tag="ABZJ_00044"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173909"
     misc_feature    complement(47367..47903)
                     /locus_tag="ABZJ_00044"
                     /note="Anticodon-binding domain of bacterial and
                     eukaryotic mitochondrial isoleucyl tRNA synthetases;
                     Region: Anticodon_Ia_Ile_BEm; cd07960"
                     /db_xref="CDD:153414"
     misc_feature    complement(order(47367..47369,47376..47378,47628..47630,
                     47637..47639,47649..47651,47664..47666,47673..47678,
                     47685..47690,47697..47699,47841..47846,47853..47855,
                     47862..47864,47874..47876,47883..47885,47895..47897))
                     /locus_tag="ABZJ_00044"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153414"
     misc_feature    complement(order(47844..47846,47853..47855))
                     /locus_tag="ABZJ_00044"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153414"
     misc_feature    complement(47064..47147)
                     /locus_tag="ABZJ_00044"
                     /note="Zinc finger found in FPG and IleRS; Region:
                     zf-FPG_IleRS; pfam06827"
                     /db_xref="CDD:253933"
     gene            complement(49921..50922)
                     /locus_tag="ABZJ_00045"
                     /db_xref="GeneID:12115123"
     CDS             complement(49921..50922)
                     /locus_tag="ABZJ_00045"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FMN
                     adenylyltransferase"
                     /protein_id="YP_005524001.1"
                     /db_xref="GI:384141291"
                     /db_xref="GeneID:12115123"
                     /translation="MKLLRLNALSPNFQLPQTAVTIGNFDGVHLGHQAMIAQLKKIAA
                     AQGLKTLVMIFEPQPLEFFKGYDAPPRINSLREKVEYLAELGVDYIAVAKFDQHFRSM
                     SASEFADLLKDKLNAQALVLGDDFHFGKDRQGNSEFLKNYGFQVTNLHTIELEGERVS
                     STRIRQVLQVGNLALAAKLLGRPYSITGRVQYGDQIGRTLDFPTINVRLNRHKPCLNG
                     IYGVEVICETTSLTQKVLQDNPEKPGIAGYHENSLYGAGHVGTRPAIQQEHPEWRLEV
                     HFPDVSANLYGLFMRVTFLHYLHGELNYPSLEALKAGIDNDVQQLRQYRNDTTQFPF"
     misc_feature    complement(49951..50883)
                     /locus_tag="ABZJ_00045"
                     /note="bifunctional riboflavin kinase/FMN
                     adenylyltransferase; Reviewed; Region: PRK05627"
                     /db_xref="CDD:235536"
     misc_feature    complement(50344..50871)
                     /locus_tag="ABZJ_00045"
                     /note="FAD synthetase, N-terminal domain of the
                     bifunctional enzyme; Region: FAD_synthetase_N; cd02064"
                     /db_xref="CDD:185679"
     misc_feature    complement(order(50440..50448,50470..50472,50548..50550,
                     50827..50829,50836..50838,50845..50856))
                     /locus_tag="ABZJ_00045"
                     /note="active site"
                     /db_xref="CDD:185679"
     misc_feature    complement(49945..50388)
                     /locus_tag="ABZJ_00045"
                     /note="Riboflavin kinase; Region: Flavokinase; smart00904"
                     /db_xref="CDD:214901"
     gene            51131..52264
                     /locus_tag="ABZJ_00046"
                     /db_xref="GeneID:12115124"
     CDS             51131..52264
                     /locus_tag="ABZJ_00046"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein"
                     /protein_id="YP_005524002.1"
                     /db_xref="GI:384141292"
                     /db_xref="GeneID:12115124"
                     /translation="MKRPFYQLNQSKDVIRHFTPNWFTATMGTGVVSMILIQLPFAKS
                     FLFMLATLLWQFNIVLFSVFSVLYLLRWFLFPHEAKQIFNHPNMSLFLGAIPMGLATI
                     LNGFLSFGIGLYGEVAVHIAQALWYIDVFLALAIAWIVPFCMFSRQNHQLHTMTAIWL
                     LPVVACEVAASSAGMLVAHLPADVHSFHLLLAGYVLWGISVLPAFAILTILMLRMALH
                     QLPEKEVAISSWLSLGPIGTGALGLLLLGEQAQRVFVNVGFPELAHVFKALGVVGSLV
                     LLGFGLWWLGLAILTTLRHAKTGIPFNLGWWGLTFPFGVFILALFNLGHQIEVVFLQY
                     VAVAFSILLLVMWSVVMKKTLAGAYSGKLFFSPCLVALQQRMQ"
     misc_feature    51170..52183
                     /locus_tag="ABZJ_00046"
                     /note="Tellurite-resistance/Dicarboxylate Transporter
                     (TDT) family includes sulfite sensitivity protein (sulfite
                     efflux pump; SSU1); Region: TDT_SSU1; cd09318"
                     /db_xref="CDD:187758"
     misc_feature    52061..52063
                     /locus_tag="ABZJ_00046"
                     /note="gating phenylalanine in ion channel; other site"
                     /db_xref="CDD:187758"
     gene            52345..52911
                     /locus_tag="ABZJ_00047"
                     /db_xref="GeneID:12115125"
     CDS             52345..52911
                     /locus_tag="ABZJ_00047"
                     /codon_start=1
                     /transl_table=11
                     /product="putative MTA/SAH nucleosidase"
                     /protein_id="YP_005524003.1"
                     /db_xref="GI:384141293"
                     /db_xref="GeneID:12115125"
                     /translation="MNTDTALIMALPNESKGLFEQAGIEVHYSGIGKINAAFKAFEVI
                     QKTGCKTLINLGTAGSSSFNRHDLVEIKTFVQRDMDVSPLGFEVGVTPLDDHLAAEIH
                     LQTHFADLPKGICGTGDSFETGQPKVACDVVDMEGYALAKVCHKLGVRLISVKYITDG
                     ADDTAHLDWEENLLLGAQKLLALYQNHF"
     misc_feature    52426..52878
                     /locus_tag="ABZJ_00047"
                     /note="Phosphorylase superfamily; Region: PNP_UDP_1;
                     cl00303"
                     /db_xref="CDD:271463"
     gene            complement(52946..53566)
                     /locus_tag="ABZJ_00048"
                     /db_xref="GeneID:12115126"
     CDS             complement(52946..53566)
                     /locus_tag="ABZJ_00048"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005524004.1"
                     /db_xref="GI:384141294"
                     /db_xref="GeneID:12115126"
                     /translation="MQQMEQKKSTQKRNQLLAAALDVFSLYGFSGASLDEIAQLADMH
                     KSNIFYYYENKESLYVEVLTTVLQKWLAPLQTLEAELEPAEALSHYLIQKIELSRSQP
                     KASRLFALEIIQGAPHILPILKGPLKKLFKRKAKVIQTWQEQGKISPDIDPELLILNI
                     WGLTQNYADFATQMEMVTGKTLRNRSMFQRSIEHTVHMMLYGVLPR"
     misc_feature    complement(52949..53533)
                     /locus_tag="ABZJ_00048"
                     /note="pyrimidine utilization regulatory protein R;
                     Region: RutR; TIGR03613"
                     /db_xref="CDD:200300"
     misc_feature    complement(53381..53521)
                     /locus_tag="ABZJ_00048"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    complement(52949..53380)
                     /locus_tag="ABZJ_00048"
                     /note="YcdC-like protein, C-terminal region; Region:
                     TetR_C_3; pfam08362"
                     /db_xref="CDD:203918"
     gene            complement(53827..54627)
                     /locus_tag="ABZJ_00049"
                     /db_xref="GeneID:12115127"
     CDS             complement(53827..54627)
                     /locus_tag="ABZJ_00049"
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate ABC transporter ATP-binding
                     protein"
                     /protein_id="YP_005524005.1"
                     /db_xref="GI:384141295"
                     /db_xref="GeneID:12115127"
                     /translation="MTNLNLNINQNDVELIPENHPESQEPVVGAEILIEQLYKFYGEV
                     KVLEDLNLHIQPGEFLAIVGRSGCGKSTLLRLIAQLEKASFGEIKFKSARHLREGITN
                     DDIRVMFQDPRLLPWRNILQNVQLGLPKSQHALAEELLEKVGLKEKAGQWPSQLSGGQ
                     RQRTALARALSHTPRILLLDEPLGALDALTRLEMQSLIERLWKEQGFTAILVTHDVSE
                     AVQLADRIILLDKGQIAQSFQVNLPRPRKKSITFAQLEQQVLDAVLAT"
     misc_feature    complement(53833..54543)
                     /locus_tag="ABZJ_00049"
                     /note="aliphatic sulfonates transport ATP-binding subunit;
                     Provisional; Region: ssuB; PRK11247"
                     /db_xref="CDD:183055"
     misc_feature    complement(53902..54534)
                     /locus_tag="ABZJ_00049"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    complement(54415..54438)
                     /locus_tag="ABZJ_00049"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(order(53986..53988,54085..54090,54298..54300,
                     54412..54420,54424..54429))
                     /locus_tag="ABZJ_00049"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(54298..54309)
                     /locus_tag="ABZJ_00049"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(54133..54162)
                     /locus_tag="ABZJ_00049"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(54085..54102)
                     /locus_tag="ABZJ_00049"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(54067..54078)
                     /locus_tag="ABZJ_00049"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(53980..54000)
                     /locus_tag="ABZJ_00049"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            complement(54641..55438)
                     /locus_tag="ABZJ_00050"
                     /db_xref="GeneID:12115128"
     CDS             complement(54641..55438)
                     /locus_tag="ABZJ_00050"
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate ABC transporter permease"
                     /protein_id="YP_005524006.1"
                     /db_xref="GI:384141296"
                     /db_xref="GeneID:12115128"
                     /translation="MSKDINIVSRGTKQVGQRLLPWIFPIVLLVVWQIASSSGLLENR
                     ILPAPTAVVSAFWHLLISGELWQHVKVSAGRALLGLFIGGGLGLLLGLLNGSSRFAST
                     LLDTTLQMIRNIPALALIPLVILWFGIDETAKLFLVAVGVFFPIYINTYHGIRSVDPQ
                     LIEMGKSYGLSRWQLYKEIILPGAMPSILVGLRFALGLVWVLLIVAETISAQAGIGYM
                     TMNAREFLQTDVVLVGILLYALLGKLADVLAQLLERYLLRWHAGYQK"
     misc_feature    complement(54647..55414)
                     /locus_tag="ABZJ_00050"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(54707..55147)
                     /locus_tag="ABZJ_00050"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(54707..54712,54719..54724,54731..54736,
                     54740..54745,54752..54757,54785..54790,54827..54832,
                     54857..54859,54866..54871,54911..54913,54962..54964,
                     54971..54976,54986..54988,54992..54997,55004..55006,
                     55010..55012,55016..55021,55067..55069,55073..55078,
                     55085..55114,55118..55129))
                     /locus_tag="ABZJ_00050"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(54833..54838,55067..55111))
                     /locus_tag="ABZJ_00050"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(54755..54757,54785..54787,54794..54796,
                     54830..54832,55067..55069))
                     /locus_tag="ABZJ_00050"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(54890..54892,54902..54907,54923..54961))
                     /locus_tag="ABZJ_00050"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(55435..56616)
                     /locus_tag="ABZJ_00051"
                     /db_xref="GeneID:12115129"
     CDS             complement(55435..56616)
                     /locus_tag="ABZJ_00051"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F420-dependent N5,N10-methylene
                     tetrahydromethanopterin reductase"
                     /protein_id="YP_005524007.1"
                     /db_xref="GI:384141297"
                     /db_xref="GeneID:12115129"
                     /translation="MHMKIFWFIPTHGDSRYLGTSKGARQVDHAYMKQIAVAVDNLGY
                     EGVLIPTGRSCEDPWITAASLIDATQHLKFLVALRPGVTTPALAARMAATFDRLSNGR
                     VLLNLVTGGDEAELRGDGLYEDHSTRYQTANEYVKIWREILTRSHTGETFTFHGERLQ
                     VDDAKLLYPPVQKPYPPLWFGGSSDVAVELAAEQVDTYLTWGEPPAAVKEKIEHVRAK
                     AEAKGRKLTYGIRLHVIVRETNEQAWAAANELIQYLDDATIAAAQKKFAQMDSVGQQR
                     MAALHGGNRDKLEVSPNLWAGIGLVRGGAGTALVGDPETVAARIQEYADLGIDTFIFS
                     GYPHLEESIRFAELVFPLLPIETRAKLAQPNLTGPFGEIIANNYVPDEKKQNSSVKEP
                     A"
     misc_feature    complement(55876..56610)
                     /locus_tag="ABZJ_00051"
                     /note="Alkanesulfonate monoxygenase is the monoxygenase of
                     a two-component system that catalyzes the conversion of
                     alkanesulfonates to the corresponding aldehyde and
                     sulfite. Alkanesulfonate monoxygenase (SsuD) has an
                     absolute requirement for reduced flavin...; Region:
                     Alkanesulfonate_monoxygenase; cd01094"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(55918..55920,55924..55926,56020..56022,
                     56062..56067,56233..56235,56293..56295,56452..56454,
                     56581..56583,56593..56595))
                     /locus_tag="ABZJ_00051"
                     /note="active site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(56113..56118,56122..56133,56137..56139,
                     56263..56268,56275..56277,56326..56328,56335..56337,
                     56344..56349,56356..56361,56365..56367,56416..56418,
                     56425..56430,56437..56439,56446..56463))
                     /locus_tag="ABZJ_00051"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(56383..56388)
                     /locus_tag="ABZJ_00051"
                     /note="non-prolyl cis peptide bond; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(55876..55887,55906..55917,56098..56139,
                     56236..56244,56263..56289))
                     /locus_tag="ABZJ_00051"
                     /note="insertion regions; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(55570..>56109)
                     /locus_tag="ABZJ_00051"
                     /note="Flavin-utilizing monoxygenases; Region:
                     Flavin_utilizing_monoxygenases; cl19096"
                     /db_xref="CDD:267449"
     gene            complement(56637..57620)
                     /locus_tag="ABZJ_00052"
                     /db_xref="GeneID:12115130"
     CDS             complement(56637..57620)
                     /locus_tag="ABZJ_00052"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type nitrate/sulfonate/bicarbonate transport
                     system protein, periplasmic component"
                     /protein_id="YP_005524008.1"
                     /db_xref="GI:384141298"
                     /db_xref="GeneID:12115130"
                     /translation="MQHQSLFNKSQWTQLVKRFSAVAVLGFTIAAPAWAIDPTVKELR
                     IGFQKSSINFAIAKQQKLFEQEFPNAKITWNEFPAGPQILEALAVGSLDVGVTGDTPP
                     VYAQAAGKPLYYIAYEAAKPLASAILVPKNSQLKQLKDLKGKRIALQKGSSSHYLLVQ
                     AVRKAGLKWSDITPIWLTPADARAAFQKGAVDAWAIWDPYYASAQLEDQARVLASGKG
                     LSPNYTFYLAAPNFVKQYPKAVPGLIKQFNQADKWVQSHQAETASAIGQSTGLKPATS
                     DLFIKRRPRPSSAAPLNSKVIAEQQQLADIFTQQGIIPKPISIKQAVWGAK"
     misc_feature    complement(56643..57494)
                     /locus_tag="ABZJ_00052"
                     /note="ABC transporter, substrate-binding protein,
                     aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
                     /db_xref="CDD:130789"
     misc_feature    complement(56865..57416)
                     /locus_tag="ABZJ_00052"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(57030..57032,57162..57164,57306..57308,
                     57381..57383))
                     /locus_tag="ABZJ_00052"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(57051..57053,57069..57071,57081..57083))
                     /locus_tag="ABZJ_00052"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(56946..56963)
                     /locus_tag="ABZJ_00052"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(57692..58660)
                     /locus_tag="ABZJ_00053"
                     /db_xref="GeneID:12115131"
     CDS             complement(57692..58660)
                     /locus_tag="ABZJ_00053"
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate transport protein"
                     /protein_id="YP_005524009.1"
                     /db_xref="GI:384141299"
                     /db_xref="GeneID:12115131"
                     /translation="MALFNSTSWAKYSVIAASLAGVMMLGGCAKKEEHTTTTLNIGYQ
                     KYGILPILKARGDLEKALKDQGVQVKWVEFPAGPQLLEGLNVGSVSLGEAGEAPPIFA
                     QAANPNLVYVANQPAAPKAEALLVQKDSPIQSIKDLKGKRVALNKGSNVHYLLLKVLE
                     ANHLSLSDIQPVYLPPSDARAAFEKGAVDAWVIWDPFFAAAEHQIQARVLATGENLVS
                     NHQFYLADRKFAENNPKVLNTVVQTLNQTTEWVSTHQDEAAKLLEKPTALEFDVLKTS
                     ISRMGFGVQPISDKVAQEQQYVADAFYAQKLIPNKLTIQEAILKLK"
     misc_feature    complement(57725..58549)
                     /locus_tag="ABZJ_00053"
                     /note="Substrate binding domain of sulfonate binding
                     protein, a member of the type 2 periplasmic binding fold
                     superfamily; Region: PBP2_SsuA; cd13557"
                     /db_xref="CDD:270275"
     misc_feature    complement(57725..58546)
                     /locus_tag="ABZJ_00053"
                     /note="ABC transporter, substrate-binding protein,
                     aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
                     /db_xref="CDD:130789"
     misc_feature    complement(order(57998..58000,58070..58072,58079..58084,
                     58208..58210,58223..58225,58295..58297,58430..58432,
                     58526..58528))
                     /locus_tag="ABZJ_00053"
                     /note="chemical substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:270275"
     gene            complement(58994..60349)
                     /locus_tag="ABZJ_00054"
                     /db_xref="GeneID:12115132"
     CDS             complement(58994..60349)
                     /locus_tag="ABZJ_00054"
                     /codon_start=1
                     /transl_table=11
                     /product="N-alpha-acetylglutamate synthase (amino-acid
                     acetyltransferase)"
                     /protein_id="YP_005524010.1"
                     /db_xref="GI:384141300"
                     /db_xref="GeneID:12115132"
                     /translation="MPTKSLEKSHNNTQHYVHWFRHSAPYINAHRDKTFVLMFGGEAV
                     RDPNFEHIIHDIALLHSLGIRLILVHGARPQINHNLKEKGIETPFYDNCRITTRESLS
                     CVMSAVGSIRLEIEALLSMGLANSPMYGARIDVVSGNFVTAKPYGIREGMDFQLTGEV
                     RSIDTDAIERHLDNNNIVLLGPTGYSTTGEVFNLRAEEVATKTATYLKADKLIFLGEQ
                     QGLPNEDGQLLRELSPHQLDYYIQQYQTTHPTLTLHLQEAKKASLSGVHRVHLISYSY
                     DGALIEELFTRDGVGTMITDAHYEEVRMAHIQDVGGLMNLLRPLEEEGILVYRSRERL
                     EQEINQFAVIERDGMILACAALYPIPTEFNETRSAEIACVAVHPSYRKSNRGSQILQF
                     LEEKAKQQGIRQLFVLTTRTAHWFLEHGFHQVSVDDLPNARQALYNYQRNSLVFKKLL
                     P"
     misc_feature    complement(59000..60325)
                     /locus_tag="ABZJ_00054"
                     /note="N-acetylglutamate synthase; Validated; Region:
                     PRK05279"
                     /db_xref="CDD:235386"
     misc_feature    complement(59468..60307)
                     /locus_tag="ABZJ_00054"
                     /note="AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like
                     domain of the NAG Synthase (NAGS) of the
                     arginine-biosynthesis pathway (ABP) found in gamma- and
                     beta-proteobacteria and higher plant chloroplasts. Domain
                     architecture of these NAGS consisted of an...; Region:
                     AAK_NAGS-ABP; cd04237"
                     /db_xref="CDD:239770"
     misc_feature    complement(60266..60295)
                     /locus_tag="ABZJ_00054"
                     /note="putative feedback inhibition sensing region; other
                     site"
                     /db_xref="CDD:239770"
     misc_feature    complement(order(59684..59689,59696..59701,60224..60232,
                     60236..60238))
                     /locus_tag="ABZJ_00054"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239770"
     misc_feature    complement(order(59759..59767,60131..60139,60227..60232,
                     60236..60238))
                     /locus_tag="ABZJ_00054"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239770"
     misc_feature    complement(59129..59329)
                     /locus_tag="ABZJ_00054"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(59189..59194,59222..59230))
                     /locus_tag="ABZJ_00054"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(60470..60790)
                     /locus_tag="ABZJ_00055"
                     /db_xref="GeneID:12115133"
     CDS             complement(60470..60790)
                     /locus_tag="ABZJ_00055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524011.1"
                     /db_xref="GI:384141301"
                     /db_xref="GeneID:12115133"
                     /translation="MKKITTAIILSMSGLIATTAMAAPHDHYHHQGYETKTVKVIHKD
                     DHANIWRAGQVVPHQYQHPRYVIDYRSHQKLTKPGRYQKWYKVNGNYVLVNEQSHKII
                     KVIR"
     misc_feature    complement(60479..60634)
                     /locus_tag="ABZJ_00055"
                     /note="Domain of unknown function (DUF3315); Region:
                     DUF3315; pfam11776"
                     /db_xref="CDD:256612"
     gene            complement(61013..61501)
                     /locus_tag="ABZJ_00056"
                     /db_xref="GeneID:12115134"
     CDS             complement(61013..61501)
                     /locus_tag="ABZJ_00056"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524012.1"
                     /db_xref="GI:384141302"
                     /db_xref="GeneID:12115134"
                     /translation="MIFTVSLHFARTVFNMRDIRCKRGCIMKKLFTILALCITVLTTS
                     MASFADPPFDRGHGPKGPKGGPRGEWNDRGHKFDRDDNGDRVRDERRMREERGFERLK
                     QHRWQPGYVMPQHYRGNGYKVDYKDNNLPKPDRNQQWYKINNDYILVDTDSNSIVSIR
                     GF"
     misc_feature    complement(61025..61177)
                     /locus_tag="ABZJ_00056"
                     /note="Domain of unknown function (DUF3315); Region:
                     DUF3315; pfam11776"
                     /db_xref="CDD:256612"
     gene            complement(61641..62387)
                     /locus_tag="ABZJ_00057"
                     /db_xref="GeneID:12115135"
     CDS             complement(61641..62387)
                     /locus_tag="ABZJ_00057"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="YP_005524013.1"
                     /db_xref="GI:384141303"
                     /db_xref="GeneID:12115135"
                     /translation="MKYSEYQPRPDLLKDRIILITGAGDGIGRAAALSYALHGATVVL
                     HGRTLNKLEVIYDEIEGLGAPQPAILPLQLSSASDRDYDFLVSTLEKQFGRLDGILHN
                     AGILGERVELAHYPAEVWDDVMAVNLRAPFALTQALLPLLQKSENASVVFTSSGVGRE
                     ARALWGAYSVSKVAIEAVSKIFAAEHTYPNIRFNCINPGATRTAMRAKAYPEEDPKTL
                     PTPESIMPAYLYLMGEDSLTLNGQSIDAQD"
     misc_feature    complement(61644..62375)
                     /locus_tag="ABZJ_00057"
                     /note="putative oxoacyl-(acyl carrier protein) reductase;
                     Provisional; Region: PRK08945"
                     /db_xref="CDD:236357"
     misc_feature    complement(61650..62351)
                     /locus_tag="ABZJ_00057"
                     /note="Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases) [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: FabG; COG1028"
                     /db_xref="CDD:223959"
     misc_feature    complement(order(61785..61796,61872..61874,61884..61886,
                     61923..61931,62076..62084,62244..62252,62307..62309,
                     62313..62318,62322..62324))
                     /locus_tag="ABZJ_00057"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(61872..61874,61884..61886,61923..61925,
                     62007..62009))
                     /locus_tag="ABZJ_00057"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(62453..63154)
                     /locus_tag="ABZJ_00058"
                     /db_xref="GeneID:12115136"
     CDS             complement(62453..63154)
                     /locus_tag="ABZJ_00058"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="YP_005524014.1"
                     /db_xref="GI:384141304"
                     /db_xref="GeneID:12115136"
                     /translation="MMKAVLFDLDGTLIDTAADFIRIIQQMCRDARRPVVEADLIRTQ
                     VSEGARAMVKLVYPELDMTNPIFLAHRQNFLDLYGNNIVVDTDLFEGMYPLLEALEAQ
                     QIPWGIVTNKPRGLSESLLEKLNLTERCAVLVCPEDVSKTKPDPEPMYLAAKQLNIPA
                     NEIIYVGDHPRDIDAGRNADMYTILAAYGYLPIEHRDDLNAWQADSIVNTVTELHELL
                     RQKLPALQENQRMIS"
     misc_feature    complement(62489..63154)
                     /locus_tag="ABZJ_00058"
                     /note="phosphoglycolate phosphatase; Provisional; Region:
                     PRK13222"
                     /db_xref="CDD:237310"
     misc_feature    complement(62600..62935)
                     /locus_tag="ABZJ_00058"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(order(62822..62827,62921..62929))
                     /locus_tag="ABZJ_00058"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(62918..62929)
                     /locus_tag="ABZJ_00058"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(62825..62827)
                     /locus_tag="ABZJ_00058"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(63151..63864)
                     /locus_tag="ABZJ_00059"
                     /db_xref="GeneID:12115137"
     CDS             complement(63151..63864)
                     /locus_tag="ABZJ_00059"
                     /codon_start=1
                     /transl_table=11
                     /product="3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="YP_005524015.1"
                     /db_xref="GI:384141305"
                     /db_xref="GeneID:12115137"
                     /translation="MSQLNVDLQEIAKFEALAAKWWDQHSEFRPLHQINPLRLNWIDE
                     RAGGLAGKKVLDVGCGGGILAESMARRGADVLGIDMGEAPLAVGRLHAQQENVQNIEY
                     RQIPVEELAQEQAGQYDVVTCMEMMEHVPDPASIVKACQTLVKPGGHVFFSTINRNPK
                     SYLFAIIGAEYVLRLLPKGTHDYHKFIRPSEMAHDIRNAGLTLKEMTGLHYNPITKRY
                     WLAPNVDVNYMVHTIKTGA"
     misc_feature    complement(63163..63852)
                     /locus_tag="ABZJ_00059"
                     /note="bifunctional 3-demethylubiquinone-9
                     3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol
                     methylase; Provisional; Region: PRK05134"
                     /db_xref="CDD:235350"
     misc_feature    complement(63406..63708)
                     /locus_tag="ABZJ_00059"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(63544..63552,63625..63630,63676..63696))
                     /locus_tag="ABZJ_00059"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            64044..64661
                     /locus_tag="ABZJ_00060"
                     /db_xref="GeneID:12115138"
     CDS             64044..64661
                     /locus_tag="ABZJ_00060"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiol-disulfide isomerase and thioredoxin"
                     /protein_id="YP_005524016.1"
                     /db_xref="GI:384141306"
                     /db_xref="GeneID:12115138"
                     /translation="MKKLVLGGLSAAIMAVSGSAMAADFVAGKDYTVIANPGKVEVPG
                     KIEVREFFWYGCPHCFKLEPHMQTWLKQIPSDVRFVRTPAAMNKVWEQGARTYYTSEA
                     LGVRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNSTYNSFAVTAKVAES
                     NKLAQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK"
     misc_feature    64122..64652
                     /locus_tag="ABZJ_00060"
                     /note="DsbA family, DsbA subfamily; DsbA is a monomeric
                     thiol disulfide oxidoreductase protein containing a redox
                     active CXXC motif imbedded in a TRX fold. It is involved
                     in the oxidative protein folding pathway in prokaryotes,
                     and is the strongest thiol...; Region: DsbA_DsbA; cd03019"
                     /db_xref="CDD:239317"
     misc_feature    order(64209..64211,64215..64220,64560..64562)
                     /locus_tag="ABZJ_00060"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239317"
     misc_feature    64299..64307
                     /locus_tag="ABZJ_00060"
                     /note="hinge region; other site"
                     /db_xref="CDD:239317"
     misc_feature    order(64317..64343,64356..64415,64425..64451,64467..64496)
                     /locus_tag="ABZJ_00060"
                     /note="alpha helical domain; other site"
                     /db_xref="CDD:239317"
     gene            complement(64739..65398)
                     /locus_tag="ABZJ_00061"
                     /db_xref="GeneID:12115139"
     CDS             complement(64739..65398)
                     /locus_tag="ABZJ_00061"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005524017.1"
                     /db_xref="GI:384141307"
                     /db_xref="GeneID:12115139"
                     /translation="MGIPMNLDRHTQFLMRKEKILSVAEKLLLENNQEITLDELVAEL
                     DIAKGTLYKHFRSKNELLLELIIQNEKQILEISQKYNTDFKEYAPRYMLHHLLTPGKT
                     ILLHQLEENLTMTESKLKHLFEELYEVRQQRILAIKDITESYLKSLNYDMSIRDYLSY
                     IWSLTYGASLLLNSTYYQRSIGSRQKLINLYINQALSLPTQTTNFDALNFQIEDENSQ
                     N"
     misc_feature    complement(64883..65353)
                     /locus_tag="ABZJ_00061"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(65204..65341)
                     /locus_tag="ABZJ_00061"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(65523..66161)
                     /locus_tag="ABZJ_00062"
                     /db_xref="GeneID:12115140"
     CDS             complement(65523..66161)
                     /locus_tag="ABZJ_00062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524018.1"
                     /db_xref="GI:384141308"
                     /db_xref="GeneID:12115140"
                     /translation="MSIRDERKQQSRQALLDAALHLSTSGRSFSSISLREVAREVGLV
                     PTAFYRHFQDMDELGKELVDQVALHLKSVLHQLGQSYLQHKSAKTQTSIELFVQAVNH
                     SPKQWQFMIAERWGGSETVRAAIAREIEFLIEDLTTDLTKLENFKHIQNPQDLNVLST
                     ILTNMSFTWAMTWLNLAKQYQGEQLKQQQTAFIENASTQVRLLFRGIANWER"
     misc_feature    complement(65526..66161)
                     /locus_tag="ABZJ_00062"
                     /note="DNA-binding transcriptional repressor FabR;
                     Provisional; Region: PRK11202"
                     /db_xref="CDD:236881"
     misc_feature    complement(65976..66119)
                     /locus_tag="ABZJ_00062"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            66335..67360
                     /locus_tag="ABZJ_00063"
                     /db_xref="GeneID:12115141"
     CDS             66335..67360
                     /locus_tag="ABZJ_00063"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="YP_005524019.1"
                     /db_xref="GI:384141309"
                     /db_xref="GeneID:12115141"
                     /translation="MNATLNYQPHWVREDFVDFVLQKINATWAWKRVLAEVTAVQPLY
                     TDMVLIKLKPNRNFNFEQVCAGQSILLTLLIDGVYQQRSYSIIEVTTQGEIALGIKVQ
                     GLVSRAAQLLHVGECVEISQPQGDFTLHQGQQPAILIASGSGITAIYSLLQQALKQQL
                     EQIHVIYFNRAEIFHAELKALAEQHPQLQYHFFNTSEQKQHLTESLLQKLVPDFAQTA
                     TYICGHHGMMQQANEIYAQKGAQSQLHQEYFQPLQVTGTHAAQPVIFRRAQHEFLAET
                     NLLSSAEQAGLRPQHGCRMGVCNKCSCTKVSGVTQNLLTGEIEDQPNRPIKLCVSQAL
                     SPVTIDL"
     misc_feature    66380..67081
                     /locus_tag="ABZJ_00063"
                     /note="Iron-sulfur binding ferredoxin reductase (FNR)
                     proteins combine the FAD and NAD(P) binding regions of FNR
                     with an iron-sulfur binding cluster domain.
                     Ferredoxin-NADP+ (oxido)reductase is an FAD-containing
                     enzyme that catalyzes the reversible electron...; Region:
                     FNR_iron_sulfur_binding_2; cd06216"
                     /db_xref="CDD:99812"
     misc_feature    66425..67060
                     /locus_tag="ABZJ_00063"
                     /note="FMN reductase; Validated; Region: fre; PRK08051"
                     /db_xref="CDD:236142"
     misc_feature    order(66536..66538,66578..66589,66626..66634,66638..66640,
                     66644..66652,66761..66763,66770..66772,67073..67075,
                     67079..67081)
                     /locus_tag="ABZJ_00063"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99812"
     misc_feature    order(66578..66580,66584..66589)
                     /locus_tag="ABZJ_00063"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99812"
     misc_feature    order(66641..66643,66650..66652,66677..66679,66701..66703,
                     66707..66709)
                     /locus_tag="ABZJ_00063"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99812"
     misc_feature    order(66746..66748,66758..66769,66773..66775)
                     /locus_tag="ABZJ_00063"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99812"
     misc_feature    order(66761..66766,66827..66835,67001..67006)
                     /locus_tag="ABZJ_00063"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99812"
     misc_feature    67154..67354
                     /locus_tag="ABZJ_00063"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    order(67199..67204,67211..67213,67220..67222,67226..67237,
                     67316..67321)
                     /locus_tag="ABZJ_00063"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    order(67211..67213,67226..67228,67235..67237,67319..67321)
                     /locus_tag="ABZJ_00063"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     gene            67385..68533
                     /locus_tag="ABZJ_00064"
                     /db_xref="GeneID:12115142"
     CDS             67385..68533
                     /locus_tag="ABZJ_00064"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524020.1"
                     /db_xref="GI:384141310"
                     /db_xref="GeneID:12115142"
                     /translation="MNMALKVSTASKSAHLTPEQIEEFGRRVEQIRQDVMQSLGEQDA
                     KYIYKVRNFVRYTEIASRGMLMFGGWIPPVWLLGTGLLGISKIVENMELGHNVMHGQF
                     DWLNEPSLNGNTYDWDTIASGDDWRETHNYVHHTYTNIVGKDHDVGYGLLRVSDQQKW
                     EPRHLFNIPLGLQLMFFFEWYVGVQNLHLEDALVYKTKSWKQVWKDSAKVRKKATRQV
                     LKDYVFFPVISGPMFLPVFAGNVVANIIRNLWSSAVIFNGHFTEDAETFEPDNTDTET
                     KAEWYLRQIRGSSNFSGTEWLHFMSGNLSHQIEHHLFPDMPANRYKEVAPKIKALCAE
                     YGINYNEANFMRQFWSVWVRLAKCSLPNHTTAKVMQTLEKLKAKFKFA"
     misc_feature    67424..68473
                     /locus_tag="ABZJ_00064"
                     /note="Fatty acid desaturase [Lipid metabolism]; Region:
                     DesA; COG3239"
                     /db_xref="CDD:225779"
     misc_feature    67610..68395
                     /locus_tag="ABZJ_00064"
                     /note="The Delta6 Fatty Acid Desaturase (Delta6-FADS)-like
                     CD includes the integral-membrane enzymes: delta-4,
                     delta-5, delta-6, delta-8, delta-8-sphingolipid, and
                     delta-11 desaturases found in vertebrates, higher plants,
                     fungi, and bacteria. These desaturases...; Region:
                     Delta6-FADS-like; cd03506"
                     /db_xref="CDD:239583"
     misc_feature    order(67667..67669,67679..67681,67772..67774,67784..67789,
                     68303..68305,68312..68317)
                     /locus_tag="ABZJ_00064"
                     /note="putative di-iron ligands [ion binding]; other site"
                     /db_xref="CDD:239583"
     gene            68692..69408
                     /locus_tag="ABZJ_00065"
                     /db_xref="GeneID:12115143"
     CDS             68692..69408
                     /locus_tag="ABZJ_00065"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH (RNase PH), tRNA
                     nucleotidyltransferase"
                     /protein_id="YP_005524021.1"
                     /db_xref="GI:384141311"
                     /db_xref="GeneID:12115143"
                     /translation="MRIDQRALDQLREVKITRNYTRYAEGSVLVEFGHTKVLCTASID
                     NSVPRFLKGQGQGWVTAEYGMLPRSTHSRCDREAARGKQTGRTQEIQRLIGRSLRAMV
                     DLKKLGENTITIDCDVIQADGGTRTASITGAAVALVDAMNVLLAQKKIKQDPLKGLVA
                     AISVGMYQDEVLLDLCYEEDSNCQTDLNVVMTQAGEFIEIQGTAEDKPFTRAQSNAML
                     EMAEKGIAELIKKQQEALGW"
     misc_feature    68692..69405
                     /locus_tag="ABZJ_00065"
                     /note="ribonuclease PH; Reviewed; Region: rph; PRK00173"
                     /db_xref="CDD:178914"
     misc_feature    68719..69399
                     /locus_tag="ABZJ_00065"
                     /note="Ribonuclease PH; Region: RNase_PH_bact; cd11362"
                     /db_xref="CDD:206767"
     misc_feature    order(68749..68763,68791..68793,68797..68799,68803..68805,
                     68809..68811,68815..68817,68875..68877,68881..68883,
                     68887..68904,68908..68910,68917..68922,68944..68949,
                     68953..68958,68965..68967,68977..68979,68986..68988,
                     69028..69030,69034..69036,69040..69042,69046..69054,
                     69277..69291,69295..69297,69301..69318,69322..69324,
                     69331..69336,69343..69348,69355..69357)
                     /locus_tag="ABZJ_00065"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206767"
     misc_feature    order(68884..68886,68947..68949,69052..69069,69229..69231,
                     69247..69249)
                     /locus_tag="ABZJ_00065"
                     /note="active site"
                     /db_xref="CDD:206767"
     gene            complement(69520..69657)
                     /locus_tag="ABZJ_00066"
                     /db_xref="GeneID:12115144"
     CDS             complement(69520..69657)
                     /locus_tag="ABZJ_00066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524022.1"
                     /db_xref="GI:384141312"
                     /db_xref="GeneID:12115144"
                     /translation="MQLLVGGVVGDELSESLSSLQALSMSAKDVINKIESFRIGFSQT
                     V"
     gene            69698..71866
                     /locus_tag="ABZJ_00067"
                     /db_xref="GeneID:12115145"
     CDS             69698..71866
                     /locus_tag="ABZJ_00067"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase C"
                     /protein_id="YP_005524023.1"
                     /db_xref="GI:384141313"
                     /db_xref="GeneID:12115145"
                     /translation="MNRREFLLNSTKTMFGTAALASFPLSIQKALAIDAKVESGTIQD
                     VKHIVILTQENRSFDNYFGTLKGVRGFGDRFTIPMTEGRKVWEQYDANKKKVLPYHLD
                     SRLGNAQRVTGTNHSWSDGQGAWDNGRMSDWVAHKQPQSMGYYKKQEVEYQFALANAF
                     TICDAYHCAMHAGTNPNRKFIWTGTNGPTGAGVASVVNEFDGIGPSTEGYEWTTYPER
                     LQQAGVTWKVYQNMPDNFTDNPLAGFKQYRRANEQSGQPVSNDTLMCPAYDEKIDVTQ
                     PLYKGIANTMPDGGFLGTFKADIAQGKLPQVSWLVAPATYSEHPGPSSPVQGAWYIQE
                     VLNALTENTQVWSQTVLLVNFDENDGFFDHVPSPSAPSKDINGVVYGKTTLTDQQVSY
                     EYFNHPAVATSKSQPETDGRVYGPGVRVPMYVISPWSRGGWVNSQVFDHTSILQFLEK
                     RFGVQEPNISPYRRAVCGDLTTAFNFKTPNLLPVGELDGKKTKAEADAIRVAQELLPQ
                     VSVPSQQQFPQQEIGIRPSRALPYILHTSAKVDATQKTVKLMFSNTGKQAAVFHVYNR
                     LDLTAIPRRYMVEAGKQLDDVWNTINGQYDLWVLGPNGFHRAFKGNLSQANQTQALPE
                     IRVCVEECDANLYLKVRHDGNKSVKLTVKANAYLPNKIWMIETNSSEKELVWDMSEFG
                     GWYDFTVTLAEDATFSRRFAGRIETQEDSISDPYMGYLES"
     misc_feature    69701..71851
                     /locus_tag="ABZJ_00067"
                     /note="phospholipase C, phosphocholine-specific,
                     Pseudomonas-type; Region: PC_PLC; TIGR03396"
                     /db_xref="CDD:234195"
     misc_feature    69830..71059
                     /locus_tag="ABZJ_00067"
                     /note="Phosphoesterase family; Region: Phosphoesterase;
                     pfam04185"
                     /db_xref="CDD:252434"
     misc_feature    71273..71533
                     /locus_tag="ABZJ_00067"
                     /note="Domain of unknown function (DUF756); Region:
                     DUF756; pfam05506"
                     /db_xref="CDD:253229"
     misc_feature    71564..71809
                     /locus_tag="ABZJ_00067"
                     /note="Domain of unknown function (DUF756); Region:
                     DUF756; pfam05506"
                     /db_xref="CDD:253229"
     gene            72272..72439
                     /locus_tag="ABZJ_00068"
                     /db_xref="GeneID:12115146"
     CDS             72272..72439
                     /locus_tag="ABZJ_00068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524024.1"
                     /db_xref="GI:384141314"
                     /db_xref="GeneID:12115146"
                     /translation="MLQGFIVLLAVVTFVLMAADPRDSGAQATQSAWQKTQAADMTKS
                     QKNTNNDADFI"
     gene            complement(72436..73281)
                     /locus_tag="ABZJ_00069"
                     /db_xref="GeneID:12115147"
     CDS             complement(72436..73281)
                     /locus_tag="ABZJ_00069"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide pyrophosphorylase
                     (quinolinate phosphoribosyltransferase)"
                     /protein_id="YP_005524025.1"
                     /db_xref="GI:384141315"
                     /db_xref="GeneID:12115147"
                     /translation="MSIPQSLLEQSIQINIQQALQEDIGDGDITAMLTPEDEQATATI
                     ISREDMVLAGQPWVNALISAYDNTVQVTWLKQEGDRVAANEAFLKLAGSARSLLTVER
                     PALNFIQTLSAVATKTAEYVQHLEGLNTKLLDTRKTLPGLRIAQKYAVTVGGGQNHRL
                     GLFDAFLIKENHIMAAGGIAQAIAKAHQIAPGKPVEVEVETWDELNQALEAGADIVML
                     DNFSQQQMIDAVKHVAGRCKLEASGNITIENLREVATTGVDYISMGVLTKDVKAVDLS
                     MRFNA"
     misc_feature    complement(72442..73263)
                     /locus_tag="ABZJ_00069"
                     /note="quinolinate phosphoribosyltransferase; Validated;
                     Region: PRK09016"
                     /db_xref="CDD:181612"
     misc_feature    complement(72448..73239)
                     /locus_tag="ABZJ_00069"
                     /note="Quinolinate phosphoribosyl transferase (QAPRTase or
                     QPRTase), also called nicotinate-nucleotide
                     pyrophosphorylase, is involved in the de novo synthesis of
                     NAD in both prokaryotes and eukaryotes. It catalyses the
                     reaction of quinolinic acid (QA) with...; Region: QPRTase;
                     cd01572"
                     /db_xref="CDD:238806"
     misc_feature    complement(order(72478..72480,72724..72726,72757..72759,
                     72766..72771,72775..72777,72781..72783,72793..72798,
                     72853..72858,72868..72870,72874..72876,72964..72966,
                     72976..72981,73189..73194))
                     /locus_tag="ABZJ_00069"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238806"
     misc_feature    complement(order(72478..72480,72487..72492,72496..72498,
                     72553..72558,72625..72627,72805..72810,72871..72879))
                     /locus_tag="ABZJ_00069"
                     /note="active site"
                     /db_xref="CDD:238806"
     gene            73453..74022
                     /locus_tag="ABZJ_00070"
                     /db_xref="GeneID:12115148"
     CDS             73453..74022
                     /locus_tag="ABZJ_00070"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-anhydromuramyl-L-alanine amidase
                     (regulates ampC)"
                     /protein_id="YP_005524026.1"
                     /db_xref="GI:384141316"
                     /db_xref="GeneID:12115148"
                     /translation="MKQITPYEVIDGQLKGARQIPSPNFNQRPAGSEIQMIVVHNISL
                     PPSQFGGGYIEQFFQNKLDWSVHPYFQTIEGMQVSTHLLILRTGEVLQFVNFNDRAWH
                     AGRSSYLAKVECNDYSIGIELEGSDDLPFEEVQYSVLTDVVAAIRQVYPEIKNHIAGH
                     SDIAPGRKTDPGPYFKWQHFRQLLAQKKT"
     misc_feature    73483..>74004
                     /locus_tag="ABZJ_00070"
                     /note="N-acetyl-anhydromuramyl-L-alanine amidase [Cell
                     envelope biogenesis, outer membrane]; Region: ampD;
                     COG3023"
                     /db_xref="CDD:225567"
     misc_feature    73552..73974
                     /locus_tag="ABZJ_00070"
                     /note="Peptidoglycan recognition proteins (PGRPs) are
                     pattern recognition receptors that bind, and in certain
                     cases, hydrolyze peptidoglycans (PGNs) of bacterial cell
                     walls. PGRPs have been divided into three classes: short
                     PGRPs (PGRP-S), that are small (20...; Region: PGRP;
                     cd06583"
                     /db_xref="CDD:133475"
     misc_feature    order(73570..73572,73690..73692,73930..73932,73954..73956,
                     73960..73962)
                     /locus_tag="ABZJ_00070"
                     /note="amidase catalytic site [active]"
                     /db_xref="CDD:133475"
     misc_feature    order(73570..73572,73930..73932,73960..73962)
                     /locus_tag="ABZJ_00070"
                     /note="Zn binding residues [ion binding]; other site"
                     /db_xref="CDD:133475"
     misc_feature    order(73573..73578,73678..73680,73690..73692,73732..73734,
                     73753..73758,73795..73797,73930..73932,73942..73944,
                     73954..73962)
                     /locus_tag="ABZJ_00070"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133475"
     gene            74095..75645
                     /locus_tag="ABZJ_00071"
                     /db_xref="GeneID:12115149"
     CDS             74095..75645
                     /locus_tag="ABZJ_00071"
                     /codon_start=1
                     /transl_table=11
                     /product="MviN family virulence factor"
                     /protein_id="YP_005524027.1"
                     /db_xref="GI:384141317"
                     /db_xref="GeneID:12115149"
                     /translation="MSTMALWRSTFIVSAMTMLSRVLGLVRDVVLLNVFGAGKDFDTF
                     VVAFRIPNFFRRLFAEGAFSQAFIPVLTEYKTGRAHAEVQILISRVFGCLLTVMTLLT
                     FVAMVLAPAIIYMYAPGFHNDPEKFDLAVSMFRLTIPYLMFMSLTAFASSILNSYGSF
                     ASPAFSPVLLNVAMIAGAWWLTPYMAEPIKALGWSVVAAGILQLAIQIPELWRKNLLI
                     PPKVDFKHEGVERILKLMLPALFGVSVTQINLLLNTIWASFMQDGSVSWLYSAERMTE
                     LPLGLIGVAIGTVILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTP
                     IIQALFQRGEFDLRDTQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLM
                     SVAANAILNVVFIGFFKLINWHAEHMALALASSGSALVNAGLLYFYLHKRNIFRFGAH
                     WKKLALQYGLANLAMIAALWFGLNWYNGELSQWIRVAEVVGLCVIGVIAYLIGLLLTG
                     FRPRDLKH"
     misc_feature    74095..75636
                     /locus_tag="ABZJ_00071"
                     /note="Uncharacterized membrane protein, putative
                     virulence factor [General function prediction only];
                     Region: MviN; COG0728"
                     /db_xref="CDD:223800"
     misc_feature    74134..75420
                     /locus_tag="ABZJ_00071"
                     /note="MurJ/MviN, a subfamily of the multidrug and toxic
                     compound extrusion (MATE)-like proteins; Region:
                     MATE_MurJ_like; cd13123"
                     /db_xref="CDD:240528"
     gene            complement(75691..76386)
                     /locus_tag="ABZJ_00072"
                     /db_xref="GeneID:12115150"
     CDS             complement(75691..76386)
                     /locus_tag="ABZJ_00072"
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type 22KD peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="YP_005524028.1"
                     /db_xref="GI:384141318"
                     /db_xref="GeneID:12115150"
                     /translation="MKKISLVIAASTMSLSVFAAAPITNKSPAKDQFSYSYGYLMGRN
                     NTDALTDLNLDIFYQGLQEGAQNKTARLTDEEMAKAINDYKKTLEAKQLVEFQKQGQQ
                     NAQAGAAFLAENTKKSGVITTKSGLQYQVLKEGTGKTPKATSRVKVNYEGRLLDGTVF
                     DSSIARNHPFDFQLNQVIAGWTEGLQTMKEGGKTRFFIPAKLAYGEVGAGDSIGPNST
                     LIFDIELLQVLPK"
     misc_feature    complement(75994..76365)
                     /locus_tag="ABZJ_00072"
                     /note="Domain amino terminal to FKBP-type peptidyl-prolyl
                     isomerase; Region: FKBP_N; pfam01346"
                     /db_xref="CDD:250550"
     misc_feature    complement(75700..76308)
                     /locus_tag="ABZJ_00072"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerases 1
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: FkpA; COG0545"
                     /db_xref="CDD:223619"
     misc_feature    complement(75709..75975)
                     /locus_tag="ABZJ_00072"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Region: FKBP_C; pfam00254"
                     /db_xref="CDD:249719"
     gene            complement(76435..77157)
                     /locus_tag="ABZJ_00073"
                     /db_xref="GeneID:12115151"
     CDS             complement(76435..77157)
                     /locus_tag="ABZJ_00073"
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase
                     fkpA precursor(PPIase) (Rotamase)"
                     /protein_id="YP_005524029.1"
                     /db_xref="GI:384141319"
                     /db_xref="GeneID:12115151"
                     /translation="MSKALPIAVAVVLGGAALVPVYYATQHPTTEVGRKADKNASPIQ
                     KISYVLGYEVAQQTPPELDTKAFVQGIHDARNKQPSAYTQEDLKAAVAAYEKELQQKM
                     QHQDKPEQAGTATDSADAQFLAENKTKAGVKTTASGLQYIITKEGTGKQPTAQSIVKV
                     HYEGRLINGQVFDSSYKRGQPVEFPLNQVIPGWTEGLQLMKEGGKATFFIPSNLAYGP
                     QELPGIPANSTLIFDVELISVK"
     misc_feature    complement(76729..77091)
                     /locus_tag="ABZJ_00073"
                     /note="Domain amino terminal to FKBP-type peptidyl-prolyl
                     isomerase; Region: FKBP_N; pfam01346"
                     /db_xref="CDD:250550"
     misc_feature    complement(76438..77052)
                     /locus_tag="ABZJ_00073"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerases 1
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: FkpA; COG0545"
                     /db_xref="CDD:223619"
     misc_feature    complement(76447..76710)
                     /locus_tag="ABZJ_00073"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Region: FKBP_C; pfam00254"
                     /db_xref="CDD:249719"
     gene            77611..78585
                     /locus_tag="ABZJ_00074"
                     /db_xref="GeneID:12115152"
     CDS             77611..78585
                     /locus_tag="ABZJ_00074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524030.1"
                     /db_xref="GI:384141320"
                     /db_xref="GeneID:12115152"
                     /translation="MKDFKVQAGNLWAFIAGILVFLISLYIEPKYLYGDQEHYREFFN
                     YCFYDGYSHTMQLFCYQNTLGSTEPGYFYLSKIAHLFLEKDIYISFANSILVFLLIKL
                     VFKWYENIWHRYFFIFLVLTNYYLIVLMFAAERLKFSFIFLVLALLVAKQWKRIIIFG
                     LALFTHVQSALLIATFFISKVLDKNTKLWVKIIISLICIIGFTGAFLLMQEHIVNKLG
                     AYSEGTEEDGNGFISMIKTGVFIFLAGISTFRILPVISGIPLVLLSYFLGSERIGMLA
                     FILYVCAVIYYKKKADLLLFLVMLYFTIKTPSFILNILNYGVGYISNS"
     gene            complement(80977..81405)
                     /locus_tag="ABZJ_00075"
                     /db_xref="GeneID:12115153"
     CDS             complement(80977..81405)
                     /locus_tag="ABZJ_00075"
                     /codon_start=1
                     /transl_table=11
                     /product="low molecular weight
                     protein-tyrosine-phosphatase"
                     /protein_id="YP_005524031.1"
                     /db_xref="GI:384141321"
                     /db_xref="GeneID:12115153"
                     /translation="MQFKNILVVCIGNICRSPMAEYFLKQQYPQLNIESAGISGLIGH
                     QADEKAQLCMQRLGIDMRSHIARKLNAEHIKKADLILVMSQNQQKHIEQTWPFAKGKT
                     YRLGHWQNKNVPDPYQLDQAVFDETCQLIQQCVADWKPYI"
     misc_feature    complement(80986..81396)
                     /locus_tag="ABZJ_00075"
                     /note="Low molecular weight phosphatase family; Region:
                     LMWPc; cd00115"
                     /db_xref="CDD:238063"
     misc_feature    complement(order(81355..81363,81367..81372,81376..81378))
                     /locus_tag="ABZJ_00075"
                     /note="active site"
                     /db_xref="CDD:238063"
     gene            complement(81411..82511)
                     /locus_tag="ABZJ_00076"
                     /db_xref="GeneID:12115154"
     CDS             complement(81411..82511)
                     /locus_tag="ABZJ_00076"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="YP_005524032.1"
                     /db_xref="GI:384141322"
                     /db_xref="GeneID:12115154"
                     /translation="MKYCQFFSVLALSLSAASCAVTSGLQTSDIPNEGVYKTDLGTTV
                     NVVKISQETLPAIQPAQIDYQRDYATLFKTQQPIYRLSPGDVLSIQLWAYPEITPPVN
                     SISNEQSVQANGYPIDQSGYIQFPLVGRYKASGKTLAQVNRELHSQLARFLKNPDVIV
                     RVLSYEGQRFSVQGSVTKGGQFYLSDQPVSIYTALGMAGGVTTTGDNTYIQLIRNGRT
                     YNLNTIDLEKAGYSLHKLLVQPNDTIYVSTRENQKIYVMGEAGKNQALPMRDQGMTLS
                     DALGESQGLNPLSASASRIYVLRTNPNDRTTELYHLNLMSLGDFGLANQFRLRSNDII
                     YVDATGLTRWQRVVNQIIPFSSALYNLDRLGQ"
     misc_feature    complement(81429..82493)
                     /locus_tag="ABZJ_00076"
                     /note="polysaccharide export protein Wza; Provisional;
                     Region: PRK15078"
                     /db_xref="CDD:237903"
     misc_feature    complement(82020..82307)
                     /locus_tag="ABZJ_00076"
                     /note="Polysaccharide biosynthesis/export protein; Region:
                     Poly_export; pfam02563"
                     /db_xref="CDD:251377"
     gene            82867..84141
                     /locus_tag="ABZJ_00077"
                     /db_xref="GeneID:12115155"
     CDS             82867..84141
                     /locus_tag="ABZJ_00077"
                     /codon_start=1
                     /transl_table=11
                     /product="putative UDP-glucose/GDP-mannose dehydrogenase"
                     /protein_id="YP_005524033.1"
                     /db_xref="GI:384141323"
                     /db_xref="GeneID:12115155"
                     /translation="MQIAKLKIAIIGLGYVGLPLAVEFGKKVPVVGFDIYQKRIEELK
                     NGQDHTLEVSPEELKQAVHLNYTAHLDDLQDSNFFIVTVPTPIDDFKQPDLTPLIKAS
                     TSIGQVLKKGDVVVYESTVYPGATEEVCIPVLEKVSGLKFNQDFFAGYSPERINPGDK
                     QHRVTNILKITSGSTPEVADYIDEVYNLIIEAGTHKAPNIKVAEAAKVIENTQRDVNI
                     ALINELALIFNKLDIDTEDVLKAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQSIG
                     LHPEIILAARRLNDRMGEHVATQLIKEMVKQRIQVVGARILVMGLSFKENCPDIRNTK
                     IVDFIKALKEYDLDLDIYDPWVDDTEVQHEYGLAPIKELQQGLYDAIVIAVAHNQFKS
                     MSVEEFHALGKEKHVLYDLKYVLDKESSNIRL"
     misc_feature    82873..84138
                     /locus_tag="ABZJ_00077"
                     /note="Vi polysaccharide biosynthesis protein TviB;
                     Provisional; Region: PRK15182"
                     /db_xref="CDD:185104"
     misc_feature    82885..83403
                     /locus_tag="ABZJ_00077"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; Region: UDPG_MGDP_dh_N; pfam03721"
                     /db_xref="CDD:252123"
     misc_feature    83464..83742
                     /locus_tag="ABZJ_00077"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    83815..84114
                     /locus_tag="ABZJ_00077"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            84155..85351
                     /locus_tag="ABZJ_00078"
                     /db_xref="GeneID:12115156"
     CDS             84155..85351
                     /locus_tag="ABZJ_00078"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nucleoside-diphosphate sugar epimerase"
                     /protein_id="YP_005524034.1"
                     /db_xref="GI:384141324"
                     /db_xref="GeneID:12115156"
                     /translation="MSTDIQLNLIGRTQELFVEDIQHWNNKLIEIVSSSKFLVLGGAG
                     SIGQAVVKEIFKRNPKKLHVVDISENNLTEVVRDIRSSFGYIDGDFQTFALDIGSAEY
                     DAYIENDGDFDYVLNLSALKHVRSEKDPFTLMRMIHVNILNTEKTIQQSIAKGVKKYF
                     CVSTDKAANPVNMMGGSKRIMEMFLMRQSQYIDISTARFANVAFSDGSLLHGFNQRIQ
                     KNQPIAAPNDIRRYFVTPKESGELCLMSCLLGENRDIFFPKLSEHLHLITFADIAVKY
                     LNNLGYEPYLCESEDEARSLIQTLPKQGKWPCLFTGSTTTGEKDFEEFFTDNETLDMQ
                     RFNNLGVIKNELNIEEDKLQVFEEKINSMLLSKHWNKEEIVDLFNYMMPNFGHKETGL
                     YLDGKM"
     misc_feature    84257..85177
                     /locus_tag="ABZJ_00078"
                     /note="UDP-Glcnac (UDP-linked N-acetylglucosamine)
                     inverting 4,6-dehydratase, extended (e) SDRs; Region:
                     UDP_invert_4-6DH_SDR_e; cd05237"
                     /db_xref="CDD:187548"
     misc_feature    84266..85141
                     /locus_tag="ABZJ_00078"
                     /note="Polysaccharide biosynthesis protein; Region:
                     Polysacc_synt_2; pfam02719"
                     /db_xref="CDD:251493"
     misc_feature    order(84275..84277,84281..84292,84350..84355,84437..84445,
                     84506..84514,84518..84520,84569..84571,84638..84640,
                     84686..84688,84749..84760,84767..84772)
                     /locus_tag="ABZJ_00078"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187548"
     misc_feature    order(84353..84355,84359..84361,84371..84373,84383..84385,
                     84431..84442,84449..84451,84458..84460,84512..84523,
                     84530..84532,84542..84544,84557..84559,84566..84568,
                     84770..84775,84788..84790)
                     /locus_tag="ABZJ_00078"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187548"
     misc_feature    order(84518..84520,84644..84652,84674..84676,84752..84757,
                     84773..84781,84788..84793,84824..84832,84839..84841,
                     84845..84847,84959..84961,85097..85099,85106..85108)
                     /locus_tag="ABZJ_00078"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187548"
     misc_feature    order(84572..84574,84644..84646,84674..84676,84686..84688)
                     /locus_tag="ABZJ_00078"
                     /note="active site"
                     /db_xref="CDD:187548"
     gene            85351..86499
                     /locus_tag="ABZJ_00079"
                     /db_xref="GeneID:12115157"
     CDS             85351..86499
                     /locus_tag="ABZJ_00079"
                     /codon_start=1
                     /transl_table=11
                     /product="putative polysaccharide biosynthesis protein"
                     /protein_id="YP_005524035.1"
                     /db_xref="GI:384141325"
                     /db_xref="GeneID:12115157"
                     /translation="MDTSKFNQFVRDIYQTNNFIPLHEPRFLGNEKKYVLDTIDSTFV
                     SSVGAYVNDFESKIQHFTGCAKAIATVNGTAALHIALLLAGVKRDDIVITQALTFVAT
                     CNALSYIGAEPLFIDVSLKTMGLCPKALDTYLQENAFLDDQGVCKHTATNKRISAIVP
                     MHTFGHPVEIDELQEVVTKWNIALVEDAAESLGSYYKGKHTGIFGLVSALSFNGNKVI
                     TTGGGGMVLCQDEELGVRAKHITTTAKIPHPYEFYHDENGFNYRLPNLNAALGCAQME
                     SLEGFLSKKRDLAHQYQNFFKDTDISFFVEPENCQSNYWLNAIICKDKTQRDLILDET
                     NSNKVMTRPIWTLMTRLPMYENALQGDLTNSLWLEERVVNIPSSVPLE"
     misc_feature    85408..86484
                     /locus_tag="ABZJ_00079"
                     /note="aminotransferase, LLPSF_NHT_00031 family; Region:
                     NHT_00031; TIGR04181"
                     /db_xref="CDD:200432"
     misc_feature    order(85567..85572,85579..85581,85831..85833,85909..85911,
                     85918..85920,85981..85983,85996..85998)
                     /locus_tag="ABZJ_00079"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    85996..85998
                     /locus_tag="ABZJ_00079"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            86448..87641
                     /locus_tag="ABZJ_00080"
                     /db_xref="GeneID:12115158"
     CDS             86448..87641
                     /locus_tag="ABZJ_00080"
                     /codon_start=1
                     /transl_table=11
                     /product="putative UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="YP_005524036.1"
                     /db_xref="GI:384141326"
                     /db_xref="GeneID:12115158"
                     /translation="MARRESCKYSKFGSSGVMRMKKIAVFTGTRAEYGLLYWLMRDIQ
                     QDPELELQILATAMHYSPEHGETWKTIVKDGFEITESVEMLLSSDTSSAVVKSMGVGL
                     LGFADALKRMQPDVLVVLGDRFEALAVTQAALIMHVPVAHLHGGEITEGAYDESIRHA
                     ITKMSNIHFAAAEEYKKRIIQLGEQPERVFNVGALGLDHIQRTTFKSISELSELYDFD
                     FSKPYFLITYHPETNLLEENVAPLFDALKQINDVNFVFSYPNADNGNTNIVKAMLDLK
                     AQLPDRVLLVKSFGIQNYLSVLKNALAMVGNSSSGLSEAPALQVPTVNIGDRQKGRLR
                     CESILDVRLDEKEIVEALQKAINFPKDQLSQVVPPLGLGNTSQKIIEVIKTTDFKKKA
                     PFYDL"
     misc_feature    86508..87596
                     /locus_tag="ABZJ_00080"
                     /note="UDP-N-acetyl-D-glucosamine 2-epimerase,
                     UDP-hydrolysing; Region: NeuC_NnaA; TIGR03568"
                     /db_xref="CDD:234263"
     misc_feature    86511..87599
                     /locus_tag="ABZJ_00080"
                     /note="Bacterial members of the UDP-N-Acetylglucosamine
                     (GlcNAc) 2-Epimerase  family are known to catalyze the
                     reversible interconversion of UDP-GlcNAc and
                     UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to
                     produce an activated form of ManNAc residues; Region:
                     GT1_UDP-GlcNAc_2-Epimerase; cd03786"
                     /db_xref="CDD:99962"
     misc_feature    order(86535..86537,87312..87314,87318..87320,87327..87329,
                     87378..87380)
                     /locus_tag="ABZJ_00080"
                     /note="active site"
                     /db_xref="CDD:99962"
     misc_feature    order(86730..86732,86736..86741,86760..86762,86847..86852,
                     86856..86858,86862..86864,86907..86909,86919..86921,
                     86988..86990)
                     /locus_tag="ABZJ_00080"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99962"
     gene            87631..88725
                     /locus_tag="ABZJ_00081"
                     /db_xref="GeneID:12115159"
     CDS             87631..88725
                     /locus_tag="ABZJ_00081"
                     /codon_start=1
                     /transl_table=11
                     /product="putative polysaccharide biosynthesis protein"
                     /protein_id="YP_005524037.1"
                     /db_xref="GI:384141327"
                     /db_xref="GeneID:12115159"
                     /translation="MIFKQDEIYVIAEIGVNHNGSVDLAKELILKAKESGANAVKFQT
                     FKAEEVLSDQADMAAYQKTNTGKDSSQLEMVKKLELSFEDTKILRDFSENNGITFIST
                     PFDNDSLDFLSNDLDVPFLKVSSADISNLPFLYKVALTGKPVILSTGTASLGDIEKAL
                     SVFTYVTEYGKTELPTVEKLRLSYAKQTNRQALKNKIVILHCVTQYPATIEGSNLLAI
                     STIQNAFGLNVGYSDHTLNEYTAIAAVALGATVFEKHITLDKKMDGPDHAASMEIDDF
                     TRYVSTLRKIKLGLGDGIKFMQEQEKDNFSLVRRSLVARKDIQQGEIFTEQNIVAKRA
                     GKVQLLPEQLWELLGTAATKNYKVNELIEK"
     misc_feature    87652..88716
                     /locus_tag="ABZJ_00081"
                     /note="N-acetylneuraminate synthase; Region: NeuB_NnaB;
                     TIGR03569"
                     /db_xref="CDD:234264"
     misc_feature    87715..88515
                     /locus_tag="ABZJ_00081"
                     /note="NeuB family; Region: NeuB; pfam03102"
                     /db_xref="CDD:251732"
     misc_feature    88555..88716
                     /locus_tag="ABZJ_00081"
                     /note="C-terminal SAF domain of sialic acid synthetase;
                     Region: SAF_NeuB_like; cd11615"
                     /db_xref="CDD:212160"
     misc_feature    order(88555..88560,88573..88575,88621..88629,88648..88656)
                     /locus_tag="ABZJ_00081"
                     /note="NeuB binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212160"
     misc_feature    88627..88629
                     /locus_tag="ABZJ_00081"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:212160"
     gene            89366..90427
                     /locus_tag="ABZJ_00082"
                     /db_xref="GeneID:12115160"
     CDS             89366..90427
                     /locus_tag="ABZJ_00082"
                     /codon_start=1
                     /transl_table=11
                     /product="putative polysaccharide biosynthesis protein"
                     /protein_id="YP_005524038.1"
                     /db_xref="GI:384141328"
                     /db_xref="GeneID:12115160"
                     /translation="MIRDVNKIVLHKNDTVLKALELLDLYALRIVLVVDDRNQLIGSI
                     TDGDIRRGLLKGQDLHASVDTIMHTNPYSIEEGSLNNRQIFEIMREKSYLALPVIKNN
                     QLVNIITLDDLIRKKRKENPVFIMAGGFGTRLRPLTDTCPKPMLPVGGKPLLETIISS
                     FKNQGFYKFYISTHYLPEVINEYFGNGEKLGVQIQYVHETDPLGTGGALSLLPASEIK
                     LPFIVINGDVLTNMNFEKLLDFHEQRQAIATMCVREFQYQIPYGVVNSEDNVIQSMTE
                     KPSYFFDINTGIYVISPELLAQVNAQFIGMPTILEQQMEKQNKVLSYPLHEYWLDIGH
                     MEDYNRAQRDIINLDFGKF"
     misc_feature    89366..89707
                     /locus_tag="ABZJ_00082"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     misc_feature    89375..89713
                     /locus_tag="ABZJ_00082"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domain associated
                     with the NTP (Nucleotidyl transferase) domain downstream.
                     CBS is a small domain originally identified in
                     cystathionine beta-synthase and subsequently...; Region:
                     CBS_pair_NTP_transferase_assoc; cd04607"
                     /db_xref="CDD:239980"
     misc_feature    89732..90391
                     /locus_tag="ABZJ_00082"
                     /note="NTP_trnasferase_like_2 is a member of the
                     nucleotidyl transferase family; Region:
                     NTP_transferase_like_2; cd06426"
                     /db_xref="CDD:133048"
     misc_feature    89738..>90412
                     /locus_tag="ABZJ_00082"
                     /note="Nucleoside-diphosphate-sugar pyrophosphorylase
                     involved in lipopolysaccharide biosynthesis/translation
                     initiation factor 2B, gamma/epsilon subunits
                     (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis,
                     outer membrane / Translation, ribosomal structure...;
                     Region: GCD1; COG1208"
                     /db_xref="CDD:224129"
     misc_feature    order(89741..89749,89879..89881,90038..90040,90044..90046)
                     /locus_tag="ABZJ_00082"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133048"
     misc_feature    order(90044..90046,90356..90358,90362..90364)
                     /locus_tag="ABZJ_00082"
                     /note="metal-binding site"
                     /db_xref="CDD:133048"
     gene            90427..91134
                     /locus_tag="ABZJ_00083"
                     /db_xref="GeneID:12115161"
     CDS             90427..91134
                     /locus_tag="ABZJ_00083"
                     /codon_start=1
                     /transl_table=11
                     /product="putative polysaccharide biosynthesis protein"
                     /protein_id="YP_005524039.1"
                     /db_xref="GI:384141329"
                     /db_xref="GeneID:12115161"
                     /translation="MIGQYRVTALIPARGGSKRLPRKNVKLLGDKPLIAWSIETAKAS
                     KYIDRVVVSTDDEEIKQVSEQYGAEVPFLRPEHLSNDHASSFDVIKHAIGFLHLDQTN
                     ELIVLLQPTSPLRLVSELDTALEFFITKNAKGIVSISETEHSPMWSNTLPENGCMSDF
                     IRPEVQGKRSQDLPKFFRLNGSIYIYETLSLLEQAKIFFDENVYGFETSLKTAVDIDT
                     ELDFLVAETIMKHRATE"
     misc_feature    90442..91113
                     /locus_tag="ABZJ_00083"
                     /note="CMP-NeuAc_Synthase activates N-acetylneuraminic
                     acid by adding CMP moiety; Region: CMP-NeuAc_Synthase;
                     cd02513"
                     /db_xref="CDD:133006"
     misc_feature    order(90460..90468,90478..90480,90496..90498,90646..90648,
                     90658..90660,90679..90681,90751..90753,90757..90759,
                     90961..90963,90976..90978,91075..91077)
                     /locus_tag="ABZJ_00083"
                     /note="ligand binding site; other site"
                     /db_xref="CDD:133006"
     misc_feature    order(90505..90507,90511..90516,90832..90834,90844..90849,
                     90952..90963,90976..90978,91033..91035,91039..91041,
                     91075..91077,91084..91089,91096..91098,91105..91110)
                     /locus_tag="ABZJ_00083"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133006"
     gene            91131..92327
                     /locus_tag="ABZJ_00084"
                     /db_xref="GeneID:12115162"
     CDS             91131..92327
                     /locus_tag="ABZJ_00084"
                     /codon_start=1
                     /transl_table=11
                     /product="putative polysaccharide biosynthesis protein"
                     /protein_id="YP_005524040.1"
                     /db_xref="GI:384141330"
                     /db_xref="GeneID:12115162"
                     /translation="MKVLKDSFIYLIGELFAKSLPFLMLPYLTRKLGPDGFGELSYYL
                     TMLSLFGIFVGLSQDGAVTRYFYFYGKKALNTVVKAGYLFNIAISIVLLLSCWWLKAE
                     IMAYVVLATMFQSFVNVQLALRQCQKQPLKYITIQIILSLTNVLFTVGALEYFNQDLV
                     AYRILAIVVANFTTFVIASLILGDLFRDSYRFTWQRLRLGLFYIFSFGFPLILHQSSI
                     FIKGQLDRIFIYQHYTKSELGIYSAGVQIALVLPIIFMALNKAIVPHYYQALKSNSLT
                     IVQIKKYTLLSLPLSILPAVVGWLMPEQLYQLFLGKGYETSKYFTVVFLVGYGLTMPY
                     LILVNYLFYHAKNRIISLITFSSSLLYIGSLYIFSQLKLEWIPFALILSNLFMLVALW
                     NIVKKV"
     misc_feature    91131..92303
                     /locus_tag="ABZJ_00084"
                     /note="Membrane protein involved in the export of
                     O-antigen and teichoic acid [General function prediction
                     only]; Region: RfbX; COG2244"
                     /db_xref="CDD:225153"
     misc_feature    91137..92234
                     /locus_tag="ABZJ_00084"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:263758"
     gene            94577..95146
                     /locus_tag="ABZJ_00085"
                     /db_xref="GeneID:12115163"
     CDS             94577..95146
                     /locus_tag="ABZJ_00085"
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase ORF 1"
                     /protein_id="YP_005524041.1"
                     /db_xref="GI:384141331"
                     /db_xref="GeneID:12115163"
                     /translation="MTHLNELYLILNKYLKWNKSHLKCFALIMLVIILKQTCNLSSAS
                     KALPIKCLPQSFYRRMQRFFAGQYFDYRQISQLIFNMFSFDQVQLTLDRTNWKWGKRN
                     INILMLAIVYRGIAIPILWTLLNKRGNSDTKERIALIQRFIAIFGKDRIVNVFADREF
                     IGEQWFTWLIEQDINFCIRVKKTSLSPII"
     misc_feature    <95021..>95128
                     /locus_tag="ABZJ_00085"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            95221..95667
                     /locus_tag="ABZJ_00086"
                     /db_xref="GeneID:12115164"
     CDS             95221..95667
                     /locus_tag="ABZJ_00086"
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase ORF 2"
                     /protein_id="YP_005524042.1"
                     /db_xref="GI:384141332"
                     /db_xref="GeneID:12115164"
                     /translation="MVGRVKLYISALQLENGELLLVVSPQFNANAIQDYALRWEIETL
                     FSCLKGRGFNLENTRLTDPRRVKKLIAVLAISFCWCYLTGEWQHDQKKAIKIKKHGRL
                     SMSLFRYGLDYVQMAIQRLIGFGKKEEFKEILAILRRQNPDRIRVL"
     misc_feature    <95323..95457
                     /locus_tag="ABZJ_00086"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            95696..96739
                     /locus_tag="ABZJ_00087"
                     /db_xref="GeneID:12115165"
     CDS             95696..96739
                     /locus_tag="ABZJ_00087"
                     /codon_start=1
                     /transl_table=11
                     /product="protein WbjB"
                     /protein_id="YP_005524043.1"
                     /db_xref="GI:384141333"
                     /db_xref="GeneID:12115165"
                     /translation="MDSMFKDKVLLITGGTGSFGNAVLKRFLETDIKEIRIFSRDEKK
                     QDDMRKKYHSAKLKFYIGDVRDYNSILNATRGVDYIYHAAALKQVPSCEFHPMEAVKT
                     NVLGTENVLEAAIQNHVKRVVCLSTDKAVYPINAMGISKAMMEKVMVAKSRNLEGLNT
                     VICGTRYGNVMASRGSVIPLFVDQIRQGKPLTITDPNMTRFMMTLEDAVDLVLYAFEH
                     GENGDIFVQKAPAATIAVLAEALKQLLNVEDHPISIMGTRHGEKAFEALLSREEMVHA
                     FDQGDYFRVPADQRDLNYEKYVEDGDLKITEFEDYNSHNTTRLDVEGMKQLLLKLDFV
                     RALTRGEYISPEA"
     misc_feature    95705..96715
                     /locus_tag="ABZJ_00087"
                     /note="UDP-N-acetylglucosamine
                     4,6-dehydratase/5-epimerase; Region: FnlA; TIGR04130"
                     /db_xref="CDD:200381"
     misc_feature    95711..96520
                     /locus_tag="ABZJ_00087"
                     /note="UDP-Glcnac (UDP-linked N-acetylglucosamine)
                     inverting 4,6-dehydratase, extended (e) SDRs; Region:
                     UDP_invert_4-6DH_SDR_e; cd05237"
                     /db_xref="CDD:187548"
     misc_feature    order(95735..95737,95741..95752,95810..95815,95879..95887,
                     95942..95950,95954..95956,95999..96001,96068..96070,
                     96116..96118,96194..96205,96212..96217)
                     /locus_tag="ABZJ_00087"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187548"
     misc_feature    order(95813..95815,95819..95821,95831..95833,95843..95845,
                     95873..95884,95891..95893,95900..95902,95948..95959,
                     95966..95968,95978..95980,95987..95989,95996..95998,
                     96215..96220,96233..96235)
                     /locus_tag="ABZJ_00087"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187548"
     misc_feature    order(95954..95956,96074..96082,96104..96106,96197..96202,
                     96218..96226,96233..96238,96269..96277,96287..96289,
                     96293..96295,96395..96397,96467..96469,96476..96478)
                     /locus_tag="ABZJ_00087"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187548"
     misc_feature    order(96002..96004,96074..96076,96104..96106,96116..96118)
                     /locus_tag="ABZJ_00087"
                     /note="active site"
                     /db_xref="CDD:187548"
     misc_feature    96557..96700
                     /locus_tag="ABZJ_00087"
                     /note="Polysaccharide biosynthesis protein C-terminal;
                     Region: Polysacc_syn_2C; pfam08485"
                     /db_xref="CDD:254825"
     gene            96742..97851
                     /locus_tag="ABZJ_00088"
                     /db_xref="GeneID:12115166"
     CDS             96742..97851
                     /locus_tag="ABZJ_00088"
                     /codon_start=1
                     /transl_table=11
                     /product="protein WbjC"
                     /protein_id="YP_005524044.1"
                     /db_xref="GI:384141334"
                     /db_xref="GeneID:12115166"
                     /translation="MKVLVTGSNGFIAKNFIQFLSEKPEVEILKAHRETTDQEFEQVV
                     LAADWIVHLAGVNRPLNEEEFAEGNTTLTEKISQILQQANKKTPVILSSSIQVERDNP
                     YGKSKLGGEQALVTLHQAQGNPVYICRLANVFGKWSRPNYNSAVATFCHNVANDLPLQ
                     IHDENAVIRLVYVDDVVETFWNILNGQQVEQFFQVEPEYQITVGDLAKVLNGFKASRG
                     TLITDRVGTGLTRALYSTYLSFLKPEQFDYSVPKYGDARGVFVEMLKTPDAGQFSYFT
                     AHPGITRGGHYHHTKTEKFLVIKGKALFKFKHVVTGEFYELETHGDEPRIVETVPGWT
                     HDITNIGDEEMVVMLWANEIFDRNKPDTYAMPITN"
     misc_feature    96742..97479
                     /locus_tag="ABZJ_00088"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    96748..97293
                     /locus_tag="ABZJ_00088"
                     /note="NAD dependent epimerase/dehydratase family; Region:
                     Epimerase; pfam01370"
                     /db_xref="CDD:250566"
     misc_feature    order(96760..96762,96766..96771,96775..96777,96835..96843,
                     96898..96906,97015..97023,97048..97050,97060..97062,
                     97129..97140)
                     /locus_tag="ABZJ_00088"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(96946..96948,97021..97023,97048..97050,97060..97062)
                     /locus_tag="ABZJ_00088"
                     /note="active site"
                     /db_xref="CDD:187535"
     misc_feature    97492..97833
                     /locus_tag="ABZJ_00088"
                     /note="dTDP-4-dehydrorhamnose 3,5-epimerase and related
                     enzymes [Cell envelope biogenesis, outer membrane];
                     Region: RfbC; COG1898"
                     /db_xref="CDD:224810"
     gene            97864..98994
                     /locus_tag="ABZJ_00089"
                     /db_xref="GeneID:12115167"
     CDS             97864..98994
                     /locus_tag="ABZJ_00089"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="YP_005524045.1"
                     /db_xref="GI:384141335"
                     /db_xref="GeneID:12115167"
                     /translation="MKKLKLMTVVGTRPEIIRLSRVMAACDEYFDHILVHTGQNYDYE
                     LNEIFFTDLGIRKPDHFLNAAGATGAETIGNVIIAVDKILEEVQPEALLVLGDTNSCM
                     AVLPAKRRKIPTFHMEAGNRCFDMRVPEEINRRIVDHTADINLTYSTIARDYLLAEGL
                     PADLVIKTGSPMFEVLHHYKAKIEASDVLERLNLKEHEYFIVSAHREENINSDQNFLD
                     LVEMLNAVADKYKYPVIVSTHPRTRKRIEELNVEFHPLIQLLKPLGFSDYNKLQLSAK
                     AALSDSGTINEESSILNFPALNLRQAHERPEGMEEAAVMMVGLKAERILQGLAILEGQ
                     TRGENRLLRLVEDYSMPNVSEKVVRIIMSYTDYVNRVIWKKY"
     misc_feature    97864..98991
                     /locus_tag="ABZJ_00089"
                     /note="UDP-N-acetylglucosamine 2-epimerase [Cell envelope
                     biogenesis, outer membrane]; Region: WecB; COG0381"
                     /db_xref="CDD:223458"
     misc_feature    97876..98946
                     /locus_tag="ABZJ_00089"
                     /note="Bacterial members of the UDP-N-Acetylglucosamine
                     (GlcNAc) 2-Epimerase  family are known to catalyze the
                     reversible interconversion of UDP-GlcNAc and
                     UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to
                     produce an activated form of ManNAc residues; Region:
                     GT1_UDP-GlcNAc_2-Epimerase; cd03786"
                     /db_xref="CDD:99962"
     misc_feature    order(97900..97902,98650..98652,98656..98658,98665..98667,
                     98713..98715,98725..98727)
                     /locus_tag="ABZJ_00089"
                     /note="active site"
                     /db_xref="CDD:99962"
     misc_feature    order(98074..98076,98080..98085,98104..98106,98185..98190,
                     98194..98196,98200..98202,98251..98253,98263..98265,
                     98332..98334)
                     /locus_tag="ABZJ_00089"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99962"
     gene            99005..100192
                     /locus_tag="ABZJ_00090"
                     /db_xref="GeneID:12115168"
     CDS             99005..100192
                     /locus_tag="ABZJ_00090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524046.1"
                     /db_xref="GI:384141336"
                     /db_xref="GeneID:12115168"
                     /translation="MKKKVYLITEYYHPYQNTTGYLLGKLYDTLNVQSDIDLVLIAKE
                     DMNCPQHANAHFIKAKKPNKASLFKRFLYELIIAFSFLMKTLKVVKKDSIVFTGTTPI
                     LLLFVLFIIKKFLNFKWILLVHDVFPENLAAAKILKKDHFLFKILKSLFDRIYASADE
                     VIVIGKDMKELVHQKTHQSNNITVVQNWIDSSDIGTEPKTNNRILQELNWLDSETTIF
                     QFFGNIGRVQGVENILHAIQKMKYAHLAKFIFIGDGAYVARLKEQIQSLGSQNILYYG
                     SLDQKEKTTGLNACDVALITLADGMLGLGVPSKSYFSMAADKPLLAIMDSESEVADMI
                     NTHHIGWVVPPNNEEALAKQLDEIVLAKHCYAFNSSREVLNEFYSEKVAMSKILNIIR
                     KFT"
     misc_feature    99011..100189
                     /locus_tag="ABZJ_00090"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    99014..100168
                     /locus_tag="ABZJ_00090"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. wbuB in E. coli is
                     involved in the biosynthesis of the O26 O-antigen.  It has
                     been proposed to function as an N-acetyl-L-fucosamine
                     (L-FucNAc) transferase; Region: GT1_wbuB_like; cd03794"
                     /db_xref="CDD:99968"
     gene            100209..101144
                     /locus_tag="ABZJ_00091"
                     /db_xref="GeneID:12115169"
     CDS             100209..101144
                     /locus_tag="ABZJ_00091"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="YP_005524047.1"
                     /db_xref="GI:384141337"
                     /db_xref="GeneID:12115169"
                     /translation="MNILITGSSGFVGSYLCEYFTTMPEHSVLAQTRKNTQKLCNNIK
                     TITFDINDDLTSLDLSSVDVIVHCAGRAHIMKEVESDPLSIYRKVNVEGTLNLAKKAA
                     KAGVKRFIFMSSIKVNGEVSDQVPFTPHDNIINIKDLYGLSKYEAEQSLLNLAQNSMM
                     EVVIIRPALIYGPNVKANFKSMINLAAKGIPLPVGCLDNKRSMVSIYNLSDFINICLS
                     HPLAKNQVFLISDQDDITVKELFTKLAKVQGRNLIAVPIPKVLINFLAKLLNKSAVAS
                     RLCSVLIVDTSKNIELLGWRAPFSFDESLKLMFKK"
     misc_feature    100209..101126
                     /locus_tag="ABZJ_00091"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    100212..101126
                     /locus_tag="ABZJ_00091"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(100227..100229,100233..100238,100242..100244,
                     100302..100310,100410..100418,100542..100550,
                     100626..100628,100638..100640,100707..100718)
                     /locus_tag="ABZJ_00091"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(100476..100478,100548..100550,100626..100628,
                     100638..100640)
                     /locus_tag="ABZJ_00091"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            102581..103201
                     /locus_tag="ABZJ_00092"
                     /db_xref="GeneID:12115170"
     CDS             102581..103201
                     /locus_tag="ABZJ_00092"
                     /codon_start=1
                     /transl_table=11
                     /product="putative UDP-galactose phosphate transferase
                     (WeeH)"
                     /protein_id="YP_005524048.1"
                     /db_xref="GI:384141338"
                     /db_xref="GeneID:12115170"
                     /translation="MMKRIVDIVISLTALIILSPIFIWVAYKVRKNLGSPVFFYQERP
                     GKDGKLFKMIKFRSMKDAFDAQGNPLPDEERITPFGHKLRSTTLDEMPQLINVLKGDM
                     SIVGPRPQLADFLEHYTSRQMRRHEVRPGMTGLAQVSGRNNLSWEEKFELDIEYVETH
                     NLSLDFKIMMKTVLVMLKKEGINAPDQLVGASRFSGSARDEDKASL"
     misc_feature    102587..103117
                     /locus_tag="ABZJ_00092"
                     /note="Bacterial sugar transferase; Region: Bac_transf;
                     pfam02397"
                     /db_xref="CDD:251270"
     gene            103220..104095
                     /locus_tag="ABZJ_00093"
                     /db_xref="GeneID:12115171"
     CDS             103220..104095
                     /locus_tag="ABZJ_00093"
                     /codon_start=1
                     /transl_table=11
                     /product="UTP-glucose-1-phosphate uridylyltransferase"
                     /protein_id="YP_005524049.1"
                     /db_xref="GI:384141339"
                     /db_xref="GeneID:12115171"
                     /translation="MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAV
                     EAGIEQIILVTHSSKASIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSVISVR
                     QPQPLGLGHAVLCAKSVVGEDDFAVLLPDVLVKDGSGQNDLSRMISRYNSSQAAQIMV
                     EAVPDHLVDQYGIVDVKHSPNVGESIAMQGIVEKPAVGAAPSNLSVVGRYVLPTKIMQ
                     LLENTPKGAGNEIQLTDAIAMLQDTDTVEAYRMQGQTFDCGSKLGYLKAVLHYGLEHP
                     KLGMEFKQLIQELKL"
     misc_feature    103226..104041
                     /locus_tag="ABZJ_00093"
                     /note="Prokaryotic UGPase catalyses the synthesis of
                     UDP-glucose; Region: UGPase_prokaryotic; cd02541"
                     /db_xref="CDD:133021"
     misc_feature    103229..104023
                     /locus_tag="ABZJ_00093"
                     /note="dTDP-glucose pyrophosphorylase [Cell envelope
                     biogenesis, outer membrane]; Region: RfbA; COG1209"
                     /db_xref="CDD:224130"
     misc_feature    order(103241..103252,103292..103297,103526..103528,
                     103535..103546,103604..103606,103610..103615,
                     103730..103735,103796..103801,103835..103837,
                     103919..103921)
                     /locus_tag="ABZJ_00093"
                     /note="active site"
                     /db_xref="CDD:133021"
     misc_feature    order(103253..103255,103262..103276,103280..103288,
                     103298..103306,103310..103318,103328..103330,
                     103400..103402,103406..103414,103418..103420,
                     103430..103435,103520..103525,103529..103531,
                     103535..103537,103727..103729,103907..103909,
                     103979..103981,103997..104005,104009..104017,
                     104021..104029,104036..104041)
                     /locus_tag="ABZJ_00093"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133021"
     gene            104213..105475
                     /locus_tag="ABZJ_00094"
                     /db_xref="GeneID:12115172"
     CDS             104213..105475
                     /locus_tag="ABZJ_00094"
                     /codon_start=1
                     /transl_table=11
                     /product="putative UDP-glucose 6-dehydrogenase (Ugd)
                     (Udg)"
                     /protein_id="YP_005524050.1"
                     /db_xref="GI:384141340"
                     /db_xref="GeneID:12115172"
                     /translation="MKIAVFGTTLHAGVMAALLAEYGNQIYWCTCVSCEENISVLSYQ
                     DQEVNHYLNKQRKAGFLKESPFSEIPLDIEVYLFCFSPTQIELALKTVEKLSERPIIH
                     PKLMINGSTFGLHGTEKLKQHLPKDEWVYFPDVIQEGNAINSVLDVKHVIVGVESRDA
                     SEIMQELLRPFFQFSYQYLFMPILDAEFTKLSISGMLATRISYMNDLAMVAEKLGIDI
                     ANVKHGIAADTRIGAAYLSPGVGFGGENFSHDILTLSSTVLETGTKSRLLEQVWAINE
                     QQKEILFRKLWNYYHCDLSGKTVAIWGASFKENTSNIHNSPIHILLAALWAQGVKVRL
                     HDPQALDEIASIYGSREDLILCSDQYEAAQNAHALCLVTAWKQYWSPDFKRLQQLMKH
                     PLILDGRNIYDPAYVKARGFAYEGVGRL"
     misc_feature    104213..105424
                     /locus_tag="ABZJ_00094"
                     /note="Predicted UDP-glucose 6-dehydrogenase [Cell
                     envelope biogenesis, outer membrane]; Region: Ugd;
                     COG1004"
                     /db_xref="CDD:223936"
     misc_feature    104213..104713
                     /locus_tag="ABZJ_00094"
                     /note="Short-chain dehydrogenases/reductases (SDR);
                     Region: SDR; cl21454"
                     /db_xref="CDD:271874"
     misc_feature    104768..105046
                     /locus_tag="ABZJ_00094"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    105110..105421
                     /locus_tag="ABZJ_00094"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            105472..107142
                     /locus_tag="ABZJ_00095"
                     /db_xref="GeneID:12115173"
     CDS             105472..107142
                     /locus_tag="ABZJ_00095"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="YP_005524051.1"
                     /db_xref="GI:384141341"
                     /db_xref="GeneID:12115173"
                     /translation="MSKSIEQFPKDLSSPLIQLKSSVEKNSKLHIKELFALEPERFQN
                     YSVKFDQLFFDYSKQRITKNILEQLVALANNKQLTQWINRLFSQDKINCTEQREAMHW
                     ALRLPSEYSKFPELTKQVHIQLQRMYTLVEKIHAGQYRGATGEVIQDVVNIGVGGSDL
                     GPHMVTHALADFKVKTAKPLNVHFVSTMDGSQLSDLLHQLRPETTLFIISSKSFGTID
                     TLSNAQTVRQWLEKALGKHDRVVKSHFIGVSTKAEKMTEWGIAPENQLLLWDWVGGRY
                     SLWSCIGFPIALTIGIEGFQQLLAGAHAVDEHFQNTSFEQNIPVLMALLGIWNNNFLN
                     IQTHAVLPYDGRLKYFASYLQQLEMESNGKSIQRDGQKVELDTCPIVWGEVGPNAQHA
                     FYQLLHQGTQAVSCDFIAPIQRYNADHFTYVENAEALIEQHHLALSNCLAQSRLLAFG
                     NEALDAAELKNLPIYKQYEGNQPSSTLLLDELNPYNLGMLIALYEHKVFVQSVIWNIN
                     PFDQWGVEKGKQIADQLLPILNGVQNDFSKLDASTRGLIKILLGKVDG"
     misc_feature    105523..107127
                     /locus_tag="ABZJ_00095"
                     /note="glucose-6-phosphate isomerase; Reviewed; Region:
                     pgi; PRK00179"
                     /db_xref="CDD:234679"
     misc_feature    105841..106335
                     /locus_tag="ABZJ_00095"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the first SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_1; cd05015"
                     /db_xref="CDD:240146"
     misc_feature    order(105934..105936,105940..105945,106102..106110,
                     106117..106119,106291..106293)
                     /locus_tag="ABZJ_00095"
                     /note="active site"
                     /db_xref="CDD:240146"
     misc_feature    order(106027..106038,106123..106125,106135..106137,
                     106144..106146)
                     /locus_tag="ABZJ_00095"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240146"
     misc_feature    106477..107046
                     /locus_tag="ABZJ_00095"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the second SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_2; cd05016"
                     /db_xref="CDD:240147"
     misc_feature    order(106477..106479,106501..106503,106537..106539,
                     106549..106551,106558..106563,106621..106623,
                     106627..106635,106642..106647,106654..106659,
                     106666..106668,106765..106767,106771..106773,
                     106795..106797,106804..106806)
                     /locus_tag="ABZJ_00095"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240147"
     misc_feature    order(106537..106539,106549..106551)
                     /locus_tag="ABZJ_00095"
                     /note="active site"
                     /db_xref="CDD:240147"
     gene            107135..108151
                     /locus_tag="ABZJ_00096"
                     /db_xref="GeneID:12115174"
     CDS             107135..108151
                     /locus_tag="ABZJ_00096"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="YP_005524052.1"
                     /db_xref="GI:384141342"
                     /db_xref="GeneID:12115174"
                     /translation="MAKILVTGGAGYIGSHTCVELLEAGHEVIVFDNLSNSSEESLNR
                     VQEITQKSLTFIEGDIRNSDELDRVFREHTIDAVIHFAGLKAVGESQEKPLIYFDNNI
                     AGSIQLVKSMEKAGVYTLVFSSSATVYDEANISPLNEEMPTGMPSNNYGYTKLIVEQL
                     LQKLSVADSKWSIALLRYFNPVGAHKSGRIGEDPQGIPNNLMPYVTQVAVGRREKLSI
                     YGNDYDTVDGTGVRDYIHVVDLANAHLCALNNRLQAQGCRAWNIGTGNGSSVLQVKNT
                     FEQVNGVPVAFEFAPRRAGDVATSFADNARAVAELGWKPQYGLEDMLKDSWNWQKQNP
                     NGYN"
     misc_feature    107141..108127
                     /locus_tag="ABZJ_00096"
                     /note="UDP-glucose 4 epimerase, subgroup 1, extended (e)
                     SDRs; Region: UDP_G4E_1_SDR_e; cd05247"
                     /db_xref="CDD:187558"
     misc_feature    107144..108145
                     /locus_tag="ABZJ_00096"
                     /note="UDP-glucose 4-epimerase; Region: PLN02240"
                     /db_xref="CDD:177883"
     misc_feature    order(107156..107158,107162..107173,107228..107245,
                     107306..107314,107375..107383,107387..107389,
                     107432..107434,107501..107509,107582..107584,
                     107594..107596,107666..107671,107675..107677)
                     /locus_tag="ABZJ_00096"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187558"
     misc_feature    order(107405..107407,107411..107419,107426..107431,
                     107438..107443,107450..107455,107459..107464,
                     107471..107473,107579..107581,107588..107590,
                     107600..107602,107609..107614,107618..107626)
                     /locus_tag="ABZJ_00096"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187558"
     misc_feature    order(107435..107437,107507..107509,107582..107584,
                     107594..107596)
                     /locus_tag="ABZJ_00096"
                     /note="active site"
                     /db_xref="CDD:187558"
     misc_feature    order(107507..107515,107582..107584,107666..107674,
                     107729..107737,107780..107791,107822..107824,
                     107828..107830,107834..107836,107942..107944,
                     108011..108013,108020..108022)
                     /locus_tag="ABZJ_00096"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187558"
     gene            complement(108196..109566)
                     /locus_tag="ABZJ_00097"
                     /db_xref="GeneID:12115175"
     CDS             complement(108196..109566)
                     /locus_tag="ABZJ_00097"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524053.1"
                     /db_xref="GI:384141343"
                     /db_xref="GeneID:12115175"
                     /translation="MTTLTCFKAYDIRGKLGTELNEEIAYKIGRAYGQIYKPKTVVVG
                     CDIRLSSEALKQATIRGLNDAGVNVLDLGMTGTEEVYFAAFHLDVQGGIEVTASHNPM
                     DYNGMKLVRENARPISADTGLKEIQALAETNNFEEVSQKGTTQSYNILPEFVDHLLTY
                     IEPAKIRPLKLVVNAGNGAAGHVIDAIEEKFKALNVPVEFIKIHHEADGTFPNGIPNP
                     ILIENRDSTRNAVLEHKADMGIAWDGDFDRCFLFDEKGQFIEGYYIVGLLAQAFLIKQ
                     SGEKIVHDPRLVWNTFDIVDEYKGVAVQSKSGHAFIKDVMREHNAVYGGEMSAHHYFR
                     DFAYCDSGMIPWLLTIALLSETGQSLSTLVENMIAKFPCSGEINFKVADTQTTIQKIF
                     DFYANQNPQIDRTDGVSLDFGTWRFNVRASNTEPLLRLNIESRADRQAQPMQHYVDEL
                     TGLIQN"
     misc_feature    complement(108256..109566)
                     /locus_tag="ABZJ_00097"
                     /note="phosphomannomutase CpsG; Provisional; Region:
                     PRK15414"
                     /db_xref="CDD:185312"
     misc_feature    complement(108256..109551)
                     /locus_tag="ABZJ_00097"
                     /note="The phosphomannomutase/phosphoglucomutase (PMM/PGM)
                     bifunctional enzyme catalyzes the reversible conversion of
                     1-phospho to 6-phospho-sugars (e.g. between
                     mannose-1-phosphate and mannose-6-phosphate or
                     glucose-1-phosphate and glucose-6-phosphate) via a...;
                     Region: PMM_PGM; cd03089"
                     /db_xref="CDD:100091"
     misc_feature    complement(order(108295..108303,108307..108309,
                     108577..108579,108583..108585,108589..108591,
                     108640..108648,108709..108711,108823..108828,
                     108832..108834,108838..108840,109243..109245,
                     109267..109275,109528..109530,109537..109539,
                     109543..109545))
                     /locus_tag="ABZJ_00097"
                     /note="active site"
                     /db_xref="CDD:100091"
     misc_feature    complement(order(108295..108303,108307..108309,
                     108577..108579,108583..108585,108589..108591,
                     108640..108642,108646..108648,108709..108711,
                     108823..108825,109273..109275,109528..109530,
                     109537..109539))
                     /locus_tag="ABZJ_00097"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100091"
     misc_feature    complement(order(108826..108828,108832..108834,
                     108838..108840,109273..109275))
                     /locus_tag="ABZJ_00097"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100091"
     gene            109729..109857
                     /locus_tag="ABZJ_00098"
                     /db_xref="GeneID:12115176"
     CDS             109729..109857
                     /locus_tag="ABZJ_00098"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524054.1"
                     /db_xref="GI:384141344"
                     /db_xref="GeneID:12115176"
                     /translation="MRNGLIFLAPIGHTNCDNYLIIDLTNNCVYDAACGLRNSICI"
     gene            109935..111602
                     /locus_tag="ABZJ_00099"
                     /db_xref="GeneID:12115177"
     CDS             109935..111602
                     /locus_tag="ABZJ_00099"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate permease"
                     /protein_id="YP_005524055.1"
                     /db_xref="GI:384141345"
                     /db_xref="GeneID:12115177"
                     /translation="MTMLNMWQQLYDPLNNIWLSSAVALIPIIFFFLALAVFRLKGSI
                     AGTGTVIIALLIALFFYQMPGQMAFASIIYGFFYGLWPISWIIIGAVFLYKISVKTGQ
                     FEVIRSSILSITEDQRLQMLLVGFAFGTFLEGAAGFGAPVAITAALLVGLGFKPLYAA
                     GLCLIVNTAPVAFGAMGIPIIVAGQVSGVDTMEISQMVGRQLPFLTIIVLFWIMAIMD
                     GWRGVKETWPAVLVGGGAFAIAQYLTSNFIGPELPDITAAIASLVSLTLLFRVWKPKH
                     IFRFEPEAGQTLTQQPTTVQRYSIGKIAKAWSPFAILTVMVTIWSVKPFKALFAKDGA
                     LEHWIFKLEVPYLHKLVEKMPPIVSEIKPYEAIYKFDWFSATGTAIFIAAIITVIFLK
                     MKASEAVTTFGETLNELKTPIYSIGMVLAFAFIANYSGLSATLALALSHTGHAFTFFS
                     PFLGWLGVFLTGSDTSSNALFSALQATTAQQIGIPEVLLVAANTSGGVTGKMISPQSI
                     AIACAAVGLVGKESDLFRFTVKHSIIFTVFVGIIITVQAYLVPWMIP"
     misc_feature    109944..111599
                     /locus_tag="ABZJ_00099"
                     /note="L-lactate permease; Provisional; Region: PRK10420"
                     /db_xref="CDD:182445"
     gene            111622..112374
                     /locus_tag="ABZJ_00100"
                     /db_xref="GeneID:12115178"
     CDS             111622..112374
                     /locus_tag="ABZJ_00100"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional repressor LldR"
                     /protein_id="YP_005524056.1"
                     /db_xref="GI:384141346"
                     /db_xref="GeneID:12115178"
                     /translation="MRISDQVVMKLQALIEERHMKKGDRLPAERQLATSLGVSRPSLR
                     EAIQQLNSQGVLISRRGDGTYIQQLPEQWPQQLIVNPISNLIEEDPLYRFDVQEARLV
                     LEGGTAWYAALRSTPEDRAKIHHYFNEISRHQNAGDSAQAAVADAEFHLAIAEASHNV
                     VLIQMMRSLFDLLQYNVLLGRKKVYNDPVNGDLLSEQHFQVMDAIDRKDPEAARQAVC
                     GHIEFVINHVRSLDEDEARQKRANRLNRVDSK"
     misc_feature    111622..112371
                     /locus_tag="ABZJ_00100"
                     /note="DNA-binding transcriptional repressor LldR;
                     Provisional; Region: PRK10421"
                     /db_xref="CDD:236690"
     misc_feature    111628..111819
                     /locus_tag="ABZJ_00100"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(111631..111633,111700..111702,111706..111711,
                     111733..111747,111751..111756,111763..111765,
                     111793..111798,111802..111813)
                     /locus_tag="ABZJ_00100"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    111904..112287
                     /locus_tag="ABZJ_00100"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            112371..113522
                     /locus_tag="ABZJ_00101"
                     /db_xref="GeneID:12115179"
     CDS             112371..113522
                     /locus_tag="ABZJ_00101"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate dehydrogenase, FMN linked"
                     /protein_id="YP_005524057.1"
                     /db_xref="GI:384141347"
                     /db_xref="GeneID:12115179"
                     /translation="MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSE
                     IALRQRVLNDMSALSLETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIP
                     FTLSTVSVCPIEEVAPAINRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPV
                     PGARYRDAHSGMSGPNAAMRRYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLE
                     DYIGWLGSNFDPSISWKDLEWIREFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHG
                     GRQLDGVMSSARALPAIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVY
                     ALAAAGGQGVSNLLDLIDKEMRVAMTLTGAKSISDINADCLVQAIKQGL"
     misc_feature    112371..113513
                     /locus_tag="ABZJ_00101"
                     /note="L-lactate dehydrogenase; Provisional; Region: lldD;
                     PRK11197"
                     /db_xref="CDD:183033"
     misc_feature    112389..113483
                     /locus_tag="ABZJ_00101"
                     /note="Family of homologous FMN-dependent
                     alpha-hydroxyacid oxidizing enzymes. This family occurs in
                     both prokaryotes and eukaryotes. Members of this family
                     include flavocytochrome b2 (FCB2), glycolate oxidase
                     (GOX), lactate monooxygenase (LMO), mandelate...; Region:
                     alpha_hydroxyacid_oxid_FMN; cd02809"
                     /db_xref="CDD:239203"
     misc_feature    order(112440..112442,112686..112688,112755..112757,
                     112839..112841,112860..112862,113121..113123,
                     113193..113195,113202..113204,113358..113360)
                     /locus_tag="ABZJ_00101"
                     /note="active site"
                     /db_xref="CDD:239203"
     misc_feature    order(112440..112442,112755..112757,112860..112862,
                     113193..113195,113202..113204)
                     /locus_tag="ABZJ_00101"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239203"
     misc_feature    order(112686..112688,112755..112757,112839..112841,
                     113121..113123,113193..113195,113202..113204,
                     113358..113360)
                     /locus_tag="ABZJ_00101"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239203"
     misc_feature    order(112755..112757,112860..112862,113193..113195)
                     /locus_tag="ABZJ_00101"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239203"
     gene            113790..115520
                     /locus_tag="ABZJ_00102"
                     /db_xref="GeneID:12115180"
     CDS             113790..115520
                     /locus_tag="ABZJ_00102"
                     /codon_start=1
                     /transl_table=11
                     /product="D-lactate dehydrogenase FAD-binding protein"
                     /protein_id="YP_005524058.1"
                     /db_xref="GI:384141348"
                     /db_xref="GeneID:12115180"
                     /translation="MDDQKETIMQTFSPQAVIERLQNIVGRSYVLTDDQSTRQYRQGR
                     RFGEGKVLAVVVPGTLLEQWQVLQAAIEADCIVIMQAANTGLTGGSTPYGDDYDRPVL
                     VMSTRRLKGIQVIHDGKQVICLPGATLDNLEQILKGYNREPHSVIGSSCIGASVLGGV
                     CNNSGGALVRRGPAYTELALYAQVNAAGQLELVNHLGVNLGSTPEEILTRLEKQQYQA
                     VDILDDNEKQASDHRYAHDVTQVDEDTPARFNADPSRLFEASGSAGKVCVFAVRLDTY
                     EKVESSVFYIGSNDADDLTAIRRYLLTSLPSLPIAGEYIHRDAYLIGEKYGKDTFLFI
                     EKFGTANVPKAFAMKDKVDGFLEKFKIKGLTDQILQAITFFLPSHLPKRMTEYRDRYE
                     HHLVLRVENNSKAQTEQFLKEYFAVHQSGNYFVCSEEEGRKAFLHRFAIAGAAIRYRD
                     THRSEVEDIVALDIALRRNDREWVEQLPAEMEKKIIHKLYYGHFFCHVFHQDYILKKG
                     NDPLEMEHQMWKLLDARRAEYPAEHNVGHLYIAKPALANFYQKLDPTNSFNVGIGHTS
                     KLKYWGKAKS"
     misc_feature    113826..115511
                     /locus_tag="ABZJ_00102"
                     /note="D-lactate dehydrogenase; Provisional; Region:
                     PRK11183"
                     /db_xref="CDD:236872"
     misc_feature    113943..114302
                     /locus_tag="ABZJ_00102"
                     /note="FAD binding domain; Region: FAD_binding_4; cl19922"
                     /db_xref="CDD:268275"
     misc_feature    114636..115502
                     /locus_tag="ABZJ_00102"
                     /note="D-lactate dehydrogenase, membrane binding; Region:
                     Lact-deh-memb; pfam09330"
                     /db_xref="CDD:117872"
     gene            complement(115569..116783)
                     /locus_tag="ABZJ_00103"
                     /db_xref="GeneID:12115181"
     CDS             complement(115569..116783)
                     /locus_tag="ABZJ_00103"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid aminotransferase"
                     /protein_id="YP_005524059.1"
                     /db_xref="GI:384141349"
                     /db_xref="GeneID:12115181"
                     /translation="MFQHIPPYAGDPILSLMEQFNADTRSEKVNLSIGLYYNEDSIVP
                     QLETIIEAQKRIEPKNGKTKLYLPMEGFKPYREAIQALLFGVNSPAVKAGRAVTIQTL
                     GGSGALKVGADFLKTYFPNSDVWVSQPTWDNHVAIFNGAGIKTHFYPYFDAETRGVDF
                     DGMLSTLKTLPEQSIVLLHPCCHNPTGADLNPAQWDQVIAVLKDRNLIPFLDIAYQGF
                     GDGMEEDAYAIRALDQAGLNFIVSNSFSKIFSLYGERVGGLTFVCDDAEAAQCTFGQL
                     KATVRRIYSSPPTTGAWLVDEVLNDAELNQQWQGEVKEMRERIIKMRSILKDELTKAL
                     PDRDFSYLVNQKGMFSYTGLTAEQVDILREEYAIYLVRSGRICVAGLNMNNVYTVAKA
                     MAEVLAKSVEAA"
     misc_feature    complement(115608..116708)
                     /locus_tag="ABZJ_00103"
                     /note="Aminotransferase class I and II; Region:
                     Aminotran_1_2; pfam00155"
                     /db_xref="CDD:249636"
     misc_feature    complement(115641..116699)
                     /locus_tag="ABZJ_00103"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(116019..116021,116043..116048,
                     116052..116054,116139..116141,116232..116234,
                     116391..116393,116469..116477))
                     /locus_tag="ABZJ_00103"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(115902..115904,115911..115913,
                     116019..116027,116160..116162,116361..116363,
                     116466..116468))
                     /locus_tag="ABZJ_00103"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(116043..116045)
                     /locus_tag="ABZJ_00103"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            117299..118009
                     /locus_tag="ABZJ_00104"
                     /db_xref="GeneID:12115182"
     CDS             117299..118009
                     /locus_tag="ABZJ_00104"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005524060.1"
                     /db_xref="GI:384141350"
                     /db_xref="GeneID:12115182"
                     /translation="MQDLTFAPEPLQSQGRTLTEHVFKQIQTAIVLGQIPAGSKISEP
                     ELARTYGISRGPLREAIHRLEGQRLVERTAHVGARVVSLSLQQFKELYQIRASLEGLA
                     CKLAAQHIDKKQILALRDVLRMHAEDENFKAGKGYYLQEGQDDFHYCIIKSSGNKTLE
                     KMLCDELYHLIRMYRIQFSNTPDRPSKAWDEHIRILDAIAEGDGELAELLMHRHINAS
                     YKIIEQTLLQAQGEHNNG"
     misc_feature    117320..117976
                     /locus_tag="ABZJ_00104"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    117347..117538
                     /locus_tag="ABZJ_00104"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(117347..117349,117353..117355,117425..117430,
                     117452..117466,117470..117475,117482..117484,
                     117512..117517,117521..117532)
                     /locus_tag="ABZJ_00104"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    117566..117949
                     /locus_tag="ABZJ_00104"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            117888..118886
                     /locus_tag="ABZJ_00105"
                     /db_xref="GeneID:12115183"
     CDS             117888..118886
                     /locus_tag="ABZJ_00105"
                     /codon_start=1
                     /transl_table=11
                     /product="methylisocitrate lyase"
                     /protein_id="YP_005524061.1"
                     /db_xref="GI:384141351"
                     /db_xref="GeneID:12115183"
                     /translation="MQLQKAMVNLPSCSCIDISMLLTKLLSKHCYKHKENITMAKQSA
                     GQLFRDAVAQEKPLQVVGTINANHALLAKRAGYKAIYLSGGGVAAGSLGLPDLGISNL
                     DDVLTDVRRITDVCDLPLLVDADTGFGASAFNIARTTKSLIKFGAAAMHIEDQVGAKR
                     CGHRPNKAIVTQEEMVDRIKAAVDARGDDSFVIMARTDALAVEGLQAAIDRAGAYIEA
                     GADMLFPEAITELDMYKQFAQKTGVPILANITEFGSTPLFTTEELASADVSLALYPLS
                     AFRAMNKAAETVYETLRKEGTQKNVVDIMQTRKELYERINYYAFEDYLDNAFAKKK"
     misc_feature    118029..118760
                     /locus_tag="ABZJ_00105"
                     /note="Members of the ICL/PEPM enzyme family catalyze
                     either P-C or C-C bond formation/cleavage. Known members
                     are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate
                     hydrolase (PPH), carboxyPEP mutase (CPEP mutase),
                     oxaloacetate hydrolase (OAH), isocitrate...; Region:
                     ICL_PEPM; cd00377"
                     /db_xref="CDD:119340"
     misc_feature    order(118035..118037,118056..118058,118062..118073,
                     118077..118091,118095..118100,118107..118109,
                     118113..118121,118140..118142,118152..118154,
                     118158..118160,118167..118172,118179..118190,
                     118194..118199,118206..118211,118215..118220,
                     118227..118232,118272..118274,118293..118298,
                     118308..118310,118317..118319,118404..118409,
                     118416..118418,118425..118430,118437..118439,
                     118725..118733,118737..118745,118749..118757)
                     /locus_tag="ABZJ_00105"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119340"
     misc_feature    order(118128..118130,118134..118142,118173..118175,
                     118254..118256,118260..118262,118344..118346,
                     118473..118475,118563..118565,118629..118631,
                     118635..118637,118707..118709)
                     /locus_tag="ABZJ_00105"
                     /note="active site"
                     /db_xref="CDD:119340"
     misc_feature    order(118173..118175,118254..118256,118260..118262,
                     118344..118346)
                     /locus_tag="ABZJ_00105"
                     /note="Mg2+/Mn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:119340"
     gene            119146..120303
                     /locus_tag="ABZJ_00106"
                     /db_xref="GeneID:12115184"
     CDS             119146..120303
                     /locus_tag="ABZJ_00106"
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylcitrate synthase"
                     /protein_id="YP_005524062.1"
                     /db_xref="GI:384141352"
                     /db_xref="GeneID:12115184"
                     /translation="MSSNETTTGFKPKKSVALSGQVAGNTALCTVGRSGNDLHYRGYD
                     ILDLAAGSEFEEVAHLLVHGKLPNKAELKAYKAKLKALRGLPAALKTALEQLPPSAHP
                     MDVMRTGVSVLGCLTPEHEDHNEAGAKDIADKLMASLGSMLLYWYHFSNNGRRIEVET
                     DDDSIAAHFLHLLHGEKPCEEWIQAMHTSLILYAEHEFNASTFTSRVVAGTGSDMYSA
                     ITGGIGALRGPKHGGANEVAFVIQQRYDNPDEAEADIRKRVENKEVVIGFGHPVYTVS
                     DPRNEVIKKVAHDLAQAQENTKMYLIAERLEAVMKEVKNMFPNLDWFSAVSYHLMGVP
                     TAMFTPLFVIARTAGWSAHVIEQRQDGKIIRPSANYTGPENLEFKPLAERG"
     misc_feature    119161..120297
                     /locus_tag="ABZJ_00106"
                     /note="Citrate synthase [Energy production and
                     conversion]; Region: GltA; COG0372"
                     /db_xref="CDD:223449"
     misc_feature    119164..120297
                     /locus_tag="ABZJ_00106"
                     /note="methylcitrate synthase; Provisional; Region:
                     PRK12351"
                     /db_xref="CDD:183463"
     misc_feature    order(119731..119733,119740..119742,119836..119838,
                     119953..119958,119980..119982,120181..120183,
                     120238..120240)
                     /locus_tag="ABZJ_00106"
                     /note="oxalacetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99853"
     misc_feature    order(119731..119733,119740..119742,119833..119838,
                     119935..119940,119944..119958,119980..119982,
                     120100..120102,120181..120183)
                     /locus_tag="ABZJ_00106"
                     /note="citrylCoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99853"
     misc_feature    order(119830..119838,119845..119847,119854..119856,
                     119935..119958,120091..120093,120100..120102,
                     120106..120108,120229..120231)
                     /locus_tag="ABZJ_00106"
                     /note="coenzyme A binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99853"
     misc_feature    order(119836..119838,119953..119955,120106..120108)
                     /locus_tag="ABZJ_00106"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:99853"
     gene            120303..122909
                     /locus_tag="ABZJ_00107"
                     /db_xref="GeneID:12115185"
     CDS             120303..122909
                     /locus_tag="ABZJ_00107"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="YP_005524063.1"
                     /db_xref="GI:384141353"
                     /db_xref="GeneID:12115185"
                     /translation="MNTKYRKPLAGTQLEYYDVRQAVEDIQPGAYEKLPYTSKVLAEQ
                     LVRRADAENLTAYLTQLIERRQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKG
                     GDPSKVNPVVPTQLIVDHSLAVEYGGADPDAFAKNRAVEDRRNEDRFHFIEWTKTAFK
                     NVDVIPAGNGIMHQINLEKMSPVIQARDGVAFPDTCVGTDSHTPHTDALGVISVGVGG
                     LEAENVMLGRASWMRLPDIIGVELVGQRQAGITATDIVLALTEFLRKERVVGAYLEFF
                     GEGADSMSVGDRATISNMTPEYGATAAMFYIDQNTIDYLRLTGREDAQVALVEQYAKE
                     IGLWASEMTKAEYPRVLRFDLSTVTRNIAGPSNPHARVSTSDLKEKGIAGVVENRSDG
                     LMPDGAIIIAAITSCTNTSNPRNTVAAGLLARKANELGLTRKPWVKTSFAPGSKAAAL
                     YLEEAGVLKDLEQLGFGIVAYACTTCNGMSGALDPVIQQEIIDRDLYATAVLSGNRNF
                     DGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIEKDALGHDKEGNPIYLKDIWPSDAEI
                     DALVKEAVKPEQFRKVYIPMFDLGEVEQAKSPLYDWRPQSTYIRRPPYWEGALAAPRT
                     LANMRPLAILGDNITTDHLSPSNAILMDSAAGEYLHKMGVPEEDFNSYATHRGDHLTA
                     QRATFANPKLYNEMVRRSDGTIKQGSKARVEPEGEVMRMWEAIETYMNRKQPLIIIAG
                     ADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFKPGVNRKTLKL
                     DGTELYSVIGNIAPRSTLTLVIERATADGKEEILEVPVTCRLDTEEEVSVYEAGGVLQ
                     RFAQDFLEGQVA"
     misc_feature    120306..122894
                     /locus_tag="ABZJ_00107"
                     /note="2-methylisocitrate dehydratase, Fe/S-dependent;
                     Region: 2met_isocit_dHY; TIGR02333"
                     /db_xref="CDD:131386"
     misc_feature    120528..121910
                     /locus_tag="ABZJ_00107"
                     /note="Aconitase catalytic domain; Aconitase catalyzes the
                     reversible isomerization of citrate and isocitrate as part
                     of the TCA cycle; Region: Aconitase; cl00285"
                     /db_xref="CDD:260326"
     misc_feature    order(120540..120542,120549..120551,120900..120905,
                     121731..121733,121818..121820,121833..121835)
                     /locus_tag="ABZJ_00107"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153129"
     misc_feature    order(120906..120908,121521..121523,121719..121721,
                     121728..121733,121815..121817)
                     /locus_tag="ABZJ_00107"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153129"
     misc_feature    122199..122726
                     /locus_tag="ABZJ_00107"
                     /note="Aconitase swivel domain. Aconitase (aconitate
                     hydratase) catalyzes the reversible isomerization of
                     citrate and isocitrate as part of the TCA cycle. This is
                     the aconitase swivel domain, which undergoes swivelling
                     conformational change in the enzyme...; Region:
                     Aconitase_swivel; cl00215"
                     /db_xref="CDD:260268"
     misc_feature    122541..122549
                     /locus_tag="ABZJ_00107"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238236"
     gene            123068..123334
                     /locus_tag="ABZJ_00108"
                     /db_xref="GeneID:12115186"
     CDS             123068..123334
                     /locus_tag="ABZJ_00108"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524064.1"
                     /db_xref="GI:384141354"
                     /db_xref="GeneID:12115186"
                     /translation="METTNKLDNQAERKLPVKAHLLCGWPLVLMLVGGAIGGALGASA
                     YGINIKIYKSNLSNIAKVLLNLLTGLTAIILMLIAANLIRMYFL"
     gene            123897..124499
                     /locus_tag="ABZJ_00109"
                     /db_xref="GeneID:12115187"
     CDS             123897..124499
                     /locus_tag="ABZJ_00109"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524065.1"
                     /db_xref="GI:384141355"
                     /db_xref="GeneID:12115187"
                     /translation="MMGIKKETVMETILGLCIGVGLSAACGFRVFVPLLVMSIATMMG
                     WFEPSKGFEWLALPSVCLALGVATVCEVAAYYIPWVDNALDTVATPAAMIAGTLATMA
                     VSSGEMSQFASWAAAIIVGGGTAGVVQMSTVAARGVSTATTGGLGNFIVATGEWIGAI
                     LLSVSAMLVPALVAIVVLIAVIWVVRWIRHKKQEQAHTPL"
     misc_feature    123939..124460
                     /locus_tag="ABZJ_00109"
                     /note="Domain of unknown function (DUF4126); Region:
                     DUF4126; pfam13548"
                     /db_xref="CDD:205726"
     gene            124894..125403
                     /locus_tag="ABZJ_00110"
                     /db_xref="GeneID:12115188"
     CDS             124894..125403
                     /locus_tag="ABZJ_00110"
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="YP_005524066.1"
                     /db_xref="GI:384141356"
                     /db_xref="GeneID:12115188"
                     /translation="MTVMLVKPHLKFKESYNNYINELADEDRHPLTTEFDHTDFESFL
                     NKLRDYEKGEFLEEGHVPNITYWLVEGNEIIGASNLRLKLNEQIEYCGGHIGLGIRPS
                     KRGQNFGSKLLELTIQEAWKLGLTELHIHCYKSNLASAKTIQANNGRLHSEITLNQVV
                     QRYVVYKTL"
     misc_feature    124960..125316
                     /locus_tag="ABZJ_00110"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    125089..125286
                     /locus_tag="ABZJ_00110"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(125182..125190,125218..125223)
                     /locus_tag="ABZJ_00110"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            125741..126166
                     /locus_tag="ABZJ_00111"
                     /db_xref="GeneID:12115189"
     CDS             125741..126166
                     /locus_tag="ABZJ_00111"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524067.1"
                     /db_xref="GI:384141357"
                     /db_xref="GeneID:12115189"
                     /translation="MIMTLIEKVVPGVFRKINNNLEILVFRHPLAGIQIVKGTVEHQE
                     QLEYAALRELYEESGIKRAQIHSYLGKHIPSEAGPDWHVFVCSTHEALKDKWSHFCED
                     DNGLTFEFLWHSFLSPPTEEWHPLFKELFEFIKSKYKLN"
     misc_feature    125762..126124
                     /locus_tag="ABZJ_00111"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cl00447"
                     /db_xref="CDD:260427"
     misc_feature    order(125852..125860,125888..125914)
                     /locus_tag="ABZJ_00111"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            complement(126269..126553)
                     /locus_tag="ABZJ_00112"
                     /db_xref="GeneID:12115190"
     CDS             complement(126269..126553)
                     /locus_tag="ABZJ_00112"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524068.1"
                     /db_xref="GI:384141358"
                     /db_xref="GeneID:12115190"
                     /translation="MTIYKPFLALSFVLVSLGISGCNLHTQQEFEKICLSSGHSKTSC
                     ECIYQRLEQTYSPKLMQHLEHVSLQSPVLPRDFAPTFLSTMQRCDKSSLG"
     gene            127223..128452
                     /locus_tag="ABZJ_00113"
                     /db_xref="GeneID:12115191"
     CDS             127223..128452
                     /locus_tag="ABZJ_00113"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="YP_005524069.1"
                     /db_xref="GI:384141359"
                     /db_xref="GeneID:12115191"
                     /translation="MERVVITGMGINSCIGNTLEKVTESLKAGRSGIRYNEVYAKLNF
                     RSHVSATAEMNFENIDPELKKHMGVCAMYAYNSALDALQHAKLDVTDIANNPKYGVIG
                     GTGGTSTASIIDMLHTLKEKGVSEVSPDLAPRYLTSTISSNLSRAFNLKGVSQSVASA
                     CATSADAIGYAYHLIAAGKQDLMLAGGGEEDHWSQTAIFDAMGALCSKYNDAPETASR
                     PYSVDNDGFVIAGGGGMVVLESLSHAQKRGAKILAEVVGYAANSDGVDMVAPSGEGAT
                     RCIKLALAEAKQNGSDTIDYINTHGTSTPAGDIPELLAIERAFGGEEVPPLSSTKSMT
                     GHSLGAAGVHEAIYSILMLQNSFIAPSINITELREEAKKFDIVQTSRETELKTVMSNS
                     FGFGGVNTCLVFRKWEG"
     misc_feature    127223..128449
                     /locus_tag="ABZJ_00113"
                     /note="3-oxoacyl-(acyl carrier protein) synthase I;
                     Reviewed; Region: PRK07967"
                     /db_xref="CDD:181184"
     misc_feature    127229..128434
                     /locus_tag="ABZJ_00113"
                     /note="Beta-ketoacyl-acyl carrier protein (ACP) synthase
                     (KAS), type I and II. KASs are responsible for the
                     elongation steps in fatty acid biosynthesis. KASIII
                     catalyses the initial condensation and KAS I and II
                     catalyze further elongation steps by Claisen...; Region:
                     KAS_I_II; cd00834"
                     /db_xref="CDD:238430"
     misc_feature    order(127535..127537,127556..127561,127571..127573,
                     127577..127582,127616..127618,127634..127636,
                     127646..127648,127658..127660,127676..127678,
                     127682..127684,127688..127696,127730..127732,
                     127739..127744,127751..127753,127811..127816,
                     127823..127828,128003..128017,128051..128053,
                     128408..128410,128414..128416)
                     /locus_tag="ABZJ_00113"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238430"
     misc_feature    order(127703..127705,128120..128122,128228..128230)
                     /locus_tag="ABZJ_00113"
                     /note="active site"
                     /db_xref="CDD:238430"
     gene            complement(128546..129247)
                     /locus_tag="ABZJ_00114"
                     /db_xref="GeneID:12115192"
     CDS             complement(128546..129247)
                     /locus_tag="ABZJ_00114"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase family protein"
                     /protein_id="YP_005524070.1"
                     /db_xref="GI:384141360"
                     /db_xref="GeneID:12115192"
                     /translation="MNNNIIIFGYGTGISKAVAHKFGKEGYKIGLVARNAQKLEKAIL
                     ELKAQGIEAYAFACDLAVLEDIPNLIKRIKDQLGEIKNIHWNAFHDIEGNILETPPLE
                     LTKSFHIRVSSYIATVQACLGDLEKNHGSILSTNGIFAFDAVGIDLVAKEYSSLATTA
                     AAQYKTTNLLAHSLADTNVYVSQVIVNGFVDGRPEAKDKTYAVHPETVAEQFWYLHQH
                     KQETVSLCGEAIQAA"
     misc_feature    complement(128579..129235)
                     /locus_tag="ABZJ_00114"
                     /note="Short-chain alcohol dehydrogenase of unknown
                     specificity [General function prediction only]; Region:
                     COG4221"
                     /db_xref="CDD:226674"
     misc_feature    complement(128597..129229)
                     /locus_tag="ABZJ_00114"
                     /note="Short-chain dehydrogenases/reductases (SDR);
                     Region: SDR; cl21454"
                     /db_xref="CDD:271874"
     misc_feature    complement(order(128681..128692,128759..128761,
                     128771..128773,128810..128815,128843..128845,
                     128984..128992,129140..129148,129206..129208,
                     129212..129217,129221..129223))
                     /locus_tag="ABZJ_00114"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(128759..128761,128771..128773,
                     128810..128812,128912..128914))
                     /locus_tag="ABZJ_00114"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            129490..130080
                     /locus_tag="ABZJ_00115"
                     /db_xref="GeneID:12115193"
     CDS             129490..130080
                     /locus_tag="ABZJ_00115"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005524071.1"
                     /db_xref="GI:384141361"
                     /db_xref="GeneID:12115193"
                     /translation="MCMRTKEFETDEIAEAAMQVFWRRGYAATSVQDLVDGTGLSRSS
                     LYSTFQNKQGLYQKALLRYELLTTLNNVKLLSGSGSAKALIRQLLMRVVEDELNDSEH
                     KGCLVANACLELAGHDEEVSQFVVSNLQKLQHALESLLIKAQQSGEIASTQNPRALAS
                     FFLNTMQGLRVLGKGSPHEQRKQCLMDVVEVALNVL"
     misc_feature    129499..130068
                     /locus_tag="ABZJ_00115"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    129526..129660
                     /locus_tag="ABZJ_00115"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            130278..131012
                     /locus_tag="ABZJ_00116"
                     /db_xref="GeneID:12115194"
     CDS             130278..131012
                     /locus_tag="ABZJ_00116"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524072.1"
                     /db_xref="GI:384141362"
                     /db_xref="GeneID:12115194"
                     /translation="MNTKSNETSHQLTDEFSTQLPIWKLLAFTVAGFLTIMTETMPAG
                     LLTQISQGLRISEAYAGQLIAVYALGSVLAAIPLISLTRSWNRRPLLLSTGHSYKVET
                     ILFIFGISSIVGILITGMFIDRSLRKITLLSLFIFAIATALLGVYSSSSFVVLTGVVL
                     WGITFGGAPTLLQTALANTAGHEADVAQSMLVTVFNLAIAFGGMIGGGLLESFGAASF
                     PWFMLAFALIALCTVYQARKHGFISL"
     misc_feature    <130584..130979
                     /locus_tag="ABZJ_00116"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    <130584..130967
                     /locus_tag="ABZJ_00116"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     gene            131692..132393
                     /locus_tag="ABZJ_00117"
                     /db_xref="GeneID:12115195"
     CDS             131692..132393
                     /locus_tag="ABZJ_00117"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524073.1"
                     /db_xref="GI:384141363"
                     /db_xref="GeneID:12115195"
                     /translation="MENKNQCRQCAVCGKSFPLKDLVSGEVIRNVISDEILKDHPDWS
                     YLSFICRADLADYRIKYVQSLLRSEKGELSNLENEVIGSMQRHELISRNTESDFDQNW
                     TFGEKLADKIASFGGSWAFLICFALFLTGWIVLNTVVMVVRPVDPYPFILLNLVLSCL
                     AAIQAPIIMMSQNRQEAKDRLRSQHDYQINLKAELEIRHLHEKMDHLLSHQWERLAHI
                     QEIQLDLLAEMNKKR"
     misc_feature    131881..132375
                     /locus_tag="ABZJ_00117"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4420"
                     /db_xref="CDD:226844"
     gene            132480..133169
                     /locus_tag="ABZJ_00118"
                     /db_xref="GeneID:12115196"
     CDS             132480..133169
                     /locus_tag="ABZJ_00118"
                     /codon_start=1
                     /transl_table=11
                     /product="putative dual specificity pseudouridine synthase
                     for 23S rRNA and tRNAphe modification (RluA-like)"
                     /protein_id="YP_005524074.1"
                     /db_xref="GI:384141364"
                     /db_xref="GeneID:12115196"
                     /translation="MLHCCFTTMPLNDNFVYAPPQDPLSILFEDDDLIVVDKPAGLLS
                     VMGRLPEHHDSAYLRVLEKFPLAKVTHRLDMATSGLLMFAKHRDAEVAVSKMFQARTV
                     KKHYIALVQGQVKQEGSVEVPLITDWENRPRQIVHFELGKHAKTLFQPLVYDETTDQS
                     RVLLEPVTGRSHQLRVHMMHIGHPIMGDKLYHPEPKRFHLNRMALHAAYLAFQHPLKG
                     TDVVIESQVPF"
     misc_feature    <132534..133166
                     /locus_tag="ABZJ_00118"
                     /note="Pseudouridylate synthases, 23S RNA-specific
                     [Translation, ribosomal structure and biogenesis]; Region:
                     RluA; COG0564"
                     /db_xref="CDD:223638"
     misc_feature    132576..133115
                     /locus_tag="ABZJ_00118"
                     /note="Pseudouridine synthase, RsuA/RluD family; Region:
                     PseudoU_synth_RluCD_like; cd02869"
                     /db_xref="CDD:211346"
     misc_feature    order(132690..132701,133002..133004)
                     /locus_tag="ABZJ_00118"
                     /note="active site"
                     /db_xref="CDD:211346"
     gene            133280..133654
                     /locus_tag="ABZJ_00119"
                     /db_xref="GeneID:12115197"
     CDS             133280..133654
                     /locus_tag="ABZJ_00119"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524075.1"
                     /db_xref="GI:384141365"
                     /db_xref="GeneID:12115197"
                     /translation="MNRDYEQFPDDDNGNVLWQMVEDGDDLTELHEIEFSIAFQDQQN
                     AEQCAMHLLYQEQKISLFQDDSVEPNEWIITIFVTMEPEYSDIVDLEQWFSTIAEQFN
                     GEYDGWGCMAYVFDEEEDDILQ"
     misc_feature    133304..133609
                     /locus_tag="ABZJ_00119"
                     /note="Regulator of ribonuclease activity B; Region: RraB;
                     pfam06877"
                     /db_xref="CDD:253957"
     gene            133683..134063
                     /locus_tag="ABZJ_00120"
                     /db_xref="GeneID:12115198"
     CDS             133683..134063
                     /locus_tag="ABZJ_00120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524076.1"
                     /db_xref="GI:384141366"
                     /db_xref="GeneID:12115198"
                     /translation="MSLSQKEIAVRFLELAAAGEVDEAYGNYTAPNFKHHNPYYAGDK
                     ISLKEGMRESAIETPNKVLEVQHVIEDGALVAVHSKLEMQMNNKLTILAVVHICRFEN
                     EKIAEFWDIGQIQPDPLVNENGMF"
     misc_feature    133713..134006
                     /locus_tag="ABZJ_00120"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            complement(134108..136198)
                     /locus_tag="ABZJ_00121"
                     /db_xref="GeneID:12115199"
     CDS             complement(134108..136198)
                     /locus_tag="ABZJ_00121"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ferric siderophore receptor protein"
                     /protein_id="YP_005524077.1"
                     /db_xref="GI:384141367"
                     /db_xref="GeneID:12115199"
                     /translation="MRHKLGLLSSLGLSFISTLTWGEETSTVLETIRVQAESTREDVS
                     QNSSATKFTHDVLDVPFNRAYLSKQIMEQQDVQRIDDALTLVSGVFHQNSFGGGFWDN
                     YSFRGFSTDPNLGAAMIRNGLSVNRGISAPKDVVNIESLEFLKGPMAALYGRGETGGL
                     LNLNSKKPQWESESELNLRANTQEQYRISLEHTAPINDELAYRLAVAHEDNQSFRDHV
                     SSERWFFSPQLTWKISDQTQLDFDSEFTEHKGTFDRGVSTVNHQFVMDPKTFTGEPDD
                     GDLKIKDYFYQLRLSHEFNPDWKLNSAVSYKDAQMVGFATEPRRMQADGRTLERQRRY
                     RDYTSEDVLAQTELLGKIDTSWARHEILLSTELGQLDYKQNQLRRNHSTDSPNTIDIY
                     QPKYGKYLPNLTPFTDTKERQRYFALNVQDQIFFNDQWSVLFGNRFDQVEQDFKNHIK
                     QTEDNQTLHQNSPRFGVNFKASEQWAFYSNYGRSFAMNSGMNRNGQTFAPEKGESYEV
                     GTKYKINDQSVLSLALFKMKKRNVLTTDPIDSNFQTAAGEVSSKGVEFDLNSQINDRW
                     FVNANYSYTDAQIEKDQGLAKGARLSNVPKHQGSVSTNYEFLQDGARKAGVGANLTYV
                     GERSGHNLDNGFNLPSYTLVNLNGYYAPSGRLRYQLNVNNLFDKTYYVSSYSDLWVQP
                     GEPLNASISAQWKF"
     misc_feature    complement(134111..136027)
                     /locus_tag="ABZJ_00121"
                     /note="TonB-dependent siderophore receptor; Region:
                     TonB-siderophor; TIGR01783"
                     /db_xref="CDD:233575"
     misc_feature    complement(134111..136003)
                     /locus_tag="ABZJ_00121"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(135704..135730,135764..135796,
                     135845..135856,135875..135892,135929..135958,
                     135986..136003))
                     /locus_tag="ABZJ_00121"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(135179..135181,135266..135268))
                     /locus_tag="ABZJ_00121"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            136274..137419
                     /locus_tag="ABZJ_00122"
                     /db_xref="GeneID:12115200"
     CDS             136274..137419
                     /locus_tag="ABZJ_00122"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524078.1"
                     /db_xref="GI:384141368"
                     /db_xref="GeneID:12115200"
                     /translation="MSLEKNIERLQSIDALRGLVIIIMLLDHVRETFYLHKQVTDPMD
                     VTVTEPALFGSRLLAHICAPVFVLLTGISAFLFQSKKQDLQQTRAFLLKRGLFLIVLE
                     LTLVNFAWTATFPPEVIYLQVIWAIGISMVVLACCVSLPLPILAGVALVIIFGHNLLD
                     SVHFSQGILQNIWFVLHERGWLEFAGIKLRTSYPVLPWIGVILLGYVLGQFFSSKYSA
                     KQRSRALLSLGLASIGLFVLLRLINIYGDQPWQHFESLQLTLMSFFNLTKYPPSLLFI
                     LLNVGIGLLVLVAFERMQQYSFLKPLVVFGSVPMFFYLLHLYVLKLMYVFALSVWGAN
                     YGNYLSVNHVWMLWLITIVLSFVLYPAVKWFSKFKHQNKHISILKYF"
     misc_feature    136277..137287
                     /locus_tag="ABZJ_00122"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3503"
                     /db_xref="CDD:226034"
     gene            complement(137460..137927)
                     /locus_tag="ABZJ_00123"
                     /db_xref="GeneID:12115201"
     CDS             complement(137460..137927)
                     /locus_tag="ABZJ_00123"
                     /codon_start=1
                     /transl_table=11
                     /product="branched chain amino acid ABC transporter"
                     /protein_id="YP_005524079.1"
                     /db_xref="GI:384141369"
                     /db_xref="GeneID:12115201"
                     /translation="MRPLDRIDRMILDILQREGRIAISELASRVNLSTTPCSERVKRL
                     ERDGIIMGYYARLNPAYVDRNLLVFLEIKLSAKSGDVFDQVARDLVEIPEVLECHLIS
                     GEFDYLVKARLKEMSAYRRLLGDLLKKLPASASSHSYVVMEEVKETLYLDVSK"
     misc_feature    complement(137472..137927)
                     /locus_tag="ABZJ_00123"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    complement(<137778..137915)
                     /locus_tag="ABZJ_00123"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(137790..137795,137799..137804,
                     137811..137816,137820..137831,137856..137864,
                     137904..137912))
                     /locus_tag="ABZJ_00123"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(137853..137855,137862..137864))
                     /locus_tag="ABZJ_00123"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(137496..137720)
                     /locus_tag="ABZJ_00123"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            138046..139329
                     /locus_tag="ABZJ_00124"
                     /db_xref="GeneID:12115202"
     CDS             138046..139329
                     /locus_tag="ABZJ_00124"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/D-amino acid oxidase (deaminating)"
                     /protein_id="YP_005524080.1"
                     /db_xref="GI:384141370"
                     /db_xref="GeneID:12115202"
                     /translation="MREGMEMRVIVLGSGVIGVASAYYLARQGAEVTVLDRQSGPAEE
                     TSFGNAGQISPGYSTPWAAPGIPFKAVKWMFQHHAPLAINLDGSMWQLQWMAQMLKNC
                     NPQSYAVNKERMMRVAEYSRDCLRELRKDTGIHYENRAKGTLQLFRKEAQMEAVQRDI
                     SVLEECGVSYELLNGNELGRVEPALANAQDKLVGGLHLPNDETGDCYLFTNALAQIAK
                     ELGVNFQFNQNVEKLIVEGDQIKGVQVNGKVLTADRYVLAFGSYSRDFLKPLDLQLPV
                     YPVKGYSLTIPIVDPAFAPQSTVLDETYKIAITRFDQRIRVGGMAELSGFNLGLNEDR
                     RATLQMVTQDLFPGGDMEQASFWTGLRPMTPDSTPIIGATRFKNLFLNTGHGTLGWTM
                     ACGSGKLISDIVLNHKTDISTDGLSIQRYSHAHAA"
     misc_feature    138058..>138156
                     /locus_tag="ABZJ_00124"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    138064..139308
                     /locus_tag="ABZJ_00124"
                     /note="D-amino acid dehydrogenase small subunit;
                     Validated; Region: PRK00711"
                     /db_xref="CDD:234819"
     misc_feature    138112..139263
                     /locus_tag="ABZJ_00124"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            139350..140453
                     /locus_tag="ABZJ_00125"
                     /db_xref="GeneID:12115203"
     CDS             139350..140453
                     /locus_tag="ABZJ_00125"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase 2, PLP-binding, catabolic"
                     /protein_id="YP_005524081.1"
                     /db_xref="GI:384141371"
                     /db_xref="GeneID:12115203"
                     /translation="MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIE
                     RVYEAFKAADGFALLDIEEAKRIRALGWTGPILLLEGVFSPQDLFDCVQYQLSFTIHS
                     EAQIEWVEQHPYPAQFDVFLKMNSGMNRLGFKPQHYVQAWERLNNLANVAKITHMMHF
                     SDADGDRFGQQGIDYQITAFEEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLY
                     GSSPDYPTHSIADWGLQPTMSLRSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACG
                     YADGYQRISPTGTPVLVDSVRTRTVGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTG
                     VILPIDDVAVSSGTVGYELMCAVTARVQFINQV"
     misc_feature    139356..140441
                     /locus_tag="ABZJ_00125"
                     /note="alanine racemase; Reviewed; Region: dadX; PRK03646"
                     /db_xref="CDD:179622"
     misc_feature    139359..140441
                     /locus_tag="ABZJ_00125"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzymes, Proteobacterial Alanine Racemases; Region:
                     PLPDE_III_AR_proteobact; cd06827"
                     /db_xref="CDD:143500"
     misc_feature    order(139446..139448,139452..139454,139464..139466,
                     139584..139586,139716..139718,139737..139739,
                     139818..139820,139824..139826,139932..139940,
                     139983..139994,140400..140402)
                     /locus_tag="ABZJ_00125"
                     /note="active site"
                     /db_xref="CDD:143500"
     misc_feature    order(139446..139448,139452..139454,139464..139466,
                     139584..139586,139824..139826,139932..139937,
                     139983..139985,139989..139994,140400..140402)
                     /locus_tag="ABZJ_00125"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143500"
     misc_feature    order(139452..139454,139464..139466,139737..139739,
                     139824..139826,140400..140402)
                     /locus_tag="ABZJ_00125"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143500"
     misc_feature    order(139452..139454,140121..140123)
                     /locus_tag="ABZJ_00125"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143500"
     misc_feature    order(140082..140084,140091..140093,140109..140114,
                     140118..140126,140163..140165,140178..140180,
                     140196..140198,140262..140264,140268..140270,
                     140394..140396,140400..140405,140418..140420,
                     140427..140429)
                     /locus_tag="ABZJ_00125"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143500"
     gene            140413..140823
                     /locus_tag="ABZJ_00126"
                     /db_xref="GeneID:12115204"
     CDS             140413..140823
                     /locus_tag="ABZJ_00126"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524082.1"
                     /db_xref="GI:384141372"
                     /db_xref="GeneID:12115204"
                     /translation="MPSPPVFNLLIRYKEIRMSNSDIQKINTNEVMSAVTVFNKVVYL
                     SGQVPKNTEQDVAGQTREILATIEELLALANTDKSRLLSAQLYLKNLSDFSTVNAIWV
                     DWLKGCVAPSRATIQADLVNPDWLIEIAVTAAQK"
     misc_feature    140506..140814
                     /locus_tag="ABZJ_00126"
                     /note="This group of proteins belong to a large family of
                     YjgF/YER057c/UK114-like proteins present in bacteria,
                     archaea, and eukaryotes with no definitive function.  The
                     conserved domain is similar in structure to chorismate
                     mutase but there is no sequence...; Region:
                     YjgF_YER057c_UK114_like_2; cd06150"
                     /db_xref="CDD:100007"
     misc_feature    order(140506..140511,140518..140520,140524..140526,
                     140533..140535,140539..140541,140545..140550,
                     140650..140652,140656..140661,140665..140667,
                     140671..140673,140704..140706,140713..140715,
                     140725..140727,140740..140766,140794..140796,
                     140800..140802,140806..140808)
                     /locus_tag="ABZJ_00126"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100007"
     misc_feature    order(140506..140508,140692..140694,140704..140706,
                     140749..140751,140794..140796)
                     /locus_tag="ABZJ_00126"
                     /note="putative active site [active]"
                     /db_xref="CDD:100007"
     gene            140985..142424
                     /locus_tag="ABZJ_00127"
                     /db_xref="GeneID:12115205"
     CDS             140985..142424
                     /locus_tag="ABZJ_00127"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid APC transporter"
                     /protein_id="YP_005524083.1"
                     /db_xref="GI:384141373"
                     /db_xref="GeneID:12115205"
                     /translation="MTTARHSDTENSPDHLQRKLSNRHLQLIAIGGAIGTGLFMGSGK
                     TISLAGPSILFIYMIIGGMFFFLMRAMGELLLANLHYKSFVDMAHDLIGPWAGYYLGW
                     TYWLGWVLVGIADLSAVINYLSFWLPDGASFSPIQQAMISAGCVLFVMGLNLLTVRLF
                     GEIEFWFALIKILAIIGLIGVGGYMIFSHFQAPQGAVASISNVWSHGGLFPKGTEGFL
                     AGFQIAVFAFVGVELVGTTAAETKDPQKNLPKAINAIPVRIILFYVLALFIVMSVTPW
                     DHIRADKSPFVELFLNAGIPVSAIIMNLVVLSSVMSSMNSGVFSTSRMLFGLSKDGQA
                     PGAFGRLSKRAVPSNGLIFSCTFIMGGAVLQYFVPNTMEAFTLASSLCVILFISVWSL
                     IMVCYLRYRKLRPELHEKSTFKMPGGIWMSYVVLAFMLFTLVILALEPDTLKALYVSP
                     VWLIILGVTYHVLYKPRMKRLGRELVNDH"
     misc_feature    140997..142394
                     /locus_tag="ABZJ_00127"
                     /note="D-alanine/D-serine/glycine permease; Provisional;
                     Region: PRK11049"
                     /db_xref="CDD:236830"
     misc_feature    141264..142304
                     /locus_tag="ABZJ_00127"
                     /note="Solute carrier families 5 and 6-like; solute
                     binding domain; Region: SLC5-6-like_sbd; cl00456"
                     /db_xref="CDD:271490"
     gene            complement(143332..143778)
                     /locus_tag="ABZJ_00128"
                     /db_xref="GeneID:12115206"
     CDS             complement(143332..143778)
                     /locus_tag="ABZJ_00128"
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase ORF 2"
                     /protein_id="YP_005524084.1"
                     /db_xref="GI:384141374"
                     /db_xref="GeneID:12115206"
                     /translation="MVGRVKLYISALQLENGELLLVVSPQFNANAIQDYALRWEIETL
                     FSCLKGRGFNLENTRLTDPRRVKKLIAVLAISFCWCYLTGEWQHDQKKAIKIKKHGRL
                     SMSLFRYGLDYVQMAIQRLIGFGKKEEFKEILAILRRQNPDRIRVL"
     misc_feature    complement(143542..>143676)
                     /locus_tag="ABZJ_00128"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(143853..144422)
                     /locus_tag="ABZJ_00129"
                     /db_xref="GeneID:12115207"
     CDS             complement(143853..144422)
                     /locus_tag="ABZJ_00129"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase 1"
                     /protein_id="YP_005524085.1"
                     /db_xref="GI:384141375"
                     /db_xref="GeneID:12115207"
                     /translation="MTHLNELYLILNKSLKWNKSHLKCFALIMLVIILKQTCNLSSAS
                     KALPIKCLPQSFYRRMQRFFAGQYFDYRQISQLIFNMFSFDQVQLTLDRTNWKWGKRN
                     INILMLAIVYRGIAIPILWTLLNKRGNSDTKERIALIQRFIAIFGKDRIVNVFADREF
                     IGEQWFTWLIEQDINFCIRVKKTSLSPII"
     misc_feature    complement(<143871..>143978)
                     /locus_tag="ABZJ_00129"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(145472..146383)
                     /locus_tag="ABZJ_00130"
                     /db_xref="GeneID:12115208"
     CDS             complement(145472..146383)
                     /locus_tag="ABZJ_00130"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005524086.1"
                     /db_xref="GI:384141376"
                     /db_xref="GeneID:12115208"
                     /translation="MQICTGTITKMKVDWDHLQFFLVLARTKTLTNAARIIGVEHSTV
                     ARRIQALELALGTTLFKREATGYELTLEGLALVPRVEQMEQAFLQIEKPHQPLQGRVR
                     IGTPEGFGTAFLARLLAEFSIQYPLLTIDLIPVPKMIKLSHREADIVVSIERPTSGPY
                     IITRLSDYCLKIYGSQNYLAQNPPIRRLEDLTQHRFVNYIDDLVYSPELYCLERLPLK
                     LNANFRSSSILAQQIAVSAGAGLAILPKFLADDKPELEEVLEQQVRFTHTFWMLTFVD
                     LQHEPRIKLVWDYLRKQADKYQHLLVD"
     misc_feature    complement(145490..146344)
                     /locus_tag="ABZJ_00130"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(146165..146341)
                     /locus_tag="ABZJ_00130"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(145514..146089)
                     /locus_tag="ABZJ_00130"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(145673..145678,145682..145687,
                     145703..145720,145982..146002,146006..146008,
                     146018..146020,146027..146032,146036..146041))
                     /locus_tag="ABZJ_00130"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            146501..148036
                     /locus_tag="ABZJ_00131"
                     /db_xref="GeneID:12115209"
     CDS             146501..148036
                     /locus_tag="ABZJ_00131"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate-semialdehyde dehydrogenase,
                     oxidoreductase protein"
                     /protein_id="YP_005524087.1"
                     /db_xref="GI:384141377"
                     /db_xref="GeneID:12115209"
                     /translation="MTYGEVMNTIQKIELDTAKLLINGQFIESKTQEWQDIVNPATQE
                     VIGRVPFATVEEVDAAIQAAQDAFASWRQTPIQARMRIMLKLQDLIRANMKEIAQVLT
                     AEQGKTLADAEGDIQRGLEVVEHACSVGTLQMGEYVEGVARGVDTYTLQQPLGVCAGI
                     TPFNFPAMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMMLVELAIQAGIPAGVLNVVHG
                     GKEVVDHLCTHKDIKAISFVGSTAVGTHVYNLAGQHGKRVQAMMGAKNHVVVMPDANK
                     EQTLNALVGAAFGAAGQRCMALSVAVMVGDSKQWIQELVEKAKTLKVNAGHEPNTDIG
                     PVISKRAKARVIDLINSGVEQGAELLLDGRNVQVQGYESGNFVGATIFSGVNTDMRIY
                     KEEIFGPVLSIICVDTLDEAIALINANPFGNGVGLFTQSGAIARTFQNLIDIGQVGIN
                     IPIPVPVPFFSFTGSRGSKLGDLGPYGKQAVQFYTQTKTITSRWFEDSHEVGGVNTTI
                     SLR"
     misc_feature    146555..147982
                     /locus_tag="ABZJ_00131"
                     /note="Methylmalonate semialdehyde dehydrogenase and ALDH
                     family members 6A1 and 6B2; Region: ALDH_F6_MMSDH;
                     cd07085"
                     /db_xref="CDD:143404"
     misc_feature    order(146723..146725,146729..146731,146741..146743,
                     146750..146752,146762..146764,146861..146863,
                     146870..146875,146900..146923,146936..146938,
                     146945..146947,146954..146956,147233..147235,
                     147245..147247,147254..147256,147263..147265,
                     147269..147271,147788..147790,147794..147799,
                     147803..147808,147815..147817,147824..147829,
                     147833..147835,147839..147850,147875..147877,
                     147887..147889,147893..147895,147935..147937,
                     147956..147973,147977..147982)
                     /locus_tag="ABZJ_00131"
                     /note="tetrameric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143404"
     misc_feature    order(146981..146992,147014..147016,147059..147061,
                     147068..147070,147158..147160,147209..147220,
                     147227..147229,147281..147289,147383..147385,
                     147683..147685,147689..147691,147767..147769)
                     /locus_tag="ABZJ_00131"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143404"
     misc_feature    order(146990..146992,147281..147283,147374..147376,
                     147383..147385)
                     /locus_tag="ABZJ_00131"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143404"
     gene            148048..148938
                     /locus_tag="ABZJ_00132"
                     /db_xref="GeneID:12115210"
     CDS             148048..148938
                     /locus_tag="ABZJ_00132"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyisobutyrate dehydrogenase"
                     /protein_id="YP_005524088.1"
                     /db_xref="GI:384141378"
                     /db_xref="GeneID:12115210"
                     /translation="MNIAFIGLGNMGGRMAQNLLKAGLKVYGYDLSEVAIQHFAEAGG
                     IVCDSPQNAAKQADVVITMLPAAKHVKEVYLGENGVLEVLKAGSLCIDSSTIDPQTIK
                     DIAAVAQSKNIKICDAPVSGGTIGAQAGTLTFMVGADEQTFNELKPVLSHMGKNIVHC
                     GDVGAGQIAKICNNLILGISMAAVAEGMALGVKLGIDPQALAGVINTSSGRCWSSDVC
                     NPWPYINENAPASRGYQDGFATQLMLKDLGLAVEAAGQVKQPVLLGGMVQQLYQQMCM
                     RGNAHLDFSSIIQQYLPQEA"
     misc_feature    148048..148527
                     /locus_tag="ABZJ_00132"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    148060..148920
                     /locus_tag="ABZJ_00132"
                     /note="3-hydroxyisobutyrate dehydrogenase; Region: HIBADH;
                     TIGR01692"
                     /db_xref="CDD:130753"
     misc_feature    148537..148920
                     /locus_tag="ABZJ_00132"
                     /note="NAD-binding of NADP-dependent 3-hydroxyisobutyrate
                     dehydrogenase; Region: NAD_binding_11; pfam14833"
                     /db_xref="CDD:258970"
     gene            149020..150669
                     /locus_tag="ABZJ_00133"
                     /db_xref="GeneID:12115211"
     CDS             149020..150669
                     /locus_tag="ABZJ_00133"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyl-CoA synthetase/AMP-(fatty) acid
                     ligase"
                     /protein_id="YP_005524089.1"
                     /db_xref="GI:384141379"
                     /db_xref="GeneID:12115211"
                     /translation="MMDYQNAVQAFDLESTAKQMLSGSLDALNACYECCDRHADGDKI
                     ALYWQGKDGRKEQYTFRELKEWSSQFANFLKSQGVKAGDRISGLLPRTPELIVTILAA
                     WRIGAVYQPLFTAFGPKAIEHRIQLAQSKLVVTDMGNRSKLDEIEKCPAIMTVADAQG
                     TPLKAGDFNFWNEVKQQSDQCDLVMRNIQDPFLLMFTSGTTGPAKPLEVPLKALIAFG
                     RYMQDAIGLTEEDSFWNIADPGWAYGLYYAITGPLFLGHATLFYEGGFSTDSLCQIVK
                     DYKVNNLAGAPTAYRMMMAADPAQMAPLKGQFRVVSSAGEPLNPEVIRWFKQVLDAPI
                     YDHYGQTEVGMVVCNHHGLKHEIHAGSAGFPSPGYRVAIVNEQGEELPPDTPGILAVD
                     ISQSPMMWFGGYKESRKSPFISHYYLTGDTAELHADGSMSFVGRSDDVITTSGYRIGP
                     FDVESALLEHDAVIEAAVIGVPDPDRTEVVKAFVILAAGVQPSDALAEELSQFVKRRL
                     SAHAYPRLVEFVSELPKTPSGKIQRFLLRNQEIAKQQAKAG"
     misc_feature    149101..150651
                     /locus_tag="ABZJ_00133"
                     /note="Acyl-coenzyme A synthetases/AMP-(fatty) acid
                     ligases [Lipid metabolism]; Region: Acs; COG0365"
                     /db_xref="CDD:223442"
     misc_feature    149191..150633
                     /locus_tag="ABZJ_00133"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    order(149599..149601,149608..149625,149629..149634)
                     /locus_tag="ABZJ_00133"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    order(149608..149610,149959..149964,150025..150042,
                     150280..150282,150316..150318,150325..150327,
                     150358..150360,150607..150609)
                     /locus_tag="ABZJ_00133"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    order(149608..149610,149728..149733,149875..149877,
                     149881..149886,149893..149895,149959..149964,
                     150025..150042,150280..150282,150316..150318,
                     150325..150327,150349..150360,150550..150552)
                     /locus_tag="ABZJ_00133"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    order(149728..149730,149881..149886,149893..149895,
                     149959..149961,150349..150357,150532..150534,
                     150550..150552)
                     /locus_tag="ABZJ_00133"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            150681..151808
                     /locus_tag="ABZJ_00134"
                     /db_xref="GeneID:12115212"
     CDS             150681..151808
                     /locus_tag="ABZJ_00134"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="YP_005524090.1"
                     /db_xref="GI:384141380"
                     /db_xref="GeneID:12115212"
                     /translation="MQFTEEQLLIRDMAKSFAQEQIKPNASDWDRDGTFPKETLTQMG
                     QLGFMGMLVSEEWGGSDTGNLAYVLALEEVAAADGATSTIMSVHNSVGCVPILKFGTD
                     EQKERFLKPLAQGEMIGAFALTEPHTGSDAAAIKTRAVKDGDDYILNGAKQFITSGNN
                     AGVIIVFAVTDPSAGKKGISAFLVPRETPGYEVIRVEEKLGLHASDTCQIALTDVRIH
                     KSLMLGKEGEGLKIALANLEGGRIGIAAQAVGLARAALEEATRYAKERITFGKPIFEH
                     QTIAFRLASMATEIEAARQLVHYAARLKEAGQPCLNEASMAKLFASEMTERVCSSALQ
                     VFGGYGYLRDFPIERIYRDARICQIYEGTSDIQRLVIARSL"
     misc_feature    150681..151805
                     /locus_tag="ABZJ_00134"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    150693..151805
                     /locus_tag="ABZJ_00134"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:271680"
     misc_feature    order(150951..150953,151041..151043,151047..151049,
                     151140..151142,151146..151148,151755..151763,
                     151767..151769,151773..151775)
                     /locus_tag="ABZJ_00134"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            151830..152603
                     /locus_tag="ABZJ_00135"
                     /db_xref="GeneID:12115213"
     CDS             151830..152603
                     /locus_tag="ABZJ_00135"
                     /codon_start=1
                     /transl_table=11
                     /product="FadB1x"
                     /protein_id="YP_005524091.1"
                     /db_xref="GI:384141381"
                     /db_xref="GeneID:12115213"
                     /translation="MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLE
                     KDCEIGCIVLAGSEKAFAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVS
                     GYALGGGCELALMCDFIYCADNAKFGLPEVTLGVIPGIGGTQRLTHAIGKAKAMEMCL
                     TARQMGAVEAEQSGLVARVFSKEELLEQTLQAAEKIAARSLTANMMLKETINRAFEVN
                     LTEGLRFERRMFHSIFATADQKEGMQAFVEKRQANFKNQ"
     misc_feature    151830..152600
                     /locus_tag="ABZJ_00135"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK05862"
                     /db_xref="CDD:180295"
     misc_feature    151845..152417
                     /locus_tag="ABZJ_00135"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(151902..151904,151908..151910,152004..152006,
                     152016..152030,152139..152141,152145..152153,
                     152217..152222,152229..152231)
                     /locus_tag="ABZJ_00135"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(152022..152024,152151..152153)
                     /locus_tag="ABZJ_00135"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(152091..152093,152115..152117,152178..152189,
                     152223..152234,152250..152252,152256..152264,
                     152268..152273,152286..152291,152295..152300,
                     152304..152309,152316..152318,152349..152351,
                     152358..152360,152403..152405,152412..152417)
                     /locus_tag="ABZJ_00135"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            152616..153641
                     /locus_tag="ABZJ_00136"
                     /db_xref="GeneID:12115214"
     CDS             152616..153641
                     /locus_tag="ABZJ_00136"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/carnithine racemase"
                     /protein_id="YP_005524092.1"
                     /db_xref="GI:384141382"
                     /db_xref="GeneID:12115214"
                     /translation="MNTENHLMIERQGKLGVITLDRVTHLNALSLDMIEGIGAQLELW
                     RNDAAVQAILIKSNSPKAFCAGGDIRYLYDSYKNGTADYKGYFSAEYKMLNTLREYEK
                     PIIVVLDGYVLGGGFGLAQACHIVVSSEKSRFAMPETAIGFFPDVGATHFLSRLDDIG
                     VYMAITGEQISSSDALYLDLIDYHVPSDQLQALQDALVEAPSLSKEGIEHIITRFITR
                     PAESELKQLAEGIRKHFGYQHLDEIEQSLENEQDESLKTWASKMLSILQQRSFIAKQT
                     SLKLQHLGRGLSLQQCMQLERDLQDIWFEHGDFIEGVRALIVDKDKQPRWQERNPELE
                     QILEKLS"
     misc_feature    152622..153596
                     /locus_tag="ABZJ_00136"
                     /note="3-hydroxyisobutyryl-CoA hydrolase; Provisional;
                     Region: PRK05617"
                     /db_xref="CDD:235533"
     misc_feature    152640..153212
                     /locus_tag="ABZJ_00136"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(152691..152693,152697..152699,152796..152798,
                     152808..152822,152946..152948,152952..152960,
                     153024..153029,153036..153038)
                     /locus_tag="ABZJ_00136"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(152814..152816,152958..152960)
                     /locus_tag="ABZJ_00136"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(152898..152900,152922..152924,152985..152996,
                     153030..153041,153057..153059,153063..153071,
                     153075..153080,153099..153101,153105..153110,
                     153117..153119,153150..153152,153159..153161,
                     153204..153206)
                     /locus_tag="ABZJ_00136"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    153285..153596
                     /locus_tag="ABZJ_00136"
                     /note="2-enoyl-CoA Hydratase C-terminal region; Region:
                     ECH_C; pfam13766"
                     /db_xref="CDD:258052"
     gene            153758..155113
                     /locus_tag="ABZJ_00137"
                     /db_xref="GeneID:12115215"
     CDS             153758..155113
                     /locus_tag="ABZJ_00137"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS family transporter"
                     /protein_id="YP_005524093.1"
                     /db_xref="GI:384141383"
                     /db_xref="GeneID:12115215"
                     /translation="MMQTIHGNGSHPKKSSHRLAGISSMVGTTIEWYDFFVYGAAAAL
                     IFNKLFFPNLDPLTGVLAAFATYAVGFIGRPLGGLVFGHFGDKIGRKSMLLLTLMLMG
                     IPTVLIGLLPTYESIGYWAAIGLVVLRFIQGMAMGGEWGGAVLMAVEHAPEGGKGFWG
                     SLPQASTGGGLMLASIALGLVSLLPEQALFSWGWRLPFLASIILLAVGWYIRVKVPES
                     PDFEKVKQQSEEVKVPAFQVFKNHPKQLITIILARAAENAWFYIASTFTLAYTTTQLG
                     IPRQDILFATICGAAVILFMTPLCGHLSDKVGQRNMFMFGLCVLALYSYPFFSMLNTK
                     DPVLVWTAIVLAIGVVFPIMYAPQAQLFARQFPAEIRYSGISISVQLAGVLGGGLAPM
                     IATKLLSIGQGNPYLIMFYIGSMAVVAIISTSFMPRDWSYKKDETYYKKENLNLKTKI
                     D"
     misc_feature    153830..155038
                     /locus_tag="ABZJ_00137"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    153836..155014
                     /locus_tag="ABZJ_00137"
                     /note="metabolite-proton symporter; Region: 2A0106;
                     TIGR00883"
                     /db_xref="CDD:233168"
     misc_feature    order(153860..153862,153869..153877,153881..153886,
                     153956..153958,153965..153970,153977..153979,
                     153989..153994,153998..154003,154163..154168,
                     154175..154180,154187..154192,154199..154201,
                     154235..154240,154247..154252,154268..154270,
                     154526..154528,154535..154540,154547..154552,
                     154559..154561,154601..154603,154613..154615,
                     154625..154627,154634..154636,154646..154648,
                     154799..154801,154808..154813,154820..154822,
                     154832..154837,154844..154846,154877..154882,
                     154892..154897,154904..154909,154916..154918)
                     /locus_tag="ABZJ_00137"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(155206..155757)
                     /locus_tag="ABZJ_00138"
                     /db_xref="GeneID:12115216"
     CDS             complement(155206..155757)
                     /locus_tag="ABZJ_00138"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acyl-L-homoserine lactone synthetase"
                     /protein_id="YP_005524094.1"
                     /db_xref="GI:384141384"
                     /db_xref="GeneID:12115216"
                     /translation="MNIIAGFQNNFSEGLYTKFKSYRYRVFVEYLGWELNCPNNEELD
                     QFDKVDTAYVVAQDRESNIIGCARLLPTTQPYLLGEIFPQLLNGMPIPCSPEIWELSR
                     FSAVDFSNPPSSNSQAVSSPVSIAILQEAINFAREQGAKQLITTSPLGVERLLRAAGF
                     RAHRAGPPMTIDGYSMFACLIDI"
     misc_feature    complement(155209..155694)
                     /locus_tag="ABZJ_00138"
                     /note="Autoinducer synthetase; Region: Autoind_synth;
                     cl17404"
                     /db_xref="CDD:247958"
     gene            complement(155836..156252)
                     /locus_tag="ABZJ_00139"
                     /db_xref="GeneID:12115217"
     CDS             complement(155836..156252)
                     /locus_tag="ABZJ_00139"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524095.1"
                     /db_xref="GI:384141385"
                     /db_xref="GeneID:12115217"
                     /translation="MVSIPPHFSISTDGFIRMNENQLMSYPLQHIISTVESRHTEASQ
                     IFYYGFTEWATSQTPALSTGWDWELIENNGITTVKRVGLPRSNIMIVDVSGMDIGFDI
                     NETLLEKKIDTLFWEPFIYAQINTSLTKSSLSQTFS"
     gene            157012..157728
                     /locus_tag="ABZJ_00140"
                     /db_xref="GeneID:12115218"
     CDS             157012..157728
                     /locus_tag="ABZJ_00140"
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer-binding transcriptional regulator"
                     /protein_id="YP_005524096.1"
                     /db_xref="GI:384141386"
                     /db_xref="GeneID:12115218"
                     /translation="MESWQEDLLSAFLVVKNEYQLFEIVKSTASRLGFDYCAYGMQSP
                     LSIAEPKTIMLNNYPEAWQKRYVERQYVKIDPTVQHCMVSLQPLVWSSQSAKTQAEKD
                     FWEEARSYGLNVGWAQSSRDFIGTRGMLTLARSNDQLSEKEQKAQYTNMYWLTQTVHS
                     SIAKIVNDVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQ
                     KLNVNNKISAAIRAVMLGLL"
     misc_feature    157018..157725
                     /locus_tag="ABZJ_00140"
                     /note="DNA-binding transcriptional activator SdiA;
                     Provisional; Region: PRK10188"
                     /db_xref="CDD:182292"
     misc_feature    157069..157497
                     /locus_tag="ABZJ_00140"
                     /note="Autoinducer binding domain; Region: Autoind_bind;
                     pfam03472"
                     /db_xref="CDD:251983"
     misc_feature    157543..157710
                     /locus_tag="ABZJ_00140"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(157546..157554,157591..157599,157621..157626,
                     157630..157635,157639..157653,157684..157686)
                     /locus_tag="ABZJ_00140"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(157579..157581,157585..157587,157591..157593,
                     157684..157692,157699..157701,157708..157710)
                     /locus_tag="ABZJ_00140"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            158344..160233
                     /locus_tag="ABZJ_00141"
                     /db_xref="GeneID:12115219"
     CDS             158344..160233
                     /locus_tag="ABZJ_00141"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA synthetase (AMP-forming)/AMP-acid
                     ligase II"
                     /protein_id="YP_005524097.1"
                     /db_xref="GI:384141387"
                     /db_xref="GeneID:12115219"
                     /translation="MAVMCTDNIIATLESHAKLNGNKIAFEYLGRQSGGIQSLTYADL
                     NERVQHQAQILMSIVDSGDRAVLLFEPGLDFIVSFFACLKAKIIAVPVSLPFNRNGFS
                     NILNIMNDCEPKIVLTTKKILELAGLITLKAQNENLILHAVDAELQRDLVEKDFPLIT
                     EKDICFLQYTSGSTGWPKGVIVTHKNIMANEVMIAEAFGTQPEDVGLTWLPVYHDMGL
                     IGSVLQTVYVGLTCYVMSPLDFIRKPLKWLQFISEKGVTISGGPNFAYELCLHRITDE
                     QAAALDLSRVRVLFNGAEPIKAHVMQRFMEKFNTQSRLRLDTFLPCYGLAEVTLLVSG
                     VTGPLNAISLDRDKLNAHLVQTSQDQTAVQVVSCGKISKHIDCRIVNPHTRKEVAAHE
                     VGEIWLAGESVTAGYWQKPEVNRETFEATILDEAGQPSQVHYLRTGDMGFIKNGDLYI
                     TGRLKDVIIIRGKNYYPQDIECSVEMAHPAVRKGCVAAVNFADSEGVTVVLEIKKKSL
                     DKTLNFETIRTQVKEQVAADIGLPVDGVYLLHQGRINKTTSGKIRRRKIKEQIERGQL
                     VCLTHPNRRTMIARNYVKNGLDVIRDREQRGQLIRYSSNLLNSMIKEREVRTLIFNRL
                     KSALF"
     misc_feature    158368..160050
                     /locus_tag="ABZJ_00141"
                     /note="acyl-CoA synthetase; Validated; Region: PRK05850"
                     /db_xref="CDD:235624"
     misc_feature    158425..160020
                     /locus_tag="ABZJ_00141"
                     /note="Fatty acyl-AMP ligase (FAAL); Region: FAAL;
                     cd05931"
                     /db_xref="CDD:213297"
     misc_feature    order(158842..158844,158851..158868,158872..158877)
                     /locus_tag="ABZJ_00141"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213297"
     misc_feature    order(158923..158925,158983..158991,159211..159213,
                     159220..159231,159307..159321,159334..159336,
                     159445..159447,159658..159660,159691..159693,
                     159700..159702)
                     /locus_tag="ABZJ_00141"
                     /note="active site"
                     /db_xref="CDD:213297"
     gene            160266..162059
                     /locus_tag="ABZJ_00142"
                     /db_xref="GeneID:12115220"
     CDS             160266..162059
                     /locus_tag="ABZJ_00142"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase"
                     /protein_id="YP_005524098.1"
                     /db_xref="GI:384141388"
                     /db_xref="GeneID:12115220"
                     /translation="MSLTSNLRQFQSAARLEQILGSVHDTNNDFSWSAAIERDEKEQY
                     PQRAVDFLNAVGMNRFYVPSELGGRMEIGEELLYLHRVLARRDLTINSTYSTNAWSVI
                     VWIGGNESQCQNIANRILSGAAPALAYSEKAHGADLLSSEVTAQPSDSKYVLNGEKWS
                     INRATLGDSLSLIAKTSNDRGPRSLSAFWLDKRHMASKGTYSLNRLPTVGMRGLDISG
                     IGFNNAEIHKDALIGEEGQGLELGLKTLQVTRAYCSSFSLGAGDTMLRIATEFAIERE
                     LYNKKVISIPLVREQLATAYAYLLAAEVLSLVGARGLHVCINQFSTWSPIVKVLVPEY
                     VESLAKITSSVLGSRFFLRNAYADGMFQKAFRDHLIVSVFDGSSTVCLDSLSFQLKSA
                     NKGRSKKADHLNQAEAKARYRQLYDLQVETGAIDFRELEIFNRDGDLVMESLETIIEM
                     LNDSNVTVGLSAETLATLHERANQLLVEQRSLDQKIQDYFSNSEQSKEFETMRFSLAR
                     NYAELFARIAVLGFWVFNRHGLRPALQNGAWLIIFLNAAEGQTAPPMTSLRESTLADL
                     LDRISTNHMLSVIDFALAPRDAKPVKKEITP"
     misc_feature    160266..161399
                     /locus_tag="ABZJ_00142"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    160557..161405
                     /locus_tag="ABZJ_00142"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cd00567"
                     /db_xref="CDD:173838"
     misc_feature    order(160557..160559,160644..160646,160650..160652,
                     160743..160745,160749..160751,161382..161390,
                     161394..161396,161400..161402)
                     /locus_tag="ABZJ_00142"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            162056..162316
                     /locus_tag="ABZJ_00143"
                     /db_xref="GeneID:12115221"
     CDS             162056..162316
                     /locus_tag="ABZJ_00143"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="YP_005524099.1"
                     /db_xref="GI:384141389"
                     /db_xref="GeneID:12115221"
                     /translation="MNKDKAYWSAIIRTLVAKEMRVEPETIDPDQKFTSYGLDSIVAL
                     SVSGDLEDLTKLELEPTLLWDYPTINALAEYLVSELQQGVAS"
     misc_feature    162089..162295
                     /locus_tag="ABZJ_00143"
                     /note="Phosphopantetheine attachment site; Region: PKS_PP;
                     smart00823"
                     /db_xref="CDD:214834"
     gene            162313..166272
                     /locus_tag="ABZJ_00144"
                     /db_xref="GeneID:12115222"
     CDS             162313..166272
                     /locus_tag="ABZJ_00144"
                     /codon_start=1
                     /transl_table=11
                     /product="non-ribosomal peptide synthetase protein"
                     /protein_id="YP_005524100.1"
                     /db_xref="GI:384141390"
                     /db_xref="GeneID:12115222"
                     /translation="MNNLARLEPEVLSRHAISAEQLGIWYIQRLEPTCSAYNMVVAFD
                     VKVNQPLGNKPIEILEAVMHDYPLLRVSMPANDQGIEQLIWDRVYPNIIFSDARHIEA
                     SELTQLVEQDAKQPFDLTQPPLWRIHCYERGQNHYVIAFVIHHALMDFWSIGLLLRDV
                     SKRFGLVAESDAVNGIEFAQYADKQQSSVIDDSDESLIFWKNALKHAPHVHSIPLDYP
                     RPAVQKHTGSSLVFRVPESVSSGLVNLAKDYEITLFGLVLSGFYILLHKLSNENNLVI
                     ATPVAGRLERSLRNALGQFVNTIAIHIDIDADQTLRQFTQQVQEQLRQSLKHQKVAFS
                     RVGEAVAPKRDGSINPLAQIGMFWERLGGMDEFKELLLPIQTPATLVGQDLTLGSFPV
                     RQQEGQLDITLEMGGEYQGELVGVLKYNTDLFSAQSAKNMVQLLQAVLSEMVAHPERK
                     IVELDIAPDYKDSIQFEALRGKATDYAQHDLFAMILKQIDERGDNHALTSNDHAVSYC
                     ELGQHIAGIAEYLCAHGITRGDRVGLMLDRTALLPAAILGIWAAGAAYVPLDPNFPTE
                     RLQNIIEDAEPKVILTQTELMDGLNVSVPRLDINQAGVVALEQVRETLAFGDIAYVMY
                     TSGSTGKPKGVRIGHPSIINFLLSMNDRLQVTTETQLLAITTYAFDISILELLIPLMY
                     GGVVHVCPREVSQDGNQLVDYLNAKSINILQATPASWKMLLDSEWSGNAGLTALCGGE
                     ALDTILAEKLLGKVGCLWNVYGPTETTVWSSAARITDAKYIDLGEPLANTQLYVLDEQ
                     QRLVPPGVMGELWIGGDGLAVDYWHRPELTDAQFRTLPSLPNAGRLYRTGDKVCLRTD
                     GRLTHHGRLDFQVKIRGFRIELGEIENVLKQIDGITDAVVLVKTTADNDQKLVAYVTG
                     QELDIAGLKKTLQIHLPAYMVPSAFIRLDEFPMTANNKLDRKAFPEPIFEQSNDYVAP
                     RDPIEIELCTTFEQILSVKRVGIHDDFFELGGHSLLAVKLVNHLKKAFGTELSVALLA
                     QYSTVERLGEIIRENKEIKPSIVIELRRGTYEQPLWLFHPIGGSTFCYMELSRHLNPN
                     RTLRAIQSPGLIEADAAEVAIEEMATLYIAEMQKMQPQGPYFLGGWCFGGAIAYEISH
                     QLRQMGQQVTGIVMIDTRAPIPENVPEDADDAMLLSWFARDLAAPYGKKLTIPAQYLR
                     ELSPDQMFDHVLKEAKAINVLPLDADPSDFRLYFDTYLANGIALQTYFPEPEDFPILL
                     VKAKDEQEDFGESLGWDQLVKDTLTQVDLPGDHSSIMYAENVVAVAQTIDQMYPIPT"
     misc_feature    162373..163230
                     /locus_tag="ABZJ_00144"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     misc_feature    163012..164979
                     /locus_tag="ABZJ_00144"
                     /note="Non-ribosomal peptide synthetase modules and
                     related proteins [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: EntF; COG1020"
                     /db_xref="CDD:223951"
     misc_feature    163294..163608
                     /locus_tag="ABZJ_00144"
                     /note="HxxPF-repeated domain; Region: HxxPF_rpt;
                     pfam13745"
                     /db_xref="CDD:258038"
     misc_feature    163792..165186
                     /locus_tag="ABZJ_00144"
                     /note="The adenylation domain of nonribosomal peptide
                     synthetases (NRPS), including salinosporamide A polyketide
                     synthase; Region: A_NRPS_Ta1_like; cd12116"
                     /db_xref="CDD:213324"
     misc_feature    order(164176..164178,164185..164202,164206..164211)
                     /locus_tag="ABZJ_00144"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213324"
     misc_feature    order(164185..164190,164527..164532,164587..164604,
                     164659..164661,164857..164859,164893..164895,
                     164902..164904,165166..165168)
                     /locus_tag="ABZJ_00144"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213324"
     misc_feature    165247..165438
                     /locus_tag="ABZJ_00144"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    165499..166245
                     /locus_tag="ABZJ_00144"
                     /note="Thioesterase domains of type I polyketide synthases
                     or non-ribosomal peptide synthetases [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: COG3319"
                     /db_xref="CDD:225856"
     misc_feature    165511..>165963
                     /locus_tag="ABZJ_00144"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            166297..169947
                     /locus_tag="ABZJ_00145"
                     /db_xref="GeneID:12115223"
     CDS             166297..169947
                     /locus_tag="ABZJ_00145"
                     /codon_start=1
                     /transl_table=11
                     /product="RND superfamily-like exporter"
                     /protein_id="YP_005524101.1"
                     /db_xref="GI:384141391"
                     /db_xref="GeneID:12115223"
                     /translation="MVTIEHAFLIPAKIDKVFTYLANPANDAGWQLSCKHSELLDSTP
                     RVGSKYEIGFSFIGREMSFKGEITHLVPNELYAFKVVEGPFHYTGTYRFKPHPEGTWI
                     EWVFEAEPGSFFGVLPPALLKKMVLAQFKKDVDNLQALAQKGEAYESVGNENKLTIET
                     NKPPRKTQQMMEKYARWILSHRRIVLTVVMLLTLALAYLASGVKIIIDPDALAPKGHP
                     YITSTKLIEKKFGSKYMVVIGITPKQGDIYQPQVLEKVKRITEEVDNAPGVVRSTMMS
                     LAARQAKGIEANAEGFDAKKLLPSNSVTQEDIDHLKKLLALNPTYMNSVVSKDQRTAA
                     ILLELEESPEGFQKMMGPINKIVESEQSKDMTISVGGNPVYLDKAEDYSKRINILFPI
                     AVLVIGLLHFEAFRSKQGLILPLVTALLAVAWGMGMMGLFKQPMDIFNSPTPILILAI
                     AAGHAVQLLKRYYEDFDRLIAQGMEPKAANSEAVVQSLVRVGPVMVLAGGIAAAGFFS
                     LLTFNIPTIRSFGIFTGIGIISTLVIEMTFIPALRSMLPPPSVVKVKRKGLPVWDWIP
                     NRIGDVILSVRPRMMLMTAIAAMGILLAIGTSRIVVDNDSRNFFSRDLPMQQDDRFLN
                     QSLGGTNSLYIMVDTKVRDGIENPEILKAIDNTEKFANSIPEVGKTISIVDYIKRMNQ
                     AMNADQPQAFQVPATKDIVAQYLLLYSMSGEPTDFESYIDTTQRYAKITILLKTGSNH
                     RIKEILESLKTYMAGQLGDKAVVSFGGDVTQTIALTETMVHGKLMNILQISFAVFFIS
                     ALVFRSISAGLIVLTPLLFSILAIFGVMGWLDIPLNIPNSLISAMAVGIGADYAIYFL
                     YRLREILREEGGDIKDAIRKTLSTAGKASLFVATAVAGGYGVLSLSQGFHVHQWLAMF
                     IVIAMLFSVFATLIMVPTMILILKPRFIFSSKKKSIPVAQTVVTSLLLGTVLTMSMPK
                     TSHADEVQDIVNRSDDASKFLSSTASAKFILTSKNGEQRVRLTKNMTKLAGNTQNNMR
                     LTEFISPADVQGTTTLLIENAKGSDSMFVYLPALKKVRRLASANKGDAFIGTDFSYGD
                     VLGYKLSDWKYTKLADGKFNGKDCYMIEATPINNTVKSDFGYSKRRMCILKDNFVTAT
                     IDIWDTAGKPLKHIEFTDIRPYGKVKPRWQAMKSMAKNLQTQHMTQVIVNDFAAEKTL
                     SDKLFSPQSLEK"
     misc_feature    166306..166716
                     /locus_tag="ABZJ_00145"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cl14643"
                     /db_xref="CDD:265438"
     misc_feature    order(166306..166308,166312..166314,166318..166320,
                     166345..166353,166357..166362,166405..166407,
                     166420..166422,166426..166428,166432..166434,
                     166438..166440,166489..166491,166495..166497,
                     166501..166503,166513..166515,166519..166521,
                     166567..166572,166576..166578,166582..166584,
                     166600..166602,166606..166608,166612..166614,
                     166618..166620,166660..166674,166678..166683,
                     166690..166698,166705..166707)
                     /locus_tag="ABZJ_00145"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     misc_feature    166804..169122
                     /locus_tag="ABZJ_00145"
                     /note="Predicted exporters of the RND superfamily [General
                     function prediction only]; Region: COG1033"
                     /db_xref="CDD:223964"
     misc_feature    <167248..168036
                     /locus_tag="ABZJ_00145"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    <168676..169143
                     /locus_tag="ABZJ_00145"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    <169387..169938
                     /locus_tag="ABZJ_00145"
                     /note="Protein of unknown function (DUF1329); Region:
                     DUF1329; pfam07044"
                     /db_xref="CDD:254034"
     gene            169944..171218
                     /locus_tag="ABZJ_00146"
                     /db_xref="GeneID:12115224"
     CDS             169944..171218
                     /locus_tag="ABZJ_00146"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524102.1"
                     /db_xref="GI:384141392"
                     /db_xref="GeneID:12115224"
                     /translation="MTQGAYWVFVCCSSFMLLQHTYADDSEMSFVSQNSARLDVWSSD
                     RDLSSLKNIGQASFWSNGTLKFNPAFKLHYDIVVSDETDHTVNPDQVSKVNRNLRELY
                     ASYNWDQTVYVDVGRQIVVWGRADGINPTDNLSPRDYTRLVPDETDQRLGNDAIKLTY
                     IPESGTNKWTALWYPRSRSDVIPLRQIAGVQYDIDRKSRPAFAMRWDYSVDGLDVGAS
                     YFSGLDHMPDLSVLSASPTGEATLQLKNNPMSVYGFDFSYNHNDLVWRGEAAYTKTDS
                     NGSEDLTHKKNNLTIVMGPEWSLKNSTLSLVGVYKHTEDFKSADSLTNPSLSTVYRYQ
                     QTISDQYEQDQYGAMLRYALNLLNDNLKLEFTGFYFAPEPNELLRVRINYNLNDHWQL
                     NAGGDRFWGRNDTVLGQFRDNSLVYAQVRYNF"
     gene            171273..173138
                     /locus_tag="ABZJ_00147"
                     /db_xref="GeneID:12115225"
     CDS             171273..173138
                     /locus_tag="ABZJ_00147"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="YP_005524103.1"
                     /db_xref="GI:384141393"
                     /db_xref="GeneID:12115225"
                     /translation="MDNLNNAKKDNFSRKTILVTGAAGFIGSRLIVELLREGHQVIAA
                     LRNAATKKDKLLGFIATQGLADPSISFVEYDLSRDFKLDSLLSDAQTKIHVIYHLAAS
                     FNWGISKAEAERTNIKSGLALIEWAATLKQLERFIWIGGYRVAAPPQESADELYCKHG
                     GYEASKILGHQAFIEACKRLNVPWTAINPATVIDGFYNYGDMQYIGIADMIGKLYQGR
                     LLALPGGRDTFLPLCNMQYIVSFLIRTMSYPETIAQEYMLLDPATPKFHRLVHLAAEH
                     LGVSSPHLQIPKVLLEKLPEVLLDGSKEQLSFISTEHYHVAGAEAMAAKMGIADLISI
                     MPYFSRWIDRLVFTRFGRMQVPTPNSFSYQNRYWTEIYTNQPVGSEKVSALFLHGIPF
                     DSACWSPIINKITYDQVAMMDLPGLGRSGSYEMMEDNNHQFIDTAAELLAPNSVVIAH
                     SLGCLFALNLAKKYPDKVARLILISPYFVQAQAAKMFQIQAISKLIFRFVPKDVIAKD
                     LHPEGQQNLSVRYAMDSLRRMSVSKHISEYMHHINLPQQRAAQTALLSELRSKIEIIV
                     GEKDPIVTPISPDIPVHIIAGAGHNPHVTHVEAVYDHLTPVLTKYISTTAQLSDV"
     misc_feature    171321..172169
                     /locus_tag="ABZJ_00147"
                     /note="Short-chain dehydrogenases/reductases (SDR);
                     Region: SDR; cl21454"
                     /db_xref="CDD:271874"
     misc_feature    171327..171965
                     /locus_tag="ABZJ_00147"
                     /note="Male sterility protein; Region: NAD_binding_4;
                     pfam07993"
                     /db_xref="CDD:254569"
     misc_feature    order(171333..171335,171339..171344,171348..171350,
                     171405..171413,171567..171575,171687..171695,
                     171756..171758,171768..171770,171837..171848)
                     /locus_tag="ABZJ_00147"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(171618..171620,171693..171695,171756..171758,
                     171768..171770)
                     /locus_tag="ABZJ_00147"
                     /note="active site"
                     /db_xref="CDD:187535"
     misc_feature    172425..173081
                     /locus_tag="ABZJ_00147"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    <172605..>172703
                     /locus_tag="ABZJ_00147"
                     /note="Esterases and lipases (includes fungal lipases,
                     cholinesterases, etc.)  These enzymes act on carboxylic
                     esters (EC: 3.1.1.-). The catalytic apparatus involves
                     three residues (catalytic triad): a serine, a glutamate or
                     aspartate and a histidine.These...; Region:
                     Esterase_lipase; cl21494"
                     /db_xref="CDD:271914"
     misc_feature    order(172623..172625,172695..172697)
                     /locus_tag="ABZJ_00147"
                     /note="catalytic site [active]"
                     /db_xref="CDD:214005"
     gene            173131..173895
                     /locus_tag="ABZJ_00148"
                     /db_xref="GeneID:12115226"
     CDS             173131..173895
                     /locus_tag="ABZJ_00148"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 4'-phosphopantetheinyl transferase"
                     /protein_id="YP_005524104.1"
                     /db_xref="GI:384141394"
                     /db_xref="GeneID:12115226"
                     /translation="MSDVANVQVYVCPISRVPNNHLILSHYLSFLNAAEKLRYDQYHP
                     HVARLFLISRVLMKSVLSDKLGILPHEVIIQLQPNGKPFVRGNKAIYFNLSHSADFIV
                     FAVTEKGEIGVDVERMDHEFEWRRVDSVLAPSEIEWIQQNEWTNPTSVYQRFFQIWTL
                     KESYIKCTGEGMSRHLKKLNFHVSPEHIQFFDLTNNDVQRTEQYHFKSYIYNYSFIFS
                     LCLQQSHCLESFNIDCFQLLPYISTHRITLEPCEHN"
     misc_feature    173143..>173697
                     /locus_tag="ABZJ_00148"
                     /note="Phosphopantetheinyl transferase [Coenzyme
                     metabolism]; Region: Sfp; COG2091"
                     /db_xref="CDD:225002"
     misc_feature    173461..173793
                     /locus_tag="ABZJ_00148"
                     /note="4'-phosphopantetheinyl transferase superfamily;
                     Region: ACPS; pfam01648"
                     /db_xref="CDD:250768"
     gene            complement(173990..174065)
                     /locus_tag="ABZJ_tRNA3"
                     /db_xref="GeneID:12115227"
     tRNA            complement(173990..174065)
                     /locus_tag="ABZJ_tRNA3"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:12115227"
     gene            complement(174111..174186)
                     /locus_tag="ABZJ_tRNA4"
                     /db_xref="GeneID:12115228"
     tRNA            complement(174111..174186)
                     /locus_tag="ABZJ_tRNA4"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:12115228"
     gene            174360..174725
                     /locus_tag="ABZJ_00149"
                     /db_xref="GeneID:12115229"
     CDS             174360..174725
                     /locus_tag="ABZJ_00149"
                     /codon_start=1
                     /transl_table=11
                     /product="putative morphogenic pathway activator (BolA)"
                     /protein_id="YP_005524105.1"
                     /db_xref="GI:384141395"
                     /db_xref="GeneID:12115229"
                     /translation="MCRQGILGLNIRIIVKGKAMSLEQQLIERLQTLAPSYLEVINES
                     AGHGGYFPGKESHFKVIVVSEEFNGLRLVQRHQKVYALASDLMNPGQIHALAIHAYLP
                     SEWQGQAPASPECAHAPKS"
     misc_feature    174447..174674
                     /locus_tag="ABZJ_00149"
                     /note="BolA-like protein; Region: BolA; pfam01722"
                     /db_xref="CDD:250816"
     gene            174744..175136
                     /locus_tag="ABZJ_00150"
                     /db_xref="GeneID:12115230"
     CDS             174744..175136
                     /locus_tag="ABZJ_00150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524106.1"
                     /db_xref="GI:384141396"
                     /db_xref="GeneID:12115230"
                     /translation="MDAHLLTKIIHMTAVAAALMVFVLRASTLFIGVQGEQPNPAGRK
                     VLVALQHLSFTVVFITGAILLVMKNFQVQPWFYAKIILFLVLLSSLMKAFKKDDTILL
                     AQRRAGLVISAIAFVAIIILVIVKPVFA"
     misc_feature    <174867..175124
                     /locus_tag="ABZJ_00150"
                     /note="Copper resistance protein D; Region: CopD; cl21540"
                     /db_xref="CDD:271960"
     gene            175213..176055
                     /locus_tag="ABZJ_00151"
                     /db_xref="GeneID:12115231"
     CDS             175213..176055
                     /locus_tag="ABZJ_00151"
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family ATPase"
                     /protein_id="YP_005524107.1"
                     /db_xref="GI:384141397"
                     /db_xref="GeneID:12115231"
                     /translation="MLTRVVFNQKGGVGKSSITVNLAAISAKHGLRTLVIDLDPQANS
                     SQYLLGEEATYAADKAVLEPNIENFFEDVLGNNQQKGLIGNALGSILKAPRNKDLDSF
                     VHSTSFAKLDVLPASPTLGTLEHALESKHKIYKLRDSIQSLVGRYDRIYIDTPPAFNF
                     FTLSALIAADKVLIPFDCDVFSKRALQTLIENVLETQDDHNDRLEIEGIVVNQFQSQA
                     KLPREVVQQLKDEGLPVLNSMLPPSILMKESHQKNLPLAHLAPEHKLTQSYEALFSEI
                     EPKR"
     misc_feature    175213..176049
                     /locus_tag="ABZJ_00151"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    175225..175848
                     /locus_tag="ABZJ_00151"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    175240..>175680
                     /locus_tag="ABZJ_00151"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl21455"
                     /db_xref="CDD:271875"
     misc_feature    175240..175260
                     /locus_tag="ABZJ_00151"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(175258..175260,175669..175671)
                     /locus_tag="ABZJ_00151"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            176018..176452
                     /locus_tag="ABZJ_00152"
                     /db_xref="GeneID:12115232"
     CDS             176018..176452
                     /locus_tag="ABZJ_00152"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524108.1"
                     /db_xref="GI:384141398"
                     /db_xref="GeneID:12115232"
                     /translation="MRHCSAKLNQNDKRKMMKGLYIVPLAAATLLLSACATTVKPTYV
                     SPTQYQSLSCQQLQSEYNRIQQYIDNGVQTPKSTGMGVGLGLGGGWGRGGWGFGPSIS
                     VNMGQSSSTKNTELSRVLGQQEAIVQAAQFKNCPIIVRKKTN"
     gene            176668..177258
                     /locus_tag="ABZJ_00153"
                     /db_xref="GeneID:12115233"
     CDS             176668..177258
                     /locus_tag="ABZJ_00153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524109.1"
                     /db_xref="GI:384141399"
                     /db_xref="GeneID:12115233"
                     /translation="MIESWFFVLAMLAVLLIPGPTNALLATAAHSQGLSKTFWLIPME
                     WLGYAYGISFWAVFIHLADPVWPALLLILHITSVLYVFWMAFRLWKTKHLQQFSQNHR
                     NIRPRQLFFSTLKNPKSLLFAAGIFPTETWNSPENFLMVLAAFTLILIPAASFWMFFG
                     RALLTGSMKKIKADHLYKGSAMLLILCMLPVVFRFF"
     misc_feature    176668..177156
                     /locus_tag="ABZJ_00153"
                     /note="LysE type translocator; Region: LysE; cl00565"
                     /db_xref="CDD:260502"
     gene            complement(177266..177907)
                     /locus_tag="ABZJ_00154"
                     /db_xref="GeneID:12115234"
     CDS             complement(177266..177907)
                     /locus_tag="ABZJ_00154"
                     /codon_start=1
                     /transl_table=11
                     /product="putative integral membrane protein (DedA)"
                     /protein_id="YP_005524110.1"
                     /db_xref="GI:384141400"
                     /db_xref="GeneID:12115234"
                     /translation="MELLDFILHVDQHLAEFITNYGTWIYGILFLIIFVETGLVVMPF
                     LPGDSLLFAAGALAASTGTMDPWLLGILLFIAAVLGDTVNYHIGRFIGPRVFEMNSRF
                     INKQHLIKTQEFFARHGGKTIIFARFIPFARTFAPFVAGAGSMNYKFFLTYNIIGAFC
                     WVASFVTLGYLFGGHPLVKDNFTHLIFGIIIISILPGVIGFIRQKLKNRKANV"
     misc_feature    complement(177269..177901)
                     /locus_tag="ABZJ_00154"
                     /note="SNARE associated Golgi protein; Region:
                     SNARE_assoc; cl00429"
                     /db_xref="CDD:260418"
     gene            178101..178538
                     /locus_tag="ABZJ_00155"
                     /db_xref="GeneID:12115235"
     CDS             178101..178538
                     /locus_tag="ABZJ_00155"
                     /codon_start=1
                     /transl_table=11
                     /product="DoxX family protein"
                     /protein_id="YP_005524111.1"
                     /db_xref="GI:384141401"
                     /db_xref="GeneID:12115235"
                     /translation="MFNPNVVVKNIVTQLGADSFISLVARLLIAYIFLAAGWGKITGY
                     AATAGYMEAMGVPGGLLPLVILVEFGGGLALLFGFQARFAAFGLGIFSILTAFLFHQG
                     GADAAAQYNNGIHFMKNLAMAGGLFFLMLHGAGRISLDHAIEK"
     misc_feature    178137..178535
                     /locus_tag="ABZJ_00155"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            complement(178598..179827)
                     /locus_tag="ABZJ_00156"
                     /db_xref="GeneID:12115236"
     CDS             complement(178598..179827)
                     /locus_tag="ABZJ_00156"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524112.1"
                     /db_xref="GI:384141402"
                     /db_xref="GeneID:12115236"
                     /translation="MLQTMIADFQQHFWLYVSIPFMSGLIGYVTKVIAIQMMFSPLEF
                     KGIKPFFGWQGIVPRKAEKMATTAVELMTAKLIKPEEIFARLDPKRIAKEIEKPLMAA
                     AEDITREVAQEYQPGLWEGMPEFARQRLIRRVQSKAPEIVEHIMSEVQRDVNRYFDIK
                     HLVISNLLKDKRLLNNIFKRVGKQEFKFFSNVGFVFGFGIGVIQMLCWIVTQGKYPWM
                     LPLFGGFVGFFSDWIALQMMFRPLYPKKILGYTWQGLFIKRQNEVAADYAALISKQLL
                     TSRHMMEELFSGTHSARVIELVNRHVKQEIDMQAGVIRPLVVYAIGGEKYQNMKTQVA
                     ERIMQQLPETMKYVESYAEDAMNIRNTLIERMQKLTPSEFEGMLRPAFKEDEWALIAV
                     GAVLGFVVGELQIQFML"
     misc_feature    complement(<179267..179794)
                     /locus_tag="ABZJ_00156"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4399; cl19827"
                     /db_xref="CDD:268180"
     misc_feature    complement(<178622..179173)
                     /locus_tag="ABZJ_00156"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4399; cl19827"
                     /db_xref="CDD:268180"
     gene            180203..181771
                     /locus_tag="ABZJ_00157"
                     /db_xref="GeneID:12115237"
     CDS             180203..181771
                     /locus_tag="ABZJ_00157"
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="YP_005524113.1"
                     /db_xref="GI:384141403"
                     /db_xref="GeneID:12115237"
                     /translation="MTTNTQITEDRILILDFGSQYSQLIARRVREAGVYSEMYAFDMS
                     EEDIRAFKPNGIILSGGPESVHEEGSPRAPQVVFELGVPVLGICYGLQTMSEQLGGKV
                     EPGTVHEFGYAEVDIVKRDQLIGNLQDRENQLHVWMSHGDKVSQIPEGFTITASTPSC
                     PVAAVSDETRRFYGVQFHPEVTHTAKGEELLSNFVHKICGCGGLWTPEHIIDLRVEQL
                     REQIGNEKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMQMFAE
                     NMGIRVIRADAEARFLNALAGVTDPEAKRKIIGREFIEVFAEEARKLDGVKFLAQGTI
                     YPDVIESAASKQGKAHVIKSHHNVGGLPDDLAFELVEPLRDLFKDEVRKLGTTLGLPH
                     SMIYRHPFPGPGLGVRILGEVKKEYADILRLADDIFMQELRDSGWYDKTAQAFAVFQP
                     VKSVGVVGDGRRYAWVIALRAVETVDFMTARFAHLPYELVDKISTRIMNEIKDVSRVV
                     YDVSSKPPATIEWE"
     misc_feature    180221..181768
                     /locus_tag="ABZJ_00157"
                     /note="GMP synthase; Reviewed; Region: guaA; PRK00074"
                     /db_xref="CDD:234614"
     misc_feature    180236..180787
                     /locus_tag="ABZJ_00157"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in GMP synthetase; Region: GATase1_GMP_Synthase;
                     cd01742"
                     /db_xref="CDD:153213"
     misc_feature    order(180257..180262,180380..180388,180464..180469,
                     180617..180619,180734..180736)
                     /locus_tag="ABZJ_00157"
                     /note="AMP/PPi binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153213"
     misc_feature    order(180383..180385,180467..180469)
                     /locus_tag="ABZJ_00157"
                     /note="candidate oxyanion hole; other site"
                     /db_xref="CDD:153213"
     misc_feature    order(180464..180466,180734..180736,180740..180742)
                     /locus_tag="ABZJ_00157"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153213"
     misc_feature    order(180476..180478,180620..180622,180728..180730)
                     /locus_tag="ABZJ_00157"
                     /note="potential glutamine specificity residues [chemical
                     binding]; other site"
                     /db_xref="CDD:153213"
     misc_feature    180878..181765
                     /locus_tag="ABZJ_00157"
                     /note="The C-terminal domain of GMP synthetase. It
                     contains two subdomains; the ATP pyrophosphatase domain
                     which closes to the N-termial and the dimerization domain
                     at C-terminal end. The ATP-PPase is a twisted,
                     five-stranded parallel beta-sheet sandwiched...; Region:
                     GMP_synthase_C; cd01997"
                     /db_xref="CDD:238955"
     misc_feature    order(180878..180952,180956..180988,180992..181024,
                     181055..181168,181184..181231,181259..181288,
                     181301..181375,181391..181435)
                     /locus_tag="ABZJ_00157"
                     /note="ATP Binding subdomain [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    order(180890..180898,180902..180913,180965..180967,
                     180971..180973,181334..181336)
                     /locus_tag="ABZJ_00157"
                     /note="Ligand Binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    order(181460..181498,181523..181552,181559..181591,
                     181601..181648,181667..181693,181697..181765)
                     /locus_tag="ABZJ_00157"
                     /note="Dimerization subdomain; other site"
                     /db_xref="CDD:238955"
     gene            181837..182625
                     /locus_tag="ABZJ_00158"
                     /db_xref="GeneID:12115238"
     CDS             181837..182625
                     /locus_tag="ABZJ_00158"
                     /codon_start=1
                     /transl_table=11
                     /product="streptomycin 3''-adenylyltransferase"
                     /protein_id="YP_005524114.1"
                     /db_xref="GI:384141404"
                     /db_xref="GeneID:12115238"
                     /translation="MSDFIQLEYLQEKLQQLLAESLFAIYLYGSAVDGGLGPESDLDV
                     LVVVTQPLTSALREQLAQELLKISQPVGELQRPLEVTILLKDEIQSGNYPLSYEMQFG
                     EWLREELKEGGTLSSQKDPDISILLRKARFHHAVLFGPALDQWAPEISDQELWQAMSD
                     TYPEIVAHWDEDADERNQILALCRIYFSLVMKDIASKDNAARWVKSQLPPEQKFVLQR
                     LIQEYRGEIGKQNWQEEHYALQPIVNFLSSKIEEQFEQKRNLIT"
     misc_feature    181837..182601
                     /locus_tag="ABZJ_00158"
                     /note="aminoglycoside resistance protein; Provisional;
                     Region: PRK13746"
                     /db_xref="CDD:184296"
     misc_feature    181852..182100
                     /locus_tag="ABZJ_00158"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    order(181918..181926,181933..181935,181954..181959,
                     181963..181965,182065..182067,182071..182073)
                     /locus_tag="ABZJ_00158"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    order(181918..181926,181933..181935,181954..181959,
                     181963..181965)
                     /locus_tag="ABZJ_00158"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    order(181957..181959,181963..181965,182071..182073)
                     /locus_tag="ABZJ_00158"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    order(182065..182067,182071..182073)
                     /locus_tag="ABZJ_00158"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     misc_feature    182275..182586
                     /locus_tag="ABZJ_00158"
                     /note="Domain of unknown function (DUF4111); Region:
                     DUF4111; pfam13427"
                     /db_xref="CDD:257752"
     gene            182847..183374
                     /locus_tag="ABZJ_00159"
                     /db_xref="GeneID:12115239"
     CDS             182847..183374
                     /locus_tag="ABZJ_00159"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005524115.1"
                     /db_xref="GI:384141405"
                     /db_xref="GeneID:12115239"
                     /translation="MRQQSEHHHAEHNDHHHAHHRSGRRGRLFEAGRMKLLVLHLIQQ
                     SPKHGYEIIKEISDLVGDGYTPSAGTIYPTLTSLEEMNLINLLDVERKQYQITEFGEA
                     YLNEHQDKLSGLLEKLRLRREIHSNDQLIEIHRAMENLKTALRLKLNTTELKQEQIYQ
                     IAEKIDQAAVAIGRL"
     misc_feature    182940..183293
                     /locus_tag="ABZJ_00159"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1695"
                     /db_xref="CDD:224609"
     gene            183435..183740
                     /locus_tag="ABZJ_00160"
                     /db_xref="GeneID:12115240"
     CDS             183435..183740
                     /locus_tag="ABZJ_00160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524116.1"
                     /db_xref="GI:384141406"
                     /db_xref="GeneID:12115240"
                     /translation="MKQHQYHVTVQHLKDAKGEVSTYTERLEFYTGNHDDIFEIVEKL
                     KKAEFFDDQTTKSFAVGLKLFSEVMLENRDHPLFQEFLPQFGQFMKNLKQQVKTQSP"
     misc_feature    183441..183719
                     /locus_tag="ABZJ_00160"
                     /note="Domain of Unknown Function with PDB structure
                     (DUF3861); Region: DUF3861; pfam12977"
                     /db_xref="CDD:257440"
     gene            183897..184844
                     /locus_tag="ABZJ_00161"
                     /db_xref="GeneID:12115241"
     CDS             183897..184844
                     /locus_tag="ABZJ_00161"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524117.1"
                     /db_xref="GI:384141407"
                     /db_xref="GeneID:12115241"
                     /translation="MSNNNDYDISDSKDCEKFANQFIQEFPIRSAEIGQGTVIKRALP
                     SRQKRMIGAWCFLDHAGPVTFPAGNGLDVGPHPHIGLQTFTWMIEGTMMHTDSLGSKQ
                     LIRPKQVNLMTAGHGISHTEVAPDTETQMHAAQLWIALPDHKRNMDPKFEHYPDLPVV
                     EKDGLEFTVLVGEYLETTSPVVVHTPLVGVDLIATQDTKTRIPLNPEFEYGFMALDGV
                     AHVNGHELTADNMVVLDTGLNEIEIEVKKGNRVLLIGGEPFETPILLWWNFVARTMDD
                     LKEAREQWVNHDVRFGEIPDYVGARLEAPVLPDQMRASK"
     misc_feature    184002..184310
                     /locus_tag="ABZJ_00161"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     misc_feature    184014..184748
                     /locus_tag="ABZJ_00161"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    184464..184772
                     /locus_tag="ABZJ_00161"
                     /note="Pirin C-terminal cupin domain; Region: Pirin_C;
                     pfam05726"
                     /db_xref="CDD:253351"
     gene            184841..185248
                     /locus_tag="ABZJ_00162"
                     /db_xref="GeneID:12115242"
     CDS             184841..185248
                     /locus_tag="ABZJ_00162"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524118.1"
                     /db_xref="GI:384141408"
                     /db_xref="GeneID:12115242"
                     /translation="MTAVIASSKAKPLAEQWKGEITSGRHQYFCDEPEKLEGHDQGPA
                     PYDLLTGSLAACTLITLRMYAKHKGYDFGEYSVEIDFHTNREHEEHIERRIVFKELPN
                     EELQQKILTICSKTPVTKTLLRSLDIHTVLVTA"
     misc_feature    184952..185230
                     /locus_tag="ABZJ_00162"
                     /note="OsmC-like protein; Region: OsmC; pfam02566"
                     /db_xref="CDD:251379"
     gene            185361..186029
                     /locus_tag="ABZJ_00163"
                     /db_xref="GeneID:12115243"
     CDS             185361..186029
                     /locus_tag="ABZJ_00163"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_005524119.1"
                     /db_xref="GI:384141409"
                     /db_xref="GeneID:12115243"
                     /translation="MISVHHLECSRSFRILWALEELGLDYDIHFYQRLPNYSAPETLK
                     CIHPLGKAPILTDDEQVIAESAVILEYLQQRYDQKQQFKPKQAQDLQQYIYWMHYAEG
                     SLMPLLVMTLVMNNVNKHVPWLIQPVAKKITEGVKANFVRPRMKDHISFLENYLAEHE
                     YFAGDFSFADIQMSFPLEALQSRLQGKYPHIQAFLHRIQQRPAFQKARQKGLGSNERN
                     CADI"
     misc_feature    185361..185984
                     /locus_tag="ABZJ_00163"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    185364..185591
                     /locus_tag="ABZJ_00163"
                     /note="GST_N family, Saccharomyces cerevisiae GTT1-like
                     subfamily; composed of predominantly uncharacterized
                     proteins with similarity to the S. cerevisiae GST protein,
                     GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are
                     cytosolic dimeric proteins involved...; Region:
                     GST_N_GTT1_like; cd03046"
                     /db_xref="CDD:239344"
     misc_feature    order(185391..185393,185397..185402,185406..185411,
                     185418..185423,185556..185558,185565..185570)
                     /locus_tag="ABZJ_00163"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    order(185391..185393,185511..185519,185550..185555)
                     /locus_tag="ABZJ_00163"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    order(185511..185513,185547..185552,185556..185561,
                     185568..185570)
                     /locus_tag="ABZJ_00163"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239344"
     misc_feature    185619..185966
                     /locus_tag="ABZJ_00163"
                     /note="C-terminal, alpha helical domain of GTT1-like
                     Glutathione S-transferases; Region: GST_C_GTT1_like;
                     cd03189"
                     /db_xref="CDD:198298"
     misc_feature    order(185640..185642,185661..185663,185862..185864,
                     185871..185876,185883..185885,185895..185897)
                     /locus_tag="ABZJ_00163"
                     /note="putative N-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198298"
     misc_feature    order(185640..185645,185652..185657,185664..185666,
                     185811..185813)
                     /locus_tag="ABZJ_00163"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198298"
     misc_feature    order(185661..185663,185673..185678,185685..185690,
                     185886..185888,185895..185897)
                     /locus_tag="ABZJ_00163"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198298"
     gene            complement(186073..186699)
                     /locus_tag="ABZJ_00164"
                     /db_xref="GeneID:12115244"
     CDS             complement(186073..186699)
                     /locus_tag="ABZJ_00164"
                     /codon_start=1
                     /transl_table=11
                     /product="Sporulation related domain protein"
                     /protein_id="YP_005524120.1"
                     /db_xref="GI:384141410"
                     /db_xref="GeneID:12115244"
                     /translation="MFGKTQRGVSERPNKPKKPLIPKWLGTLVAILAVLCIAVMLMLW
                     KPWQPVSSKNQITSEHYKEEETNKDYRFYDLLPQQQVTPIPEQAIPESKNQGTAMIVE
                     APSTAQPAASEPASVSTDDTTDSTAAIPQQPNYILQVRSYTDPDQADARRAEIILNGL
                     SADVIKSSENGKTWYRVISGPYDTQEAALAAQQTLQHSGIDSIVIKRK"
     misc_feature    complement(186082..186300)
                     /locus_tag="ABZJ_00164"
                     /note="Sporulation related domain; Region: SPOR;
                     pfam05036"
                     /db_xref="CDD:252961"
     gene            complement(186853..188643)
                     /locus_tag="ABZJ_00165"
                     /db_xref="GeneID:12115245"
     CDS             complement(186853..188643)
                     /locus_tag="ABZJ_00165"
                     /codon_start=1
                     /transl_table=11
                     /product="arginyl-tRNA synthetase"
                     /protein_id="YP_005524121.1"
                     /db_xref="GI:384141411"
                     /db_xref="GeneID:12115245"
                     /translation="MNTAIQAALDHAVQTLQQEGVLPSDWNNSSNLTRTKDRSHGDFA
                     SNIAMIGSKAAGMKPRDLAEKILAALPEVADISKAEIAGPGFINFFLNADQRFAILDQ
                     IQAQKESFGRSQSNAAKKIQVEFVSANPTSSLHVGHGRGAAYGMTVANLLEATGAKVD
                     REYYVNDAGRQMDILATSTYLRYLELLGQNLVFPKNAYQGDYVKEIAQGIIDKDGDAY
                     VREVANVYKDVPEDVQYAEELDSEGNKVVLSGDKEKHIDGLIANSQQLLGEGYRVFHQ
                     AALHAILDDIKDDLADFGVTFNQWFSEASLSAKIDEALETLDQRGFLYEKDGNIWFKS
                     TEFGDEKDRVVKRRNGQTTYFASDIAYHLNKLQRGYTDLVDIWGSDHHGYISRVKAAI
                     DAMGYDSKKLTVLLVQFVSLWRGGEMVQMSSRSGQFVTLRDLRKEVGNDAARFYYVMR
                     KSEQHIDFDLDLAVSQSKDNAVYYIQYAHARICRMLEKAASTGLQFEVSAARSHAARL
                     SLDAETEILAKLAAYPDVVLRAANAYEPHQVGNYLKELAALFHGWYNEHKVLSDDAEL
                     TQARLLLSINVQQVLRNGLELLGVSAPEAM"
     misc_feature    complement(186856..188643)
                     /locus_tag="ABZJ_00165"
                     /note="arginyl-tRNA synthetase; Reviewed; Region: argS;
                     PRK01611"
                     /db_xref="CDD:234964"
     misc_feature    complement(188371..188631)
                     /locus_tag="ABZJ_00165"
                     /note="Arginyl tRNA synthetase N terminal dom; Region:
                     Arg_tRNA_synt_N; smart01016"
                     /db_xref="CDD:214975"
     misc_feature    complement(187366..188286)
                     /locus_tag="ABZJ_00165"
                     /note="catalytic core domain of arginyl-tRNA synthetases;
                     Region: ArgRS_core; cd00671"
                     /db_xref="CDD:185675"
     misc_feature    complement(order(187492..187494,187501..187503,
                     187570..187572,187582..187584,188230..188232,
                     188239..188241,188257..188259,188263..188265,
                     188272..188274))
                     /locus_tag="ABZJ_00165"
                     /note="active site"
                     /db_xref="CDD:185675"
     misc_feature    complement(188230..188241)
                     /locus_tag="ABZJ_00165"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:185675"
     misc_feature    complement(187258..>187419)
                     /locus_tag="ABZJ_00165"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:271408"
     misc_feature    complement(187372..187383)
                     /locus_tag="ABZJ_00165"
                     /note="KMSK motif region; other site"
                     /db_xref="CDD:185675"
     misc_feature    complement(order(186982..186984,186991..186993,
                     187000..187002,187021..187023,187189..187194,
                     187198..187203,187213..187215,187240..187242,
                     187249..187251,187261..187263))
                     /locus_tag="ABZJ_00165"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153408"
     misc_feature    complement(186856..187221)
                     /locus_tag="ABZJ_00165"
                     /note="DALR anticodon binding domain; Region: DALR_1;
                     smart00836"
                     /db_xref="CDD:214846"
     misc_feature    complement(order(186982..186984,187189..187194,
                     187201..187206,187213..187215))
                     /locus_tag="ABZJ_00165"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153408"
     gene            189139..190836
                     /locus_tag="ABZJ_00166"
                     /db_xref="GeneID:12115246"
     CDS             189139..190836
                     /locus_tag="ABZJ_00166"
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="YP_005524122.1"
                     /db_xref="GI:384141412"
                     /db_xref="GeneID:12115246"
                     /translation="MISGHPSKHPLYIPYAGYTLLELPLLNKGSAFTQEERSNFNLHG
                     LLPHIIETIEEQSQRSYQQYCAFNDDINKHIYLRNIQDTNETLFYHLIENHLEEMMPI
                     IYTPTVGEACQRFSDIYRRHRGVFISYPDRDVIDDILQNVNKNNVKVIVITDGERILG
                     LGDQGIGGMGIPIGKLSLYTACGGISPAYTLPITIDVGTNNPQLLNDPIYMGWRQPRI
                     SGDEYYDFVDMVIEAVKRRWPKALIQFEDFAQKNAMPLLEKYRDKICCFNDDIQGTAA
                     VSVGSLIAASRAAGKQLKDQTIAFLGAGSAGCGIAEQIVAQMVSEGLTDAEARARVYM
                     VDRFGLITENQPNLLDFQRKLAQKAEVVDQWGNIEEVISLLDVVKNAKPTVLIGVSGQ
                     PGLFTEEIIKTMAANCERPIVMPLSNPTSRVEAVPADIVEWTEGKALIATGSPFAPVN
                     HHGKLYNISQCNNSYIFPGIGLGVVASGAKRVTENMLMASSSALADCSPLLKDPQADL
                     LPPLGEIQQVSKVIAFEVAKAAMADGVAVTISDDLLKQKIDQSFWKPEYRKYKRIPF"
     misc_feature    189139..190827
                     /locus_tag="ABZJ_00166"
                     /note="malate dehydrogenase; Provisional; Region:
                     PRK13529"
                     /db_xref="CDD:237414"
     misc_feature    189379..189921
                     /locus_tag="ABZJ_00166"
                     /note="Malic enzyme, N-terminal domain; Region: malic;
                     pfam00390"
                     /db_xref="CDD:249824"
     misc_feature    189949..190803
                     /locus_tag="ABZJ_00166"
                     /note="NAD(P) binding domain of malic enzyme (ME),
                     subgroup 1; Region: NAD_bind_1_malic_enz; cd05312"
                     /db_xref="CDD:133454"
     misc_feature    order(190045..190056,190144..190149,190306..190311,
                     190384..190392,190465..190467,190519..190521,
                     190525..190527)
                     /locus_tag="ABZJ_00166"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133454"
     gene            191080..191523
                     /locus_tag="ABZJ_00167"
                     /db_xref="GeneID:12115247"
     CDS             191080..191523
                     /locus_tag="ABZJ_00167"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524123.1"
                     /db_xref="GI:384141413"
                     /db_xref="GeneID:12115247"
                     /translation="MKNIYILIFIGALIACSDKGTDKNQHNSNHKLDVVQTETNKSQS
                     VVGENQENTDKTVKTKEADQVAQFSCSNPNITQWYGFNENIAEPKCEVVKNFQLKAYK
                     CDISKNAFGASKDAILLENQDKRIFVYSTSKDCNEMLEVRNANAP"
     gene            complement(191663..192583)
                     /locus_tag="ABZJ_00168"
                     /db_xref="GeneID:12115248"
     CDS             complement(191663..192583)
                     /locus_tag="ABZJ_00168"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-dependent peroxidase"
                     /protein_id="YP_005524124.1"
                     /db_xref="GI:384141414"
                     /db_xref="GeneID:12115248"
                     /translation="MTAQSVILPLPSDHARFIVLRLKDLTIAELKEQLEALFETRDRL
                     ITQHSDAQIKTAVAFGPELWKQLYSQSPAGFKQLEPENGAFNMPVVPADVLIHIASMR
                     SDICFALSQAFFEGIKDKVEVLDERVCFRYFDGRDITGFIDGTENPQFPDDRAETALL
                     PESAGVFADGSFIFAQRYAHDLEKWKKLKVDAQENVMGRTKLESIELDDDVKPENAHV
                     ARTVVEDEEGEEMEILRHSLPYGDGRGDQGLFFIAYTKDLSIIDAMLKRMFGTSGDGI
                     HDRLLHFVTPLDGAYYFAPSEELLEEILEE"
     misc_feature    complement(191696..192574)
                     /locus_tag="ABZJ_00168"
                     /note="Dyp-type peroxidase family; Region: Dyp_perox;
                     cl01067"
                     /db_xref="CDD:260772"
     gene            192742..193368
                     /locus_tag="ABZJ_00169"
                     /db_xref="GeneID:12115249"
     CDS             192742..193368
                     /locus_tag="ABZJ_00169"
                     /codon_start=1
                     /transl_table=11
                     /product="putative threonine efflux protein"
                     /protein_id="YP_005524125.1"
                     /db_xref="GI:384141415"
                     /db_xref="GeneID:12115249"
                     /translation="MSLQVWFAYMLACWVISISPGAGAIASMSSGLNYGFRHGYWNAI
                     GLQIALLIQIMIVAAGVGVLFATTPLAFQAVKWFGVAYLLYLAYLQWTAPVKDIEIQH
                     EKKDKSVSALLLNGFVVNISNPKAIVFLLAVLPQFLDLSKPQWIQYLIMAATMVTIDL
                     IVMAGYTGLASKVLRLLRSPKQQKYLNRGFAVMFSCAALLLSTVHQAA"
     misc_feature    192742..193356
                     /locus_tag="ABZJ_00169"
                     /note="LysE type translocator; Region: LysE; cl00565"
                     /db_xref="CDD:260502"
     gene            complement(193370..194179)
                     /locus_tag="ABZJ_00170"
                     /db_xref="GeneID:12115250"
     CDS             complement(193370..194179)
                     /locus_tag="ABZJ_00170"
                     /codon_start=1
                     /transl_table=11
                     /product="high affinity Zn ABC transporter membrane
                     protein"
                     /protein_id="YP_005524126.1"
                     /db_xref="GI:384141416"
                     /db_xref="GeneID:12115250"
                     /translation="MMEWLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHG
                     TLLGVAIAGALSLPLWLGVAGTAILLVAILWALHDNRLPNDALLALCSATLLCSGLLF
                     IQHVPSLRPELLSYLFGDLLSIDWPDLPVFTLIIAVSLAILYRFWQPQIQIAIDPDIA
                     ISEGVNAKWQRLIFMLLLALFTVLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIW
                     AFVLAQLGVSVGLWSSAALNISTGLSIVLCMALSFALIFMVQKIKNQTQAA"
     misc_feature    complement(193400..194167)
                     /locus_tag="ABZJ_00170"
                     /note="Transmembrane subunit (TM) of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which are involved in the uptake of
                     branched-chain amino acids (AAs), as well as TMs of
                     transporters involved in the uptake of...; Region:
                     TM_PBP1_branched-chain-AA_like; cl00454"
                     /db_xref="CDD:271489"
     misc_feature    complement(193388..194161)
                     /locus_tag="ABZJ_00170"
                     /note="ABC-type Mn2+/Zn2+ transport systems, permease
                     components [Inorganic ion transport and metabolism];
                     Region: ZnuB; COG1108"
                     /db_xref="CDD:224033"
     misc_feature    complement(order(193544..193546,193565..193567,
                     193691..193699,193703..193720,193724..193729,
                     193733..193741,193745..193750,194084..194092,
                     194102..194104))
                     /locus_tag="ABZJ_00170"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(193409..193411,193418..193423,
                     193430..193432,193439..193444,193451..193453,
                     193598..193600,193826..193828,193835..193840,
                     193868..193870,193874..193879,193886..193888,
                     193895..193900,193907..193912,193919..193924,
                     193928..193930,194066..194068,194081..194083,
                     194087..194089))
                     /locus_tag="ABZJ_00170"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(193460..193462,193475..193477,
                     193610..193612,193622..193624,193796..193798,
                     193868..193870))
                     /locus_tag="ABZJ_00170"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(194183..194971)
                     /locus_tag="ABZJ_00171"
                     /db_xref="GeneID:12115251"
     CDS             complement(194183..194971)
                     /locus_tag="ABZJ_00171"
                     /codon_start=1
                     /transl_table=11
                     /product="high affinity Zn ABC transporter ATP-binding
                     protein"
                     /protein_id="YP_005524127.1"
                     /db_xref="GI:384141417"
                     /db_xref="GeneID:12115251"
                     /translation="MPAVPHSSLNPVLIQLEQVSVHRDQRDILKKVDFALHENEIVTL
                     IGPNGAGKSTLIKVLLGILKPSSGRVISNKKLKMAYVPQKFNPSHSLPLRVQDLLDLE
                     KCSPALRQEIIQDTGIAKLQQSKVQQLSGGERQRVLLARALLRKPDILVLDEPMQGLD
                     IQSEAELYEYVRSLPERYGCAILIVSHDLQWVMQGTQRVVCLNKHICCSGLPESIQQH
                     PEYQAIFGTQRVFYQHHHDHCAHGDAAHPCPHNSRPHIHPEPEA"
     misc_feature    complement(194252..194944)
                     /locus_tag="ABZJ_00171"
                     /note="ABC-type Mn/Zn transport systems, ATPase component
                     [Inorganic ion transport and metabolism]; Region: ZnuC;
                     COG1121"
                     /db_xref="CDD:224046"
     misc_feature    complement(194342..194929)
                     /locus_tag="ABZJ_00171"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl21455"
                     /db_xref="CDD:271875"
     misc_feature    complement(194813..194836)
                     /locus_tag="ABZJ_00171"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(194411..194413,194510..194515,
                     194723..194725,194810..194818,194822..194827))
                     /locus_tag="ABZJ_00171"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(194723..194734)
                     /locus_tag="ABZJ_00171"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(194558..194587)
                     /locus_tag="ABZJ_00171"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(194510..194527)
                     /locus_tag="ABZJ_00171"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(194492..194503)
                     /locus_tag="ABZJ_00171"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(194405..194425)
                     /locus_tag="ABZJ_00171"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(194944..195447)
                     /locus_tag="ABZJ_00172"
                     /db_xref="GeneID:12115252"
     CDS             complement(194944..195447)
                     /locus_tag="ABZJ_00172"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn transport system transcriptional repressor"
                     /protein_id="YP_005524128.1"
                     /db_xref="GI:384141418"
                     /db_xref="GeneID:12115252"
                     /translation="MSMSSCMHEHHDSLHGVHDHHNVASRLAEAETLCTAVGARLTPL
                     RKEVLELILNASGPMGAYDLLARIKSQTDRPAAPPTVYRTLDFLLEKGLIHRLTSINA
                     YIPCCHPREGHQAAFLICTECHTVKEASSQGLTQQLDQLAALDDFAAQHSIIEISGKC
                     QQCRTAR"
     misc_feature    complement(194959..195369)
                     /locus_tag="ABZJ_00172"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cl17326"
                     /db_xref="CDD:266630"
     misc_feature    complement(order(195064..195066,195109..195111,
                     195115..195117,195136..195138,195274..195276))
                     /locus_tag="ABZJ_00172"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(195175..195216,195220..195222))
                     /locus_tag="ABZJ_00172"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(194992..194994,195043..195045,
                     195112..195114,195118..195120))
                     /locus_tag="ABZJ_00172"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(194971..194997,195001..195009,
                     195034..195039,195085..195093))
                     /locus_tag="ABZJ_00172"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(194968..194970,195079..195081,
                     195088..195090))
                     /locus_tag="ABZJ_00172"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            195569..196408
                     /locus_tag="ABZJ_00173"
                     /db_xref="GeneID:12115253"
     CDS             195569..196408
                     /locus_tag="ABZJ_00173"
                     /codon_start=1
                     /transl_table=11
                     /product="high affinity Zn ABC transporter
                     substrate-binding protein"
                     /protein_id="YP_005524129.1"
                     /db_xref="GI:384141419"
                     /db_xref="GeneID:12115253"
                     /translation="MFRVFVFSLFSLMSTLGWSQGLVVSTHPIYLIAKEITKGVEEPQ
                     LLLQGQSGHDVQLTPAHRKAINDASLVIWLGKAHEAPLNKLLSNNKKAIALLDSGILS
                     ILPQRNTRGAALPNTVDTHVWLEPNNAVRIGFFIAALRSQQHPENKAKYWNNANTFAR
                     NMLQAAQAYDSSSNGKPYWSYHDAYQYLERSLNLKFAGALTDDPHVAPTAAQIKYLND
                     SRPKAQMCLLAESFTTKGQYQKLGSITFQPVDESMNNEDNFVTAWKKLAIKTDKCVLN
                     TQK"
     misc_feature    195635..196369
                     /locus_tag="ABZJ_00173"
                     /note="Periplasmic solute binding protein family; Region:
                     TroA; pfam01297"
                     /db_xref="CDD:250515"
     misc_feature    order(195815..195820,195827..195829,195980..195982)
                     /locus_tag="ABZJ_00173"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            196578..196976
                     /locus_tag="ABZJ_00174"
                     /db_xref="GeneID:12115254"
     CDS             196578..196976
                     /locus_tag="ABZJ_00174"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase protein I"
                     /protein_id="YP_005524130.1"
                     /db_xref="GI:384141420"
                     /db_xref="GeneID:12115254"
                     /translation="MSQTSRLIDRRLAKALVFLQACMIPVSALVAWSIKDMTAALSAA
                     LGALVCWLATSYFAWQSFRTAGARASKQVLSNMYRGMLGKFAIMIVGFILILSNVKPL
                     SPLALLFGFILVQAMSWVAPFWVSRLQKRV"
     misc_feature    196596..196967
                     /locus_tag="ABZJ_00174"
                     /note="ATP synthase I chain; Region: ATP_synt_I; cl09170"
                     /db_xref="CDD:263734"
     gene            197081..197956
                     /locus_tag="ABZJ_00175"
                     /db_xref="GeneID:12115255"
     CDS             197081..197956
                     /locus_tag="ABZJ_00175"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound ATP synthase, F0 sector, subunit
                     a, important for FO assembly"
                     /protein_id="YP_005524131.1"
                     /db_xref="GI:384141421"
                     /db_xref="GeneID:12115255"
                     /translation="MAAEEHALTSTEYIKHHLTNMTYGKMPDGTWKLAETAEEAHSMG
                     FTAIHLDSMGWSIGLGVIFCLLFWIVARAANAGVPTKFQSAIEMIIEFVDSSVRDTFH
                     GKSRLIAPLALTIFVWIFLMNLMDLIPVDWIPQVAAFVGANVFGMDPHHVYFKIVPST
                     DPNITLGMSLSVFVLILFYSIREKGVGGFVGELALNPFNPSNPVAKALLIPVNLILEL
                     VTFLARPISLALRLFGNMYAGELIFILIALLPFWIQWALSVPWAIFHILVITLQAFIF
                     MMLTIVYLSMASEKH"
     misc_feature    197192..197953
                     /locus_tag="ABZJ_00175"
                     /note="F0F1 ATP synthase subunit A; Validated; Region:
                     PRK05815"
                     /db_xref="CDD:235617"
     gene            197842..198015
                     /locus_tag="ABZJ_00176"
                     /db_xref="GeneID:12115256"
     CDS             197842..198015
                     /locus_tag="ABZJ_00176"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524132.1"
                     /db_xref="GI:384141422"
                     /db_xref="GeneID:12115256"
                     /translation="MGVICALGDLPHSCNHVAGIHLYDAYHRLLEHGKRKTLMVLPNC
                     QTMVGLNFFNLIW"
     gene            198041..198286
                     /locus_tag="ABZJ_00177"
                     /db_xref="GeneID:12115257"
     CDS             198041..198286
                     /locus_tag="ABZJ_00177"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound ATP synthase, F0 sector subunit
                     c"
                     /protein_id="YP_005524133.1"
                     /db_xref="GI:384141423"
                     /db_xref="GeneID:12115257"
                     /translation="MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPEL
                     APQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFVG"
     misc_feature    198041..198274
                     /locus_tag="ABZJ_00177"
                     /note="F0F1 ATP synthase subunit C; Validated; Region:
                     PRK06876"
                     /db_xref="CDD:180739"
     gene            198325..198795
                     /locus_tag="ABZJ_00178"
                     /db_xref="GeneID:12115258"
     CDS             198325..198795
                     /locus_tag="ABZJ_00178"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound ATP synthase, F0 sector, subunit
                     b"
                     /protein_id="YP_005524134.1"
                     /db_xref="GI:384141424"
                     /db_xref="GeneID:12115258"
                     /translation="MNINLTLIGQAIAFAFFVAFCMKFVWPPLINAISERQRKIADGL
                     NAAEKAKADLADAQAQVKQELDAAKAQAAQLIEQANRRAAQLIEEARTQAAAEGERIR
                     QQAKEAVDQEINSAREELRQQVAALAVTGAEKILNQQVDAEAHNAMLSQLAAKL"
     misc_feature    198325..198792
                     /locus_tag="ABZJ_00178"
                     /note="F0F1 ATP synthase subunit B; Validated; Region:
                     PRK05759"
                     /db_xref="CDD:180240"
     misc_feature    198391..198744
                     /locus_tag="ABZJ_00178"
                     /note="Mitochondrial ATP synthase B chain precursor
                     (ATP-synt_B); Region: Mt_ATP-synt_B; cl21478"
                     /db_xref="CDD:271898"
     gene            198808..199344
                     /locus_tag="ABZJ_00179"
                     /db_xref="GeneID:12115259"
     CDS             198808..199344
                     /locus_tag="ABZJ_00179"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound ATP synthase, F1 sector,
                     delta-subunit"
                     /protein_id="YP_005524135.1"
                     /db_xref="GI:384141425"
                     /db_xref="GeneID:12115259"
                     /translation="MAELLTLARPYAKAAFAYASEQGATDNWSNALQVLSAAVQDEAF
                     SAYLNRPELTPAEQVKLFAKVLGEDQSQAVSNFLTLLADNDRLVLLPEIAAEYEQLKS
                     QNNNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTVSVEVKPELIAGVVIRAGDQV
                     IDDSALNKLEKMRTRLLA"
     misc_feature    198808..199341
                     /locus_tag="ABZJ_00179"
                     /note="F0F1 ATP synthase subunit delta; Validated; Region:
                     PRK05758"
                     /db_xref="CDD:235593"
     gene            199391..200935
                     /locus_tag="ABZJ_00180"
                     /db_xref="GeneID:12115260"
     CDS             199391..200935
                     /locus_tag="ABZJ_00180"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound ATP synthase, F1 sector,
                     alpha-subunit"
                     /protein_id="YP_005524136.1"
                     /db_xref="GI:384141426"
                     /db_xref="GeneID:12115260"
                     /translation="MQQLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHG
                     LADAMYGEMIEFDGGLFGMALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGP
                     ELLGRVVDALGNPIDGKGPIDAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPV
                     GRGQRELIIGDRQTGKTAMAIDAIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGA
                     MAYTTVVAAAAADPAAMQYLAPYSGCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISL
                     LLRRPPGREAYPGDVFYLHSRLLERASRVSAEYVEKFTNGAVTGKTGSLTALPIIETQ
                     AGDVSAFVPTNVISITDGQIFLETSLFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSG
                     GIRTALAQYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPYSIADQAVSVY
                     ASNEGYMADVEVKKIVDFDAALIAYFRSEYAPLMKQIDETGDYNKDIEAAIKAGIESF
                     KATQTY"
     misc_feature    199397..200923
                     /locus_tag="ABZJ_00180"
                     /note="F0F1 ATP synthase subunit alpha; Validated; Region:
                     PRK09281"
                     /db_xref="CDD:236448"
     misc_feature    199478..199669
                     /locus_tag="ABZJ_00180"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    199673..200527
                     /locus_tag="ABZJ_00180"
                     /note="F1 ATP synthase alpha, central domain. The F-ATPase
                     is found in bacterial plasma membranes, mitochondrial
                     inner membranes and in chloroplast thylakoid membranes. It
                     has also been found in the archaea Methanosarcina barkeri.
                     It uses a proton gradient to...; Region: F1_ATPase_alpha;
                     cd01132"
                     /db_xref="CDD:238552"
     misc_feature    order(199736..199741,199787..199792,199796..199801,
                     199808..199810,199814..199816,199904..199909,
                     199994..200005,200009..200014,200021..200023,
                     200204..200209,200225..200233,200237..200242,
                     200255..200257,200267..200269,200276..200278,
                     200288..200290,200432..200434,200441..200443,
                     200474..200479,200486..200488,200519..200521)
                     /locus_tag="ABZJ_00180"
                     /note="beta subunit interaction interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238552"
     misc_feature    199898..199921
                     /locus_tag="ABZJ_00180"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238552"
     misc_feature    order(199904..199906,199916..199924,199976..199978,
                     199991..199993,200174..200179,200186..200188,
                     200384..200386,200432..200434,200471..200473,
                     200486..200491,200519..200521)
                     /locus_tag="ABZJ_00180"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238552"
     misc_feature    200162..200176
                     /locus_tag="ABZJ_00180"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238552"
     misc_feature    200552..200827
                     /locus_tag="ABZJ_00180"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:249758"
     gene            201013..201882
                     /locus_tag="ABZJ_00181"
                     /db_xref="GeneID:12115261"
     CDS             201013..201882
                     /locus_tag="ABZJ_00181"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit gamma"
                     /protein_id="YP_005524137.1"
                     /db_xref="GI:384141427"
                     /db_xref="GeneID:12115261"
                     /translation="MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRP
                     YADNMRRVIAHLVQANPEYKHRYMVDRPVKRVGYIIVSSDRGLAGGLNINLFKKVVQH
                     VKAQQEQSIEVQFALIGQKAVSFFKNYGGKVLGATTQIGDAPSLEQLTGSVQVMLDAF
                     DKGELDRIYLVSNGFVNAMTQKPKVEQLVPLAPAEEGDDLNRTYGWDYIYEPEAEELL
                     NGLLVRYIESMVYQGVIENVACEQSARMVAMKAATDNAGQLIKDLQLIYNKLRQAAIT
                     QEISEIVGGAAAV"
     misc_feature    201016..201870
                     /locus_tag="ABZJ_00181"
                     /note="mitochondrial ATP synthase gamma subunit; Region:
                     F1-ATPase_gamma; cd12151"
                     /db_xref="CDD:213394"
     misc_feature    order(201025..201027,201040..201042,201058..201060,
                     201070..201072,201079..201084,201088..201093,
                     201100..201105,201265..201267,201271..201282,
                     201370..201375,201382..201387,201394..201396,
                     201766..201768,201775..201780,201787..201789,
                     201805..201807,201814..201819,201823..201828,
                     201835..201840,201847..201849,201853..201870)
                     /locus_tag="ABZJ_00181"
                     /note="core domain interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213394"
     misc_feature    order(201133..201138,201142..201147,201154..201156,
                     201163..201168,201661..201663,201670..201675,
                     201682..201684)
                     /locus_tag="ABZJ_00181"
                     /note="delta subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213394"
     misc_feature    order(201379..201381,201412..201429,201670..201672,
                     201679..201684)
                     /locus_tag="ABZJ_00181"
                     /note="epsilon subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213394"
     gene            201913..203307
                     /locus_tag="ABZJ_00182"
                     /db_xref="GeneID:12115262"
     CDS             201913..203307
                     /locus_tag="ABZJ_00182"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit beta"
                     /protein_id="YP_005524138.1"
                     /db_xref="GI:384141428"
                     /db_xref="GeneID:12115262"
                     /translation="MSSGRIIQIIGAVIDVEFERTSVPKIYDALQVDGTETTLEVQQQ
                     LGDGVVRTIAMGSTEGLKRGLTVTSTNAPISVPVGTATLGRIMDVLGRPIDEAGPVAT
                     EERLPIHRQAPSYAEQAASTDLLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMME
                     LINNIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRV
                     ALTGLTMAEYFRDEKDENGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTL
                     AEEMGVLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASSG
                     IYPAIDPLDSTSRQLDPLVVGQEHYEIARAVQNVLQRYKELKDIIAILGMDELAEEDK
                     LVVYRARKIQRFFSQPFHVAEVFTGAPGKLVPLKETIRGFKGLLAGEYDHIPEQAFYM
                     VGGIDEVIAKAEKL"
     misc_feature    201913..203304
                     /locus_tag="ABZJ_00182"
                     /note="F0F1 ATP synthase subunit beta; Validated; Region:
                     PRK09280"
                     /db_xref="CDD:236447"
     misc_feature    201928..202125
                     /locus_tag="ABZJ_00182"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    202129..202965
                     /locus_tag="ABZJ_00182"
                     /note="F1 ATP synthase beta subunit, nucleotide-binding
                     domain. The F-ATPase is found in bacterial plasma
                     membranes, mitochondrial inner membranes and in
                     chloroplast thylakoid membranes. It has also been found in
                     the archaea Methanosarcina barkeri. It uses a...; Region:
                     F1-ATPase_beta; cd01133"
                     /db_xref="CDD:238553"
     misc_feature    order(202198..202200,202249..202251,202255..202260,
                     202264..202266,202270..202272,202453..202461,
                     202468..202470,202534..202542,202555..202557,
                     202663..202665,202672..202674,202684..202686,
                     202702..202710,202714..202719,202732..202734,
                     202744..202746,202765..202767,202816..202818,
                     202825..202830,202840..202842,202861..202863,
                     202867..202875,202906..202911,202936..202941,
                     202945..202947,202951..202953)
                     /locus_tag="ABZJ_00182"
                     /note="alpha subunit interaction interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238553"
     misc_feature    202357..202377
                     /locus_tag="ABZJ_00182"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238553"
     misc_feature    order(202363..202365,202372..202380,202450..202455,
                     202462..202464,202651..202653,202663..202665,
                     202915..202920)
                     /locus_tag="ABZJ_00182"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238553"
     misc_feature    202639..202653
                     /locus_tag="ABZJ_00182"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238553"
     misc_feature    order(202909..202911,202915..202917,202933..202938)
                     /locus_tag="ABZJ_00182"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238553"
     misc_feature    202987..203304
                     /locus_tag="ABZJ_00182"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:249758"
     gene            203325..203744
                     /locus_tag="ABZJ_00183"
                     /db_xref="GeneID:12115263"
     CDS             203325..203744
                     /locus_tag="ABZJ_00183"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound ATP synthase, F1 sector,
                     epsilon-subunit"
                     /protein_id="YP_005524139.1"
                     /db_xref="GI:384141429"
                     /db_xref="GeneID:12115263"
                     /translation="MATMQCDVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTL
                     LQPGPIRVLLENGTEEIVYVSGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAE
                     QLLANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ"
     misc_feature    203334..203663
                     /locus_tag="ABZJ_00183"
                     /note="mitochondrial ATP synthase delta subunit; Region:
                     F1-ATPase_delta; cd12152"
                     /db_xref="CDD:213395"
     misc_feature    203334..203633
                     /locus_tag="ABZJ_00183"
                     /note="F0F1 ATP synthase subunit epsilon; Provisional;
                     Region: atpC; PRK13451"
                     /db_xref="CDD:172059"
     misc_feature    order(203343..203345,203352..203360,203364..203366,
                     203373..203375,203439..203453,203520..203537,
                     203553..203555,203559..203567)
                     /locus_tag="ABZJ_00183"
                     /note="gamma subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    order(203358..203360,203406..203408,203454..203459,
                     203463..203465,203511..203513,203517..203525,
                     203565..203570,203574..203576,203583..203588,
                     203592..203594,203613..203615)
                     /locus_tag="ABZJ_00183"
                     /note="epsilon subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    order(203388..203390,203394..203396,203412..203417,
                     203421..203423,203427..203429,203433..203441,
                     203481..203483)
                     /locus_tag="ABZJ_00183"
                     /note="LBP interface [polypeptide binding]; other site"
                     /db_xref="CDD:213395"
     gene            complement(203805..204404)
                     /locus_tag="ABZJ_00184"
                     /db_xref="GeneID:12115264"
     CDS             complement(203805..204404)
                     /locus_tag="ABZJ_00184"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524140.1"
                     /db_xref="GI:384141430"
                     /db_xref="GeneID:12115264"
                     /translation="MKKVLQGAFFPFVIFASGMLLLGCDQTQDHAKEQESVQTNDQIS
                     DQADDSQQEITATQNKTELKNGNVFYIVRDAANLQLKAGDYIEKLKDTQLDVEQAIQD
                     KDQHELKTTVTTLKAQLEGLNQALLGLDIRSQEVENIRQSLLQANQQALSMPLLNGKL
                     EQINFDQIEKQLNTIQMDMVKLAAMIMAGDEKSDSKTDS"
     gene            complement(204549..205094)
                     /locus_tag="ABZJ_00185"
                     /db_xref="GeneID:12115265"
     CDS             complement(204549..205094)
                     /locus_tag="ABZJ_00185"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="YP_005524141.1"
                     /db_xref="GI:384141431"
                     /db_xref="GeneID:12115265"
                     /translation="MTQSVYHIPVKAISGETVDLDQYKGKVLLIVNTASKCGLTPQYE
                     GLEKLYQAKKDQGLEILGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGE
                     DKHPLYQALTTAQPERIGEGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVVARF
                     APNLTADDEQIVKAVEAELAK"
     misc_feature    complement(204570..205085)
                     /locus_tag="ABZJ_00185"
                     /note="Glutathione (GSH) peroxidase family; tetrameric
                     selenoenzymes that catalyze the reduction of a variety of
                     hydroperoxides including lipid peroxidases, using GSH as a
                     specific electron donor substrate. GSH peroxidase contains
                     one selenocysteine residue per...; Region: GSH_Peroxidase;
                     cd00340"
                     /db_xref="CDD:238207"
     misc_feature    complement(order(204666..204668,204882..204884,
                     204984..204986))
                     /locus_tag="ABZJ_00185"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238207"
     misc_feature    complement(order(204840..204842,204852..204854,
                     204861..204863,204870..204872,204876..204878,
                     204885..204887))
                     /locus_tag="ABZJ_00185"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238207"
     gene            complement(205217..205981)
                     /locus_tag="ABZJ_00186"
                     /db_xref="GeneID:12115266"
     CDS             complement(205217..205981)
                     /locus_tag="ABZJ_00186"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC-type DNA-binding domain-containing protein"
                     /protein_id="YP_005524142.1"
                     /db_xref="GI:384141432"
                     /db_xref="GeneID:12115266"
                     /translation="MKNEDQQFSLLESIEVHEFLYEKEDIVRPHASLWGDFNFSLNGI
                     LEIQVEEQIYLSPPSYGLWIPPQTVHQSTHIDHEIHYICIRLHPRLCSILGDICRCFS
                     IQPFFRTLVLQILEQQKQTEKPEYLEHLLQVLFDQLQQAPAYSHYLPQTRHPVLLPIL
                     EKLSDPLLFNLSLQQLLQNFSVSDRHLLRLSQQELQLSLSEWRNRAKIVYAIHQIRQG
                     TPIKRLAYDLGYQHSSSFIEFFKRYTGQTPVQIRNN"
     misc_feature    complement(205223..205579)
                     /locus_tag="ABZJ_00186"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(205223..205348)
                     /locus_tag="ABZJ_00186"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(206003..207217)
                     /locus_tag="ABZJ_00187"
                     /db_xref="GeneID:12115267"
     CDS             complement(206003..207217)
                     /locus_tag="ABZJ_00187"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS family transporter"
                     /protein_id="YP_005524143.1"
                     /db_xref="GI:384141433"
                     /db_xref="GeneID:12115267"
                     /translation="MDQSTTSKARPMTSTQGSWFAILAVAIAAFALVTSEFLPVGVLN
                     SVAADLHISVGTAGLIITVPGIMAAIAAPLLPVSVKQLDRRYVLILLTAIMVIANTIT
                     AFAENFHVLLLSRLILGISIGGFWATAIALSGKLAPANLPIAKATAVVMAGVTFATVL
                     GVPIGTWLSEFYGWRSAFGITAAIGLVVLVLQLIFLPKLLPESAIHIRDLPALLRTPK
                     ARSGMLIVLLIGLAHFCAYSYLAPFFKNVAGFNGTTISSLLLLYGIAGIFGNAFAGYS
                     GNLNVRYTLAFVGTCFAIVFFGFPIFAIHEFGAIVLTALWGFAFGAFPTSANIWMFVH
                     APHAVEKGMPLFVGMFQVMIATGSLLGGYVVDHFNENTLIYGVLSFVALALISTFTLA
                     KGLNNPKATCEN"
     misc_feature    complement(206039..207196)
                     /locus_tag="ABZJ_00187"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    complement(206042..207154)
                     /locus_tag="ABZJ_00187"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(206156..206158,206165..206170,
                     206177..206182,206189..206194,206225..206227,
                     206234..206239,206249..206251,206255..206260,
                     206267..206269,206408..206410,206420..206422,
                     206429..206431,206441..206443,206453..206455,
                     206495..206497,206504..206509,206516..206521,
                     206528..206530,206744..206746,206762..206767,
                     206774..206779,206816..206818,206825..206830,
                     206837..206842,206849..206854,206990..206995,
                     206999..207004,207014..207016,207023..207028,
                     207035..207037,207086..207091,207095..207103,
                     207110..207112))
                     /locus_tag="ABZJ_00187"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            207354..208004
                     /locus_tag="ABZJ_00188"
                     /db_xref="GeneID:12115268"
     CDS             207354..208004
                     /locus_tag="ABZJ_00188"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="YP_005524144.1"
                     /db_xref="GI:384141434"
                     /db_xref="GeneID:12115268"
                     /translation="MIFMTNRHETDLVNEDTLKKKRGRPKCFDEQQVLEKAMLLFWEH
                     GYEATSISDLTHALEITAPSLYSAFGDKAGLFYKSIDYYLAHEACPIETIFLEAKTAK
                     IAFELYLYDNVKRLVQPNKPAGCMLVVAAMNCSDATQEVQQNLLDKRIKTKEKLLKRL
                     EQGVEQGDLPTNAPLQEMTDFYATVIQGLTIQARDGASTEQLHKVVEHAMKAWTLF"
     misc_feature    207402..207989
                     /locus_tag="ABZJ_00188"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    207450..207581
                     /locus_tag="ABZJ_00188"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            208110..209030
                     /locus_tag="ABZJ_00189"
                     /db_xref="GeneID:12115269"
     CDS             208110..209030
                     /locus_tag="ABZJ_00189"
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family permease"
                     /protein_id="YP_005524145.1"
                     /db_xref="GI:384141435"
                     /db_xref="GeneID:12115269"
                     /translation="MSQVMKYHKWAFIFPILAVLIWSLNIVVTRYVSDYISPVSISFY
                     RWLIAFIILTPFMFLSVWRQRRLVIPYLPKLAVLSAFGMVLYQGLAYTAAHYTSATNM
                     GIVNAFIPIFTIFVSLAILKDVPNRFAVFGSILSFAGLLYVMSQGNINKLLSGGGHLG
                     DALMIIAVFFYAFYGVFLKKWQLSLPIMTSLYVQIGFSVLFHLPLIFWFGLDALNAQN
                     APSAIYAGVFASLIAPLVWMLAVQQLGPNRTSIFMNLVPVFTAIIASIWLSEQWTIYH
                     TFGGIMILVGIIMAQKKVNSKKSDLLPEQN"
     misc_feature    208122..208988
                     /locus_tag="ABZJ_00189"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    208167..208541
                     /locus_tag="ABZJ_00189"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    208614..208976
                     /locus_tag="ABZJ_00189"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(209422..209991)
                     /locus_tag="ABZJ_00190"
                     /db_xref="GeneID:12115270"
     CDS             complement(209422..209991)
                     /locus_tag="ABZJ_00190"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ribosome maturation factor
                     (dsRNA-binding protein) (RimN)"
                     /protein_id="YP_005524146.1"
                     /db_xref="GI:384141436"
                     /db_xref="GeneID:12115270"
                     /translation="MITTSVTEAAECLQQGQVLAYPTEAVWGLGCDPFNEQAFQKILE
                     LKQRPIEKGVILLAGHISQVEHLLTSLPQTTQQEIIDCWTNHQPSERATTWLLPADQH
                     IPSWIKGEHPLVAVRVTTHPLCVALCNAFHGFIVSTSANPSGQEPAHSLQDACQYFGS
                     QLNYLNGDLGQSQQPSRIINALTGEVIRP"
     misc_feature    complement(209428..209988)
                     /locus_tag="ABZJ_00190"
                     /note="Telomere recombination; Region: Sua5_yciO_yrdC;
                     cl00305"
                     /db_xref="CDD:271464"
     gene            complement(210042..211193)
                     /locus_tag="ABZJ_00191"
                     /db_xref="GeneID:12115271"
     CDS             complement(210042..211193)
                     /locus_tag="ABZJ_00191"
                     /codon_start=1
                     /transl_table=11
                     /product="Rossmann fold nucleotide-binding protein"
                     /protein_id="YP_005524147.1"
                     /db_xref="GI:384141437"
                     /db_xref="GeneID:12115271"
                     /translation="MLDVPFTMLTQLSSHHYHTLKVWYLVQHSLVSFKKIIDYFGNCE
                     KATQPDGLAKWSSLGLHANHLKRVNEFQTPQGQAQFEQLVQQVRQHTDFILTPDDSGY
                     PTQLLPYTDYPPIIFGKGQAQALLQPQIAIVGSRKPSPHGRQVAYDFAYYLSEKGFFI
                     SSGLAYGIDEAAHQGASTHQRTIAVTGTGLDTTYPAQNKKLAEHILAKNGAIITEFLP
                     GTPPLQQNFPRRNRIVSGLSLGVLVVEATLKSGSLITANKAAEQGKTVFAIPGHIYSE
                     FHQGCHQLIREGAILIDHPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLY
                     QSLDWVGQNIDQLVVHHNIPVSELTSSLMELELLGLCMQQSGLYLRCRS"
     misc_feature    complement(210054..211103)
                     /locus_tag="ABZJ_00191"
                     /note="Predicted Rossmann fold nucleotide-binding protein
                     involved in DNA uptake [DNA replication, recombination,
                     and repair / Intracellular trafficking and secretion];
                     Region: Smf; COG0758"
                     /db_xref="CDD:223829"
     misc_feature    complement(210318..210917)
                     /locus_tag="ABZJ_00191"
                     /note="DNA recombination-mediator protein A; Region:
                     DNA_processg_A; pfam02481"
                     /db_xref="CDD:251323"
     gene            complement(211193..212347)
                     /locus_tag="ABZJ_00192"
                     /db_xref="GeneID:12115272"
     CDS             complement(211193..212347)
                     /locus_tag="ABZJ_00192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524148.1"
                     /db_xref="GI:384141438"
                     /db_xref="GeneID:12115272"
                     /translation="MKKVFNGMVNFHALGIKKHLLALALCTGVAIGTIAEVHATSPNH
                     NPPSLKSNAPNVYVVKRGDTLWDISGHFLNKPWRWPEIWASNQHVKNPHWIYPGDRLL
                     LCSLDGRPLVGKDEGDGCVGIIRRYTGQTTNLQPQVRVEALNNSVPVIPLEHIKQWLE
                     NSTILPADSITNTPYIVGTADQRVLAGKGQTIYARGQGLINGQRYAVYREGEPYYFTD
                     NKGKKHSLGIELLQVASGVAVSSEKDITTLELTDSYNAEVRRGDRVMPEEQATLPTLF
                     YPVDAKQVTDGGKIIRVMGSIGRAAKNSVVTLDRGTTQGIQVGQVFDITQQGESIRDP
                     KTKEVIQLPGQQIGSLMVFRTFDQLSYAYVLESDLPIKVGSSIQPPQFND"
     misc_feature    complement(212045..>212188)
                     /locus_tag="ABZJ_00192"
                     /note="Uncharacterized protein containing LysM domain
                     [Function unknown]; Region: XkdP; COG1652"
                     /db_xref="CDD:224566"
     misc_feature    complement(212039..212182)
                     /locus_tag="ABZJ_00192"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     gene            212470..213000
                     /locus_tag="ABZJ_00193"
                     /db_xref="GeneID:12115273"
     CDS             212470..213000
                     /locus_tag="ABZJ_00193"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase 1
                     (N-formylmethionylaminoacyl-tRNA deformylase, binds
                     Zn(II))"
                     /protein_id="YP_005524149.1"
                     /db_xref="GI:384141439"
                     /db_xref="GeneID:12115273"
                     /translation="MALLPILSFPDPRLRTIAKPVEEVTDEIRQLAADMFETMYAAPG
                     IGLAASQVDRHIQLIVMDLSESKDEPMVFINPKVTPLTEETQPYEEGCLSVPQIYDKV
                     DRPSRVKIEAINLEGQAFEIEADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKV
                     EKIVRQREREKVAVKR"
     misc_feature    212485..212901
                     /locus_tag="ABZJ_00193"
                     /note="Polypeptide or peptide deformylase; a family of
                     metalloenzymes that catalyzes the removal of the
                     N-terminal formyl group in a growing polypeptide chain
                     following translation initiation during protein synthesis
                     in prokaryotes. These enzymes utilize Fe(II)...; Region:
                     Pep_deformylase; cd00487"
                     /db_xref="CDD:238271"
     misc_feature    order(212599..212607,212620..212622,212740..212748,
                     212869..212874,212881..212883)
                     /locus_tag="ABZJ_00193"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    order(212605..212607,212620..212622,212746..212748,
                     212872..212874)
                     /locus_tag="ABZJ_00193"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    order(212743..212745,212869..212871,212881..212883)
                     /locus_tag="ABZJ_00193"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            213037..213465
                     /locus_tag="ABZJ_00194"
                     /db_xref="GeneID:12115274"
     CDS             213037..213465
                     /locus_tag="ABZJ_00194"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524150.1"
                     /db_xref="GI:384141440"
                     /db_xref="GeneID:12115274"
                     /translation="MVFRSGLLLACAAVFLQIAVFLQPLLPKQYQIAPVCETITRALL
                     KPKAQTEAMSHAMHHSHHQYHIEQAQVPDHHDHHDANHQCQYCTVYANLVLPPEFGIK
                     EVLVRIQVRLVAYQQAFRHVYFALQRLFLLPQGRAPPLFA"
     gene            213569..215650
                     /locus_tag="ABZJ_00195"
                     /db_xref="GeneID:12115275"
     CDS             213569..215650
                     /locus_tag="ABZJ_00195"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane receptor protein"
                     /protein_id="YP_005524151.1"
                     /db_xref="GI:384141441"
                     /db_xref="GeneID:12115275"
                     /translation="MGCDVCCLSFGSSVCRIRKNDAETNTLHSLAPIVVTAQQGNDAN
                     GLIVHADPKQPIQPVPATDGADYLQSIMGFNSIQSGGTNGDVTFRGMFGSRIKILTDG
                     TENLGACPNRMDAPTSYISPESYDRISVIKGPQTVQYANTGSAATVLFERQPEKLTSE
                     KPYRGQASVLLGSYGRIDHNIEAAVGDEKKYIRLNANRSESNSYQDGDGNTVPSAWKK
                     WNADVALGFTPDENTWVEITGGKSDGESLYAGRSMDGSQFARESLGLRFEKKNITDVI
                     KKIEGQVNYSYNDHIMDNFSLRTPPLVEMNHGGMTMLMPNAMAMQVTRRTLNSRLAMT
                     SEWNKWSLITGVDSQFNKHGGSMSSPTMPSMNVPYRQDMRFQSYGAFGELGYQWNDQN
                     KLVTGARLDRVTVEDERADSQAKGFNTKLEKTLPSAFVRWENQHPEHDLKSYIGLGYV
                     ERMPDYWELFSPKHGNAGSTNTFNGVNPEKTLQLDLGFQQQHGALNTWASAYAGLVDD
                     YILMSYHHHPSMGMDGHDMSHDITAGAKNVDATIAGAEAGIGYQFTDRIQADLSAMYA
                     WGKNTTDDKPLPQISPLEGRLNIRYVADKYNLGLLWRAVAEQNRVSLHQGNIVGYDLK
                     PSKGFSTLSLNGSYNLRKDIDVSVGIDNVLDKTYTEHLNKAGSAGFGFASEEQFNNIG
                     RNYWVRMSMKF"
     misc_feature    213719..215647
                     /locus_tag="ABZJ_00195"
                     /note="TonB-dependent copper receptor; Region:
                     TonB-copper; TIGR01778"
                     /db_xref="CDD:233571"
     misc_feature    213746..215647
                     /locus_tag="ABZJ_00195"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(213764..213793,213824..213841,213860..213883,
                     213932..213964,213998..214024)
                     /locus_tag="ABZJ_00195"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    order(214436..214438,214526..214528)
                     /locus_tag="ABZJ_00195"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            215704..215910
                     /locus_tag="ABZJ_00196"
                     /db_xref="GeneID:12115276"
     CDS             215704..215910
                     /locus_tag="ABZJ_00196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524152.1"
                     /db_xref="GI:384141442"
                     /db_xref="GeneID:12115276"
                     /translation="MTNKLSPEQSWWGWKLLIVASILSVLFMIIFYLAINNEPDYMPS
                     QKKKQMMESHEQMNHAEMHSSSAQ"
     gene            complement(215980..217194)
                     /locus_tag="ABZJ_00197"
                     /db_xref="GeneID:12115277"
     CDS             complement(215980..217194)
                     /locus_tag="ABZJ_00197"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524153.1"
                     /db_xref="GI:384141443"
                     /db_xref="GeneID:12115277"
                     /translation="MQMISPTRLASFNDMQDSNFFTQFLNICCGKPVQPNYKEYVSLQ
                     HALYEGDIEMDKVIDWVMQSPKDHRIIFEKILFQGRDEFSKPIPTELENFFNYIEQKP
                     DWLDQQQIDEAVKFTHRLGINNGFILRDLSLMAGYLYPGFNQPLILTGALKKEAGTRL
                     AETTKWWVDITEPQGLFRLSAGFTSTIYVRFIHALVRRQLKKSSRWDSEIWGIPLNQF
                     DLAMTNLAFSSVVLLGIRALGIWPTKQEAKSFLHFWRYVGWLMGIDEKWLIQSEPEGW
                     RLLYWMQFAHPRSDHSSIELGLSLSKEPFERKYLHLRSLQQKLAYRQHLELTQFFIGK
                     KRMKLLGLPQQSASWFAYYLIVRNLLLYNGAKLSPKVEKFLSKSGRNIQKLGLTLYQN
                     QGKAKTLASMHQ"
     misc_feature    complement(216118..216819)
                     /locus_tag="ABZJ_00197"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2236); Region: DUF2236; pfam09995"
                     /db_xref="CDD:255683"
     gene            217283..217879
                     /locus_tag="ABZJ_00198"
                     /db_xref="GeneID:12115278"
     CDS             217283..217879
                     /locus_tag="ABZJ_00198"
                     /codon_start=1
                     /transl_table=11
                     /product="Bacterial regulatory protein, tetR family
                     protein"
                     /protein_id="YP_005524154.1"
                     /db_xref="GI:384141444"
                     /db_xref="GeneID:12115278"
                     /translation="MRKAPQQQRSKIIVDHILEATQQCIAQYGLLHTTTPKIAEKSGV
                     SVGSIYQYFENKDQIIEELLRRKSELLGQQLKELVVRQGNIPLELLIPLAIELGFNAL
                     KADHGFFIEVLKHWHDYSHSQAAQILEKHFFEVGLYTFSRNPHQWDFEQVKHKSFVII
                     NSTLFTMMRYVSQNNFLISEQQLKRELSSMILAYLSQK"
     misc_feature    217283..>217669
                     /locus_tag="ABZJ_00198"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    217331..217471
                     /locus_tag="ABZJ_00198"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            218380..219904
                     /locus_tag="ABZJ_rRNA4"
                     /db_xref="GeneID:12115279"
     rRNA            218380..219904
                     /locus_tag="ABZJ_rRNA4"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:12115279"
     gene            219969..220045
                     /locus_tag="ABZJ_tRNA5"
                     /db_xref="GeneID:12115280"
     tRNA            219969..220045
                     /locus_tag="ABZJ_tRNA5"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:12115280"
     gene            220101..220176
                     /locus_tag="ABZJ_tRNA6"
                     /db_xref="GeneID:12115281"
     tRNA            220101..220176
                     /locus_tag="ABZJ_tRNA6"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:12115281"
     gene            220519..223408
                     /locus_tag="ABZJ_rRNA5"
                     /db_xref="GeneID:12115282"
     rRNA            220519..223408
                     /locus_tag="ABZJ_rRNA5"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:12115282"
     gene            223595..223708
                     /locus_tag="ABZJ_rRNA6"
                     /db_xref="GeneID:12115283"
     rRNA            223595..223708
                     /locus_tag="ABZJ_rRNA6"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:12115283"
     gene            223884..224426
                     /locus_tag="ABZJ_00199"
                     /db_xref="GeneID:12115284"
     CDS             223884..224426
                     /locus_tag="ABZJ_00199"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase"
                     /protein_id="YP_005524155.1"
                     /db_xref="GI:384141445"
                     /db_xref="GeneID:12115284"
                     /translation="MQFKIIAAQDLDRNQRHQIAELCFSAFDEDPWTQYAFMQKAIHV
                     AGILNNQIVSHALWTDRVFTINGSSDVKTAYVEYVTTDYTMRGKGLASQLLKYLVDTL
                     THLEYGLAALQPEDEAFYEKLGWTVWKGNLSIKQNTCSYLTDEYEIMLYPLNIQMKDQ
                     LSNSSEEDTICADWREGELW"
     misc_feature    224028..>224183
                     /locus_tag="ABZJ_00199"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(224118..224126,224154..224159)
                     /locus_tag="ABZJ_00199"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            224633..225631
                     /locus_tag="ABZJ_00200"
                     /db_xref="GeneID:12115285"
     CDS             224633..225631
                     /locus_tag="ABZJ_00200"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase A"
                     /protein_id="YP_005524156.1"
                     /db_xref="GI:384141446"
                     /db_xref="GeneID:12115285"
                     /translation="MSTDPQFPTPNNLGIAVYSNNAEAIGNTPLVRINRLIKTDAIVL
                     AKVESRNPAFSVKCRIGAALIADAEKRGVLKEGMHIVEPTSGNTGIALAFVAAAKGYS
                     ITLTMPASMSLERRKVLKALGANLVLTEPAKGMKGAVDEAVRLATEQPEVYFLPQQFE
                     NPANPQIHVDTTGPEIWQATGGQVDILVAGVGTGGTITGISRYFEQVQNKPLYSVAVE
                     PAESPIITQTKNGENITPAPHKIQGIGANFIPKNLDLDLVDEVLPVSSEEAIQWARKC
                     ATQEGILVGISSGAALAAAAKIAERPENAGKTIVVILPDSGERYLSSVLFEGLFDE"
     misc_feature    224699..225628
                     /locus_tag="ABZJ_00200"
                     /note="cysteine synthase; Region: PLN02565"
                     /db_xref="CDD:166206"
     misc_feature    224708..225598
                     /locus_tag="ABZJ_00200"
                     /note="CBS_like: This subgroup includes Cystathionine
                     beta-synthase (CBS) and Cysteine synthase. CBS is a unique
                     heme-containing enzyme that catalyzes a pyridoxal
                     5'-phosphate (PLP)-dependent condensation of serine and
                     homocysteine to give cystathionine; Region: CBS_like;
                     cd01561"
                     /db_xref="CDD:107204"
     misc_feature    order(224720..224728,224762..224764,224780..224782,
                     224786..224788,224912..224914,224921..224923,
                     224969..224974,224981..224986,224993..224998,
                     225164..225169,225461..225469,225473..225481,
                     225554..225556,225584..225586,225593..225595)
                     /locus_tag="ABZJ_00200"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    order(224801..224803,224891..224893,225203..225220,
                     225359..225361,225491..225493,225572..225577)
                     /locus_tag="ABZJ_00200"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    224801..224803
                     /locus_tag="ABZJ_00200"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107204"
     gene            complement(225687..226268)
                     /locus_tag="ABZJ_00201"
                     /db_xref="GeneID:12115286"
     CDS             complement(225687..226268)
                     /locus_tag="ABZJ_00201"
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="YP_005524157.1"
                     /db_xref="GI:384141447"
                     /db_xref="GeneID:12115286"
                     /translation="MLTSSLAQDHFAPSQLQRLSLKFFIIALMTIMTGCTSLGPNSGS
                     FSWRSSKLSSGLQKAYSVPPSTANRLSPMIIQSADRYNVPPLLLAAVIRQESSYNSNA
                     RSPTGAIGLTQIIPSYWQQTCAGNLYDESTNIQCGAYILNHYYQTADSWFKATAYYNV
                     GPTGYERSFWTRHKAKKYARSVKRHQKTLKSAL"
     misc_feature    complement(225693..>226094)
                     /locus_tag="ABZJ_00201"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    complement(225708..226016)
                     /locus_tag="ABZJ_00201"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(order(225795..225797,225849..225851,
                     225924..225926,225984..225986))
                     /locus_tag="ABZJ_00201"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(225984..225986)
                     /locus_tag="ABZJ_00201"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(226601..227167)
                     /locus_tag="ABZJ_00202"
                     /db_xref="GeneID:12115287"
     CDS             complement(226601..227167)
                     /locus_tag="ABZJ_00202"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent fmn reductase"
                     /protein_id="YP_005524158.1"
                     /db_xref="GI:384141448"
                     /db_xref="GeneID:12115287"
                     /translation="MKTVAIIYHSRQGHTQFIAQQIQIGVLSHHNIKADLLNAEDLIE
                     RPEILIQYDGLIWGSPTYLGGVSSKLKQLMDATGPLWKKQSFKGKLAAGFTVSSLPAG
                     DKQSTLISIFTFCMQHGMLWVGNPILPEQHQGVAYTQAANRLGSWSGLMAQAEHASNA
                     DGFDEGDIKTAQQFGENFALTLNAYQGT"
     misc_feature    complement(226625..227167)
                     /locus_tag="ABZJ_00202"
                     /note="Multimeric flavodoxin WrbA [General function
                     prediction only]; Region: WrbA; COG0655"
                     /db_xref="CDD:223728"
     gene            complement(227184..227669)
                     /locus_tag="ABZJ_00203"
                     /db_xref="GeneID:12115288"
     CDS             complement(227184..227669)
                     /locus_tag="ABZJ_00203"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524159.1"
                     /db_xref="GI:384141449"
                     /db_xref="GeneID:12115288"
                     /translation="MNTSTLFFQALCLGIGATIVMDIWLLILKIFKVPTLNFAFLGRW
                     VGWIFQGKLVHQSIAKSPPMKGEYLLGWIAHYSVGIIFALSFLLIVGSTWLDHPQFYS
                     ALLFGLVTVLIPFFIMQPAMGSGFASSKTPHPFLNCLKSLLNHSVFGCGLYLTAKLFQ
                     I"
     misc_feature    complement(227196..227639)
                     /locus_tag="ABZJ_00203"
                     /note="Protein of unknown function (DUF2938); Region:
                     DUF2938; pfam11158"
                     /db_xref="CDD:256325"
     gene            227751..228155
                     /locus_tag="ABZJ_00204"
                     /db_xref="GeneID:12115289"
     CDS             227751..228155
                     /locus_tag="ABZJ_00204"
                     /codon_start=1
                     /transl_table=11
                     /product="SoxR family transcriptional regulator"
                     /protein_id="YP_005524160.1"
                     /db_xref="GI:384141450"
                     /db_xref="GeneID:12115289"
                     /translation="MDIGEVAKKAKVTTATLRFYEEKGLIKSIGRQGLRRQYSKQVID
                     QLALIALGRAAGFSLNEIATMFGQDGKPDLDRQKLKDKAEQLEQMAKRLHFISQGLEH
                     AAVCPAENHMECPTFQKFLKAAIAGEYQPTKL"
     misc_feature    227751..228107
                     /locus_tag="ABZJ_00204"
                     /note="Helix-Turn-Helix DNA binding domain of putative
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-like_sg6; cd04781"
                     /db_xref="CDD:133408"
     misc_feature    227751..228095
                     /locus_tag="ABZJ_00204"
                     /note="Cu(I)-responsive transcriptional regulator; Region:
                     CueR; TIGR02044"
                     /db_xref="CDD:131099"
     misc_feature    order(227754..227762,227802..227804,227850..227858)
                     /locus_tag="ABZJ_00204"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133408"
     misc_feature    order(227892..227894,227901..227903,227913..227918,
                     227943..227945,227985..227987,227997..227999,
                     228015..228017,228027..228029,228036..228041)
                     /locus_tag="ABZJ_00204"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133408"
     misc_feature    order(228066..228068,228090..228092)
                     /locus_tag="ABZJ_00204"
                     /note="putative metal binding residues [ion binding];
                     other site"
                     /db_xref="CDD:133408"
     gene            228303..229562
                     /locus_tag="ABZJ_00205"
                     /db_xref="GeneID:12115290"
     CDS             228303..229562
                     /locus_tag="ABZJ_00205"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524161.1"
                     /db_xref="GI:384141451"
                     /db_xref="GeneID:12115290"
                     /translation="MSKKTLIALLCCASLGLTACNDDNDQDQTSPTENVTEPTLISFA
                     KLPVETYAAGPDSGAYVKGANGIYPPFKGQPVQGFSAALKNEDGSYMAMADNGFGTQD
                     NSSDFLLRIYKIKPDFKTKTKGTGQVNVQSFIQLRDPNKLIPFNIINGNTPERLLTGA
                     DFDPESMQRTSDGTYWIGDEFGPYLLHFSADGVLLDAPIPLPNPLNPTQELRSPQNQF
                     NKAQINFVEPLVQQSGGFEGMAISPDGQYLYPLIEKPIKSIRETERQLLISQFDLKKK
                     AYTGKYYWFQLDSKATNIGDFQLFNDKEGIIIERDATQNNLGGYKKLIRIKLNESGQL
                     VSREDLVDLIKIANPNMLYGTARAGDIGTGQVFAFPFETIEDVIIENGTTLTVFNDNN
                     FPGSTGRNAKLADDNEIIQIRLPKALF"
     misc_feature    228393..229526
                     /locus_tag="ABZJ_00205"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4222"
                     /db_xref="CDD:226675"
     misc_feature    228510..229547
                     /locus_tag="ABZJ_00205"
                     /note="Esterase-like activity of phytase; Region:
                     Phytase-like; pfam13449"
                     /db_xref="CDD:257774"
     gene            229777..232155
                     /locus_tag="ABZJ_00206"
                     /db_xref="GeneID:12115291"
     CDS             229777..232155
                     /locus_tag="ABZJ_00206"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="YP_005524162.1"
                     /db_xref="GI:384141452"
                     /db_xref="GeneID:12115291"
                     /translation="MSTAYTMQTAPKALFDYDKYWASCFEPAPFLPMSREEMDQLGWD
                     ACDFILVCGDAYIDHPSFVSGVIGRVLEAQGFRVGIIAQPDWTNVESFRVLGKPTIAW
                     GVTAGNMDSMINRYTADRKIRSDDAYSPNNEPNKRPDRAATVYCQRCREAFPDVPVLL
                     GGIEGSLRRIAHYDYWSDKVRRSILMDSKADMLMYGNGERAIIDVMHRLAKGEKIHEI
                     TDVRGTAFIINKHNKAAKAKFVEIASNDVDTIGRVDPIINPYVMTEDIDGCEIEKDKG
                     NTLAQYQGFQKEIVANPIVREGDQLDENTQIVQLKPAQSKAIKHKLPPRELAVIRLPS
                     FEEVANDQVLYAHANRILHLETNPGNARALVQRHGERDVWINPPPIPLTTEEMDYVFD
                     LPYARLPHPAYGDARFPAFDMIKFSVNIMRGCFGGCTFCSITEHEGRIIQNRSEDSIL
                     REIEKIRDTAPNFTGIISDLGGPTANMYRLHCKDPEIEKNCRKPSCVYPGVCQNLHTD
                     HAPLVQLYRKARAIKGVKKILIGSGLRYDLAVLNPEYVKELVQHHVGGYLKIAPEHTE
                     QGPLSKMMKPGIGTYDRFKQMFDRFSKEAGKEQYLIPYFIAAHPGTSDYDMMHLAIWL
                     KKNGFRADQVQTFYPSPMATATTMYYSGKNPLAKVARYTENVDIVKGEKRRRLHKAFL
                     RYHDPNNWPLLREALKEMGRADLIGNSKQHLIPTYQPKGAEGEYKSARKKNSTVAGDS
                     VKRSGQTVQNKNQHKRPQKGQVLTQHTGLPPRETGEKRPFGGKSKPKSKARG"
     misc_feature    229795..232101
                     /locus_tag="ABZJ_00206"
                     /note="hypothetical protein; Provisional; Region:
                     PRK01254"
                     /db_xref="CDD:234928"
     misc_feature    229864..231027
                     /locus_tag="ABZJ_00206"
                     /note="Radical SAM N-terminal; Region: Radical_SAM_N;
                     pfam08497"
                     /db_xref="CDD:254836"
     misc_feature    231016..231723
                     /locus_tag="ABZJ_00206"
                     /note="Elongator protein 3, MiaB family, Radical SAM;
                     Region: Elp3; smart00729"
                     /db_xref="CDD:214792"
     misc_feature    231670..232101
                     /locus_tag="ABZJ_00206"
                     /note="Domain of unknown function (DUF3362); Region:
                     DUF3362; pfam11842"
                     /db_xref="CDD:256664"
     gene            232469..232969
                     /locus_tag="ABZJ_00207"
                     /db_xref="GeneID:12115292"
     CDS             232469..232969
                     /locus_tag="ABZJ_00207"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524163.1"
                     /db_xref="GI:384141453"
                     /db_xref="GeneID:12115292"
                     /translation="MYYLITILLLFLTVVMAAKSLSRKHQQDSALKRRAVLSSHEQMT
                     LTRLQTVLPKFTVLAHVSFDALLTTKYAHTRRKYQNMTADFVVLDQNYQVVVVVMLEE
                     SGLRRAHQQYERRLLQLAGYRVLSYSTVPDYHELRRDLLTPESEMATLHVTPQLERIS
                     NAFVKS"
     misc_feature    232565..232888
                     /locus_tag="ABZJ_00207"
                     /note="Superfamily of nucleases including Short Patch
                     Repair (Vsr) Endonucleases, archaeal Holliday junction
                     resolvases, MutH methy-directed DNA mismatch-repair
                     endonucleases, and catalytic domains of many restriction
                     endonucleases, such as EcoRI, BamHI, and...; Region:
                     Restriction_endonuclease_like; cl00277"
                     /db_xref="CDD:271456"
     gene            complement(233115..233468)
                     /locus_tag="ABZJ_00208"
                     /db_xref="GeneID:12115293"
     CDS             complement(233115..233468)
                     /locus_tag="ABZJ_00208"
                     /codon_start=1
                     /transl_table=11
                     /product="YjgF family translation initiation inhibitor"
                     /protein_id="YP_005524164.1"
                     /db_xref="GI:384141454"
                     /db_xref="GeneID:12115293"
                     /translation="MTVKRLHVTSRYCEVAISGNLVHLAGQLADDTSVDITAQTQQTL
                     DNIDRLLAEAGTDKSHILSVMIFLKDIDKDYAAMNTVWDAWISKEHPPARTCVESKLY
                     APDVLVEMTVVAVLP"
     misc_feature    complement(233124..233438)
                     /locus_tag="ABZJ_00208"
                     /note="This group of proteins belong to a large family of
                     YjgF/YER057c/UK114-like proteins present in bacteria,
                     archaea, and eukaryotes with no definitive function.  The
                     conserved domain is similar in structure to chorismate
                     mutase but there is no sequence...; Region:
                     YjgF_YER057c_UK114_like_2; cd06150"
                     /db_xref="CDD:100007"
     misc_feature    complement(order(233130..233132,233136..233138,
                     233142..233144,233172..233198,233211..233213,
                     233223..233225,233232..233234,233268..233270,
                     233274..233276,233280..233285,233289..233291,
                     233391..233396,233400..233402,233406..233408,
                     233415..233417,233421..233423,233430..233435))
                     /locus_tag="ABZJ_00208"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100007"
     misc_feature    complement(order(233142..233144,233187..233189,
                     233232..233234,233244..233246,233433..233435))
                     /locus_tag="ABZJ_00208"
                     /note="putative active site [active]"
                     /db_xref="CDD:100007"
     gene            complement(233789..234844)
                     /locus_tag="ABZJ_00209"
                     /db_xref="GeneID:12115294"
     CDS             complement(233789..234844)
                     /locus_tag="ABZJ_00209"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV, devoid of proofreading,
                     damage-inducible protein P"
                     /protein_id="YP_005524165.1"
                     /db_xref="GI:384141455"
                     /db_xref="GeneID:12115294"
                     /translation="MRKIIHIDMDAFYASVELRERPDLRHLPVVISSHHPRAVIAAAS
                     YPARQFGLRSAMSMSQARKLCPQVVIIEPNFEKYRAISAQIHSIFQQYTTLIEPLSLD
                     EAYLDVTENLKQIASATEVAMHIREDIFRQTGLTASAGVAPNKFLAKVASDWNKPNGL
                     FVIKPSQVASFIQDLPLKKIPGVGKVTQEKLQQLELHTLGDLQKIEEAVLVHHFGKYG
                     QQLYLYAQGIDNRPVQAERARQQISKETTFDSDFTLAQCQPYWHGLAEKVWQSLEKKQ
                     LNARGVNIKLKLKNFQTLQHSKSFKNPIHSQQDLIQVLFLLLNEMHIPENFQFRLIGI
                     GVYQLQTKADDFQLSLW"
     misc_feature    complement(233828..234832)
                     /locus_tag="ABZJ_00209"
                     /note="DNA Polymerase IV/Kappa; Region: PolY_Pol_IV_kappa;
                     cd03586"
                     /db_xref="CDD:176459"
     misc_feature    complement(order(234377..234379,234539..234541,
                     234701..234703,234710..234712,234719..234724,
                     234806..234814,234818..234823))
                     /locus_tag="ABZJ_00209"
                     /note="active site"
                     /db_xref="CDD:176459"
     misc_feature    complement(233792..234820)
                     /locus_tag="ABZJ_00209"
                     /note="DNA polymerase IV; Validated; Region: PRK02406"
                     /db_xref="CDD:235035"
     misc_feature    complement(order(233831..233833,233840..233842,
                     233852..233857,233948..233950,233954..233965,
                     234032..234034,234104..234127,234194..234199,
                     234284..234304,234398..234400,234536..234541,
                     234545..234547,234674..234676,234746..234748))
                     /locus_tag="ABZJ_00209"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176459"
     gene            complement(234846..235604)
                     /locus_tag="ABZJ_00210"
                     /db_xref="GeneID:12115295"
     CDS             complement(234846..235604)
                     /locus_tag="ABZJ_00210"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lysozyme"
                     /protein_id="YP_005524166.1"
                     /db_xref="GI:384141456"
                     /db_xref="GeneID:12115295"
                     /translation="MTKLAKTFSAPRYNTLIGIVLACVMGVLTYFGLFYQQKAIAQDY
                     PVQGFDVSHHQENINWKKISPKKFQFVYLKATEGGDYKDPKFQENWLKAREHGFHVGA
                     YHFYRLCRDGKTQAENFISTVPNKADALPPVIDLEYDSNCINSHTKEQLLKEIGIMHD
                     SLKHHYGKQPIFYISKTFYHIVLIGSFPNTPLWVRDYEGKPELKDKRKWLFWQHSNQG
                     KIEGMTKPVDLNVYEGSVKEWHQFLQQQGIVKAQ"
     misc_feature    complement(234903..235475)
                     /locus_tag="ABZJ_00210"
                     /note="Uncharacterized bacterial muramidase containing a
                     glycosyl hydrolase family 25 (GH25) catalytic domain.
                     Endo-N-acetylmuramidases are lysozymes (also referred to
                     as peptidoglycan hydrolases) that degrade bacterial cell
                     walls by catalyzing the hydrolysis...; Region:
                     GH25_muramidase_1; cd06413"
                     /db_xref="CDD:119375"
     misc_feature    complement(order(234921..234923,234966..234968,
                     235026..235028,235086..235088,235194..235196,
                     235200..235202,235290..235292,235296..235298,
                     235383..235385,235455..235457))
                     /locus_tag="ABZJ_00210"
                     /note="active site"
                     /db_xref="CDD:119375"
     misc_feature    complement(234936..235457)
                     /locus_tag="ABZJ_00210"
                     /note="Glycosyl hydrolases family 25; Region:
                     Glyco_hydro_25; pfam01183"
                     /db_xref="CDD:250424"
     gene            complement(235682..237073)
                     /locus_tag="ABZJ_00211"
                     /db_xref="GeneID:12115296"
     CDS             complement(235682..237073)
                     /locus_tag="ABZJ_00211"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane transport protein YieO"
                     /protein_id="YP_005524167.1"
                     /db_xref="GI:384141457"
                     /db_xref="GeneID:12115296"
                     /translation="MNATPTHQALQPEYRLLVLLVSIGFFMQALDTTIVNTAIPAMAH
                     HLNEDPLRMHSVVVAYVLSVAACIPLSGWLADRFGVRNTFLSAIIIFTLASLGCGLSQ
                     SLNQLLFFRVIQGVGGALLLPVGRLSLLKIIPRTQFLAAMSLMSLAGLLGPLAGPTLG
                     GWLVEVATWHWIFLINIPMGVLGILMTLKVMPNVKEPTVKTFDLIGFVLLVIAMIGWS
                     LGIEHLASPEYSKWFSISLLVVGAVATLWYAYHSHTHQNALFRSRLFRNKIYAIGILG
                     NFFARFGGNALPFVLPLMLQVAFGFEPFIAGLMMIPLVLGSLFSKPIVRPIIQKMGYR
                     RFLLINTTLVGLCIASFTIMTVDTPTWFRALHFFLFGTLNSLQFVGMNTLTLKDLPQQ
                     DASSGNSFLSMIMMLSMSIGVALAGTLINVFTDYYGTAHVTTAFHVTLICLGCINIIT
                     ALIFWQIPKNTPV"
     misc_feature    complement(235709..237022)
                     /locus_tag="ABZJ_00211"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(235691..237016)
                     /locus_tag="ABZJ_00211"
                     /note="putative transporter; Provisional; Region:
                     PRK10504"
                     /db_xref="CDD:182502"
     misc_feature    complement(order(235847..235849,235856..235861,
                     235868..235873,235880..235885,235916..235918,
                     235925..235930,235940..235942,235949..235954,
                     235961..235963,236111..236113,236123..236125,
                     236132..236134,236144..236146,236156..236158,
                     236198..236200,236207..236212,236219..236224,
                     236231..236233,236615..236617,236633..236638,
                     236645..236650,236684..236686,236693..236698,
                     236705..236710,236717..236722,236858..236863,
                     236867..236872,236882..236884,236891..236896,
                     236903..236905,236954..236959,236963..236971,
                     236978..236980))
                     /locus_tag="ABZJ_00211"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(237282..237905)
                     /locus_tag="ABZJ_00212"
                     /db_xref="GeneID:12115297"
     CDS             complement(237282..237905)
                     /locus_tag="ABZJ_00212"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524168.1"
                     /db_xref="GI:384141458"
                     /db_xref="GeneID:12115297"
                     /translation="MNSVLTMAVNDSPITSVKTTQPLIALYCGSRAGNNPIYREKAIE
                     LASGIAEQGFGLVYGGASIGLMGQVAESVLAHGGEAVGVIPEFMLDYEVAHAGLTELH
                     VVETMHERKAMMAERASAFIALPGGLGTFEEILEIATWGQLNQHQKPMILYNVNGFYN
                     ALIAQLDHAVQEGFLPLQHRAKLIVCEEIDQIYNVIKNLKMPKRFVV"
     misc_feature    complement(237312..237842)
                     /locus_tag="ABZJ_00212"
                     /note="DNA recombination-mediator protein A; Region:
                     DNA_processg_A; cl00695"
                     /db_xref="CDD:271513"
     gene            238104..238235
                     /locus_tag="ABZJ_00213"
                     /db_xref="GeneID:12115298"
     CDS             238104..238235
                     /locus_tag="ABZJ_00213"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524169.1"
                     /db_xref="GI:384141459"
                     /db_xref="GeneID:12115298"
                     /translation="MGSGCSRSVLISCPKKTLFPLCLGMPFALPNKDKIHPAQEQDQ"
     gene            238232..239824
                     /locus_tag="ABZJ_00214"
                     /db_xref="GeneID:12115299"
     CDS             238232..239824
                     /locus_tag="ABZJ_00214"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524170.1"
                     /db_xref="GI:384141460"
                     /db_xref="GeneID:12115299"
                     /translation="MIFEWMSDPSAWVGLATLIVLEIVLGIDNLVFIAILAEKLPPEQ
                     RTKARIVGLILALGMRLILLASIAWVVTLTQPLFHIFSHPFSGRDLILLFGGVFLLFK
                     GTMELHERMEGKQLHKEDNPVHAAFWMVIVQIVVLDAVFSLDSVITAVGMVKELSVMM
                     VAVVIAVGIMLWASRPLMDFVNKHPTVVILCLGFLMMIGFSLVVEGFGFHIPKGYLYA
                     AIGFSILVEMINQTMRRNQEKLVTTTDLRYRTASAVLRMLGSKNSGSTSDAQTADKED
                     VLATQAFADEVFDEENGAYHSVLVQGVLGLSERPVKSVMTPRPELEWIDLDEEPEVLK
                     ERLMSMTHSRLIVARGELDNIEGIALTHKVLNGFIETGVIDFQKHLREPVIVHENAQV
                     LMVMEQLRQAPLQMAIVLNEYGSIEGIATPIDILEAIAGEFPDEDELDAAAESLEDGS
                     LILEGSTDIRHVSLLLGRDLVDESEQYSTLSGYLLFHLGRLPENGETVEADGYRFEVV
                     TMEGHKIEKVHIVSIEQDESKD"
     misc_feature    238232..238948
                     /locus_tag="ABZJ_00214"
                     /note="Membrane protein TerC, possibly involved in
                     tellurium resistance [Inorganic ion transport and
                     metabolism]; Region: TerC; COG0861"
                     /db_xref="CDD:223930"
     misc_feature    <238967..239821
                     /locus_tag="ABZJ_00214"
                     /note="Hemolysins and related proteins containing CBS
                     domains [General function prediction only]; Region: TlyC;
                     COG1253"
                     /db_xref="CDD:224173"
     misc_feature    239186..239515
                     /locus_tag="ABZJ_00214"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    239567..239794
                     /locus_tag="ABZJ_00214"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     smart01091"
                     /db_xref="CDD:215020"
     gene            239896..240396
                     /locus_tag="ABZJ_00215"
                     /db_xref="GeneID:12115300"
     CDS             239896..240396
                     /locus_tag="ABZJ_00215"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524171.1"
                     /db_xref="GI:384141461"
                     /db_xref="GeneID:12115300"
                     /translation="MTQQTCPCGKGSYAECCEPLHLGTAKALTAEQLMRSRYSAFALQ
                     QIDYIVQTTALGQQTALDKEAIAEWSKQNQWLGLEVVNANEKLDKTHAQVEFKAHYHD
                     GKSAQIHHEVSHFVFHQQQWFFLDPTVDMQVTMKQPCICGSGKNLNNAVHNSYNFILK
                     YAHRLA"
     misc_feature    239905..240330
                     /locus_tag="ABZJ_00215"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3012"
                     /db_xref="CDD:225557"
     misc_feature    239911..240282
                     /locus_tag="ABZJ_00215"
                     /note="SEC-C motif; Region: SEC-C; cl19389"
                     /db_xref="CDD:267742"
     gene            240408..241052
                     /locus_tag="ABZJ_00216"
                     /db_xref="GeneID:12115301"
     CDS             240408..241052
                     /locus_tag="ABZJ_00216"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524172.1"
                     /db_xref="GI:384141462"
                     /db_xref="GeneID:12115301"
                     /translation="MLLTVIYIIAITAEAMTGALSAGRRSMDWFGVVLIACVTALGGG
                     SVRDVLLGHYPLTWVKHPEYLVLTCCAAFVTIVIAKWMRHLHNIFLVLDALGLIGFTI
                     IGCQIALQMGHGFVVSAVAGVLTGVSGGILRDILCNDVPFVFRRELYASISFVAVICY
                     WVCLDLGLSLELTVISTLVFGFTLRLIAIYFGLEMPKFIYKDDDAESASSTDEH"
     misc_feature    240408..241016
                     /locus_tag="ABZJ_00216"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2860"
                     /db_xref="CDD:225415"
     misc_feature    240414..240650
                     /locus_tag="ABZJ_00216"
                     /note="UPF0126 domain; Region: UPF0126; pfam03458"
                     /db_xref="CDD:251969"
     misc_feature    240672..240911
                     /locus_tag="ABZJ_00216"
                     /note="UPF0126 domain; Region: UPF0126; pfam03458"
                     /db_xref="CDD:251969"
     gene            241135..242454
                     /locus_tag="ABZJ_00217"
                     /db_xref="GeneID:12115302"
     CDS             241135..242454
                     /locus_tag="ABZJ_00217"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_005524173.1"
                     /db_xref="GI:384141463"
                     /db_xref="GeneID:12115302"
                     /translation="MDLISRIQNLPIGKFHYTLLWVVGLGWMFDAMDTGIIAFIMTTL
                     VKDWSLTPVESGWIVSIGFVGMAIGAVCSGALADRFGRKTVFAMTMAIYSIATALCAF
                     APDLKWLLIFRFIVGLGLGGQLPVAVTLVSEYVPAHVRGRFIVLLESFWGLGWLVAAL
                     ISYFIIPKFGWHIAFLIGGLPLIYILVIWKKVPESIPYLINRGRIEEAHALVQKLEAE
                     ACVQIVHHIEVVPVAMRQKVSFKQLWSGQFARRSLMLWLIWFGIVYSYYGIFTWLPSL
                     LVKQGYDIVKSFEYVLLMILAQLPGYLAAAWFVERLGRKITLAAFIGFCALSAYFFGQ
                     ADSVNSIMFWGCLMSFFNLGAWGVLYTYTPEQYPANIRAFGSGWASAMGRIGGIVAPM
                     VVTHMMVAKNGFNHVFMMFTVVLLAVALVILILGEETQGKRLESIGL"
     misc_feature    241138..242316
                     /locus_tag="ABZJ_00217"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    241192..242409
                     /locus_tag="ABZJ_00217"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(241234..241236,241243..241251,241255..241260,
                     241309..241311,241318..241323,241330..241332,
                     241342..241347,241351..241356,241492..241497,
                     241504..241509,241516..241521,241528..241530,
                     241564..241569,241576..241581,241597..241599,
                     241921..241923,241930..241935,241942..241947,
                     241954..241956,241993..241995,242005..242007,
                     242017..242019,242026..242028,242038..242040,
                     242179..242181,242188..242193,242200..242202,
                     242212..242217,242224..242226,242257..242262,
                     242269..242274,242281..242286,242293..242295)
                     /locus_tag="ABZJ_00217"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            242608..244827
                     /locus_tag="ABZJ_00218"
                     /db_xref="GeneID:12115303"
     CDS             242608..244827
                     /locus_tag="ABZJ_00218"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="YP_005524174.1"
                     /db_xref="GI:384141464"
                     /db_xref="GeneID:12115303"
                     /translation="MTSLAHHATENRSVAEFTEQAYLNYAMYVIMDRALPHISDGLKP
                     VQRRIVYAMSELGLKSSGKPKKSARTVGDVLGKYHPHGDLACYEAMVLMAQPFSYRYP
                     LIEGQGNWGSPDDPKSFAAMRYTEAKLSAYSELLLSELGQGTSEWQDNFDGSLKEPIT
                     LPARVPNILLNGTTGIAVGMATDIPPHNLREVVKGTIALIRNPQTSDEKLAEYIPAPD
                     LPTKAEIITPPEELLKIQTTGRGSYRMRAVYTIEKNEIVITELPYQVSGSKVITQIAD
                     QMQAKKLPLVVDVRDESDHENPTRLVIVLRSNRIDAEAVMSHLFATTDLESSYRVNLN
                     MIGEDGRPQVKSIRRILLEWIEIRKKTVTRRLQYHLNRIEKRLHILAGLLIAYLDIDT
                     VIRIIREEDQPKPVLMEHFNIDEIQAEAILELKLRHLAKLEEMEIRHEQDELSAKAAI
                     IREQLENPESLKNLIIGELKEDAKKFGDERRSPIVARAEAVQIKEQDLMPAETVTVVL
                     SEAGWVRAAKGADVDAENLNYRAGDQYLSHAVGKTNQRVYFLDETGRSYALPISNLPS
                     ARGLGDPLSSKLSPASGVSFIQVYLDDDESELIAASSAGYGFKTQTKQLDTNAKAGKT
                     FLTVPDKAKALPLISAQNMTHLAVLSSAGRLLILDLAELPNLNKGKGNKLIQLEGKEQ
                     ILSMTTLNLDEIIQVVAGQQHLKLKGDDLQKYMGKRASKGQLLPRGYQKANKLLIQR"
     misc_feature    242608..244812
                     /locus_tag="ABZJ_00218"
                     /note="DNA topoisomerase IV subunit A; Validated; Region:
                     PRK05561"
                     /db_xref="CDD:235503"
     misc_feature    242698..244020
                     /locus_tag="ABZJ_00218"
                     /note="DNA Topoisomerase, subtype IIA; domain A';
                     bacterial DNA topoisomerase IV (C subunit, ParC),
                     bacterial DNA gyrases (A subunit, GyrA),mammalian DNA
                     toposiomerases II. DNA topoisomerases are essential
                     enzymes that regulate the conformational changes...;
                     Region: TOP4c; cd00187"
                     /db_xref="CDD:238111"
     misc_feature    order(242698..242781,242794..242943,242947..242952,
                     242956..243006,243010..243081,243088..243090)
                     /locus_tag="ABZJ_00218"
                     /note="CAP-like domain; other site"
                     /db_xref="CDD:238111"
     misc_feature    242977..242979
                     /locus_tag="ABZJ_00218"
                     /note="active site"
                     /db_xref="CDD:238111"
     misc_feature    order(243769..243777,243784..243795,243817..243822,
                     243862..243912)
                     /locus_tag="ABZJ_00218"
                     /note="primary dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238111"
     gene            245125..246804
                     /locus_tag="ABZJ_00219"
                     /db_xref="GeneID:12115304"
     CDS             245125..246804
                     /locus_tag="ABZJ_00219"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="YP_005524175.1"
                     /db_xref="GI:384141465"
                     /db_xref="GeneID:12115304"
                     /translation="MEKIWFAEYQKTGIPETVALPAENTSLVDIFERNFQKFGSRDAF
                     IFMDKAMSFNELELASRKFATYLQNLGLAKGTRVAVMMPNVLQYPVVALAVLRAGLVL
                     VNVNPLYTARELEHQLNDSGAEVLVIIENFASVYQSILGKTPVKHVVVASVGDMLGTL
                     KGTLVNFVLRKVRKQIPAWNIPGHVKFNSALNKENPSNYKRPTLTLSDTAVLQYTGGT
                     TGVSKGAELTHRNLVANLLQCDGIFQSKFGANDGAKGDRIVCALPLYHIFAFMVCAMY
                     GMYKGQANILIPNPRDLPAVIKELRKYQPSFFPAVNTLFNALVNNEEFKQLDHSNLKM
                     AMGGGMAVLPSTAEAWKKITGTTIIEGYGLSETSPVATANPPASTEFSGTIGIPLPLT
                     EVAILDDDGKEVPLGEQGEISIRGPQVMKGYWNRPDETAKVMTADGFFRTGDIGVMDS
                     RGYVKIVDRKKDMILVSGFNVYPSEIEEVIAKHPKVLEVAAIGVPDEKSGEVPKLFIV
                     KKDPSLTTEEVLNFAKENLTGYKRPRYVEFMDELPKSNVGKILRKDLRKPA"
     misc_feature    245125..246792
                     /locus_tag="ABZJ_00219"
                     /note="Long-chain-fatty-acid--CoA ligase; Validated;
                     Region: PRK07059"
                     /db_xref="CDD:235923"
     misc_feature    245203..246792
                     /locus_tag="ABZJ_00219"
                     /note="Prokaryotic long-chain fatty acid CoA synthetases
                     similar to Escherichia coli FadD; Region:
                     FC-FACS_FadD_like; cd05936"
                     /db_xref="CDD:213302"
     misc_feature    order(245758..245760,245767..245784,245788..245793)
                     /locus_tag="ABZJ_00219"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    order(245767..245769,246136..246141,246202..246219,
                     246454..246456,246490..246492,246499..246501,
                     246532..246534,246769..246771)
                     /locus_tag="ABZJ_00219"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    order(245767..245769,245908..245913,246055..246057,
                     246061..246066,246073..246075,246136..246141,
                     246202..246219,246454..246456,246490..246492,
                     246499..246501,246523..246534,246712..246714)
                     /locus_tag="ABZJ_00219"
                     /note="putative active site [active]"
                     /db_xref="CDD:213302"
     misc_feature    order(245908..245910,246061..246066,246073..246075,
                     246136..246138,246523..246531,246694..246696,
                     246712..246714)
                     /locus_tag="ABZJ_00219"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     gene            complement(246843..247226)
                     /locus_tag="ABZJ_00220"
                     /db_xref="GeneID:12115305"
     CDS             complement(246843..247226)
                     /locus_tag="ABZJ_00220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524176.1"
                     /db_xref="GI:384141466"
                     /db_xref="GeneID:12115305"
                     /translation="MQQPDQKELFEVLEKQKKNQLQVDRIFKIVLPIVAFLLSVICAN
                     FNWQSTLGTFVILTVTFIAVGVKRLPLWHWLIVITIYCLVDNYLSYGQLDVTHLRLQL
                     GTMLVFVGMVGIGRPYVDRWFMKNH"
     gene            247318..247731
                     /locus_tag="ABZJ_00221"
                     /db_xref="GeneID:12115306"
     CDS             247318..247731
                     /locus_tag="ABZJ_00221"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524177.1"
                     /db_xref="GI:384141467"
                     /db_xref="GeneID:12115306"
                     /translation="MMDGTMHGISSIIYIILVACLLPYAFTVIAKFTGGFQPVDNQNP
                     RDFLANTKGIAARANAVQQNSFESLPLFLTAILMAEYMVVPEYFILRLGWAYIILRVI
                     YGICYLSNWATLRSIVWFLSLLCPIFLLIVTIKLT"
     misc_feature    247351..247719
                     /locus_tag="ABZJ_00221"
                     /note="MAPEG family; Region: MAPEG; cl09190"
                     /db_xref="CDD:263738"
     gene            247859..248386
                     /locus_tag="ABZJ_00222"
                     /db_xref="GeneID:12115307"
     CDS             247859..248386
                     /locus_tag="ABZJ_00222"
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="YP_005524178.1"
                     /db_xref="GI:384141468"
                     /db_xref="GeneID:12115307"
                     /translation="MSYSNIPAGKDAPNDIYVIIEIPANAAPIKYEIDKDSDALFVDR
                     FMGTAMFYPANYGYVPNTLSEDGDPLDVLVVTPHPVAAGSVIRCRPVGKLNMEDDGGI
                     DAKLIAVPHEKLSPLYKDVQEYTDLPPLLISQVEHFFSHYKDLEPGKWVKISGWEGAD
                     VAKAEVLKAIEAAKK"
     misc_feature    247898..248371
                     /locus_tag="ABZJ_00222"
                     /note="Inorganic pyrophosphatase. These enzymes hydrolyze
                     inorganic pyrophosphate (PPi) to two molecules of
                     orthophosphates (Pi). The reaction requires bivalent
                     cations. The enzymes in general exist as homooligomers;
                     Region: pyrophosphatase; cd00412"
                     /db_xref="CDD:238239"
     misc_feature    order(247928..247933,248090..248095)
                     /locus_tag="ABZJ_00222"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238239"
     misc_feature    order(247946..247948,247988..247990,248024..248026,
                     248282..248287)
                     /locus_tag="ABZJ_00222"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238239"
     misc_feature    order(247952..247954,248054..248056,248069..248071,
                     248150..248152,248165..248167)
                     /locus_tag="ABZJ_00222"
                     /note="metal binding sites [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238239"
     gene            complement(248493..249809)
                     /locus_tag="ABZJ_00223"
                     /db_xref="GeneID:12115308"
     CDS             complement(248493..249809)
                     /locus_tag="ABZJ_00223"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="YP_005524179.1"
                     /db_xref="GI:384141469"
                     /db_xref="GeneID:12115308"
                     /translation="MLKAQKLTLAVLISAAIISSAQASEQSEAKGFVEDANGSILFRT
                     GYISRDKKQGAKDTSSVAQSAIVSIESGFTPGIVGFGVGVVGDGSFKIGENKNAGNQM
                     IPKHNDGSAYDHWARGGGSVKARFSNTTVRYGTQVLDLPVLASNTGRMVPEYFTGTLL
                     TSHEIKNLEVVAGKFTKDQMSDQINTDADASGRGLDRAIVWGAKYKFNDNLNASYYGL
                     DSKNALERHYANVNFKQPLANDSSLTYDFSGYHTKFDANAHTYSATGTVAPNYAADGI
                     AGEEKTNNIWAISGTYATGPHSVMLAYQQNTGNVGYDYGQNADGFQSIYLPNSYMSDF
                     IGNHEKSAQIQYNVDFGKLGVLPGLNWTTAFVYGWDIKVRNVTDDAQEREFFNQVKYT
                     VQSGFAKDASLRIRNSYYRASDAYQGAYIGDTNEWRIFLDIPVKLF"
     misc_feature    complement(248499..249722)
                     /locus_tag="ABZJ_00223"
                     /note="outer membrane porin, OprD family; Region: OprD;
                     cl21675"
                     /db_xref="CDD:272095"
     gene            250506..250676
                     /locus_tag="ABZJ_00224"
                     /db_xref="GeneID:12115309"
     CDS             250506..250676
                     /locus_tag="ABZJ_00224"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524180.1"
                     /db_xref="GI:384141470"
                     /db_xref="GeneID:12115309"
                     /translation="MFSLYFTQTKCSYFIVIYKDNYLEDFYFSRYISFLVSKLMKCSD
                     TKYELGTAIAKA"
     gene            250718..251545
                     /locus_tag="ABZJ_00225"
                     /db_xref="GeneID:12115310"
     CDS             250718..251545
                     /locus_tag="ABZJ_00225"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524181.1"
                     /db_xref="GI:384141471"
                     /db_xref="GeneID:12115310"
                     /translation="MGEIKMMKFALKAVTFGVLTAGSTMVMAEDAPSFYGITATGSVA
                     ATTDYRFRGITQSSNNPAIQGGFTFSHKSGAYVALWGSSVDFNTPGVSTETDISLGYT
                     NTLKLSDTLAPTYDVGVIRYGYIGSDSKFTNPYNGDTGFDFTEFYGKLTFADSLFKGD
                     ALSVGVNYSNDYWGHSDEFWYFNVGYSAPIADTGFTGLASVGYNKLKNKDSLLVVAGG
                     PGEDDSYIDYKVGVNYNILGIVAELDVVGTDISTSGMTDAQKKPYDTGLVFSLTKTF"
     misc_feature    250733..251542
                     /locus_tag="ABZJ_00225"
                     /note="Bacterial protein of unknown function (Gcw_chp);
                     Region: Gcw_chp; cl09901"
                     /db_xref="CDD:263911"
     gene            complement(251588..252466)
                     /locus_tag="ABZJ_00226"
                     /db_xref="GeneID:12115311"
     CDS             complement(251588..252466)
                     /locus_tag="ABZJ_00226"
                     /codon_start=1
                     /transl_table=11
                     /product="putative dihydrodipicolinate synthase (DapA)"
                     /protein_id="YP_005524182.1"
                     /db_xref="GI:384141472"
                     /db_xref="GeneID:12115311"
                     /translation="MKLNGIIGYPVTPFSDDNNINLPVLKQMLDLLIENGCDAIAPLG
                     STGESAYLEWDEWCLVAKTSIESINKRVPVIIGISELTTNQAIKKAQIAQSYGADALM
                     VIPVSYWKLTDQEIFEYYQAIAQATTLPIMIYNNPATSGVDMSPELIVRMFNNIANIM
                     MVKESSGDIQRMHKIYELSKGELPFYNGCNPLALEALCAGASGWCTAAPNLLGQRPQQ
                     LIEYVKNGELEQAQKSFYQQLPLLRFIVKGGLPKTIKAGLQLKGVAAGTPRKPLTKAT
                     DIELNQLKQLLSEIEN"
     misc_feature    complement(251606..252451)
                     /locus_tag="ABZJ_00226"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(251978..251980,252065..252067,
                     252329..252337,252344..252346,252440..252442))
                     /locus_tag="ABZJ_00226"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(251852..251854,251978..251980,
                     252065..252067,252329..252337,252344..252346))
                     /locus_tag="ABZJ_00226"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(251654..251659,252110..252112,
                     252122..252124,252143..252148,252218..252223,
                     252314..252319,252332..252334))
                     /locus_tag="ABZJ_00226"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    complement(251978..251980)
                     /locus_tag="ABZJ_00226"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            complement(252482..253258)
                     /locus_tag="ABZJ_00227"
                     /db_xref="GeneID:12115312"
     CDS             complement(252482..253258)
                     /locus_tag="ABZJ_00227"
                     /codon_start=1
                     /transl_table=11
                     /product="class II aldolase/adducin domain-containing
                     protein"
                     /protein_id="YP_005524183.1"
                     /db_xref="GI:384141473"
                     /db_xref="GeneID:12115312"
                     /translation="MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDH
                     GHDAGLAGQITCRSENKETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANR
                     FHTWIYKEHPEVNCIIHTHPTYVAALSMLQIPLMISQMDVCALYEDCSFVGHWPGVPV
                     GNEEGILISSALGKNRAVLLSHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQI
                     QPIPHALAAEAHDWVSTDKRNKVNFAYYARKALKKHSDCI"
     misc_feature    complement(252485..253258)
                     /locus_tag="ABZJ_00227"
                     /note="class II aldolase/adducin domain protein;
                     Provisional; Region: PRK07090"
                     /db_xref="CDD:180832"
     misc_feature    complement(order(252626..252628,252647..252649,
                     252659..252661,252680..252682,252713..252715,
                     252833..252838,252842..252844,252866..252874,
                     252887..252892,252896..252898,253034..253039,
                     253043..253045,253115..253117,253139..253141,
                     253151..253153))
                     /locus_tag="ABZJ_00227"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(252710..252712,252896..252898,
                     252902..252904,252956..252964,253049..253054,
                     253100..253102))
                     /locus_tag="ABZJ_00227"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(252710..252712,252896..252898,
                     252902..252904))
                     /locus_tag="ABZJ_00227"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            253370..254803
                     /locus_tag="ABZJ_00228"
                     /db_xref="GeneID:12115313"
     CDS             253370..254803
                     /locus_tag="ABZJ_00228"
                     /codon_start=1
                     /transl_table=11
                     /product="Bacterial regulatory protein, gntR family
                     protein"
                     /protein_id="YP_005524184.1"
                     /db_xref="GI:384141474"
                     /db_xref="GeneID:12115313"
                     /translation="MLRPWQIHFRIDEREEKTVFLKLTNLISQEILSGRLVQGTMLPG
                     SRILSKELGINRKTVQAVYEELEAQGWLVTRPRKGTFVADVLPEKKPQIEPRADRKVS
                     DKPIIQQVAQRPHNDGVPDPRLIPYELFSRAYRHALIKITQNQYMGYGDPRGMAELRQ
                     ALKQMLSMERFMNVAEDEICVVRGSQMGIFLASRALPNRQGVIVVEELYYPSAFKAFQ
                     SNGFQVVSVKLDEQGIVIEDLERILKEHSVAAIYTTPHHQYPTTVTMTMSRRLQLLEL
                     SKKWGFYIIEDDYDHEFHYDSRPMPPLASLPHSELVIHVGSLSKVFAPGIRLGYIVAA
                     PTIIQTITEDILLIDRQGNNITELALADLMQRGEIKRHIRKMKKIYQLRRDHALAEFQ
                     RVFAESIQIQPPAGGMALWVKFQKSFTQNQLIKLKELNIDTEQKFKQKEYPNCSIRFG
                     FAALSEKEITSLIETLNEALNKRTADL"
     misc_feature    253421..253618
                     /locus_tag="ABZJ_00228"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(253421..253423,253427..253429,253496..253498,
                     253502..253507,253529..253543,253547..253552,
                     253559..253561,253589..253594,253598..253609)
                     /locus_tag="ABZJ_00228"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    253430..254794
                     /locus_tag="ABZJ_00228"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    253721..254773
                     /locus_tag="ABZJ_00228"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(253919..253927,253997..253999,254144..254146,
                     254237..254239,254318..254320,254324..254329,
                     254348..254350)
                     /locus_tag="ABZJ_00228"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(253928..253930,254027..254029,254216..254218,
                     254342..254350,254435..254437,254444..254446)
                     /locus_tag="ABZJ_00228"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    254327..254329
                     /locus_tag="ABZJ_00228"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(254818..255501)
                     /locus_tag="ABZJ_00229"
                     /db_xref="GeneID:12115314"
     CDS             complement(254818..255501)
                     /locus_tag="ABZJ_00229"
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComM"
                     /protein_id="YP_005524185.1"
                     /db_xref="GI:384141475"
                     /db_xref="GeneID:12115314"
                     /translation="MPLYSIAVNDSGSHPKPGEITLSHLGVLFLDELPEFDRKVLEVL
                     RQPLESKEIIISRAARQITYPANFQLIAAMNPCPCGYAFNQDSRCQCSPESIKRYQNR
                     ISGPLLDRIDLHIDVPPLKAQELQDPTPAEDSTTVRQRVIYAYEQQMQRQDCLNQALS
                     PKQLEQHAVLDSTSQRMIEMAQQRLNLSARAYHRVLRVARTIADLAQSEVIQSPHLTE
                     ALSYRGNHS"
     misc_feature    complement(254833..>255468)
                     /locus_tag="ABZJ_00229"
                     /note="Predicted ATPase with chaperone activity
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0606"
                     /db_xref="CDD:223679"
     misc_feature    complement(255127..>255468)
                     /locus_tag="ABZJ_00229"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl21455"
                     /db_xref="CDD:271875"
     misc_feature    complement(254833..255114)
                     /locus_tag="ABZJ_00229"
                     /note="Magnesium chelatase, subunit ChlI; Region:
                     Mg_chelatase_2; pfam13335"
                     /db_xref="CDD:257665"
     gene            255626..256336
                     /locus_tag="ABZJ_00230"
                     /db_xref="GeneID:12115315"
     CDS             255626..256336
                     /locus_tag="ABZJ_00230"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase protein A"
                     /protein_id="YP_005524186.1"
                     /db_xref="GI:384141476"
                     /db_xref="GeneID:12115315"
                     /translation="MKKLSDEYLPVRKAQTVYGSISGNYAFRGEKTIWFESTLERDFI
                     LKQEFNNNVIDVIGQPVVIPYITELGNQSTYTPDFLVQFSSSNCDDFEDFPVPMLIEI
                     KPKKKLVEDWDKLKPKFRAAHRFAADKGWKFKIISETRLYDQYWENINFLKKFRRSHV
                     GAVDQQLLLDTLQELGQSTINQLPAHIFKDKTNVLKGIHQVWALVAKRMIACDLYCPL
                     TAETVIWVNQNDAFARNI"
     misc_feature    255776..256039
                     /locus_tag="ABZJ_00230"
                     /note="TnsA endonuclease N terminal; Region:
                     Tn7_Tnp_TnsA_N; pfam08722"
                     /db_xref="CDD:255000"
     misc_feature    256064..256267
                     /locus_tag="ABZJ_00230"
                     /note="TnsA endonuclease C terminal; Region:
                     Tn7_Tnp_TnsA_C; pfam08721"
                     /db_xref="CDD:254999"
     gene            256337..258247
                     /locus_tag="ABZJ_00231"
                     /db_xref="GeneID:12115316"
     CDS             256337..258247
                     /locus_tag="ABZJ_00231"
                     /codon_start=1
                     /transl_table=11
                     /product="transposition protein B"
                     /protein_id="YP_005524187.1"
                     /db_xref="GI:384141477"
                     /db_xref="GeneID:12115316"
                     /translation="MIESNAVNIDRSRIILKPNVVVGYEGQPYKIVNVLNANDIVISS
                     LDSVRSLQVNARSLTIFNGGNTLTERLNKGDQDISNEAWQIALQRYEIIKPLIEYSTT
                     ELVENRANEYDVNRSTLWKWLKDYRENNSLMALIPKKRGWTTEKSRLSPQVSNIIKQA
                     INDEYLNAKKPSISKTIEIVKAECSRLQLEAPHENSIRRRIEALNDYQVTKARLGSKA
                     AIDKFKAAAGSFPNADYPLAYVQIDHTPLDIEIVDDEFREAIGKPHLTLAIDVFSRMI
                     VGYYLSLEAPSTTSVAMCIASCILSKKRKLIELDIDAEWQVEGIMDSVHTDNGPDFRT
                     NHISKACLKYGIHWEYRPIGGARFGGHIERMLGIVNLEMHVLDGTTFSNVQQRGTYDS
                     AKQACMTLKELEYYIVYWITKVYHQKKHSALGTSPIVKWEEGVWGTKTTAGTGLKERV
                     SDEDTLFIDFLPEFEATIQRTGVQKDNLFYFADCLRQWVNSIDPEDNNRKRKRKFLFK
                     RDPRDISQIWFYEPYSNTYFKVPTAKREIPPISLFEYKQVQNYLKSERQDVQNQDEIY
                     KAILHLRDQLNQARSLTRKQRRSNQRKKENAKAITQLSEQNQSKKAVVSESLQTSDDL
                     WSTPLTAFDDLR"
     misc_feature    256598..256759
                     /locus_tag="ABZJ_00231"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     misc_feature    257030..257431
                     /locus_tag="ABZJ_00231"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    257714..257896
                     /locus_tag="ABZJ_00231"
                     /note="Mu transposase, C-terminal; Region: Mu-transpos_C;
                     pfam09299"
                     /db_xref="CDD:255273"
     gene            258252..259172
                     /locus_tag="ABZJ_00232"
                     /db_xref="GeneID:12115317"
     CDS             258252..259172
                     /locus_tag="ABZJ_00232"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposition helper protein"
                     /protein_id="YP_005524188.1"
                     /db_xref="GI:384141478"
                     /db_xref="GeneID:12115317"
                     /translation="MEKYEHLAEHVLEIMQLSDSERIETLFTDRWIGYKKAITIMNTL
                     TDILNRPRKLRPECLLIVGDSNMGKTTIIHEFARQYYTKTVSDADMDLLSVTKPVLPI
                     LAPAKANVKELYINILNHFFVPFRASDPEAKLRNQAVHLMRKYETKMLIIDEIHNCLT
                     GSAKLLPEVMNTLKNLSNELSLNIVGVGTREAITILHTDPQYASRFDVVNLPKWELNQ
                     DFLRLLVSYVRLLPLKKQSNLASKEIATLIFEVSGGNLGDLNRLLVECAKEAILQGDE
                     EITYDIVHKFKWLKPTEGLRNIRNINLSLS"
     misc_feature    258363..258878
                     /locus_tag="ABZJ_00232"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    258414..>258812
                     /locus_tag="ABZJ_00232"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    258438..258461
                     /locus_tag="ABZJ_00232"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(258441..258464,258708..258710,258816..258818)
                     /locus_tag="ABZJ_00232"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    258696..258713
                     /locus_tag="ABZJ_00232"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    258864..258866
                     /locus_tag="ABZJ_00232"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            259202..260317
                     /locus_tag="ABZJ_00233"
                     /db_xref="GeneID:12115318"
     CDS             259202..260317
                     /locus_tag="ABZJ_00233"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524189.1"
                     /db_xref="GI:384141479"
                     /db_xref="GeneID:12115318"
                     /translation="MSQPEQCWYIRTPIQQGEIFSSWLIRSALDVGCSPMVLIEALWG
                     KWRALTIDLDKGVDAERFDALLSHSMESKQKIQQSMLSSVVSQIQPNYDSNQNIPWVL
                     SLGTRNRSNTSGRQVCVECLKSHENPPYLRLMWRIGWHCSCVEHQLSLIDHCPECGVT
                     IQPFKADMEHGCLAICTTCGFDLRRCEESKNINLNALNFQNKAEQVLKQKIGFYNQSP
                     VTTQVWFEIARSWLSEIRFLVNTPNKNVIQLFESFDVNLHLSHPVTPLAFEYLSTQER
                     IVLLSMLDQIMDIPCDLLVQRSKEYGVSRANFWDKRKKLPVQLQQMKDLMIKPTRRYP
                     VSRAAITVTKPKSKATVQRQWLNLLRRSNNSGAMHID"
     gene            260310..261740
                     /locus_tag="ABZJ_00234"
                     /db_xref="GeneID:12115319"
     CDS             260310..261740
                     /locus_tag="ABZJ_00234"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524190.1"
                     /db_xref="GI:384141480"
                     /db_xref="GeneID:12115319"
                     /translation="MTENVIEHDCHGCNQSVSFIKKRYKGKKYCSTCYARIFKKRLCP
                     SCGDFARLPRDDEQAICNECIKKQPCIRCNQTNKPIGKLTEYGVVCNSCSVYFRPIEP
                     CERCGTPSQKLTRISRFNDDLRVCPKCATRDYETCPSCQKHRLLESDVSGQRTCKKCR
                     DKPQKSCKACHCMIAAGCADLCDDCYWHQNLWNKFDQNQKVFESSDLKQQYENYIGWL
                     EKKVGSHKAALYINKHTHFFIKTEIDWNQSVPTPKQLLVRLRSSGLRKFELVMQWLEE
                     VHDIRIDMDNKKSCSERDQMEKLVQRILQPSLAYDVVLEYKNKLEEKIKRGETSIRSA
                     RLAVKPAVALMLSMEGESAQLPNLEHVKAYLAEYSGQAAALTGFINFLNENYGASIDY
                     LKLKKSDFLKTKQKKKLEMELIALTQTDLNDSELILSWVRNGLRYFHQLPYIDALKIK
                     TEMITEIEDGFTVVLNGQYYWLPKTQ"
     misc_feature    <260592..260753
                     /locus_tag="ABZJ_00234"
                     /note="formamidopyrimidine-DNA glycosylase; Provisional;
                     Region: PRK14811"
                     /db_xref="CDD:184831"
     misc_feature    261024..>261539
                     /locus_tag="ABZJ_00234"
                     /note="reticulocyte binding/rhoptry protein; Region:
                     235kDa-fam; TIGR01612"
                     /db_xref="CDD:130673"
     gene            complement(261887..262006)
                     /locus_tag="ABZJ_00235"
                     /db_xref="GeneID:12115320"
     CDS             complement(261887..262006)
                     /locus_tag="ABZJ_00235"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524191.1"
                     /db_xref="GI:384141481"
                     /db_xref="GeneID:12115320"
                     /translation="MIFIFMSLKLYCVNTAFKASLGDFLGGGDNLINTWKSTL"
     gene            complement(262115..262486)
                     /locus_tag="ABZJ_00236"
                     /db_xref="GeneID:12115321"
     CDS             complement(262115..262486)
                     /locus_tag="ABZJ_00236"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524192.1"
                     /db_xref="GI:384141482"
                     /db_xref="GeneID:12115321"
                     /translation="MGQAKQRGTLEQRVKQAQEQKDDFYGTERSVAEVLAELGLPKES
                     TVKGYVIHLPEKDEFVAAINDNNISFSVAYARTPELAMIYDEPQKAISDAKKISKHKL
                     LVCVLFETSNQYMINDIWANY"
     gene            complement(262559..262858)
                     /locus_tag="ABZJ_00237"
                     /db_xref="GeneID:12115322"
     CDS             complement(262559..262858)
                     /locus_tag="ABZJ_00237"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524193.1"
                     /db_xref="GI:384141483"
                     /db_xref="GeneID:12115322"
                     /translation="MNTMLISPTLNVSCSENVLLKISSYFGVSHEQAYRKGVDSLLKL
                     TEMVIANNEHSEIIKLFLCDCHLRTSINLDDISDMPTQLIGDCLNVIVLRYAFVV"
     gene            complement(262926..263777)
                     /locus_tag="ABZJ_00238"
                     /db_xref="GeneID:12115323"
     CDS             complement(262926..263777)
                     /locus_tag="ABZJ_00238"
                     /codon_start=1
                     /transl_table=11
                     /product="Universal stress protein"
                     /protein_id="YP_005524194.1"
                     /db_xref="GI:384141484"
                     /db_xref="GeneID:12115323"
                     /translation="MSKIIACIDGSLVTNTVCDYAAWFSDKLNSPIKLLHVIDKPKAK
                     APQDLSGAIGLGSRETLLKELVELEERKGKIELEHGQILLREAKNYLLEKFSIDAQSF
                     QRHGSVLETIMGMEDDIRVLVMGKHGNETEHDSSKIGTHIENVVRALHKPVLITSAPF
                     SPPKSFLIAFDGSQTARKCVERIASSPLLKGLAVHLVYVGNPNSEMQNQLSWAKEQLE
                     SQGFNITSNTLDGEVDKAIINYAEQHQIDLIVVGAYGHSKIRQFFIGSTTTKVITSAN
                     KPVLLLR"
     misc_feature    complement(263313..263771)
                     /locus_tag="ABZJ_00238"
                     /note="Universal stress protein family; Region: Usp;
                     pfam00582"
                     /db_xref="CDD:249978"
     misc_feature    complement(262935..263279)
                     /locus_tag="ABZJ_00238"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    complement(order(262974..262985,263013..263018,
                     263022..263027,263181..263183,263265..263273))
                     /locus_tag="ABZJ_00238"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            complement(263790..265277)
                     /locus_tag="ABZJ_00239"
                     /db_xref="GeneID:12115324"
     CDS             complement(263790..265277)
                     /locus_tag="ABZJ_00239"
                     /codon_start=1
                     /transl_table=11
                     /product="sul1delta fusion protein"
                     /protein_id="YP_005524195.1"
                     /db_xref="GI:384141485"
                     /db_xref="GeneID:12115324"
                     /translation="MLSTIREQWFSNIRGDVLAGIVVALALIPEAIAFSIIAGVDPKV
                     GLYASFCIAVVIAFVGGRPGMISAATGAMALLMVTLVKEHGLQYLLAATILTGFIQIL
                     AGYLKLGALMRFVSKSVVIGFVNALAILIFMAQLPELTNVTWHVYAMTIGGLAVIYLF
                     PYIPVIGKLLPSPLICIVLLTLFALFIGLDVRTVGDMGQLPDTLPIFLLPDIPLNLET
                     LAIILPYSLGLAAVGLLESMMTATIVDDLTDTTSDKNRECKGQGVANVASGFLGGMAG
                     CAMIGQSIINVKSGGRTRLSSFSAGVFLLIMVVFISDWLKAIPMAALVAVMIMVSIGT
                     FNWDSLRNIRQYPLSSNIVMIVTVVVVVATHNLAYGVLVGVLLSALFFANKIERYMAI
                     QSVFDESESTRTYTVTGQVFFSSADKFTSAFDFKEALSKVVIDVSQAHFWDVSAVAAV
                     DKVVIKFRREGTEVELIGMNEASKTLVDKFGIHDKPDALDRLNSH"
     misc_feature    complement(263814..265277)
                     /locus_tag="ABZJ_00239"
                     /note="Sulfate permease and related transporters (MFS
                     superfamily) [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     misc_feature    complement(265035..265277)
                     /locus_tag="ABZJ_00239"
                     /note="Sulfate transporter N-terminal domain with GLY
                     motif; Region: Sulfate_tra_GLY; pfam13792"
                     /db_xref="CDD:258076"
     misc_feature    complement(264231..264971)
                     /locus_tag="ABZJ_00239"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     pfam00916"
                     /db_xref="CDD:250221"
     misc_feature    complement(263793..264089)
                     /locus_tag="ABZJ_00239"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist domain of SulP-like sulfate transporters, plays
                     a role in the function and regulation of the transport
                     activity, proposed general NTP binding function; Region:
                     STAS_SulP_like_sulfate_transporter; cd07042"
                     /db_xref="CDD:132913"
     gene            complement(265572..267368)
                     /locus_tag="ABZJ_00240"
                     /db_xref="GeneID:12115325"
     CDS             complement(265572..267368)
                     /locus_tag="ABZJ_00240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524196.1"
                     /db_xref="GI:384141486"
                     /db_xref="GeneID:12115325"
                     /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEV
                     LLIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTDQSYRFSGKLITKRFS
                     FDFTNNKPKNIKLTDRIPNTSDYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNH
                     CLMHSNDGTQVITSSIHVLHSLFVNRKDIRGLLLGTSSQSIINRFLESYTTEIVDDNV
                     EYKIKIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEITEFNHLQQGTGKRYP
                     IVFPPHPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTISKPDEK
                     NPRPREKSQNKNEHINTQKPPSRTSGEYRKRSEVETGNTQGILKYSFNEPTDDPIEVG
                     ASNQPYSDKSEEVETSSDEPYGNQNTKIKKSETTDTPPSRDERFDIQYIIQSLQELAS
                     EMGSPLEHLSAINEHGEMIASINLLQIKKLVPEPKHPSWIDYDKGRKLLFLKLDLKDQ
                     NGFSYLIDIHKNKNHEAFCAFLIFTQNKLTSEQIKKICIELENAKGIKKWALYCDSFI
                     HKMIAIKHLYATPDEWKNRFKNLFISLQKDKS"
     gene            complement(267655..268236)
                     /locus_tag="ABZJ_00241"
                     /db_xref="GeneID:12115326"
     CDS             complement(267655..268236)
                     /locus_tag="ABZJ_00241"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524197.1"
                     /db_xref="GI:384141487"
                     /db_xref="GeneID:12115326"
                     /translation="MDNSESKILAEYEKAKKWDKYEKVFSILGVLSLFIFMVMIIISA
                     ITLSLNDTSPTKIFNSYCWAAILFLAVLFTSLRNIAEQISFKKSMEILIDSKDAEDEK
                     DQLAVVRRQHTIICITAFCALIVADFILFYFIAFNLTLPLNILIHKPLFIIMLACLIF
                     FTINYLIYKYKFNKLNNEAMVAFGKHLDNKRKK"
     gene            complement(268257..269420)
                     /locus_tag="ABZJ_00242"
                     /db_xref="GeneID:12115327"
     CDS             complement(268257..269420)
                     /locus_tag="ABZJ_00242"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524198.1"
                     /db_xref="GI:384141488"
                     /db_xref="GeneID:12115327"
                     /translation="MASLNSEFQIPLKVVTTRLNHMKINLPQLVKKIEKRAIENLKRR
                     KDKKEQIDLLITWDDWIYAALDADHERIHGSADPHPLPPTFKNNMVSGVYEKALKNVM
                     GHFGVKATVPAWAANIKVGEHIPKELLDRLPVTTGELVTLGNWMLTKNIYRFEDIVIN
                     ELIKTGFNGVIPNHILNLPDLCVYIQTDNAKGLTFENRQVVGVLFCVTELCGDRLLVS
                     TMYLDDGMPRTIAIMLNEDQDIEASLTNFVDQFQQDYDPETMASDLKERLKIQKKLIN
                     LVLWFSQSKPEVTPLTPDTNKPVQFVEIKKEKRLFEAGKYKTFKIGSETARKLTKLYE
                     EIEVAKAEGKASGREPHLRKSHWHLYWYGKKGRYERYDFLLIPVTIVGGVSKD"
     gene            complement(269505..271007)
                     /locus_tag="ABZJ_00243"
                     /db_xref="GeneID:12115328"
     CDS             complement(269505..271007)
                     /locus_tag="ABZJ_00243"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524199.1"
                     /db_xref="GI:384141489"
                     /db_xref="GeneID:12115328"
                     /translation="MTQKNELDTKYAVIVAGGNGAGKSTLIDNVIIPKFNSLNLDINF
                     INADVWQLQHFGHFDNTNPTHAREAQKWAEAERQKHLDEGRSFIAETVFSHPSKVDLI
                     KEAKSKGFYVVLYHIHLENSDIALDRIKDRVRKGGHDVDEDKVKARYERVLPLVAEAT
                     QYADLTFVLDNSVRDRPHQQVFKLEYGKITAIDNNVPDWAIKAYEKQLTDYLGLDQAT
                     KISNTNEDLTMSNTKEKLGFEYNARLLANDIQPQHRETVVANYRKNFVEHVANSAAVA
                     GNSHKLDDVASLINGTTVGGHSVKDQRQVLNLIDASNELVNMVRNGNFALNKSTYLKV
                     NGIVADRESIEAGVLRGEGVEQSFTPDVGIRHFRTHRPMKTEEDAPALNKFMQEGFDH
                     INSLKNPLEKGIATFLYGSLNQFTFEGEKRTAHLMMNGVLMSAGLDAISIPADKAIDF
                     RQKMVRFYESKNADEVMEFLADLHPALNNTKKLDAEKEKKSENDFGRSFQ"
     misc_feature    complement(270555..270971)
                     /locus_tag="ABZJ_00243"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     misc_feature    complement(270411..270968)
                     /locus_tag="ABZJ_00243"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl21455"
                     /db_xref="CDD:271875"
     gene            complement(271008..271247)
                     /locus_tag="ABZJ_00244"
                     /db_xref="GeneID:12115329"
     CDS             complement(271008..271247)
                     /locus_tag="ABZJ_00244"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524200.1"
                     /db_xref="GI:384141490"
                     /db_xref="GeneID:12115329"
                     /translation="MVVLMNSKFSVDQSNKISLKAVLEDLGDQMFEANKCPDTHPVYD
                     QLRERLRKDRQLLDALDAQDENANTEERSRSLDIN"
     misc_feature    complement(<271041..>271145)
                     /locus_tag="ABZJ_00244"
                     /note="hypothetical protein; Validated; Region: PRK09169"
                     /db_xref="CDD:236394"
     gene            271336..272268
                     /locus_tag="ABZJ_00245"
                     /db_xref="GeneID:12115330"
     CDS             271336..272268
                     /locus_tag="ABZJ_00245"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific tyrosine recombinase"
                     /protein_id="YP_005524201.1"
                     /db_xref="GI:384141491"
                     /db_xref="GeneID:12115330"
                     /translation="MLDREILLKKWLDEYLLANKSNETIYTLKNSLNLFFEYTNLALE
                     EIEASDIRTFIAYRAQNGVGVSTLKKNISAIRTFFHYLTKEKLINFNPAEDIKIKKSS
                     KVLPKFHEVTVINEVLDSNKNLEFERPSSTVIFKRDLALIEIAYSCGLRLEEIHSLQI
                     ENVEVKRKQVRVTGKGNKTRIIPLGSKAIEAYLEWLPLREEIMNKDTNQKHNYVFVTT
                     TGAQLSRVQINKRIKNAFKLAGYPIQSNPHMLRHSFATHLINNSVGIREIQEMLGHSN
                     LNTTQIYTDLDHTSMTNVYMDTHPRAVKNTEGEN"
     misc_feature    271336..272241
                     /locus_tag="ABZJ_00245"
                     /note="site-specific tyrosine recombinase XerC; Reviewed;
                     Region: xerC; PRK00236"
                     /db_xref="CDD:234698"
     misc_feature    271357..272220
                     /locus_tag="ABZJ_00245"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    order(271786..271791,271858..271860,272071..272079,
                     272182..272184)
                     /locus_tag="ABZJ_00245"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    order(271786..271788,271858..271860,272077..272079,
                     272086..272088,272155..272157,272182..272184)
                     /locus_tag="ABZJ_00245"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    order(271786..271788,272077..272079,272086..272088,
                     272155..272157,272182..272184)
                     /locus_tag="ABZJ_00245"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            272475..272792
                     /locus_tag="ABZJ_00246"
                     /db_xref="GeneID:12115331"
     CDS             272475..272792
                     /locus_tag="ABZJ_00246"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524202.1"
                     /db_xref="GI:384141492"
                     /db_xref="GeneID:12115331"
                     /translation="MNEVKAYKLTVENVELFEEIEHEVLFQTTIKTKKSILNYLTPVS
                     TLATLLQRHNIILPKGIFLGSIIEIYDEEVEPRVIIGHEGCDFGNVKTVRQLEIYWEE
                     VAF"
     gene            272838..273194
                     /locus_tag="ABZJ_00247"
                     /db_xref="GeneID:12115332"
     CDS             272838..273194
                     /locus_tag="ABZJ_00247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524203.1"
                     /db_xref="GI:384141493"
                     /db_xref="GeneID:12115332"
                     /translation="MKNSVSNSYIVQANGVKVVKADVNSIVTTNKRIHVGDDTPAFAF
                     YVCGFWDSIDQFERYGMTPHVTLYKTESEVKEYCKGKVVSYREYYANSEKEVDDLIAT
                     NRMSHENHARSLAELF"
     gene            273248..273517
                     /locus_tag="ABZJ_00248"
                     /db_xref="GeneID:12115333"
     CDS             273248..273517
                     /locus_tag="ABZJ_00248"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524204.1"
                     /db_xref="GI:384141494"
                     /db_xref="GeneID:12115333"
                     /translation="MASTAAERKAKQRQEMLKKGFTRKDLWLSKESLEVIEKFKSEHK
                     LSSNDEAINLLLKTIVVIEKFKSEHKFNTIDEVINLFLKSLNECK"
     gene            273829..274539
                     /locus_tag="ABZJ_00249"
                     /db_xref="GeneID:12115334"
     CDS             273829..274539
                     /locus_tag="ABZJ_00249"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase protein A"
                     /protein_id="YP_005524205.1"
                     /db_xref="GI:384141495"
                     /db_xref="GeneID:12115334"
                     /translation="MKKLSDEYLPVRKAQTVYGSISGNYAFRGEKTIWFESTLERDFI
                     LKQEFNNNVIDVIGQPVVIPYITELGNQSNYTPDFLVQFSSSNCDDFEDFPVPMLIEI
                     KPKKKLAEDWDKLKPKFRAAHRFAADKGWKFKIISETRLYDQYWENINFLKKFRRSHI
                     DAVDQQLLLDTLQKLGQSTINQLPAHLFKDKTNVLKGIHQVWALVAKRMIACDLYCPL
                     TAETVIWVNQNDAFVRNI"
     misc_feature    273979..274242
                     /locus_tag="ABZJ_00249"
                     /note="TnsA endonuclease N terminal; Region:
                     Tn7_Tnp_TnsA_N; pfam08722"
                     /db_xref="CDD:255000"
     misc_feature    274267..274470
                     /locus_tag="ABZJ_00249"
                     /note="TnsA endonuclease C terminal; Region:
                     Tn7_Tnp_TnsA_C; pfam08721"
                     /db_xref="CDD:254999"
     gene            274540..276450
                     /locus_tag="ABZJ_00250"
                     /db_xref="GeneID:12115335"
     CDS             274540..276450
                     /locus_tag="ABZJ_00250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005524206.1"
                     /db_xref="GI:384141496"
                     /db_xref="GeneID:12115335"
                     /translation="MIESNAVSIDRSRITLKPNVVVGYEGNPYKIVNVLNANDIVISS
                     LDSVRSLQVNSKSLTVFEGENTLTENLNKGDKDISNEAWQIALQRYEIIKPLIEYSTT
                     ELVENRANEYDVNRSTLWKWLRDYRENNSLMTLIPKKRGWTTEKSRLSPQVSNIIKQA
                     INDEYLNAKKPSISKTIEIVKAECSRLQLEAPHENSIRRRIEALNNYQVTKARLGSKA
                     AIDKFKAAAGSFPNADYPLAYVQIDHTPLDIEIVDDEFREAIGKPHLTLAIDVFSRMI
                     VGYYLSLEAPSTTSVAMCIASCILSKKRKLIELNIDAEWQVEGIMDSVHTDNGPDFRT
                     NHISKACLKYGIHWEYRPIGGARFGGHIERMLGIVNLEMHVLDGTTFSNVQQRGTYDS
                     AKQACMTLKELEYYIVYWITKVYHQKKHSALGTSPIVKWEEGVWGTKTTAGTGLKERV
                     SDEDTLFIDFLPEFEATIQRTGVQKDNLFYFADCLRQWVNSIDPDDNNRKRKRKFLFK
                     RDPRDISQIWFYEPFSNTYFKVPTAKREIPPISLFEYRQVQNYLKNGRQDVQNQDEIY
                     KAILHLREQLNQARSLTRKQRRSNQRKKENEKAITQLSEQNQSKKAVVSESLQTSDDL
                     WSTPLTAFDDLR"
     misc_feature    274801..274962
                     /locus_tag="ABZJ_00250"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     misc_feature    275233..275634
                     /locus_tag="ABZJ_00250"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    275917..276099
                     /locus_tag="ABZJ_00250"
                     /note="Mu transposase, C-terminal; Region: Mu-transpos_C;
                     pfam09299"
                     /db_xref="CDD:255273"
     gene            276452..277375
                     /locus_tag="ABZJ_00251"
                     /db_xref="GeneID:12115336"
     CDS             276452..277375
                     /locus_tag="ABZJ_00251"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposition helper protein"
                     /protein_id="YP_005524207.1"
                     /db_xref="GI:384141497"
                     /db_xref="GeneID:12115336"
                     /translation="MMEKYEYLAEHVLEIMQLSDSERIETLFTDRWIGYKKAITIMNT
                     LTDILNRPRKLRPECLLIVGDSNMGKTTIIHEFARQYYTKTVSDADMDLLSVTKPVLP
                     ILAPAKANVKELYINILNHFFVPFRASDPEAKLRNQAVHLMRKYETKMLIIDEIHNCL
                     TGSAKLLPEVMNTLKNLSNELSLNIVGVGTREAITILHTDPQYASRFDVVNLPKWELN
                     QDFLRLLVSYVRLLPLKKQSNLASKEIATLIFEVSGGNLGDLNRLLVECAKEAILQGD
                     EEITYDIVHKFKWLKPTEGLRNIRNINLSLS"
     misc_feature    276566..277081
                     /locus_tag="ABZJ_00251"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    276617..>277015
                     /locus_tag="ABZJ_00251"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    276641..276664
                     /locus_tag="ABZJ_00251"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(276644..276667,276911..276913,277019..277021)
                     /locus_tag="ABZJ_00251"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    276899..276916
                     /locus_tag="ABZJ_00251"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    277067..277069
                     /locus_tag="ABZJ_00251"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            277405..278520
                     /locus_tag="ABZJ_00252"
                     /db_xref="GeneID:12115337"
     CDS             277405..278520
                     /locus_tag="ABZJ_00252"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524208.1"
                     /db_xref="GI:384141498"
                     /db_xref="GeneID:12115337"
                     /translation="MSQPEQCWYIRTPIQQGEIFSSWLIRSALDVGCSPMVLIEALWG
                     KWRALTIDLDKGVDAERFDALLSHSMESKQKIQQSMLSSVVSQIQPNYDSNQNIPWVL
                     SLGTRNRSNTSGRQVCVECLKSHENPPYLRLMWRIGWHCSCVEHQLSLIDHCPECGVT
                     IQPFKADMEHGCLAICTTCGFDLRRCEESKNINLNALNFQNKAEQVLKQKIGFYNQSP
                     VTTQVWFEIARSWLSEIRFLVNTPNKNVIQLFESFDVNLHLSHPVTPLAFEYLSTQER
                     IVLLSMLDQIMDIPCDLLVQRSKEYGVSRANFWDKRKKLPVQLQQMKDLMIKPTRRYP
                     VSRAAITVTKPKSKATVQRQWLNLLRRSNNSGAMHID"
     gene            278513..279943
                     /locus_tag="ABZJ_00253"
                     /db_xref="GeneID:12115338"
     CDS             278513..279943
                     /locus_tag="ABZJ_00253"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524209.1"
                     /db_xref="GI:384141499"
                     /db_xref="GeneID:12115338"
                     /translation="MTENVIEHDCHGCNQSVSFIKKRYKGKKYCSTCYARIFKKRLCP
                     SCGDFARLPRDDEQAICNECIKKQPCIRCNQTNKPIGKLTEYGVVCNSCSVYFRPIEP
                     CERCGTPSQKLTRISRFNDDLRVCPKCATRDYETCPSCQKHRLLESDVSGQRTCKKCR
                     DKPQKSCKACHCMIAAGCADLCDDCYWHQNLWNKFDQNQKVFESSDLKQQYENYIGWL
                     EKKVGSHKAALYINKHTHFFIKTEIDWNQSVPTPKQLLVRLRSSGLRKFELVMQWLEE
                     VHDIRIDMDNKKSCSERDQMEKLVQRILQPSLAYDVVLEYKNKLEEKIKRGETSIRSA
                     RLAVKPAVALMLSMEGESAQLPNLEHVKAYLAEYSGQAAALTGFINFLNENYGASIDY
                     LKLKKSDFLKTKQKKKLEMELIALTQTDLNDSELILSWVRNGLRYFHQLPYIDALKIK
                     TEMITEIEDGFTVVLNGQYYWLPKTQ"
     misc_feature    <278795..278956
                     /locus_tag="ABZJ_00253"
                     /note="formamidopyrimidine-DNA glycosylase; Provisional;
                     Region: PRK14811"
                     /db_xref="CDD:184831"
     misc_feature    279227..>279742
                     /locus_tag="ABZJ_00253"
                     /note="reticulocyte binding/rhoptry protein; Region:
                     235kDa-fam; TIGR01612"
                     /db_xref="CDD:130673"
     gene            complement(280090..280209)
                     /locus_tag="ABZJ_00254"
                     /db_xref="GeneID:12115339"
     CDS             complement(280090..280209)
                     /locus_tag="ABZJ_00254"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524210.1"
                     /db_xref="GI:384141500"
                     /db_xref="GeneID:12115339"
                     /translation="MIFIFMSLKLYCVNTAFKASLGDFLGGGDNLINTWKSTL"
     gene            complement(280318..280689)
                     /locus_tag="ABZJ_00255"
                     /db_xref="GeneID:12115340"
     CDS             complement(280318..280689)
                     /locus_tag="ABZJ_00255"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524211.1"
                     /db_xref="GI:384141501"
                     /db_xref="GeneID:12115340"
                     /translation="MGQAKQRGTLEQRVKQAQEQKDDFYGTERSVAEVLAELGLPKES
                     TVKGYVIHLPEKDEFVAAINDNNISFSVAYARTPELAMIYDEPQKAISDAKKISKHKL
                     LVCVLFETSNQYMINDIWANY"
     gene            complement(280762..281061)
                     /locus_tag="ABZJ_00256"
                     /db_xref="GeneID:12115341"
     CDS             complement(280762..281061)
                     /locus_tag="ABZJ_00256"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524212.1"
                     /db_xref="GI:384141502"
                     /db_xref="GeneID:12115341"
                     /translation="MNTMLISPTLNVSCSENVLLKISSYFGVSHEQAYRKGVDSLLKL
                     TEMVIANNEHSEIIKLFLCDCHLRTSINLDDISDMPTQLIGDCLNVIVLRYAFVV"
     gene            complement(281129..281980)
                     /locus_tag="ABZJ_00257"
                     /db_xref="GeneID:12115342"
     CDS             complement(281129..281980)
                     /locus_tag="ABZJ_00257"
                     /codon_start=1
                     /transl_table=11
                     /product="Universal stress protein"
                     /protein_id="YP_005524213.1"
                     /db_xref="GI:384141503"
                     /db_xref="GeneID:12115342"
                     /translation="MSKIIACIDGSLVTNTVCDYAAWFSDKLNSPIKLLHVIDKPKAK
                     APQDLSGAIGLGSRETLLKELVELEERKGKIELEHGQILLREAKNYLLEKFSIDAQSF
                     QRHGSVLETIMGMEDDIRVLVMGKHGNETEHDSSKIGTHIENVVRALHKPVLITSAPF
                     SPPKSFLIAFDGSQTARKCVERIASSPLLKGLAVHLVYVGNPNSEMQNQLSWAKEQLE
                     SQGFNITSNTLDGEVDKAIINYAEQHQIDLIVVGAYGHSKIRQFFIGSTTTKVITSAN
                     KPVLLLR"
     misc_feature    complement(281516..281974)
                     /locus_tag="ABZJ_00257"
                     /note="Universal stress protein family; Region: Usp;
                     pfam00582"
                     /db_xref="CDD:249978"
     misc_feature    complement(281138..281482)
                     /locus_tag="ABZJ_00257"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    complement(order(281177..281188,281216..281221,
                     281225..281230,281384..281386,281468..281476))
                     /locus_tag="ABZJ_00257"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            complement(281993..283480)
                     /locus_tag="ABZJ_00258"
                     /db_xref="GeneID:12115343"
     CDS             complement(281993..283480)
                     /locus_tag="ABZJ_00258"
                     /codon_start=1
                     /transl_table=11
                     /product="sul1delta fusion protein"
                     /protein_id="YP_005524214.1"
                     /db_xref="GI:384141504"
                     /db_xref="GeneID:12115343"
                     /translation="MLSTIREQWFSNIRGDVLAGIVVALALIPEAIAFSIIAGVDPKV
                     GLYASFCIAVVIAFVGGRPGMISAATGAMALLMVTLVKEHGLQYLLAATILTGFIQIL
                     AGYLKLGALMRFVSKSVVIGFVNALAILIFMAQLPELTNVTWHVYAMTIGGLAVIYLF
                     PYIPVIGKLLPSPLICIVLLTLFALFIGLDVRTVGDMGQLPDTLPIFLLPDIPLNLET
                     LAIILPYSLGLAAVGLLESMMTATIVDDLTDTTSDKNRECKGQGVANVASGFLGGMAG
                     CAMIGQSIINVKSGGRTRLSSFSAGVFLLIMVVFISDWLKAIPMAALVAVMIMVSIGT
                     FNWDSLRNIRQYPLSSNIVMIVTVVVVVATHNLAYGVLVGVLLSALFFANKIERYMAI
                     QSVFDESESTRTYTVTGQVFFSSADKFTSAFDFKEALSKVVIDVSQAHFWDVSAVAAV
                     DKVVIKFRREGTEVELIGMNEASKTLVDKFGIHDKPDALDRLNSH"
     misc_feature    complement(282017..283480)
                     /locus_tag="ABZJ_00258"
                     /note="Sulfate permease and related transporters (MFS
                     superfamily) [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     misc_feature    complement(283238..283480)
                     /locus_tag="ABZJ_00258"
                     /note="Sulfate transporter N-terminal domain with GLY
                     motif; Region: Sulfate_tra_GLY; pfam13792"
                     /db_xref="CDD:258076"
     misc_feature    complement(282434..283174)
                     /locus_tag="ABZJ_00258"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     pfam00916"
                     /db_xref="CDD:250221"
     misc_feature    complement(281996..282292)
                     /locus_tag="ABZJ_00258"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist domain of SulP-like sulfate transporters, plays
                     a role in the function and regulation of the transport
                     activity, proposed general NTP binding function; Region:
                     STAS_SulP_like_sulfate_transporter; cd07042"
                     /db_xref="CDD:132913"
     gene            complement(283775..285571)
                     /locus_tag="ABZJ_00259"
                     /db_xref="GeneID:12115344"
     CDS             complement(283775..285571)
                     /locus_tag="ABZJ_00259"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524215.1"
                     /db_xref="GI:384141505"
                     /db_xref="GeneID:12115344"
                     /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEV
                     LLIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTDQSYRFSGKLITKRFS
                     FDFTNNKPKNIKLTDRIPNTSDYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNH
                     CLMHSNDGTQVITSSIHVLHSLFVNRKDIRGLLLGTSSQSIINRFLESYTTEIVDDNV
                     EYKIKIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEITEFNHLQQGTGKRYP
                     IVFPPHPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTISKPDEK
                     NPRPREKSQNKNEHINTQKPPSRTSGEYRKRSEVETGNTQGILKYSFNEPTDDPIEVG
                     ASNQPYSDKSEEVETSSDEPYGNQNTKIKKSETTDTPPSRDERFDIQYIIQSLQELAS
                     EMGSPLEHLSAINEHGEMIASINLLQIKKLVPEPKHPSWIDYDKGRKLLFLKLDLKDQ
                     NGFSYLIDIHKNKNHEAFCAFLIFTQNKLTSEQIKKICIELENAKGIKKWALYCDSFI
                     HKMIAIKHLYATPDEWKNRFKNLFISLQKDKS"
     gene            complement(285654..286889)
                     /locus_tag="ABZJ_00260"
                     /db_xref="GeneID:12115345"
     CDS             complement(285654..286889)
                     /locus_tag="ABZJ_00260"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetracycline resistance protein, class B
                     (TETA(B) ) (Metal-tetracycline/H(+) antiporter)"
                     /protein_id="YP_005524216.1"
                     /db_xref="GI:384141506"
                     /db_xref="GeneID:12115345"
                     /translation="MIEKSEMNSSTKIALVITLLDAMGIGLIMPVLPTLLREFIASED
                     IANHFGVLLALYALMQVIFAPWLGKMSDRFGRRPVLLLSLIGASLDYLLLAFSSALWM
                     LYLGRLLSGITGATGAVAASVIADTTSASQRVKWFGWLGASFGLGLIAGPIIGGFAGE
                     ISPHSPFFIAALLNIVTFLVVMFWFRETKNTRDNTDTEVGVETQSNSVYITLFKTMPI
                     LLIIYFSAQLIGQIPATVWVLFTENRFGWNSMMVGFSLAGLGLLHSVFQAFVAGRIAT
                     KWGEKTAVLLGFIADSSAFAFLAFISEGWLVFPVLILLAGGGIALPALQGVMSIQTKS
                     HQQGALQGLLVSLTNATGVIGPLLFAVIYNHSLPIWDGWIWIIGLAFYCIIILLSMTF
                     MLTPQAQGSKQETSCQFHK"
     misc_feature    complement(285711..286853)
                     /locus_tag="ABZJ_00260"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(285822..286847)
                     /locus_tag="ABZJ_00260"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(285834..285836,285843..285848,
                     285855..285860,285867..285872,285903..285905,
                     285912..285917,285930..285935,285942..285944,
                     286086..286088,286098..286100,286110..286112,
                     286122..286124,286134..286136,286176..286178,
                     286185..286190,286197..286202,286209..286211,
                     286446..286448,286464..286469,286476..286481,
                     286515..286517,286524..286526,286533..286538,
                     286545..286550,286686..286691,286695..286700,
                     286710..286712,286719..286724,286731..286733,
                     286791..286796,286800..286808,286815..286817))
                     /locus_tag="ABZJ_00260"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            286950..287576
                     /locus_tag="ABZJ_00261"
                     /db_xref="GeneID:12115346"
     CDS             286950..287576
                     /locus_tag="ABZJ_00261"
                     /codon_start=1
                     /transl_table=11
                     /product="tetracycline repressor protein TetR"
                     /protein_id="YP_005524217.1"
                     /db_xref="GI:384141507"
                     /db_xref="GeneID:12115346"
                     /translation="MMSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYW
                     HVKNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHL
                     GTRPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERE
                     TPTTDSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS"
     misc_feature    286953..287567
                     /locus_tag="ABZJ_00261"
                     /note="tetracycline repressor protein TetR; Provisional;
                     Region: PRK13756"
                     /db_xref="CDD:172294"
     misc_feature    286977..287117
                     /locus_tag="ABZJ_00261"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    287154..287555
                     /locus_tag="ABZJ_00261"
                     /note="Tetracyclin repressor, C-terminal all-alpha domain;
                     Region: TetR_C; pfam02909"
                     /db_xref="CDD:251612"
     gene            complement(287987..288130)
                     /locus_tag="ABZJ_00262"
                     /db_xref="GeneID:12115347"
     CDS             complement(287987..288130)
                     /locus_tag="ABZJ_00262"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524218.1"
                     /db_xref="GI:384141508"
                     /db_xref="GeneID:12115347"
                     /translation="MLVVGKGAASGKEEGKFSALLAPRQPDWVASQGCRKSQLRSKAV
                     GLG"
     gene            complement(288196..289689)
                     /locus_tag="ABZJ_00263"
                     /db_xref="GeneID:12115348"
     CDS             complement(288196..289689)
                     /locus_tag="ABZJ_00263"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005524219.1"
                     /db_xref="GI:384141509"
                     /db_xref="GeneID:12115348"
                     /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMA
                     EQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARR
                     MAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKK
                     AGHTHQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPE
                     LTQLTHTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQ
                     AGRKVFTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSE
                     KRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPN
                     SRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAM
                     KVIACIEDPIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD"
     misc_feature    complement(289258..289605)
                     /locus_tag="ABZJ_00263"
                     /note="Transposase zinc-binding domain; Region:
                     Zn_Tnp_IS91; pfam14319"
                     /db_xref="CDD:258494"
     misc_feature    complement(288508..289179)
                     /locus_tag="ABZJ_00263"
                     /note="Putative transposase; Region: Y2_Tnp; pfam04986"
                     /db_xref="CDD:252923"
     gene            complement(289900..290340)
                     /locus_tag="ABZJ_00264"
                     /db_xref="GeneID:12115349"
     CDS             complement(289900..290340)
                     /locus_tag="ABZJ_00264"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524220.1"
                     /db_xref="GI:384141510"
                     /db_xref="GeneID:12115349"
                     /translation="MPFRSLERGWRRGATRSSYRGRDQAGATDVILDIKRLLLSPGNT
                     SILPENIVGQSLSVGFRPLPQTTPGGKGMKKPNQDDEPFFITEEIAAEMIAGGYEFEL
                     PPIPCTIRLRDVLERMTDAELALQPGEIADQERERCRRKPCSTS"
     gene            complement(290244..291080)
                     /locus_tag="ABZJ_00265"
                     /db_xref="GeneID:12115350"
     CDS             complement(290244..291080)
                     /locus_tag="ABZJ_00265"
                     /codon_start=1
                     /transl_table=11
                     /product="streptomycin 3''-kinase"
                     /protein_id="YP_005524221.1"
                     /db_xref="GI:384141511"
                     /db_xref="GeneID:12115350"
                     /translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLK
                     PIEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATE
                     IAAELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMM
                     SNASELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDP
                     RRIAQMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQT
                     SY"
     misc_feature    complement(290310..291053)
                     /locus_tag="ABZJ_00265"
                     /note="Aminoglycoside/hydroxyurea antibiotic resistance
                     kinase; Region: APH_6_hur; pfam04655"
                     /db_xref="CDD:252722"
     gene            complement(291080..291925)
                     /locus_tag="ABZJ_00266"
                     /db_xref="GeneID:12115351"
     CDS             complement(291080..291925)
                     /locus_tag="ABZJ_00266"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524222.1"
                     /db_xref="GI:384141512"
                     /db_xref="GeneID:12115351"
                     /translation="MYLSDLNAQQREPPLNRTNIFFGESHSDWLPVRGGESGDFVFRR
                     GDGHAFAKIAPASRRGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGV
                     PAADLSGADLLKAWPSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDF
                     LPDEDKSTPQLDLLARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLID
                     LGRLGTADRYADLALMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLD
                     PLTWG"
     misc_feature    complement(291089..291847)
                     /locus_tag="ABZJ_00266"
                     /note="Aminoglycoside 3'-phosphotransferase; Region: APH;
                     cd05150"
                     /db_xref="CDD:270699"
     misc_feature    complement(291110..291844)
                     /locus_tag="ABZJ_00266"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    complement(order(291089..291091,291095..291100,
                     291206..291208,291215..291220,291272..291277,
                     291311..291313,291317..291322,291332..291334,
                     291440..291454,291617..291619,291629..291640,
                     291686..291688,291770..291772,291776..291778,
                     291803..291805,291818..291826,291830..291832))
                     /locus_tag="ABZJ_00266"
                     /note="active site"
                     /db_xref="CDD:270699"
     misc_feature    complement(order(291272..291277,291311..291313,
                     291317..291322,291617..291619,291629..291640,
                     291770..291772,291776..291778,291803..291805,
                     291818..291820,291830..291832))
                     /locus_tag="ABZJ_00266"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270699"
     misc_feature    complement(order(291089..291091,291095..291100,
                     291206..291208,291215..291220,291332..291334,
                     291440..291454))
                     /locus_tag="ABZJ_00266"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:270699"
     gene            complement(292266..294053)
                     /locus_tag="ABZJ_00267"
                     /db_xref="GeneID:12115352"
     CDS             complement(292266..294053)
                     /locus_tag="ABZJ_00267"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524223.1"
                     /db_xref="GI:384141513"
                     /db_xref="GeneID:12115352"
                     /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEV
                     LLIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTNYTYRFSGKLITKRFS
                     FDFSNNKPRNIKLSDKIPDTSEYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNH
                     CLMHSNDGTQVITSSIHILHSLFVNRKDIRGLLLSTSGQSIINRFLESYTTEVENDNI
                     EYKIKIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEVTEFHHLQHGTGIRYP
                     IVYPPHPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTVSKTDEK
                     NPRPREKSQNKNEHINTQKPPSRTSGEYRKRSDVETGNTQNILKYSFNEPANDPIEVG
                     TSNHPYSDKSEDVETSSDEPYGNKNTKTKKSETTDNPPSRDERFDIQYIIQSLNHLTL
                     DTTSPLERVYSIDILGNEIHGFNLLQIKKLVPQPKHPSWIDAEFGRKLLFLKLELKDQ
                     HDQYYLIDIHKNKSHEAFCAFIIVSPHKLTREQIKNICIELENAKGIKKWTLRCESFT
                     KKIISIKHSSATPDEWKNRFKNLFSTLIN"
     gene            complement(294136..294993)
                     /locus_tag="ABZJ_00268"
                     /db_xref="GeneID:12115353"
     CDS             complement(294136..294993)
                     /locus_tag="ABZJ_00268"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_005524224.1"
                     /db_xref="GI:384141514"
                     /db_xref="GeneID:12115353"
                     /translation="MSFSKIYTRGLLGLHAPLIEVEVHVSQGLPSLTIVGLAEAAVRE
                     SKDRVRSAIINSGFQFPTKRLTINLAPADLPKDGSRLDLPIALGILIASGQLPENCTE
                     DFEFIGELALDGHVRPVSGALTLAMACQQAQHKIVLPVDNSQDISHLPNLECYPVNHL
                     KEVCEHFLGTQKLAHAQPSDHSNEMPYKFDLADVKGQLRPRRALEIAAAGGHSLLFKG
                     PPGTGKTLLASRLPSILPPLSTQETLEVASIYSISNTPHTFGQRPFRAPHHTASAIAL
                     VGGGCQFHK"
     misc_feature    complement(<294154..294948)
                     /locus_tag="ABZJ_00268"
                     /note="Predicted ATPase with chaperone activity
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0606"
                     /db_xref="CDD:223679"
     misc_feature    complement(294568..294933)
                     /locus_tag="ABZJ_00268"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     misc_feature    complement(<294301..294363)
                     /locus_tag="ABZJ_00268"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(294319..294342)
                     /locus_tag="ABZJ_00268"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(294316..294339)
                     /locus_tag="ABZJ_00268"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     gene            complement(295059..295286)
                     /locus_tag="ABZJ_00269"
                     /db_xref="GeneID:12115354"
     CDS             complement(295059..295286)
                     /locus_tag="ABZJ_00269"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524225.1"
                     /db_xref="GI:384141515"
                     /db_xref="GeneID:12115354"
                     /translation="MLETLLQAILEQIDEPKKDLEKNLRALLNETVEKLDLVSKQEIE
                     RQKTALHLANQRLEALQKQVSLLEEALKNKK"
     misc_feature    complement(295077..295286)
                     /locus_tag="ABZJ_00269"
                     /note="Membrane fusogenic activity; Region: BMFP; cl01115"
                     /db_xref="CDD:260794"
     gene            295566..295904
                     /locus_tag="ABZJ_00270"
                     /db_xref="GeneID:12115355"
     CDS             295566..295904
                     /locus_tag="ABZJ_00270"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein for nitrogen assimilation by
                     glutamine synthetase, regulates GlnL (NRII) and GlnE
                     (ATase)"
                     /protein_id="YP_005524226.1"
                     /db_xref="GI:384141516"
                     /db_xref="GeneID:12115355"
                     /translation="MKLVTAIVKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTE
                     LYRGAEYVVDFLPKVKIEIAISDEMVDAVIESITRVASTGKIGDGKIFVTNLEQVIRI
                     RTGETGPDAV"
     misc_feature    295566..295901
                     /locus_tag="ABZJ_00270"
                     /note="Nitrogen regulatory protein PII [Amino acid
                     transport and metabolism]; Region: GlnK; COG0347"
                     /db_xref="CDD:223424"
     gene            295962..297359
                     /locus_tag="ABZJ_00271"
                     /db_xref="GeneID:12115356"
     CDS             295962..297359
                     /locus_tag="ABZJ_00271"
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="YP_005524227.1"
                     /db_xref="GI:384141517"
                     /db_xref="GeneID:12115356"
                     /translation="MKKMLMALSLTGALLGGTAAWAEETVTTPTSEVTATSTSEAPAT
                     IAAAPAAEETPAAPTPTAKLDTGDTSWILISTALVLLMTIPGLALFYGGMVRKKNVLS
                     TMMFSLSAAILVSLLWVIAGYSIAFSGTGAYFGDLSKAMLNGVAFDALSGTIPESLFV
                     IFQMTFAIITVAILSGSIADRMKYSAFMAFIAIWVLVVYAPITHWVWAADGWLFKAGA
                     LDFAGGTVVHINSGVAGLVAAYMLGKRIGLGRESMAPHNLTLTVIGASLLWVGWFGFN
                     GGSALGAGARASMAILVTQVAAAAAAFSWLVVERMIRGKASVLGGASGAVAGLVVITP
                     AAGFVGVGGALVMGLIGGVVCFWGITALKRLLKADDALDAFGLHAVGGIVGAILTGVF
                     YSDEIIKAANVALAPTFAGQLWVQVEGVLATMVYSGIATFIILKVIDLIIGLRVNSDD
                     ERMGLDLSQHGERIE"
     misc_feature    296151..297350
                     /locus_tag="ABZJ_00271"
                     /note="Ammonia permease [Inorganic ion transport and
                     metabolism]; Region: AmtB; COG0004"
                     /db_xref="CDD:223083"
     gene            297517..297975
                     /locus_tag="ABZJ_00272"
                     /db_xref="GeneID:12115357"
     CDS             297517..297975
                     /locus_tag="ABZJ_00272"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator NrdR"
                     /protein_id="YP_005524228.1"
                     /db_xref="GI:384141518"
                     /db_xref="GeneID:12115357"
                     /translation="MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESY
                     EVVMPRVIKSNGKNEPFDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERD
                     VKSRTIGEIVMQSLFALDHVAYVRFASVYQDFQDVEAFRRQIEQMQQREH"
     misc_feature    297517..297960
                     /locus_tag="ABZJ_00272"
                     /note="transcriptional regulator NrdR; Validated; Region:
                     nrdR; PRK00464"
                     /db_xref="CDD:234774"
     misc_feature    297661..297927
                     /locus_tag="ABZJ_00272"
                     /note="ATP cone domain; Region: ATP-cone; pfam03477"
                     /db_xref="CDD:251987"
     gene            297991..299076
                     /locus_tag="ABZJ_00273"
                     /db_xref="GeneID:12115358"
     CDS             297991..299076
                     /locus_tag="ABZJ_00273"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine deaminase"
                     /protein_id="YP_005524229.1"
                     /db_xref="GI:384141519"
                     /db_xref="GeneID:12115358"
                     /translation="MSELKQDQYWMQQAIELAKRGLYSTKPNPNVGCVIVKDDQLIGE
                     GFHPKAGQPHAEVFALRQAGEQAQGATAYVTLEPCAHYGRTPPCAEALVKAQVKKVVV
                     ACPDPNPLVAGKGVQILKNAGIEVEIGICEDLAAQLNQGFLKAMSTGMPYVRLKVASS
                     LDGRTAMASGESKWITGSAARQDVQHWRAISGAVITGIETVIADDCQLNVRSLHNVDI
                     ETVAQPKRVILDRRGRLPLTAKILENPETVMVMGPYRQELADLGVIQLEIQPLKTLLQ
                     TLSKQYQIYDVLIEAGATLSSAFLQEGLIDEMISYVAPTLLGQSARAMFNADFEYMAQ
                     QLRFKLLDVTQLDQDIRLRLIPTQEKV"
     misc_feature    298021..299046
                     /locus_tag="ABZJ_00273"
                     /note="riboflavin biosynthesis protein RibD; Region:
                     eubact_ribD; TIGR00326"
                     /db_xref="CDD:232920"
     misc_feature    298021..298359
                     /locus_tag="ABZJ_00273"
                     /note="Riboflavin-specific deaminase. Riboflavin
                     biosynthesis protein RibD
                     (Diaminohydroxyphosphoribosylaminopyrimidine deaminase)
                     catalyzes the deamination of
                     2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone
                     5'-phosphate, which is an intermediate step in the...;
                     Region: Riboflavin_deaminase-reductase; cd01284"
                     /db_xref="CDD:238611"
     misc_feature    order(298150..298158,298222..298227,298252..298254)
                     /locus_tag="ABZJ_00273"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238611"
     misc_feature    order(298150..298152,298156..298158,298225..298227,
                     298252..298254)
                     /locus_tag="ABZJ_00273"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238611"
     misc_feature    298432..299058
                     /locus_tag="ABZJ_00273"
                     /note="Pyrimidine reductase, riboflavin biosynthesis
                     [Coenzyme metabolism]; Region: RibD; COG1985"
                     /db_xref="CDD:224896"
     gene            299073..300365
                     /locus_tag="ABZJ_00274"
                     /db_xref="GeneID:12115359"
     CDS             299073..300365
                     /locus_tag="ABZJ_00274"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA modification methylase
                     (adenine-specific methyltransferase)"
                     /protein_id="YP_005524230.1"
                     /db_xref="GI:384141520"
                     /db_xref="GeneID:12115359"
                     /translation="MNSEPSVYHKRRHAARTTDEYLFHQLVPYLGNKRRLLHLILEAL
                     EITGTLNSKKKNPPIFADFFAGSGVVSRLARQNGYRVIANDWEPYSHALNHAILACVD
                     APAFKELGGYQKAIDYLNRLPEVKGWVTHNLCPRNDDVYDPSRDRLFFKRRNGMRIDA
                     IRQQIATWQAQGAINDVEMSALLAPLLYSASFVSNTSGVFKSFHQGWGGRTQTALERI
                     ESLLWLTPSRFCEIGDRKRPAAEMWCVDAQHLANQMSGFEVDVAYLDPPYNQHAYSSN
                     YHVLNALTLWDQVDLPPPDTKGYKSGIDRAWRKERPSPYNSSKHAKDAYEKLLSTINA
                     RYILTSYSTDGNIEPKDLLMANLERGKVTLLTQDVPRYRVSKQRQSERARVLEFIVIT
                     DTHAKPGPPLRQLLGQLYHFAELGGVDTSGNSTQLALW"
     misc_feature    299157..300200
                     /locus_tag="ABZJ_00274"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:271798"
     gene            300408..301067
                     /locus_tag="ABZJ_00275"
                     /db_xref="GeneID:12115360"
     CDS             300408..301067
                     /locus_tag="ABZJ_00275"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase subunit alpha"
                     /protein_id="YP_005524231.1"
                     /db_xref="GI:384141521"
                     /db_xref="GeneID:12115360"
                     /translation="MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATN
                     GICLTVIEWGDNWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHV
                     DGVGEITLVREDARSIYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLI
                     PHTAERTNIGTWQVGSKVNLEVDVLARYIERLLLGDKAAEQKTESNISMAFLAENGFL
                     K"
     misc_feature    300408..300983
                     /locus_tag="ABZJ_00275"
                     /note="riboflavin synthase subunit alpha; Provisional;
                     Region: PRK09289"
                     /db_xref="CDD:236455"
     misc_feature    300414..300665
                     /locus_tag="ABZJ_00275"
                     /note="Lumazine binding domain; Region: Lum_binding;
                     pfam00677"
                     /db_xref="CDD:250049"
     misc_feature    300702..300956
                     /locus_tag="ABZJ_00275"
                     /note="Lumazine binding domain; Region: Lum_binding;
                     pfam00677"
                     /db_xref="CDD:250049"
     gene            complement(301127..301345)
                     /locus_tag="ABZJ_00276"
                     /db_xref="GeneID:12115361"
     CDS             complement(301127..301345)
                     /locus_tag="ABZJ_00276"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524232.1"
                     /db_xref="GI:384141522"
                     /db_xref="GeneID:12115361"
                     /translation="MDIPHQISTQIEQLNQGEQWTFSAQELYMSHNDFNSLSILLTRA
                     SEKGEFSITRTQHNKPWVGTHSVTLTKH"
     gene            complement(301476..302030)
                     /locus_tag="ABZJ_00277"
                     /db_xref="GeneID:12115362"
     CDS             complement(301476..302030)
                     /locus_tag="ABZJ_00277"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524233.1"
                     /db_xref="GI:384141523"
                     /db_xref="GeneID:12115362"
                     /translation="MARICDLLEPQTPIQLWVLNDEKAQLESQQNIEKAYADLKAELI
                     EQARIRRQLALEKALADKRAKEAAYAAELQADEVRKFSEQTEALQALRSHLEQEVAEH
                     TARYQKNPETPAIDYSSGAKLSITDDQILSELESVRVRLELEAESLIEQAVTVFRAKL
                     HAAAQEEIEYILKNSNFSDEKIEK"
     misc_feature    complement(<301698..>301982)
                     /locus_tag="ABZJ_00277"
                     /note="Archaeal/vacuolar-type H+-ATPase subunit I [Energy
                     production and conversion]; Region: NtpI; COG1269"
                     /db_xref="CDD:224188"
     gene            complement(302181..302558)
                     /locus_tag="ABZJ_00278"
                     /db_xref="GeneID:12115363"
     CDS             complement(302181..302558)
                     /locus_tag="ABZJ_00278"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit chi"
                     /protein_id="YP_005524234.1"
                     /db_xref="GI:384141524"
                     /db_xref="GeneID:12115363"
                     /translation="MAKVSFYLFETSEERQVDSACRLCRKILLKHSQIWWYCPDVQLQ
                     QTLDEKLWSFDPTSFIAHGVDQVDAAVCISAKQPSEQGWLVFNFNNHALEQVNHFSHI
                     IEIVENNEAAKQIGRENLKCIVV"
     misc_feature    complement(302196..302558)
                     /locus_tag="ABZJ_00278"
                     /note="DNA polymerase III chi subunit, HolC; Region:
                     DNA_pol3_chi; pfam04364"
                     /db_xref="CDD:252547"
     gene            complement(302551..303999)
                     /locus_tag="ABZJ_00279"
                     /db_xref="GeneID:12115364"
     CDS             complement(302551..303999)
                     /locus_tag="ABZJ_00279"
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase A"
                     /protein_id="YP_005524235.1"
                     /db_xref="GI:384141525"
                     /db_xref="GeneID:12115364"
                     /translation="MKFTTYTTFPEQTSNESLWILVDSEQLQSNLNTYQINNLESILT
                     ATQFKANFNETLPLFGQLSTQPHSQLLGLGKAAELQAAKLAKLAQTIIKSAQNKFKHI
                     AIDIAALPVEYHYLFALSLTQAAYGYDEFKSKKNEFVLQQVDLISSQTSLDENQLALV
                     HAVQSGQSYARDLGNRPGNICFPEYLAEQALALAAEFPDLLKVTVLNEQQMADLGMYA
                     FLAVSKGSERPGRIVTLEYQAQLEQAPVVLVGKGVTFDTGGISLKPGLGMDEMKFDMC
                     GAASVLGTIRALCEARLPIHVVGAIAAAENMPSGKATRPGDIVTTMSGQTVEILNTDA
                     EGRLVLCDTLTYIKRFNPAVVIDIATLTGACVVALGKVLSGLFSPDDTLAAELQQAGE
                     QSFDRVWRMPVIDDYQELLDSPFADIANIGGPHGGAITAACFLERFTRDYRWAHLDVA
                     GTAWLSGSAKGATGRPVPLLMQFLANRVSTNG"
     misc_feature    complement(302572..303999)
                     /locus_tag="ABZJ_00279"
                     /note="multifunctional aminopeptidase A; Provisional;
                     Region: PRK00913"
                     /db_xref="CDD:234863"
     misc_feature    complement(302578..303909)
                     /locus_tag="ABZJ_00279"
                     /note="Cytosol aminopeptidase family, N-terminal and
                     catalytic domains.  Family M17 contains zinc- and
                     manganese-dependent exopeptidases ( EC  3.4.11.1),
                     including leucine aminopeptidase. They catalyze removal of
                     amino acids from the N-terminus of a protein and...;
                     Region: Peptidase_M17; cd00433"
                     /db_xref="CDD:238247"
     misc_feature    complement(order(302620..302622,302713..302715,
                     302719..302724,302749..302751,302755..302757,
                     302770..302775,302779..302781,302794..302796,
                     302800..302805,302881..302883,302890..302904,
                     303010..303012,303022..303024,303028..303030,
                     303046..303060,303064..303066,303070..303081,
                     303085..303087,303181..303186,303193..303195,
                     303202..303204,303217..303219,303235..303237,
                     303319..303321,303325..303327,303463..303471,
                     303475..303477,303754..303756,303799..303801,
                     303823..303825,303862..303867))
                     /locus_tag="ABZJ_00279"
                     /note="interface (dimer of trimers) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238247"
     misc_feature    complement(order(302917..302919,302989..302991,
                     302995..302997,303001..303003,303178..303180,
                     303211..303213,303232..303234,303247..303249))
                     /locus_tag="ABZJ_00279"
                     /note="Substrate-binding/catalytic site; other site"
                     /db_xref="CDD:238247"
     misc_feature    complement(order(302995..302997,303001..303003,
                     303178..303180,303232..303234,303247..303249))
                     /locus_tag="ABZJ_00279"
                     /note="Zn-binding sites [ion binding]; other site"
                     /db_xref="CDD:238247"
     gene            304143..305243
                     /locus_tag="ABZJ_00280"
                     /db_xref="GeneID:12115365"
     CDS             304143..305243
                     /locus_tag="ABZJ_00280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524236.1"
                     /db_xref="GI:384141526"
                     /db_xref="GeneID:12115365"
                     /translation="MIIRRYLVKQVVSTSLVVIALLTLIMMGGRLIKYFGVAAQGRLD
                     ASILFSIIGYRLPEFLTLILPLGFFIGLMLVFGRLYVDHEMAVLNGSGVSRHQLARLL
                     IPMTLVYMVCQSVLMLWMTPWGLREFEKLTTTQAVRTGFDLVRPREFISSGPYTIYAG
                     SLSEDRKNLKDIFFYQRAAKEGKPDVMILAKEATRVEVANDTANVVDLVQGRRYEIFP
                     GQPKYTQAEFQSYRLRLENDKDVKFESGDVEALSTSKLFSKANDPVVRSELGWRLFGP
                     FTIIIALMLSVALSEVSPRQGRYYRLIPSIFIFASLIVLMIAIKTRISKGELDIWAYP
                     VALLVYAIAAALFSRKQKLGPKIKKQIKRVKL"
     misc_feature    304155..305192
                     /locus_tag="ABZJ_00280"
                     /note="Predicted permease YjgP/YjgQ family; Region:
                     YjgP_YjgQ; pfam03739"
                     /db_xref="CDD:252138"
     gene            305243..306313
                     /locus_tag="ABZJ_00281"
                     /db_xref="GeneID:12115366"
     CDS             305243..306313
                     /locus_tag="ABZJ_00281"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524237.1"
                     /db_xref="GI:384141527"
                     /db_xref="GeneID:12115366"
                     /translation="MLARRIVAKYVTKTTALAMFGTTIVLSVLQILFTYLGELGELKP
                     DYNAWQAFIYVLWGAPRYLYEILPISALIGAVIGLGALASNSELIVMRSVGISLWRIV
                     GWVMRSALLLIVLSFALSEWVVPYTNEKAQSVKSHRSVAALGEVKGYWSREGQRFIYI
                     DYANSQGNLRDIQVVDFNKDYHLQSLINAEQGKFIQDGQWTLQKASQMDILTDGNSIL
                     NNHDQQSLGLALQPKYVHMVTLDPEDLSPSQLISFMRYMDEYSQVPKTYQLAFWQKVA
                     SPFSLITLVLVACSFIFGPLRQQSMGFRLVIALFIGLGFYYLQDFLGYASLVYAPSPA
                     WFVLMPIILMFGAGSYLLYRAR"
     misc_feature    305255..306310
                     /locus_tag="ABZJ_00281"
                     /note="Predicted permease YjgP/YjgQ family; Region:
                     YjgP_YjgQ; cl12074"
                     /db_xref="CDD:264535"
     gene            306439..307986
                     /locus_tag="ABZJ_00282"
                     /db_xref="GeneID:12115367"
     CDS             306439..307986
                     /locus_tag="ABZJ_00282"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase III, cofactor
                     independent"
                     /protein_id="YP_005524238.1"
                     /db_xref="GI:384141528"
                     /db_xref="GeneID:12115367"
                     /translation="MTDATAGKIPHVLVIMDGVGHREAIEDNAFLAAKTPNLTAMKAK
                     HPNSLISGSGEDVGLPDGQMGNSEVGHMNLGAGRVLYQDFTRITKDIRTGAFFEHEVL
                     VDAVEKAKAAGGAVHIMGLLSEGGVHSHEDHIVAMCELALKRGAKVYLHAFLDGRDTP
                     PRSAQPSLEKLDALFAQYEGKGRIATMIGRYFAMDRDNRWDRVEQAYRLLTEGEAVRT
                     ATTAVEGLELAYAANENDEFVKATRIGEIAKVQDGDSVVFMNFRADRAREITRAFVEK
                     DFAGFERKVVPNLSKFVMLTRYQASIDAPVAYMPEELKNSLGEYLSSLGKTQLRIAET
                     EKYAHVTFFFSGGREDEYPGEKRILIPSPNVATYDLKPEMSAYEVTDELVKAINSGEY
                     DLLVVNYANGDMVGHTGVFDAAVKAVEAVDTCLGRVYEAVMAKKGHMLITADHGNVEQ
                     MQDYESGQVHTQHTTELVPFIYVGPTQATIAEGGVLADVAPTILNLMQIPVPAEMQGR
                     NLITLSA"
     misc_feature    306451..307971
                     /locus_tag="ABZJ_00282"
                     /note="phosphoglyceromutase; Provisional; Region:
                     PRK05434"
                     /db_xref="CDD:235463"
     gene            308002..309186
                     /locus_tag="ABZJ_00283"
                     /db_xref="GeneID:12115368"
     CDS             308002..309186
                     /locus_tag="ABZJ_00283"
                     /codon_start=1
                     /transl_table=11
                     /product="putative periplasmic carboxyl-terminal protease"
                     /protein_id="YP_005524239.1"
                     /db_xref="GI:384141529"
                     /db_xref="GeneID:12115368"
                     /translation="MLQYNIYKAFFVSVLMCCSQLAFAAPVVKEKLSSLHPDSPESEE
                     SYAEVPIESIQQFVQIYGIVRDNYVDEKSDDALFLQAIKGLVSGLDRYSRYLSAEEYR
                     QLIQYTEGDLASVDFVLSPESHVHKWMIRDLKTGSDSYKLGLRNGQTILKIDNQELKN
                     LTHDQVLGLLYGSIGSTLQVQTEESNSPISLVRNKKIETDIEPVMLHNQVLVLKIRVF
                     QQDTANEIKRLIEENSSSRLKAVLIDLRNNPGGLLSAAVESADLFLNHGIIVSTKSRS
                     EGNQQFQALPGNDFQNIKVGILINHRSASAAEVFTAAMKEHQRAWVMGEKSYGKGVVQ
                     KLFPLPSGAALQMTVSHYYTPNGNMIEGQGIQPNQTYPLPPEMKEEVYLDRVADLLLK
                     RK"
     misc_feature    308155..309117
                     /locus_tag="ABZJ_00283"
                     /note="C-terminal processing peptidase; serine protease
                     family S41; Region: Peptidase_S41_CPP; cd07560"
                     /db_xref="CDD:143476"
     misc_feature    308194..309138
                     /locus_tag="ABZJ_00283"
                     /note="C-terminal peptidase (prc); Region: prc; TIGR00225"
                     /db_xref="CDD:232883"
     misc_feature    <308407..308544
                     /locus_tag="ABZJ_00283"
                     /note="PDZ domain, also called DHR (Dlg homologous region)
                     or GLGF (after a conserved sequence motif). Many PDZ
                     domains bind C-terminal polypeptides, though binding to
                     internal (non-C-terminal) polypeptides and even to lipids
                     has been demonstrated; Region: PDZ; cd00136"
                     /db_xref="CDD:238080"
     misc_feature    order(308914..308916,308989..308991)
                     /locus_tag="ABZJ_00283"
                     /note="Catalytic dyad [active]"
                     /db_xref="CDD:143476"
     gene            complement(309190..310611)
                     /locus_tag="ABZJ_00284"
                     /db_xref="GeneID:12115369"
     CDS             complement(309190..310611)
                     /locus_tag="ABZJ_00284"
                     /codon_start=1
                     /transl_table=11
                     /product="type 4 fimbriae expression regulatory protein"
                     /protein_id="YP_005524240.1"
                     /db_xref="GI:384141530"
                     /db_xref="GeneID:12115369"
                     /translation="MAEQQPLVLLVDDEEDLCLLMQMTLARMGIKTHLAYRVEQAKQL
                     FTQFHYDACLTDLNLPDGSGIDLVKHVSQNYTNTPIAVLTAYGNMDIAIAALKAGAFD
                     FVSKPVNQVHLDQLLQKALNRQKVEHDAAENALENKLLIGRSLPIQQLRIAIKKIARS
                     QAPVFVTGESGTGKEVVANLVHRLSNRSEGPFIAINCGAIPTELMESELFGHKKGSFT
                     GATQDKQGLILSAHGGSLFLDEIAELPLSMQVKLLRAVQEKKIRPVGSDQEIDVDFRV
                     ISASHQDLDLLVRQGKFRQDLFFRIHVMDLILPPLRERGEDVLLLANHFIQKICMEWE
                     TPPKQLTEAAETYLLQQHFPGNVRELRNMIERAITLSEDTTIDVSHLHPAPLRANISN
                     PFASAAQSIQTTVAAPQVVKKLPSEGLERYLENIEKDILLNALNMTHWNRTLAAKKLG
                     MTFRSLRYRLKKFGLDTETEQEV"
     misc_feature    complement(309208..310608)
                     /locus_tag="ABZJ_00284"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    complement(310249..310587)
                     /locus_tag="ABZJ_00284"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(310291..310296,310303..310305,
                     310360..310362,310420..310422,310444..310446,
                     310573..310578))
                     /locus_tag="ABZJ_00284"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(310444..310446)
                     /locus_tag="ABZJ_00284"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(310420..310428,310432..310437))
                     /locus_tag="ABZJ_00284"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(310288..310296)
                     /locus_tag="ABZJ_00284"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(309709..310173)
                     /locus_tag="ABZJ_00284"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(310087..310110)
                     /locus_tag="ABZJ_00284"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(309769..309771,309895..309897,
                     310084..310107))
                     /locus_tag="ABZJ_00284"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(309892..309909)
                     /locus_tag="ABZJ_00284"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(309712..309714)
                     /locus_tag="ABZJ_00284"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(309223..309348)
                     /locus_tag="ABZJ_00284"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(310636..312204)
                     /locus_tag="ABZJ_00285"
                     /db_xref="GeneID:12115370"
     CDS             complement(310636..312204)
                     /locus_tag="ABZJ_00285"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein"
                     /protein_id="YP_005524241.1"
                     /db_xref="GI:384141531"
                     /db_xref="GeneID:12115370"
                     /translation="MQFPLNSSLSHTIFRLGTWYGLYRLIIAVSLNIILVLTDAQTDN
                     SLQQPALYSYTLLGYSLLSLVQLLCFKFIATQATRQLILFFIVDIICLSLLTFSVGEP
                     NLQLSLLYVIAIFTSAILLSARMSLLITLLAVIAVIYQRFVGSLFDYNNLNTIGNSAL
                     LAFLFFVVHGIGQIAVQRFKLLEALTFHQSIELYQLQNINRYILEQIEEGYLVLDENY
                     DIVVSNPAACSLLGIPPQFANEKYPLAKWHADLFEILKFGDLKEGDRFIFESRLSAYS
                     INIKVQHLLVPQQTLTLLILQDAQQINQQAQQLKLAALGQLSASIAHEIRNPLAAIVQ
                     ANELLKDSDPEQQNTLRHMIGKQTKRIDSIVQDTLGLARSERTHPIQIDVKHFIVTLL
                     EEDLFDVKHSIQLKISDSSLKFLFDEKQLRQVMINLVRNALRHNAPDSPYITINIHSQ
                     TNKIYIDVIDYGEGVSKRDISQLFKPFFSTEINGTGLGLYLSHSFCEANHAKLTYVEQ
                     KQGACFRIECPIIY"
     misc_feature    complement(<311497..>311727)
                     /locus_tag="ABZJ_00285"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    complement(<311497..311607)
                     /locus_tag="ABZJ_00285"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     misc_feature    complement(310645..311598)
                     /locus_tag="ABZJ_00285"
                     /note="Signal transduction histidine kinase, nitrogen
                     specific [Signal transduction mechanisms]; Region: NtrB;
                     COG3852"
                     /db_xref="CDD:226370"
     misc_feature    complement(311086..311274)
                     /locus_tag="ABZJ_00285"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(311101..311103,311113..311115,
                     311122..311124,311134..311136,311143..311145,
                     311155..311157,311200..311202,311209..311211,
                     311221..311223,311230..311232,311242..311244,
                     311254..311256))
                     /locus_tag="ABZJ_00285"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(311236..311238)
                     /locus_tag="ABZJ_00285"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(310654..310944)
                     /locus_tag="ABZJ_00285"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(310663..310665,310669..310674,
                     310690..310692,310738..310749,310810..310815,
                     310819..310821,310825..310827,310831..310833,
                     310903..310905,310912..310914,310924..310926))
                     /locus_tag="ABZJ_00285"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(310912..310914)
                     /locus_tag="ABZJ_00285"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(310741..310743,310747..310749,
                     310813..310815,310819..310821))
                     /locus_tag="ABZJ_00285"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(312215..312850)
                     /locus_tag="ABZJ_00286"
                     /db_xref="GeneID:12115371"
     CDS             complement(312215..312850)
                     /locus_tag="ABZJ_00286"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_005524242.1"
                     /db_xref="GI:384141532"
                     /db_xref="GeneID:12115371"
                     /translation="MITVLVVDDHELVRTGICRMLEDHADVEVIGQAESGEEAIAIVR
                     QQHPQVVLLDVNMPGIGGVETTRRLLQTAPETKVIAVSGLAEEPYPSLLLKAGAKGYI
                     TKGAPIAEMVRAINKVMQGGKYFSADIAEQLASSYLSDTQQSPFDSLSEREMQVAMMV
                     VNCISAQEIADKLFVSVKTVNTYRYRIFEKLGIDSDVKLTHLAIRYGLIKP"
     misc_feature    complement(312218..312850)
                     /locus_tag="ABZJ_00286"
                     /note="response regulator; Provisional; Region: PRK09483"
                     /db_xref="CDD:236538"
     misc_feature    complement(312494..312838)
                     /locus_tag="ABZJ_00286"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(312536..312541,312548..312550,
                     312605..312607,312665..312667,312689..312691,
                     312824..312829))
                     /locus_tag="ABZJ_00286"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(312689..312691)
                     /locus_tag="ABZJ_00286"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(312665..312673,312677..312682))
                     /locus_tag="ABZJ_00286"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(312533..312541)
                     /locus_tag="ABZJ_00286"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(312236..312406)
                     /locus_tag="ABZJ_00286"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(312263..312265,312296..312310,
                     312314..312319,312323..312328,312350..312358,
                     312395..312403))
                     /locus_tag="ABZJ_00286"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(312236..312241,312248..312250,
                     312257..312265,312356..312358,312362..312364,
                     312368..312370))
                     /locus_tag="ABZJ_00286"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            313063..314109
                     /locus_tag="ABZJ_00287"
                     /db_xref="GeneID:12115372"
     CDS             313063..314109
                     /locus_tag="ABZJ_00287"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine endopeptidase"
                     /protein_id="YP_005524243.1"
                     /db_xref="GI:384141533"
                     /db_xref="GeneID:12115372"
                     /translation="MKNSKKSLMHVLSMSILLSLSSTSFAELVNNPSSGSTGTASLNW
                     SAADASQLLNDEDDEPTPQGSTSVTTTLRGSNAPRVITSTPKVAPIRDTVGYNAQPSV
                     SARAALVMDAQTGEVLYSKNTNASVPIASITKLMTAVVTADARLNMSEEITLEQIDFA
                     GAGGKNSSSTLRVGDKMNRAEVLLFALMKSENPAAAALARTYPGGRAAFVAAMNAKAR
                     ALGMNATHYYESTGLDPRNVSSARDLGILASTASQYGLIRQFSTTPTYDFNLGYRVLK
                     SNNTNALVRNGGWNINLSKTGYINEAGRCVVMHTTVNSRPAVIVLLGEPSTQARNNDA
                     TNLLGWLSNLPKRI"
     misc_feature    313291..314085
                     /locus_tag="ABZJ_00287"
                     /note="Beta-lactamase enzyme family; Region:
                     Beta-lactamase2; cl19191"
                     /db_xref="CDD:267544"
     misc_feature    313303..>314103
                     /locus_tag="ABZJ_00287"
                     /note="D-alanyl-D-alanine carboxypeptidase [Cell envelope
                     biogenesis, outer membrane]; Region: DacC; COG1686"
                     /db_xref="CDD:224600"
     gene            complement(314216..315355)
                     /locus_tag="ABZJ_00288"
                     /db_xref="GeneID:12115373"
     CDS             complement(314216..315355)
                     /locus_tag="ABZJ_00288"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="YP_005524244.1"
                     /db_xref="GI:384141534"
                     /db_xref="GeneID:12115373"
                     /translation="MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPR
                     IIGKDVEIYVKYEGLNPTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAA
                     RAGIKAFVLIPEGKIAMGKMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNS
                     INPYRLQGQKTIAYEIVEALGRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQ
                     VVYDAATDQFTGPKPEGLPTMVGYQASGAAPFLRGAPVEKPETVATAIRIGNPQSWNH
                     AKAVVRDSKGWFDELQDSEILEAQRLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEG
                     SVIVCTVTGNGLKDPDTAIKQCADAVMLSIDATMDQVKDSILSNM"
     misc_feature    complement(314312..315319)
                     /locus_tag="ABZJ_00288"
                     /note="Threonine synthase is a pyridoxal phosphate (PLP)
                     dependent enzyme that catalyses the last reaction in the
                     synthesis of  threonine from aspartate. It proceeds by
                     converting O-phospho-L-homoserine (OPH) into threonine and
                     inorganic phosphate. In plants; Region: Thr-synth_1;
                     cd01563"
                     /db_xref="CDD:107206"
     misc_feature    complement(order(314324..314326,314429..314434,
                     314438..314446,314819..314821,314909..314914,
                     314948..314956,314960..314980,315029..315031,
                     315047..315052,315059..315061,315107..315109,
                     315176..315178,315248..315253,315266..315268))
                     /locus_tag="ABZJ_00288"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107206"
     misc_feature    complement(order(314330..314332,314768..314782,
                     315080..315082,315158..315160))
                     /locus_tag="ABZJ_00288"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107206"
     misc_feature    complement(315158..315160)
                     /locus_tag="ABZJ_00288"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107206"
     gene            complement(315411..316724)
                     /locus_tag="ABZJ_00289"
                     /db_xref="GeneID:12115374"
     CDS             complement(315411..316724)
                     /locus_tag="ABZJ_00289"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="YP_005524245.1"
                     /db_xref="GI:384141535"
                     /db_xref="GeneID:12115374"
                     /translation="MECDVKPVRLAILGLGTVGGGALKLLQENAAEIKRRTGREIQIT
                     HVGTRRPRPDLELEGIKQSADLLDIVRQPDVDVVVEVMGGIHPAYEIIMEAIKHGKQV
                     VTANKALLAEHGNELFKAAEDNAVQIAYEAAVAGGIPIIKVIREGLAANHIEWLAGII
                     NGTGNFILTEMREKGRAFDDVLKEAQELGYAEADPTFDVEGIDAAHKLTILASCAFGI
                     PLQFDKVYTEGISKITAQDVKYAEELGFRIKHLGIARRAEKGIELRVHPTLIPDEQLI
                     ANVNGVKNAVLVQANAVGPTLYYGAGAGAGPTASAVVADVIDIVRDISYTEDGAGTIP
                     QLAFEALTNMPILSREEMTTGYYIRLNAEDQTGVLADVTTILSRAGISIDAIMQQSRL
                     KDLIPIVILTDPIVESKMDDALAQIQALPAIRGEIVRIRLESLDS"
     misc_feature    complement(315426..316709)
                     /locus_tag="ABZJ_00289"
                     /note="homoserine dehydrogenase; Provisional; Region:
                     PRK06349"
                     /db_xref="CDD:235783"
     misc_feature    complement(316332..316685)
                     /locus_tag="ABZJ_00289"
                     /note="Homoserine dehydrogenase, NAD binding domain;
                     Region: NAD_binding_3; pfam03447"
                     /db_xref="CDD:251960"
     misc_feature    complement(315774..316310)
                     /locus_tag="ABZJ_00289"
                     /note="Homoserine dehydrogenase; Region: Homoserine_dh;
                     pfam00742"
                     /db_xref="CDD:250099"
     misc_feature    complement(315426..315659)
                     /locus_tag="ABZJ_00289"
                     /note="ACT_HSDH_Hom CD includes the C-terminal ACT domain
                     of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH)
                     and related domains; Region: ACT_HSDH-Hom; cd04881"
                     /db_xref="CDD:153153"
     gene            complement(316957..317772)
                     /locus_tag="ABZJ_00290"
                     /db_xref="GeneID:12115375"
     CDS             complement(316957..317772)
                     /locus_tag="ABZJ_00290"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-disulfide isomerase"
                     /protein_id="YP_005524246.1"
                     /db_xref="GI:384141536"
                     /db_xref="GeneID:12115375"
                     /translation="MSFTRSQIFLACALASSLLFSACSKENKPQKEDALTATAPATGE
                     ASTIIERNAKQRLIETLQKQFKNANINVKILDIKPTEVPNLYWVNLEGMTSVYTTSDG
                     KYLIQGDVIRLGDKELHNIGDSLQASENKKHLAALKNEDLIVYPAKGGKAKHVIYVFT
                     DASCPYCHKLHEHLAEINEKGIEVRYIAWPRGEQFMPTMEAVWCSADRKAAFDQAVQG
                     ISIPPAQCKNPVREQYQLGLNMGVNGTPAIYNVDGEYLGGYLTPDELIKRLDK"
     misc_feature    complement(316960..317673)
                     /locus_tag="ABZJ_00290"
                     /note="Protein-disulfide isomerase [Posttranslational
                     modification, protein turnover, chaperones]; Region: DsbG;
                     COG1651"
                     /db_xref="CDD:224565"
     misc_feature    complement(316966..317559)
                     /locus_tag="ABZJ_00290"
                     /note="DsbA family, DsbC and DsbG subfamily; V-shaped
                     homodimeric proteins containing a redox active CXXC motif
                     imbedded in a TRX fold. They function as protein disulfide
                     isomerases and chaperones in the bacterial periplasm to
                     correct non-native disulfide bonds...; Region:
                     DsbA_DsbC_DsbG; cd03020"
                     /db_xref="CDD:239318"
     misc_feature    complement(order(317440..317487,317491..317526,
                     317533..317559))
                     /locus_tag="ABZJ_00290"
                     /note="dimerization domain [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239318"
     misc_feature    complement(317440..317463)
                     /locus_tag="ABZJ_00290"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239318"
     misc_feature    complement(order(317272..317274,317281..317283))
                     /locus_tag="ABZJ_00290"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239318"
     gene            complement(317919..318839)
                     /locus_tag="ABZJ_00291"
                     /db_xref="GeneID:12115376"
     CDS             complement(317919..318839)
                     /locus_tag="ABZJ_00291"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific recombinase XerD"
                     /protein_id="YP_005524247.1"
                     /db_xref="GI:384141537"
                     /db_xref="GeneID:12115376"
                     /translation="MINKKPRIPSPVQIPEHLSFLQGFRDYLVAQTVSPHTRNAYLSD
                     LIQCSELHKKNRLPDWTSDDISDVLIELTKVGKSPRSIARCLSALRQFYKFLREQKLR
                     SDNPVATHHSPKIGRALPKDLCEEDVEALIQAPDITTALGLRDRAMFEVLYACGLRVS
                     ELLNLRLELINLKQGYLRITGKGNKERLVPLGQYACDWVERYLNEARPQFYKSSTDYL
                     FLTQHGGIMSRQNFWYAIKRYALQANIQAELSPHTLRHAFATHLLNHGADLRVVQMLL
                     GHSDLSTTQIYTHVAQVRMQQLHEKHHPRG"
     misc_feature    complement(317922..318797)
                     /locus_tag="ABZJ_00291"
                     /note="site-specific tyrosine recombinase XerD; Reviewed;
                     Region: xerD; PRK00283"
                     /db_xref="CDD:234713"
     misc_feature    complement(317943..318779)
                     /locus_tag="ABZJ_00291"
                     /note="XerD and XerC integrases, DNA breaking-rejoining
                     enzymes, N- and C-terminal domains. XerD-like integrases
                     are involved in the site-specific integration and excision
                     of lysogenic bacteriophage genomes, transposition of
                     conjugative transposons, termination...; Region:
                     INT_XerDC; cd00798"
                     /db_xref="CDD:238413"
     misc_feature    complement(order(317979..317981,318006..318008,
                     318075..318077,318084..318086,318294..318296,
                     318366..318368))
                     /locus_tag="ABZJ_00291"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238413"
     misc_feature    complement(order(317979..317981,318072..318077,
                     318084..318086,318366..318368))
                     /locus_tag="ABZJ_00291"
                     /note="active site"
                     /db_xref="CDD:238413"
     gene            318947..319246
                     /locus_tag="ABZJ_00292"
                     /db_xref="GeneID:12115377"
     CDS             318947..319246
                     /locus_tag="ABZJ_00292"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+ transport system protein A"
                     /protein_id="YP_005524248.1"
                     /db_xref="GI:384141538"
                     /db_xref="GeneID:12115377"
                     /translation="MYTSKKGLGSDAVRLSALKVKQAATITKVNRIEVESEQQDLVAI
                     RLESLGFVPGTRVEVITKGVFGGDPILIQIGFTRFALRKAEAEKIEIQVEEGVPA"
     misc_feature    318983..319225
                     /locus_tag="ABZJ_00292"
                     /note="FeoA domain; Region: FeoA; pfam04023"
                     /db_xref="CDD:252322"
     gene            319243..321096
                     /locus_tag="ABZJ_00293"
                     /db_xref="GeneID:12115378"
     CDS             319243..321096
                     /locus_tag="ABZJ_00293"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+ transport system protein B"
                     /protein_id="YP_005524249.1"
                     /db_xref="GI:384141539"
                     /db_xref="GeneID:12115378"
                     /translation="MSDALRIALVGNPNCGKTSLFNHLTGTRQKVANYAGVTVERKVG
                     HFQLPSGRSVRVLDLPGTYSLNATSPDEAITRDVCLGKIAEEGQQDAFLCVVDATNLK
                     LHLGLVLEMIELGRPILLVLNMMDEARRRGIQINTQKLSQRLGVPVVETVAVRNAGIE
                     NLLHALDQEKYSVPQTELSGLTGTHHQKIDMIFKDVVHYVDQEDKRTDFLDRIFLHPV
                     LGLLSLAIMMFIVFQAVFAWAAPFMDGIEGFFGWLGEVVGSVITQPLLHSLVVDGIIA
                     GAGGVVVFLPQILILFFFILVLEESGYLPRAAFLLDKLMFQAGLSGRAFIPLLSSFAC
                     AVPGIMATRSISDPRDRFTTIMVAPLMTCSARLPVYALLIAAFIPEKMVWGIFNLQGL
                     VLFGLYMAGIVSALCVSFLMKFFQKDKSQHALLLELPSYRFPDLKSVGIGLLDRAKIF
                     LKRVGGIIFALSILLWFLCTFPQPPEGATLPAIDYSFAGMLGHLIQPLFAPVGFNWQI
                     CIALIPAMAAREVVVAALGTVYALSATDEDAVAQGLSHLISADGTGWSLATGLSLLVW
                     FIYAPHCLATLATVRRETGSWKHVAAMTAYLFGLAYFASFVTYQIASHYWG"
     misc_feature    319252..321084
                     /locus_tag="ABZJ_00293"
                     /note="Fe2+ transport system protein B [Inorganic ion
                     transport and metabolism]; Region: FeoB; COG0370"
                     /db_xref="CDD:223447"
     misc_feature    319264..319752
                     /locus_tag="ABZJ_00293"
                     /note="Ferrous iron transport protein B (FeoB) family;
                     Region: FeoB; cd01879"
                     /db_xref="CDD:206667"
     misc_feature    319273..319296
                     /locus_tag="ABZJ_00293"
                     /note="G1 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(319282..319284,319288..319299,319609..319614,
                     319618..319620,319696..319704)
                     /locus_tag="ABZJ_00293"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206667"
     misc_feature    319351..319365
                     /locus_tag="ABZJ_00293"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206667"
     misc_feature    319354..319356
                     /locus_tag="ABZJ_00293"
                     /note="G2 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    319414..319425
                     /locus_tag="ABZJ_00293"
                     /note="G3 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(319423..319479,319504..319509)
                     /locus_tag="ABZJ_00293"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206667"
     misc_feature    319609..319620
                     /locus_tag="ABZJ_00293"
                     /note="G4 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    319696..319704
                     /locus_tag="ABZJ_00293"
                     /note="G5 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    320089..320364
                     /locus_tag="ABZJ_00293"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     misc_feature    320419..320580
                     /locus_tag="ABZJ_00293"
                     /note="Ferrous iron transport protein B C terminus;
                     Region: FeoB_C; pfam07664"
                     /db_xref="CDD:254341"
     misc_feature    320599..>320832
                     /locus_tag="ABZJ_00293"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     gene            321117..321368
                     /locus_tag="ABZJ_00294"
                     /db_xref="GeneID:12115379"
     CDS             321117..321368
                     /locus_tag="ABZJ_00294"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524250.1"
                     /db_xref="GI:384141540"
                     /db_xref="GeneID:12115379"
                     /translation="MLQYLIIAVLVIWSAIVVFKKVFPKTANSAFSALSVFCEKQGWA
                     TLAKWLKPKMTFGCAGGCGCSSEDKPTNTIQEIKPVKWQ"
     gene            321481..322875
                     /locus_tag="ABZJ_00295"
                     /db_xref="GeneID:12115380"
     CDS             321481..322875
                     /locus_tag="ABZJ_00295"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
                     synthetase"
                     /protein_id="YP_005524251.1"
                     /db_xref="GI:384141541"
                     /db_xref="GeneID:12115380"
                     /translation="MLTFLPFCRLINCGAKMLIQRGGLKVVAGLGISGVSAVNFLHEQ
                     GYQVAVTDSRPTPPGHDQIPAGVKTSFGQLDQELLLQAEEIILSPGLAPQLPEIQAAI
                     AKGISVVGDIQLLRRATDVPIVAITGSNAKSTVTTLIGLMAKDAGKKVAVGGNLGRPA
                     LDLLKDQPELLVLELSSFQLETTSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIF
                     QGAKKVVFNRDDALSRPLVPDTTPMQSFGLNAPDLNQYGVLRDADGTLWLARGLQRLI
                     KSSDLYIQGMHNVANALACLALGEAIGLPMESMLETLKRFKGLEHRCEYVKTVRDVRY
                     YNDSKGTNVGATLAAIDGLGAAIEVKKGKVALILGGQGKGQDFSPLRSSIEKYAKVVV
                     LIGEDAPVIEQAIQGATKILHAATLKEAVELCQRETQAEDVVLLSPACASFDMFKSYN
                     DRGQQFVACVNSLV"
     misc_feature    321529..322872
                     /locus_tag="ABZJ_00295"
                     /note="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
                     synthetase; Provisional; Region: murD; PRK03803"
                     /db_xref="CDD:235160"
     misc_feature    321856..322377
                     /locus_tag="ABZJ_00295"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    322441..322704
                     /locus_tag="ABZJ_00295"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            322900..324096
                     /locus_tag="ABZJ_00296"
                     /db_xref="GeneID:12115381"
     CDS             322900..324096
                     /locus_tag="ABZJ_00296"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein, stabililzes FtsZ ring"
                     /protein_id="YP_005524252.1"
                     /db_xref="GI:384141542"
                     /db_xref="GeneID:12115381"
                     /translation="MAGLAQTTIQKINHWYERILPKWPAEVTPRNVLIFCVVALLCIG
                     SVMVASASMPYAEYMHENPFHYVIRHGISIVAAGVVAYLTYRISLNTWFKNTFPLWLL
                     TMVLLLAALAVGSEVNGSTRWIKIGGFTLQPTEVAKVMMAIFTADYVVRRAKEVRTHW
                     KGLLRLSGVMAITVGLIIAEPDLGATVVIVMMMVGVFFLAGAPPTQFLIMLGAIVTGI
                     VFLILFEPYRFQRLISFTDPWADPLGVGYQLSNALMAFGRGEWFGTGLGHSVQKLSYL
                     PEAHTDFMLAVLGEEFGFFGISIVIGLSFLMLACCIKIGHRALKHHYLRAGYLAYGIS
                     IIFLLQILVNAGMNMGLMPTKGLTLPFISYGGTSLMMCAAMISLILKIDASTQEVNPE
                     REESNF"
     misc_feature    322987..324057
                     /locus_tag="ABZJ_00296"
                     /note="cell division protein FtsW; Region: ftsW;
                     TIGR02614"
                     /db_xref="CDD:233951"
     gene            complement(324146..325078)
                     /locus_tag="ABZJ_00297"
                     /db_xref="GeneID:12115382"
     CDS             complement(324146..325078)
                     /locus_tag="ABZJ_00297"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl- and glutaminyl-tRNA synthetase"
                     /protein_id="YP_005524253.1"
                     /db_xref="GI:384141543"
                     /db_xref="GeneID:12115382"
                     /translation="MTVKNSPAELSSALANQRNDVPLIRYSGRFAPSPTGPLHFGSLI
                     TAVASYCDARAHQGRWLVRVEDTDIPRIYPGSEDHILASLEAFQFDPDAEIIFQKDRL
                     DIYESVLDQLKKEGLVYACQCTRKMLGSNAIYAGTCRDLHLDFQHQAIRVKVQDQPIC
                     FDDRLQGLHCSNLEHDLGDFVLKRRDGIINYQLAVVVDDYLQGITHVVRGADLLDNTE
                     RQIWLGQLLGYPKLSYMHLPLAMNDQGQKLSKQNLAHALDLTKAPELLQQAIQALGQP
                     QVDLDRPEVMLKQAVAQWNVDLIPHGQQLCGTYL"
     misc_feature    complement(324164..325006)
                     /locus_tag="ABZJ_00297"
                     /note="glutamyl-Q tRNA(Asp) synthetase; Reviewed; Region:
                     PRK05710"
                     /db_xref="CDD:235573"
     misc_feature    complement(order(324323..324334,324953..324964))
                     /locus_tag="ABZJ_00297"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    complement(order(324329..324331,324953..324955,
                     324962..324964))
                     /locus_tag="ABZJ_00297"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    complement(324953..324964)
                     /locus_tag="ABZJ_00297"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    complement(324323..324334)
                     /locus_tag="ABZJ_00297"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173912"
     gene            complement(325081..325641)
                     /locus_tag="ABZJ_00298"
                     /db_xref="GeneID:12115383"
     CDS             complement(325081..325641)
                     /locus_tag="ABZJ_00298"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaK suppressor protein"
                     /protein_id="YP_005524254.1"
                     /db_xref="GI:384141544"
                     /db_xref="GeneID:12115383"
                     /translation="MYDEECPIMANDNHNQVLDEHTEVVVEGDKASAKRARKVKPKTS
                     DVGSTASLFGIAPYQPKKNEEYMSEGQLEHFRQILQAWKAELMSEVDRTLNTMQDEST
                     ALPDVNDRATQEEEFAIELRTRDRERKLIRKIEQSLEAIKNEDYGFCETCGIEIGLRR
                     LEARPTATLCIDCKTLAEIKEKQNNG"
     misc_feature    complement(325114..325443)
                     /locus_tag="ABZJ_00298"
                     /note="RNA polymerase-binding protein DksA; Region: dksA;
                     TIGR02420"
                     /db_xref="CDD:131473"
     gene            complement(325828..326640)
                     /locus_tag="ABZJ_00299"
                     /db_xref="GeneID:12115384"
     CDS             complement(325828..326640)
                     /locus_tag="ABZJ_00299"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic 3',5'-adenosine monophosphate
                     phosphodiesterase (regulator of lacZ)"
                     /protein_id="YP_005524255.1"
                     /db_xref="GI:384141545"
                     /db_xref="GeneID:12115384"
                     /translation="MTFQVSTLSQKNHVIIQITDTHLLEYPQLEFVGMNPEESFHAII
                     QQILKQHPEADAIIHTGDLAQAPTPITYKRYINFMQTLGLPFFQTLGNHDNVDHFPLH
                     NENHQQPVVVGLGNWRVIMLNSAVKGKVDGHLSSEQLENLANLLEQFADHPVLLACHH
                     HPFAMKSKWIDHHKLQNSNALLDTLSPFQNVKALVCGHVHQDSLNIWQGIEFFSTPST
                     SVQFKPFSNDFALDQNAPGYRYIRLNNDGSFETKVFRLENFKTRINTDISGY"
     misc_feature    complement(325831..326598)
                     /locus_tag="ABZJ_00299"
                     /note="Predicted phosphohydrolases [General function
                     prediction only]; Region: Icc; COG1409"
                     /db_xref="CDD:224327"
     misc_feature    complement(325897..326598)
                     /locus_tag="ABZJ_00299"
                     /note="Enterobacter aerogenes GpdQ and related proteins,
                     metallophosphatase domain; Region: MPP_GpdQ; cd07402"
                     /db_xref="CDD:163645"
     misc_feature    complement(order(325981..325983,326041..326043,
                     326047..326049,326164..326166,326362..326367,
                     326446..326448,326455..326457,326575..326577,
                     326581..326583))
                     /locus_tag="ABZJ_00299"
                     /note="active site"
                     /db_xref="CDD:163645"
     misc_feature    complement(order(326041..326043,326047..326049,
                     326164..326166,326365..326367,326455..326457,
                     326575..326577,326581..326583))
                     /locus_tag="ABZJ_00299"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163645"
     misc_feature    complement(order(325900..325902,325906..325908,
                     325915..325917,326002..326004,326008..326016,
                     326023..326037,326056..326058,326062..326064,
                     326143..326148,326152..326154,326410..326412,
                     326437..326439,326446..326448,326503..326508,
                     326515..326520,326527..326529,326536..326538))
                     /locus_tag="ABZJ_00299"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163645"
     gene            complement(326645..327271)
                     /locus_tag="ABZJ_00300"
                     /db_xref="GeneID:12115385"
     CDS             complement(326645..327271)
                     /locus_tag="ABZJ_00300"
                     /codon_start=1
                     /transl_table=11
                     /product="NTP pyrophosphohydrolase including oxidative
                     damage repair enzymes"
                     /protein_id="YP_005524256.1"
                     /db_xref="GI:384141546"
                     /db_xref="GeneID:12115385"
                     /translation="MSIVERPSYTSKDVEVTSREPLFSGFIQVEKVSLRHRLFNQSEY
                     TPVLQRELVHRPEAAGVLLYNDQKQQFALIEQFRVGALDDSHSPWQLEIIAGVLDGNE
                     SPESCIRRESLEESGCEVQDLEHLFSFYPSAGACSELFHLYVAETNLPAVGGVFGVDN
                     EGENIQLHLFSYSEIQTLLDSGRLRNAPVIMALQWLAQHSKTIINPKR"
     misc_feature    complement(326657..327250)
                     /locus_tag="ABZJ_00300"
                     /note="ADP-ribose pyrophosphatase NudF; Provisional;
                     Region: nudF; PRK10729"
                     /db_xref="CDD:182682"
     misc_feature    complement(326675..327109)
                     /locus_tag="ABZJ_00300"
                     /note="ADP-ribose pyrophosphatase (ADPRase) catalyzes the
                     hydrolysis of ADP-ribose and a variety of additional
                     ADP-sugar conjugates to AMP and ribose-5-phosphate. Like
                     other members of the Nudix hydrolase superfamily, it
                     requires a divalent cation, such as Mg2+; Region:
                     ADPRase_NUDT5; cd03424"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(326675..326680,326690..326692,
                     326699..326701,326711..326713,326732..326737,
                     326774..326776,326780..326785,326855..326869,
                     326873..326875,326879..326890,327005..327007,
                     327035..327037,327041..327043,327047..327049,
                     327101..327103,327107..327109))
                     /locus_tag="ABZJ_00300"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(326858..326860,326927..326929,
                     326939..326941,326981..326983,327038..327040,
                     327098..327100))
                     /locus_tag="ABZJ_00300"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(326783..326785,326858..326860,
                     326927..326929,326939..326941,326981..326989,
                     327038..327040))
                     /locus_tag="ABZJ_00300"
                     /note="active site"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(326918..326971,326975..326986))
                     /locus_tag="ABZJ_00300"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239516"
     misc_feature    complement(order(326783..326785,326927..326929,
                     326939..326941))
                     /locus_tag="ABZJ_00300"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239516"
     gene            complement(327347..329227)
                     /locus_tag="ABZJ_00301"
                     /db_xref="GeneID:12115386"
     CDS             complement(327347..329227)
                     /locus_tag="ABZJ_00301"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylpyrimidine moiety synthesis in
                     thiamin biosynthesis"
                     /protein_id="YP_005524257.1"
                     /db_xref="GI:384141547"
                     /db_xref="GeneID:12115386"
                     /translation="MMNQLTNLSSAEISAQHEQDAKDLTRILPASKKVYIEGSRPDIQ
                     VPMREISLTDTPTGLGGEHNPPIMVYDTSGVYTDPNVQIDLNKGLPSVRQKWIEERND
                     TDVLSGLTSKFGQERLKDIRTADIRFAHIQNPRRAKAGKNVTQMHYAKQGIITPEMEY
                     IAIRENQRQREAVDMRQHPGQNFGAKNLKEITPEFVRQEVAEGRAIIPANINHPELEP
                     MIIGRNFLVKINANIGNSALGSSIDEEVAKMTWATRWGADTIMDLSTGKNIHETREWI
                     IRNSPVPIGTVPIYQALEKVDGVAENLTWEIFKDTLIEQAEQGVDYFTIHAGVLLRYV
                     PLTANRLTGIVSRGGSIMAQWCLAHHEENFLYTHFDEICEIMKAYDVSFSLGDGLRPG
                     CIQDANDEAQFSELKTLGELTHRAWEHDVQVMIEGPGHVPMHMIKENMDLQLEVCKEA
                     PFYTLGPLTTDIAPGYDHITSAIGAAMIGWYGTAMLCYVTPKEHLGLPNKKDVKDGII
                     TYKIAAHAADLAKGHPGAQVRDNALSKARFEFRWDDQFNLSLDPDTARSMHDETLPKE
                     AHKSAHFCSMCGPKFCSMKITQNVRDYANNLTNSDSEVEEGLKAMKEVYQEQGQKLYH
                     KV"
     misc_feature    complement(327350..329191)
                     /locus_tag="ABZJ_00301"
                     /note="thiamine biosynthesis protein ThiC; Provisional;
                     Region: PRK09284"
                     /db_xref="CDD:236451"
     misc_feature    complement(328919..329146)
                     /locus_tag="ABZJ_00301"
                     /note="ThiC-associated domain; Region: ThiC-associated;
                     pfam13667"
                     /db_xref="CDD:257973"
     misc_feature    complement(327455..328798)
                     /locus_tag="ABZJ_00301"
                     /note="ThiC family; Region: ThiC; pfam01964"
                     /db_xref="CDD:250998"
     gene            complement(329483..330562)
                     /locus_tag="ABZJ_00302"
                     /db_xref="GeneID:12115387"
     CDS             complement(329483..330562)
                     /locus_tag="ABZJ_00302"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524258.1"
                     /db_xref="GI:384141548"
                     /db_xref="GeneID:12115387"
                     /translation="MKKILMMSMCGALLLTGCNKTSQQDQTVSKEQKSTAQKATEQRD
                     SSCLQIMVAMHTINQNSKIEDLNQINEKLKTCVPSLKNEEQLKLIDASTTMYQRFIKQ
                     DYTEKTGRAFEAFGYAVLEQKQDLKKVIQSQKKLFAQLSPRDQYLLQHEGQAYIELLY
                     QGEGMFTYRRQPNYLVDVFSKALPADQKEFLSRMAKDNQDIFYNDGALAVSWKELTER
                     ALFWEKFIQKYPKSYFINDAKLLFNEYRYFIFFGLDNTPVSNEYAPNTWFDPDALQQI
                     RFLSTQSQSSLAKPAQQFLKFIATPVDERNKQFKIDLTDENGQKKSTYQIVHEQLEQL
                     LKFDSPWNTEVYRDCHIDAVCIDTN"
     misc_feature    complement(<330431..330562)
                     /locus_tag="ABZJ_00302"
                     /note="Type IV conjugative transfer system lipoprotein
                     (TraV); Region: TraV; cl19474"
                     /db_xref="CDD:267827"
     gene            330673..331254
                     /locus_tag="ABZJ_00303"
                     /db_xref="GeneID:12115388"
     CDS             330673..331254
                     /locus_tag="ABZJ_00303"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005524259.1"
                     /db_xref="GI:384141549"
                     /db_xref="GeneID:12115388"
                     /translation="MNDRTARQKILDAAATLFYNDGITATGINTVTAKADVAKMSLYN
                     NFSSKGELVDAYIAARHQEWLDLYQKRLEKTKTAKEAILAVFDAYQDHAEFAYEKGFR
                     GCGLLNAAAEFPANSSGRNAVRQHKEQVEAIVAEHLNRLLKDSQRVSYIASQLSFLLE
                     GSMARAGLEGSSRQLQLARQMAEDVLDRECQHD"
     misc_feature    330682..331236
                     /locus_tag="ABZJ_00303"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    330700..330837
                     /locus_tag="ABZJ_00303"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            331247..332152
                     /locus_tag="ABZJ_00304"
                     /db_xref="GeneID:12115389"
     CDS             331247..332152
                     /locus_tag="ABZJ_00304"
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family permease"
                     /protein_id="YP_005524260.1"
                     /db_xref="GI:384141550"
                     /db_xref="GeneID:12115389"
                     /translation="MISLIKNSSYGGTIAILVASFLWGTTGTAAAFAPTLGPLAIGAV
                     AMGGGGLLQALIASRAIREHRQFIGRNISIILLGVVAVGIYPLAFYSSMHYAGITIGT
                     VVSIGSAPLIAAVLERFFDRKVLSKTWFLSFVLGVVGVSLLSMGESHAAQESTNEWNK
                     IFGIFLGLVAGATYSLYSWAAKRLIDRGIAAKAAMGMIMGGGAVILLPTLLITGGGLL
                     QSSTNLLVAGYMMLIPMFLGYLLFGFGLKTVNASQATTLTLFEPLVAAIFAIVLVGES
                     VSWIGWAGMFLIFICILMLSKPENT"
     misc_feature    331307..331681
                     /locus_tag="ABZJ_00304"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    331313..332113
                     /locus_tag="ABZJ_00304"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:233205"
     misc_feature    331763..332134
                     /locus_tag="ABZJ_00304"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            332233..333579
                     /locus_tag="ABZJ_00305"
                     /db_xref="GeneID:12115390"
     CDS             332233..333579
                     /locus_tag="ABZJ_00305"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RND family drug transporter"
                     /protein_id="YP_005524261.1"
                     /db_xref="GI:384141551"
                     /db_xref="GeneID:12115390"
                     /translation="MKIKLMLVAGLWSFTSSSFALDLVETYERAKLNDPTWQANQQQF
                     EADQLNLGLATGALLPTVTLSGNITRNRQTVKRSNFPGVDQEGLSDALVSNTSTTKQA
                     TLSARQPLFRMDAWEGYKQVKTSVALSEITLRLQKQDHVLNVAEAYFNVLRQQALTAA
                     YLQEEKALLEQLNMMSAKLKEGLVARSDVSEANAQYQNARANRIATNVQLLLAQEQLS
                     EYIGPYQDKLAVLRSDFIFQKPYPAQLDEWLGLAQQQNLKIQQARLQKRYAEDQRRVE
                     KAALYPQIDAVASYGYTKQTPETLISTDGKFDQVGVEMNWNLFNGGRTRTSIKKASVE
                     LNKAQAQLDAAIRRANVDVKSAFMQVDTDRAKLEARKAAMDSSALVSQASKASYNEGL
                     KSMVDVLLAQRNAFSAKQDYLNAQYDYLLNVLRLKAAVGQLGEKDLVELNSWLTYQ"
     misc_feature    332287..333570
                     /locus_tag="ABZJ_00305"
                     /note="type I secretion outer membrane protein, TolC
                     family; Region: type_I_sec_TolC; TIGR01844"
                     /db_xref="CDD:233594"
     misc_feature    332299..332898
                     /locus_tag="ABZJ_00305"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    332965..333525
                     /locus_tag="ABZJ_00305"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            333642..334409
                     /locus_tag="ABZJ_00306"
                     /db_xref="GeneID:12115391"
     CDS             333642..334409
                     /locus_tag="ABZJ_00306"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor for high affinity
                     phosphate uptake"
                     /protein_id="YP_005524262.1"
                     /db_xref="GI:384141552"
                     /db_xref="GeneID:12115391"
                     /translation="MLNHFIPAPSCWRLPLSPSNPVLSHHISSQFNEDLQDVNTKFMT
                     MGGLVEQQVANAIHSLLDTDANLAIDVQFKDNAVNQYERDIDEGLTLILARRHPAAID
                     LRMVIAMSKANTDLERIGDEAAKIARIAQNLCEEGGSPRGYMETRHIGNQVRVMIHDA
                     LDAFARLDADQALRVLLADADIDREYQSATRTLMTYMIEDPRHIARVINVMWVLRSLE
                     RIGDHARNIAEQVIYMAKGFDARHTKIEEIEAKVHEK"
     misc_feature    333708..334388
                     /locus_tag="ABZJ_00306"
                     /note="transcriptional regulator PhoU; Provisional;
                     Region: PRK11115"
                     /db_xref="CDD:182974"
     misc_feature    333765..334031
                     /locus_tag="ABZJ_00306"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     misc_feature    334080..334334
                     /locus_tag="ABZJ_00306"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     gene            complement(334722..334991)
                     /locus_tag="ABZJ_00307"
                     /db_xref="GeneID:12115392"
     CDS             complement(334722..334991)
                     /locus_tag="ABZJ_00307"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524263.1"
                     /db_xref="GI:384141553"
                     /db_xref="GeneID:12115392"
                     /translation="MSRQVFCRKYQKEMEGLDFAPFPGAKGQEFFENVSKQAWQEWLQ
                     HQTTLINEKRLNVFEPEAKKFLEEQREKFFNNDESVEKAEGWKPE"
     misc_feature    complement(334725..334991)
                     /locus_tag="ABZJ_00307"
                     /note="oxidative damage protection protein; Provisional;
                     Region: PRK05408"
                     /db_xref="CDD:180059"
     gene            complement(335001..336434)
                     /locus_tag="ABZJ_00309"
                     /db_xref="GeneID:12115393"
     CDS             complement(335001..336434)
                     /locus_tag="ABZJ_00309"
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="YP_005524264.1"
                     /db_xref="GI:384141554"
                     /db_xref="GeneID:12115393"
                     /translation="MTTSSNPPNSAAPNQTSGMWGGRFSEATDAFVAEFTASVQFDQR
                     FYKQDIAGSIAHATMLAKVGVLTEAERDDIIEGLSTIRAEIEAGTFEWRIDLEDVHMN
                     IESRLTQRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDDILGLLERLQKGLLGLAAK
                     NVNTIMPGFTHLQTAQPVTFGHHLLAWFEMLVRDTERLQDCRKRVNRMPLGSAALAGT
                     TYPIDRAYTAELLGFEAVSENSLDAVSDRDFAIEFNAAASLIMMHLSRMSEELILWTS
                     AQFKFVNIPDRFCTGSSIMPQKKNPDVPELIRGKSGRVFGDLISLLTLMKGQPLAYNK
                     DNQEDKEPLFDAIDTVRGSLMAFADMIPALVPNVEIMREAALRGFSTATDLADYLVKK
                     GVAFRDAHEIVGKAVALGVAEEKDLSELTLEQLQQFSDLITADVFDKALTLEASVNAR
                     DHIGGTSPKQVEAAIARAHKRLEQLYA"
     misc_feature    complement(335016..336380)
                     /locus_tag="ABZJ_00309"
                     /note="argininosuccinate lyase; Provisional; Region:
                     PRK00855"
                     /db_xref="CDD:179143"
     misc_feature    complement(335019..336323)
                     /locus_tag="ABZJ_00309"
                     /note="Argininosuccinate lyase (argininosuccinase, ASAL);
                     Region: Argininosuccinate_lyase; cd01359"
                     /db_xref="CDD:176463"
     misc_feature    complement(order(335415..335420,335424..335426,
                     335433..335435,335439..335441,335520..335522,
                     335529..335531,335535..335537,335559..335561,
                     335565..335567,335694..335696,335922..335927,
                     336051..336053,336060..336068,336135..336137,
                     336141..336143,336309..336311,336321..336323))
                     /locus_tag="ABZJ_00309"
                     /note="active sites [active]"
                     /db_xref="CDD:176463"
     misc_feature    complement(order(335043..335045,335067..335081,
                     335085..335087,335226..335228,335235..335237,
                     335244..335249,335262..335264,335274..335276,
                     335289..335291,335370..335372,335379..335381,
                     335412..335414,335421..335423,335430..335441,
                     335463..335471,335475..335477,335484..335492,
                     335496..335513,335517..335522,335529..335531,
                     335535..335543,335547..335558,335574..335576,
                     335598..335600,335607..335612,335625..335630,
                     335637..335642,335646..335651,335658..335660,
                     335670..335672,335679..335681,335691..335693,
                     335697..335702,335709..335723,335763..335765,
                     335772..335774,335778..335792,335823..335825,
                     335835..335837,335844..335849,335856..335858,
                     335874..335879,335889..335891,335907..335930,
                     336075..336080,336087..336089,336096..336098))
                     /locus_tag="ABZJ_00309"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176463"
     gene            336425..337564
                     /locus_tag="ABZJ_00308"
                     /db_xref="GeneID:12115394"
     CDS             336425..337564
                     /locus_tag="ABZJ_00308"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="YP_005524265.1"
                     /db_xref="GI:384141555"
                     /db_xref="GeneID:12115394"
                     /translation="MWSWWLSKIKKSISLAEAQQTKLFSTAYRNQNSSYFFTKIDRWQ
                     HLLELIIASNVLALVLALAEAQSWHALNGSRLLQYIVFINWVILSFFALVEHFQDFFS
                     QLQQKYALVIGFVMLQAIVVVTTIISNFFQFGVLKKTSVIAQDWSIYFTNVPLYLSYG
                     ILLGAFCLRYLYVREQWLHQQYAELNARIQAMQARIHPHFLFNSLNNVVSLITIDPDK
                     AESMLISLSRLFRASFQELKLVSLHEEIELSKQYLMIEQIRLGERLKVEWKVEIEPLQ
                     LKQVTIPLLTLQPLLENSIFHGVEPMMGKATIGVLVEILQNQVSIVITNPYTHDTINS
                     RKGHGIALENVKQRLKAYYGNSVRFQVYKGEALYTTIMSYQYQSK"
     misc_feature    336986..337228
                     /locus_tag="ABZJ_00308"
                     /note="Histidine kinase; Region: His_kinase; pfam06580"
                     /db_xref="CDD:253806"
     misc_feature    337292..337540
                     /locus_tag="ABZJ_00308"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cl00075"
                     /db_xref="CDD:260175"
     gene            337625..338365
                     /locus_tag="ABZJ_00310"
                     /db_xref="GeneID:12115395"
     CDS             337625..338365
                     /locus_tag="ABZJ_00310"
                     /codon_start=1
                     /transl_table=11
                     /product="alginate biosynthesis regulatory protein"
                     /protein_id="YP_005524266.1"
                     /db_xref="GI:384141556"
                     /db_xref="GeneID:12115395"
                     /translation="MKVLICDDEPLAVERLSRLVSKMGHEVVATAHHGQDALEQARLH
                     HPDVILLDIQMPGMNGLVCAEQLSQLNPRPAIVFCTAYDQHALEAFKSQAQAYLLKPI
                     DPQELEQTFKQLTQLTQAQLSALPKPELLQDLKTQRHQIAAKTYRGVELIPVENIYYF
                     LADQKYVTVRHKNGSVLIDETLKELETEFADQFIRIHRNALVSIAYLDGLELVSSGQY
                     QVRLRGLDERLSVSRRHLSTLRERIHQL"
     misc_feature    337625..338362
                     /locus_tag="ABZJ_00310"
                     /note="Response regulator of the LytR/AlgR family
                     [Transcription / Signal transduction mechanisms]; Region:
                     LytT; COG3279"
                     /db_xref="CDD:225818"
     misc_feature    337634..337966
                     /locus_tag="ABZJ_00310"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(337643..337648,337778..337780,337802..337804,
                     337862..337864,337913..337915,337922..337927)
                     /locus_tag="ABZJ_00310"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    337778..337780
                     /locus_tag="ABZJ_00310"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(337787..337792,337796..337804)
                     /locus_tag="ABZJ_00310"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    337922..337930
                     /locus_tag="ABZJ_00310"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    338063..338350
                     /locus_tag="ABZJ_00310"
                     /note="LytTr DNA-binding domain; Region: LytTR;
                     smart00850"
                     /db_xref="CDD:197918"
     gene            338439..339383
                     /locus_tag="ABZJ_00311"
                     /db_xref="GeneID:12115396"
     CDS             338439..339383
                     /locus_tag="ABZJ_00311"
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase (PBG)
                     (hydroxymethylbilane synthase) (HMBS)
                     (Pre-uroporphyrinogen synthase)"
                     /protein_id="YP_005524267.1"
                     /db_xref="GI:384141557"
                     /db_xref="GeneID:12115396"
                     /translation="MFDQPMLEFMKTLKIATRQSPLALWQAEHIRARLQELHPDLTVE
                     LVKFVTQGDKILDTPLAKIGGKGLFVKELEAALLDGRADLAVHSMKDVPMALPEGLTL
                     AVICEREDPLDAFVSNQFEKFADLPQGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVG
                     TRLAKLDDGQYDAIILASAGLKRLGLAERIRHCIEPSVSLPAVGQGALGLECRADDQE
                     VLTLIQPLLHPETDVCVRAERAFNAYLEGGCQVPIAGYATLQDGKIHIEGRVGSVDGQ
                     TLLRAELTDEANNAQQLGENLARNLLDQGAGDLLKALY"
     misc_feature    338466..339347
                     /locus_tag="ABZJ_00311"
                     /note="porphobilinogen deaminase; Reviewed; Region: hemC;
                     PRK00072"
                     /db_xref="CDD:234612"
     misc_feature    338475..339347
                     /locus_tag="ABZJ_00311"
                     /note="Hydroxymethylbilane synthase (HMBS), also known as
                     porphobilinogen deaminase (PBGD), is an intermediate
                     enzyme in the biosynthetic pathway of tetrapyrrolic ring
                     systems, such as heme, chlorophylls, and vitamin B12.
                     HMBS catalyzes the conversion of...; Region: HMBS;
                     cd00494"
                     /db_xref="CDD:238276"
     misc_feature    order(338496..338498,338511..338513,338703..338720,
                     338724..338726,338751..338756,338760..338777,
                     338850..338852,338856..338861,338871..338873,
                     338910..338912,338973..338975,338982..338987,
                     339033..339056,339108..339110,339129..339131,
                     339138..339140,339150..339155,339162..339164,
                     339183..339185,339195..339197,339201..339203,
                     339237..339239,339252..339254,339261..339263,
                     339270..339272,339276..339278)
                     /locus_tag="ABZJ_00311"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238276"
     misc_feature    order(338502..338504,338514..338516,338700..338702,
                     338706..338711,338838..338846,338850..338855,
                     338901..338903,338922..338924,338961..338969,
                     338976..338978,338985..338987,339042..339044,
                     339051..339056,339183..339185)
                     /locus_tag="ABZJ_00311"
                     /note="active site"
                     /db_xref="CDD:238276"
     gene            339388..340155
                     /locus_tag="ABZJ_00312"
                     /db_xref="GeneID:12115397"
     CDS             339388..340155
                     /locus_tag="ABZJ_00312"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="YP_005524268.1"
                     /db_xref="GI:384141558"
                     /db_xref="GeneID:12115397"
                     /translation="MLFINTRPDSRAAELTHALQNKGFQVESLPLLELVAQPFSESLS
                     QLYQQLTGAQAIVVVSPTAVDVGMQYLTQSGLKIDELKHIQWIAVGQATANRLHDYGI
                     EAHVPEVETSEGMLNLPLLHHMQKSGSVAFWRGEGGRQFMMETLQQQGIQILNFVLYR
                     RQCPQASYSTFKHLTQNSNYNLDKWLVLITSEASWKYWLELCLKNKAQPDCVYLVLGP
                     RLFQLVKDYRDQQQAHFHIIQLENLSPSGMIHHIQAL"
     misc_feature    339397..340143
                     /locus_tag="ABZJ_00312"
                     /note="Uroporphyrinogen-III synthase (HemD) catalyzes the
                     asymmetrical cyclization of tetrapyrrole (linear) to
                     uroporphyrinogen-III, the fourth step in the biosynthesis
                     of heme. This ubiquitous enzyme is present in eukaryotes,
                     bacteria and archaea. Mutations in...; Region: HemD;
                     cd06578"
                     /db_xref="CDD:119440"
     misc_feature    order(339406..339408,339565..339573,339661..339663,
                     339790..339792,339862..339864,339868..339870,
                     339955..339969)
                     /locus_tag="ABZJ_00312"
                     /note="active site"
                     /db_xref="CDD:119440"
     gene            340164..341003
                     /locus_tag="ABZJ_00313"
                     /db_xref="GeneID:12115398"
     CDS             340164..341003
                     /locus_tag="ABZJ_00313"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524269.1"
                     /db_xref="GI:384141559"
                     /db_xref="GeneID:12115398"
                     /translation="MRKLVSIIILLGIAWVAKLSYDMWQISRTVPELQQSLLQSEQQY
                     ANLNDQLVALQRQIQNQPSHNSKTTPLATTEVVQTGIAPTVLIKQKLELIQFAIDQQQ
                     FIYAVDHLTQLQQTLPQYGIAPALQHSLNQALEQDKQAIQQFVLAQNQRHQLIDDLLQ
                     NIDKNIQQALQQPKFEMDQSEAVSWWKKWFRIEKVETPSINLMNRSVVLKEVQLRLLI
                     AEQALNQGKMAEYQNELQTVMQKLNELPDATSQQLKNRIAKVAHLSVVPVPKLSTLGL
                     IGS"
     gene            341013..342206
                     /locus_tag="ABZJ_00314"
                     /db_xref="GeneID:12115399"
     CDS             341013..342206
                     /locus_tag="ABZJ_00314"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524270.1"
                     /db_xref="GI:384141560"
                     /db_xref="GeneID:12115399"
                     /translation="MKHLLWVYFLISLVLFAALALLSYGYGMGYVYIYWRQLQLQTNV
                     WGLVFTFVVMSFIAQVIWLWIKRYSSREQRKRENIFQFKNLHPYEQLGIVWLLEAAED
                     QRVFIERVFTQSGLLKNIIDAKFLVLSGDYQKALEALDQSPPMAFELAELQRIEIFLA
                     QNEAERALTHLEFLYQHQLSPWLEEIETAYQQRLTALWGQLALQQPWVYLRSMKYGLL
                     DAEHRDLWLQQLLQQFDQASIDDLQALQQRYLDLESEIQTRPYSSKLLWLKLLARMPE
                     MSIQHEVLTLHLLKEQFDPDVFYLWFQQQLLKQVPDYADVEEKINQFESQYMNLPVLT
                     FAKWHVYMATGRQAEAEILLSLYPDNILMSYLRIKSTLKEDDELIKQLNLIFENDANF
                     LKFKI"
     misc_feature    341097..>341618
                     /locus_tag="ABZJ_00314"
                     /note="heme biosynthesis-associated TPR protein; Region:
                     TPR_hemY_coli; TIGR00540"
                     /db_xref="CDD:233013"
     gene            342214..342654
                     /locus_tag="ABZJ_00315"
                     /db_xref="GeneID:12115400"
     CDS             342214..342654
                     /locus_tag="ABZJ_00315"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524271.1"
                     /db_xref="GI:384141561"
                     /db_xref="GeneID:12115400"
                     /translation="MKELSVYPVIYDQKVAWGDMDAFGHVNNVQYYRYIESSRILYME
                     NVNILTPNIYTVVASSQCKYLKSVFYPDVLKVGVRVEELRKSAFRMAYILWSESQQQI
                     VATGEAVMVCVNKMTGLKCEIPSEVKSKIIELEKSVGHDLIHLA"
     misc_feature    342241..342555
                     /locus_tag="ABZJ_00315"
                     /note="4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes
                     the final step in the 4-chlorobenzoate degradation pathway
                     in which 4-chlorobenzoate is converted to
                     4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT
                     forms a homotetramer with four active sites; Region: 4HBT;
                     cd00586"
                     /db_xref="CDD:238329"
     misc_feature    order(342319..342321,342376..342378,342382..342384,
                     342463..342474)
                     /locus_tag="ABZJ_00315"
                     /note="active site"
                     /db_xref="CDD:238329"
     gene            342849..343175
                     /locus_tag="ABZJ_00316"
                     /db_xref="GeneID:12115401"
     CDS             342849..343175
                     /locus_tag="ABZJ_00316"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA binding protein"
                     /protein_id="YP_005524272.1"
                     /db_xref="GI:384141562"
                     /db_xref="GeneID:12115401"
                     /translation="MKPDISELSVEELKRLQEEAEALIASKKDQAIEDAYNQIIEIAE
                     NVGFSVEQLLEFGAQKRKKTTRKSVEPRYRNKNNAEETWTGRGKQPRWLVAEIEKGAK
                     LEDFLI"
     misc_feature    342879..343157
                     /locus_tag="ABZJ_00316"
                     /note="H-NS histone family; Region: Histone_HNS;
                     pfam00816"
                     /db_xref="CDD:250154"
     misc_feature    343035..343172
                     /locus_tag="ABZJ_00316"
                     /note="Domain in histone-like proteins of HNS family;
                     Region: HNS; smart00528"
                     /db_xref="CDD:128801"
     gene            343507..344250
                     /locus_tag="ABZJ_00317"
                     /db_xref="GeneID:12115402"
     CDS             343507..344250
                     /locus_tag="ABZJ_00317"
                     /codon_start=1
                     /transl_table=11
                     /product="putative general secretion pathway protein"
                     /protein_id="YP_005524273.1"
                     /db_xref="GI:384141563"
                     /db_xref="GeneID:12115402"
                     /translation="MKKKSKQWKWWFFALIAFLIFIILQIPATWLISKFSKNNQTVHN
                     VSGNIWQGQADWHRGALRGTIHWKTRPLDLLLLRFAADVDIHSGNTQLTGIMAYGFGK
                     KVIVRDMNGQIAPETLKQIVNWQWPVNSIQLKDIQFNYKKEQGFAAVDGQLHWGGGAL
                     IYNIGDRQDRMNMPSLSGQLTDQNGQLQVDIRDQRNQKMANLLLDANMMLDVQLTQRL
                     LLNVPSYDGKAGLDTFVISSRQPLLQGGN"
     misc_feature    343639..344151
                     /locus_tag="ABZJ_00317"
                     /note="Type II secretion system (T2SS), protein N; Region:
                     T2SN; pfam01203"
                     /db_xref="CDD:250440"
     gene            344250..345086
                     /locus_tag="ABZJ_00318"
                     /db_xref="GeneID:12115403"
     CDS             344250..345086
                     /locus_tag="ABZJ_00318"
                     /codon_start=1
                     /transl_table=11
                     /product="putative general secretion pathway protein"
                     /protein_id="YP_005524274.1"
                     /db_xref="GI:384141564"
                     /db_xref="GeneID:12115403"
                     /translation="MKVWIDKLQQLQWQKLDRLSVVVLAILILWLCWKLASFFWLVIA
                     PPQLMQFDRVELGSQQPQIPNISTFSLFNEPSANAAQESVNLELQGVMVGYPNRFSSA
                     VIKIDNTAERYRVGETIGSTSYQLAEVYWDRVVLSQGNGSTRELQFKGLPNGLYQPMT
                     PDASQQSATPSQSTEPMNTAQQALGQAIQQMQGNREQYLRDMGVSGNSGEGYEVTERT
                     PTALRNKLGLRPGDRIVSLNGQTVGQGQTDVQLLEQARRAGQVKIEIKRGDQVMTIQQ
                     NF"
     misc_feature    344259..345050
                     /locus_tag="ABZJ_00318"
                     /note="Type II secretory pathway, component PulC
                     [Intracellular trafficking and secretion]; Region: PulC;
                     COG3031"
                     /db_xref="CDD:225575"
     misc_feature    344469..344687
                     /locus_tag="ABZJ_00318"
                     /note="Type IV pilus biogenesis; Region: Pilus_PilP;
                     pfam11356"
                     /db_xref="CDD:256430"
     misc_feature    <344886..345074
                     /locus_tag="ABZJ_00318"
                     /note="PDZ domain, also called DHR (Dlg homologous region)
                     or GLGF (after a conserved sequence motif). Many PDZ
                     domains bind C-terminal polypeptides, though binding to
                     internal (non-C-terminal) polypeptides and even to lipids
                     has been demonstrated; Region: PDZ; cl00117"
                     /db_xref="CDD:271422"
     gene            345128..347404
                     /locus_tag="ABZJ_00319"
                     /db_xref="GeneID:12115404"
     CDS             345128..347404
                     /locus_tag="ABZJ_00319"
                     /codon_start=1
                     /transl_table=11
                     /product="putative general secretion pathway protein"
                     /protein_id="YP_005524275.1"
                     /db_xref="GI:384141565"
                     /db_xref="GeneID:12115404"
                     /translation="MALLNHQRPLWALLAAAPLIATVSSSAYAQTWKINLRDADLTAF
                     INEVADITGKNFAVDPRVRGNVTVISNKPLNKDEVYDLFLGVLNVNGVVAIPSGNTIK
                     LVPDSNVKNSGIPYDSRNRVRGDQIVTRVIWLENTNPNDLIPALRPLMPQFAHMAAIA
                     GTNALIVSDRAANIYQLENIIRNLDGTGQNDIEAITLQSSQAEEIITQLEAMSATGAS
                     KDFSGARIRIIADNRTNRILIKGDPQTRKRIRHMIEMLDVPSADRLGGLKVFRLKYAS
                     AKNLSEILQGLVTGQAVSSSNNSNNSSNSSNPINSLIGNNQNSGSNTSGSNGASISTP
                     AINLNGNSNSSNQNNITSFNQNGVSIIADNAQNSLVVKADPQLMREIESAIQQLDVRR
                     QQVLIEAAIIEVSGDDADQLGIQWALGDLSSGIGLLSFSNVGASLSSIAAGYLSGGSA
                     GAASAIANGANKGNGATLGLGNFDNSRKAYGALIQALKTNTKSNLLSTPSIVTMDNEE
                     AYIVVGQNVPFVTGSVTTNSTGINPYTTVERKDVGVTLKVVPHIGEGGTVRLEVEQEV
                     SAVQDSRGQAADLVTSKRAIKTAVLAEHGQTVVLGGLVSDDTSLSRQGIPGLSSIPYV
                     GRLFRSDNRSNVKRNLLVFIHPTIVGDANDVRRLSQQRYNQLYSLQLAMDKNGNFAKL
                     PEQVDDIYNQKMTPPSIASKPKNYQQVPSGGKSSTITTPVAVEPTVQKQTLQLPDPEI
                     NRTKNTVTTTTLRPSTAP"
     misc_feature    345227..347104
                     /locus_tag="ABZJ_00319"
                     /note="type II secretion system protein D; Region:
                     type_II_gspD; TIGR02517"
                     /db_xref="CDD:233907"
     misc_feature    345512..345682
                     /locus_tag="ABZJ_00319"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    345701..345907
                     /locus_tag="ABZJ_00319"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    <346187..346303
                     /locus_tag="ABZJ_00319"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    346583..347077
                     /locus_tag="ABZJ_00319"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; pfam00263"
                     /db_xref="CDD:249725"
     gene            347445..348074
                     /locus_tag="ABZJ_00320"
                     /db_xref="GeneID:12115405"
     CDS             347445..348074
                     /locus_tag="ABZJ_00320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524276.1"
                     /db_xref="GI:384141566"
                     /db_xref="GeneID:12115405"
                     /translation="MTWKLQAITGEFTGQEINVDRDMLVGRHQDADLLLQAAEISRRH
                     AALLLKDQALWVQDLNSSNGTFVNDIRIEQEKQLHDGDIVQFASLKFSVFAPAQENTD
                     LPEIEVEPVQTAPTQDLSDQGMPSIAERAAETEVSRDGMPQRVSVPKPAPIPEGVDIH
                     AQPEQTPVAIEEPVSRVTEEKEQQKNASIGLVTIIILVILAVLAWLFFK"
     misc_feature    347451..347726
                     /locus_tag="ABZJ_00320"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    <347517..347801
                     /locus_tag="ABZJ_00320"
                     /note="FOG: FHA domain [Signal transduction mechanisms];
                     Region: COG1716"
                     /db_xref="CDD:224630"
     misc_feature    order(347523..347525,347559..347561,347565..347570,
                     347628..347636)
                     /locus_tag="ABZJ_00320"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     gene            348140..348808
                     /locus_tag="ABZJ_00321"
                     /db_xref="GeneID:12115406"
     CDS             348140..348808
                     /locus_tag="ABZJ_00321"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="YP_005524277.1"
                     /db_xref="GI:384141567"
                     /db_xref="GeneID:12115406"
                     /translation="MSVAQLSKRDLILFDLDGTLVDSAADLYRSMNLSLQSLSWPLVT
                     EAQIREWVGKGASKLCESVLLHVFGKLDVEQHKVLLQKFVEVYGAELCVNTQIYPGVP
                     EFLKHCQTLNIKMACVTNKPVKLAQGLLDELELSSYFQVVLGGDSLPERKPHPLPLLH
                     CMESLKISASQSLMIGDSSNDIEAARRAGIDCIVVSYGYNHGENIYDCQPQQVVDSLA
                     ELIV"
     misc_feature    348170..348799
                     /locus_tag="ABZJ_00321"
                     /note="phosphoglycolate phosphatase; Provisional; Region:
                     PRK13222"
                     /db_xref="CDD:237310"
     misc_feature    348170..348724
                     /locus_tag="ABZJ_00321"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(348182..348190,348494..348499)
                     /locus_tag="ABZJ_00321"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    348182..348199
                     /locus_tag="ABZJ_00321"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    348494..348496
                     /locus_tag="ABZJ_00321"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            348917..350410
                     /locus_tag="ABZJ_00322"
                     /db_xref="GeneID:12115407"
     CDS             348917..350410
                     /locus_tag="ABZJ_00322"
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate/para-aminobenzoate synthase
                     component I"
                     /protein_id="YP_005524278.1"
                     /db_xref="GI:384141568"
                     /db_xref="GeneID:12115407"
                     /translation="MTTLAQFEQLKAAGYNTIPVYRQRLADTETPLSVFARFKDQTQA
                     YLFESVEGGENWARYSMIGLGESTVFSCNAGVLSIQHADGSVTQQNCLDPFQYIREFQ
                     KQFKVPAAKLLPDLPSFTGGLVGYLGYDAVRYIEPRLKNVPAADPITLPDLWLMLSKT
                     VIVFDNLKDTLFLIVHADTEQSNAYEDAQQKLDQLEQLLATPVSLQARPHTPPHFESI
                     TGKAKFLETVEKVKEYIRAGDVMQVVPGQRMVSDFDGEALQVYRALRHLNPSPYLFLV
                     QGQTITDKKPFHIVGSSPEILSRLENGIATVRPLAGTRPRGKTKEEDIALEKDLLSDE
                     KEIAEHLMLIDLGRNDVGRVSKIGKVQVTDQMVIERYSHVMHIVSNVQGEVRDDIDAL
                     DVFKATFPAGTLSGAPKIRAMEIIDEVEPVKRGVFGGAVGYLGWHGEMDMSIAIRTCV
                     IRDKKVYVQAGAGLVADSNPESEWNETQIKARAVIKAVELSSNGLIL"
     misc_feature    348923..350401
                     /locus_tag="ABZJ_00322"
                     /note="anthranilate synthase component I; Provisional;
                     Region: PRK13565"
                     /db_xref="CDD:184146"
     misc_feature    348995..349435
                     /locus_tag="ABZJ_00322"
                     /note="Anthranilate synthase component I, N terminal
                     region; Region: Anth_synt_I_N; pfam04715"
                     /db_xref="CDD:252755"
     misc_feature    349574..350356
                     /locus_tag="ABZJ_00322"
                     /note="chorismate binding enzyme; Region: Chorismate_bind;
                     pfam00425"
                     /db_xref="CDD:249850"
     gene            350510..350585
                     /locus_tag="ABZJ_tRNA7"
                     /db_xref="GeneID:12115408"
     tRNA            350510..350585
                     /locus_tag="ABZJ_tRNA7"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:12115408"
     gene            350642..350725
                     /locus_tag="ABZJ_tRNA8"
                     /db_xref="GeneID:12115409"
     tRNA            350642..350725
                     /locus_tag="ABZJ_tRNA8"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:12115409"
     gene            350763..350838
                     /locus_tag="ABZJ_tRNA9"
                     /db_xref="GeneID:12115410"
     tRNA            350763..350838
                     /locus_tag="ABZJ_tRNA9"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:12115410"
     gene            350852..350926
                     /locus_tag="ABZJ_tRNA10"
                     /db_xref="GeneID:12115411"
     tRNA            350852..350926
                     /locus_tag="ABZJ_tRNA10"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:12115411"
     gene            351090..352280
                     /locus_tag="ABZJ_00323"
                     /db_xref="GeneID:12115412"
     CDS             351090..352280
                     /locus_tag="ABZJ_00323"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="YP_005524279.1"
                     /db_xref="GI:384141569"
                     /db_xref="GeneID:12115412"
                     /translation="MAKAKFERNKPHVNVGTIGHVDHGKTTLTAAIATICAKTYGGEA
                     KDYSQIDSAPEEKARGITINTSHVEYDSPTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCAATDGPMPQTREHILLSRQVGVPYIIVFLNKCDLVDDEELLELVEMEVRELLST
                     YDFPGDDTPVIRGSALAALNGEAGPYGEESVLALVAALDSYIPEPERAIDKAFLMPIE
                     DVFSISGRGTVVTGRVEAGIIKVGEEVEIVGIKDTVKTTVTGVEMFRKLLDEGRAGEN
                     CGILLRGTKREEVQRGQVLAKPGTIKPHTKFDAEVYVLSKEEGGRHTPFLNGYRPQFY
                     FRTTDVTGAIQLKEGVEMVMPGDNVEMSVELIHPIAMDPGLRFAIREGGRTVGAGVVA
                     KVTA"
     misc_feature    351090..352277
                     /locus_tag="ABZJ_00323"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     misc_feature    351120..351704
                     /locus_tag="ABZJ_00323"
                     /note="Elongation Factor Tu (EF-Tu) GTP-binding proteins;
                     Region: EF_Tu; cd01884"
                     /db_xref="CDD:206671"
     misc_feature    351144..351167
                     /locus_tag="ABZJ_00323"
                     /note="G1 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    order(351147..351149,351153..351155,351165..351170,
                     351177..351179,351186..351191,351201..351203,
                     351285..351290,351342..351347,351414..351419,
                     351423..351434,351441..351443,351534..351536,
                     351546..351548,351624..351629)
                     /locus_tag="ABZJ_00323"
                     /note="GEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    order(351153..351170,351228..351230,351495..351500,
                     351504..351506,351609..351617)
                     /locus_tag="ABZJ_00323"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    351255..351287
                     /locus_tag="ABZJ_00323"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206671"
     misc_feature    351273..351275
                     /locus_tag="ABZJ_00323"
                     /note="G2 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    351330..351341
                     /locus_tag="ABZJ_00323"
                     /note="G3 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    351336..351392
                     /locus_tag="ABZJ_00323"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206671"
     misc_feature    351495..351506
                     /locus_tag="ABZJ_00323"
                     /note="G4 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    351609..351617
                     /locus_tag="ABZJ_00323"
                     /note="G5 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    351726..351986
                     /locus_tag="ABZJ_00323"
                     /note="EFTU_II: Elongation factor Tu domain II. Elongation
                     factors Tu (EF-Tu) are three-domain GTPases with an
                     essential function in the elongation phase of mRNA
                     translation. The GTPase center of EF-Tu is in the
                     N-terminal domain (domain I), also known as the...;
                     Region: EFTU_II; cd03697"
                     /db_xref="CDD:239668"
     misc_feature    351993..352262
                     /locus_tag="ABZJ_00323"
                     /note="Domain III of elongation factor (EF) Tu. Ef-Tu
                     consists of three structural domains, designated I, II and
                     III. Domain III adopts a beta barrel structure. Domain III
                     is involved in binding to both charged tRNA and binding to
                     elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707"
                     /db_xref="CDD:239678"
     misc_feature    order(352029..352031,352035..352043,352095..352097,
                     352215..352223,352251..352253)
                     /locus_tag="ABZJ_00323"
                     /note="Antibiotic Binding Site [chemical binding]; other
                     site"
                     /db_xref="CDD:239678"
     gene            352341..352416
                     /locus_tag="ABZJ_tRNA11"
                     /db_xref="GeneID:12115413"
     tRNA            352341..352416
                     /locus_tag="ABZJ_tRNA11"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:12115413"
     gene            352492..352932
                     /locus_tag="ABZJ_00324"
                     /db_xref="GeneID:12115414"
     CDS             352492..352932
                     /locus_tag="ABZJ_00324"
                     /codon_start=1
                     /transl_table=11
                     /product="IISP family preprotein translocase membrane
                     subunit"
                     /protein_id="YP_005524280.1"
                     /db_xref="GI:384141570"
                     /db_xref="GeneID:12115414"
                     /translation="MSNDKSRDALSDAPIPQRNNSAEVVRSGSPLDIVLWVIAIALLL
                     SATMVNQHLPAYWAPANDVWVRVGVIFACIVVALGLLYATHQGKGFVRLLKDARVELR
                     RVTWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG"
     misc_feature    352657..352929
                     /locus_tag="ABZJ_00324"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK05740"
                     /db_xref="CDD:235587"
     gene            352940..353473
                     /locus_tag="ABZJ_00325"
                     /db_xref="GeneID:12115415"
     CDS             352940..353473
                     /locus_tag="ABZJ_00325"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein"
                     /protein_id="YP_005524281.1"
                     /db_xref="GI:384141571"
                     /db_xref="GeneID:12115415"
                     /translation="MKRWYIIHAYSGYEKQVMRSLKERIQRSAVADSFGDVLVPTEEV
                     VEMKDGKKRKSERKFFPGYVLVEMEMNDDTWHIVKECPKVLGFIGGTPEKPAPITQRE
                     ADAILARVRNTGEAPRPKTMFEPGEELLVIDGPFTDFKGVVEEVQYDKSRLTLTINVF
                     NRPTQVELEFRQVEKTI"
     misc_feature    352940..353464
                     /locus_tag="ABZJ_00325"
                     /note="transcription antitermination protein NusG;
                     Validated; Region: nusG; PRK05609"
                     /db_xref="CDD:180161"
     misc_feature    352946..353269
                     /locus_tag="ABZJ_00325"
                     /note="Bacterial N-Utilization Substance G (NusG)
                     N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1;
                     cd09891"
                     /db_xref="CDD:193580"
     misc_feature    order(352955..352957,353057..353059,353117..353119,
                     353126..353128,353132..353134,353231..353233,
                     353255..353257)
                     /locus_tag="ABZJ_00325"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193580"
     misc_feature    353297..353464
                     /locus_tag="ABZJ_00325"
                     /note="NusG contains an NGN domain at its N-terminus and
                     KOW motif at its C-terminus; Region: KOW_NusG; cd06091"
                     /db_xref="CDD:240515"
     misc_feature    order(353333..353347,353354..353356,353390..353392,
                     353417..353425,353429..353440,353450..353455)
                     /locus_tag="ABZJ_00325"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     misc_feature    353333..353344
                     /locus_tag="ABZJ_00325"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     gene            353582..354010
                     /locus_tag="ABZJ_00326"
                     /db_xref="GeneID:12115416"
     CDS             353582..354010
                     /locus_tag="ABZJ_00326"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_005524282.1"
                     /db_xref="GI:384141572"
                     /db_xref="GeneID:12115416"
                     /translation="MAKKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNA
                     ATQKVEPGLPIPVVITVYNDKSFTFIMKTPPASILLKKAAGIQKGSSVPNKTKVGKLT
                     RAQLEEIATTKEPDLTGADLDARVRTIAGSARSMGLEVEL"
     misc_feature    353582..354004
                     /locus_tag="ABZJ_00326"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     misc_feature    353606..354001
                     /locus_tag="ABZJ_00326"
                     /note="Ribosomal protein L11. Ribosomal protein L11,
                     together with proteins L10 and L7/L12, and 23S rRNA, form
                     the L7/L12 stalk on the surface of the large subunit of
                     the ribosome. The homologous eukaryotic cytoplasmic
                     protein is also called 60S ribosomal...; Region:
                     Ribosomal_L11; cd00349"
                     /db_xref="CDD:100101"
     misc_feature    order(353609..353611,353669..353671,353804..353812,
                     353822..353824,353843..353845,353918..353920,
                     353933..353941,353951..353953,353960..353965,
                     353972..353977,353981..353989)
                     /locus_tag="ABZJ_00326"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100101"
     misc_feature    order(353609..353611,353753..353755,353759..353770,
                     353780..353782,353786..353791,353921..353926,
                     353933..353938)
                     /locus_tag="ABZJ_00326"
                     /note="L7/L12 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(353657..353659,353669..353671)
                     /locus_tag="ABZJ_00326"
                     /note="putative thiostrepton binding site; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(353861..353863,353870..353872)
                     /locus_tag="ABZJ_00326"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     gene            354014..354709
                     /locus_tag="ABZJ_00327"
                     /db_xref="GeneID:12115417"
     CDS             354014..354709
                     /locus_tag="ABZJ_00327"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_005524283.1"
                     /db_xref="GI:384141573"
                     /db_xref="GeneID:12115417"
                     /translation="MAKLTKRQKAIAAAVEANKVYTLEEAVQVLNSLPAAKFKESLDI
                     SVNLGVDPRKSDQVVRGATTLPAGTGKTVRVAVFAQGAQAEAAKEAGADVVGFDDLAE
                     SIQGGNLDFDVVIAAPDAMRVVGKLGTILGPRGLMPNPKVGTVTPDVAGAVKNAKSGQ
                     ARYRVDKAGIIHAAIGQVGFDAAAIRQNVETLVADLKKLKPATSKGVYIKKITLSSTM
                     GPGLTVDVNNVSN"
     misc_feature    354080..354685
                     /locus_tag="ABZJ_00327"
                     /note="Ribosomal protein L1.  The L1 protein, located near
                     the E-site of the ribosome, forms part of the L1 stalk
                     along with 23S rRNA.  In bacteria and archaea, L1
                     functions both as a ribosomal protein that binds rRNA, and
                     as a translation repressor that binds...; Region:
                     Ribosomal_L1; cd00403"
                     /db_xref="CDD:238235"
     misc_feature    order(354119..354127,354134..354136,354140..354142,
                     354146..354148,354152..354154,354515..354517,
                     354521..354523,354527..354529,354665..354670,
                     354674..354676)
                     /locus_tag="ABZJ_00327"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            355029..355535
                     /locus_tag="ABZJ_00328"
                     /db_xref="GeneID:12115418"
     CDS             355029..355535
                     /locus_tag="ABZJ_00328"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_005524284.1"
                     /db_xref="GI:384141574"
                     /db_xref="GeneID:12115418"
                     /translation="MALLIEDKKQIVAEVSEVASKAFAAVVADYQGLSVEQLTTLRVE
                     ARKLGVTTRIVRNTLAKRAFQGTQFDILNDNLVGPTILGFSTSEDDMGAAARLFEEFA
                     KTNKAFELKAAAFDGKVYQGADVSVIANLPNQEKALTMLASVLQAPISKLGRLITALK
                     EKNESEAA"
     misc_feature    355038..355514
                     /locus_tag="ABZJ_00328"
                     /note="Ribosomal protein L10 family, L10 subfamily;
                     composed of bacterial 50S ribosomal protein and eukaryotic
                     mitochondrial 39S ribosomal protein, L10. L10 occupies the
                     L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
                     of L10 interacts with L11 protein...; Region:
                     Ribosomal_L10; cd05797"
                     /db_xref="CDD:240223"
     misc_feature    order(355050..355055,355062..355064,355194..355205,
                     355212..355214)
                     /locus_tag="ABZJ_00328"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    order(355302..355304,355371..355373,355380..355382,
                     355428..355430,355437..355442,355449..355454,
                     355458..355475,355479..355487,355494..355499,
                     355503..355508,355512..355514)
                     /locus_tag="ABZJ_00328"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            355578..355949
                     /locus_tag="ABZJ_00329"
                     /db_xref="GeneID:12115419"
     CDS             355578..355949
                     /locus_tag="ABZJ_00329"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_005524285.1"
                     /db_xref="GI:384141575"
                     /db_xref="GeneID:12115419"
                     /translation="MALTNEEILNAVAEKTVLELVELISAFEEKFNVSAAAVAVAAPA
                     GGAAAAAEEQSEFNVELTSFGANKVAVIKAVREATGLGLKEAKDLVEGAPQVLKEGVS
                     KEEGEELKKKLEEAGATVTLK"
     misc_feature    355584..355943
                     /locus_tag="ABZJ_00329"
                     /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
                     refers to the large ribosomal subunit proteins L7 and L12,
                     which are identical except that L7 is acetylated at the N
                     terminus. It is a component of the L7/L12 stalk, which is
                     located at the surface of...; Region: Ribosomal_L7_L12;
                     cd00387"
                     /db_xref="CDD:100102"
     misc_feature    order(355584..355586,355623..355631,355638..355643,
                     355650..355652,355659..355661,355704..355712,
                     355740..355745,355806..355808,355812..355817,
                     355821..355823,355827..355832,355872..355877,
                     355881..355883,355890..355892)
                     /locus_tag="ABZJ_00329"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    order(355593..355595,355602..355604,355614..355616,
                     355653..355655,355668..355670)
                     /locus_tag="ABZJ_00329"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    order(355635..355637,355644..355649,355659..355661,
                     355668..355670)
                     /locus_tag="ABZJ_00329"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(355779..355784,355791..355796,355803..355805,
                     355824..355829,355836..355838)
                     /locus_tag="ABZJ_00329"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(355782..355784,355794..355796,355803..355805,
                     355824..355829,355836..355838)
                     /locus_tag="ABZJ_00329"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(355782..355784,355791..355796,355803..355805)
                     /locus_tag="ABZJ_00329"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            356255..360343
                     /locus_tag="ABZJ_00330"
                     /db_xref="GeneID:12115420"
     CDS             356255..360343
                     /locus_tag="ABZJ_00330"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_005524286.1"
                     /db_xref="GI:384141576"
                     /db_xref="GeneID:12115420"
                     /translation="MAYSYTEKKRIRKNFGKLPQVMDAPYLLSIQVDSYRTFLQDGKS
                     PKNREDIGLQAAFRSVFPIESYSGNAALEFVEYSLGKPEFDVRECILRGSTYAAPMRV
                     KIRLIIKDRETKSIKDVREQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFD
                     HDKGKTHSSGKVLYSARIIPYRGSWLDFEFDAKDLVYVRIDRRRKLLATVVLRALGYN
                     NEQILNLFYEKVPVYLDMGSYQIDLVPERLRGEMAQFDITDNEGKVIVEQGKRINARH
                     VRQMEAAGLTKLSVPDEYLYERITAEDITLRDGEVIAANTLLSHEVMVKLAEGGVKQF
                     NILFTNDIDRGSFVADTLRADLTRDREEALVEIYKVMRPGEPPTKEAAENLFNNLFFS
                     SERYDLSPVGRMKFNRRLGRPYEVGTDQKSREVEGILSHEDIIDVLRTLVEIRNGKGE
                     VDDIDHLGNRRVRSVGEMTENQFRVGLVRVERAVKERLSQAETDNLSPQDLINAKPVA
                     AAIKEFFGSSQLSQFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHQTHYGR
                     VCPIETPEGPNIGLINSLSVYAKANDFGFLETPYRKVVDGRVTDDVEYLSAIEEVGTV
                     IAQADSAVDKDGNLTEEFVSVRHQGEFVRMPPEKVTHMDVSAQQVVSVAASLIPFLEH
                     DDANRALMGSNMQRQAVPTLRADKPLVGTGMEANVARDSGVCVIANRGGVIEYVDASR
                     IVIRVNEDEMVAGEAGVDIYNLIKYTRSNQNTCINQNVIVNLGDKVARGDILADGPST
                     DMGELALGQNMRVAFMTWNGYNYEDSILLSERVLQEDRLTSIHIQELSCVARDTKLGA
                     EEITADIPNVGEAALSKLDESGIVYIGAEVTAGDILVGKVTPKGETQLTPEEKLLRAI
                     FGEKAADVKDSSLRVPSGTKGTVIDVQVFTRDGLEKDDRALAIEKAQLDSYRKDLKEE
                     YKIFEEAARERVIRLLKGQESNGGGSTKRGDKLSEDLLSGLELVDLLEIQPADEAIAE
                     RLTQIQVFLKEKSAEIDEKFAEKKRKLATGDELTTGVLKVVKVYLAVKRRIQPGDKMA
                     GRHGNKGVVSNILPVEDMPHDANGVPVDIVLNPLGVPSRMNVGQILETHLGMAAKGLG
                     DKIEKMLKEQRTVLELREFLDKIYNKVGGEQEDLDSLTDEEILALAGNLRAGVPLATP
                     VFDGAEESQIKDLLELADISRTGQTVLFDGRTGEQFDRPVTVGYMYMLKLNHLVDDKM
                     HARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVEGR
                     TRIYKNIVDGNHYMDPGMPESFNVLTKEIRSLGINIELKNGD"
     misc_feature    356255..360340
                     /locus_tag="ABZJ_00330"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     misc_feature    356333..360331
                     /locus_tag="ABZJ_00330"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    order(356528..356530,358766..358768,358877..358879,
                     358883..358885,358895..358903,358907..358909)
                     /locus_tag="ABZJ_00330"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    356711..357643
                     /locus_tag="ABZJ_00330"
                     /note="RNA polymerase beta subunit; Region:
                     RNA_pol_Rpb2_1; cl19478"
                     /db_xref="CDD:267831"
     misc_feature    order(357917..357919,357923..357931,357935..357937,
                     357944..357946,357959..357961,358241..358243,
                     358295..358303,358307..358309,358691..358702,
                     358709..358711,358715..358723,359534..359536,
                     359540..359542,359546..359548,359612..359614,
                     359618..359620,359627..359629,359636..359638,
                     359651..359653,359663..359665,359870..359872,
                     359951..359953,359975..359983,359987..359989,
                     360026..360028,360035..360043,360047..360052,
                     360113..360121,360131..360133,360137..360142,
                     360146..360148,360152..360169,360173..360190,
                     360200..360202,360269..360271,360281..360283,
                     360287..360289,360293..360298,360302..360304,
                     360308..360319,360323..360325,360329..360331)
                     /locus_tag="ABZJ_00330"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    358052..358249
                     /locus_tag="ABZJ_00330"
                     /note="RNA polymerase beta subunit external 1 domain;
                     Region: RNA_pol_Rpb2_45; pfam10385"
                     /db_xref="CDD:255954"
     misc_feature    order(358367..358372,358676..358678,358682..358684,
                     358745..358747,358754..358756,359561..359563,
                     359600..359602,359681..359686,359690..359692,
                     359939..359941,359990..359992)
                     /locus_tag="ABZJ_00330"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(358709..358711,358751..358753,359558..359560,
                     359957..359959)
                     /locus_tag="ABZJ_00330"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(358751..358756,358766..358768,359480..359482,
                     359486..359488,359561..359569,359576..359578,
                     359582..359587,359954..359977,359981..359983)
                     /locus_tag="ABZJ_00330"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            360430..364623
                     /locus_tag="ABZJ_00331"
                     /db_xref="GeneID:12115421"
     CDS             360430..364623
                     /locus_tag="ABZJ_00331"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="YP_005524287.1"
                     /db_xref="GI:384141577"
                     /db_xref="GeneID:12115421"
                     /translation="MKDLLDIMRKKTDSDGHAPVEFDRIRIGLASPEMIKSWSHGEVK
                     KPETINYRTFKPERDGLFCAKIFGPVKDYECLCGKYKRMKYKGVICEKCGVEVTTAKV
                     RRERMGHIELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVTDPGMTPFE
                     KYQLLNDEEYFTALEEHGDEFVAKMGAEAVQDLLKDIDLEAEISRLREEIPQTTSETK
                     LKKASKRLKLMEAFKDSNNKPEWMVMNVLPVLPPDLRPLVPLEGGRFATSDLNDLYRR
                     VINRNNRLKRLLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLAD
                     MIKGKQGRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFAKLQA
                     SGQATTIKAAKKMVERETPEVWDVLASVIRQHPVMLNRAPTLHRLGLQAFEPILIEGK
                     AIRLHPLVCAAFNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPS
                     QDVVLGLYYITRDAVNAKGEGMVFADTHEVNRALATGQVAIHARVKVRVHQTVINENG
                     EREQQTIIVDTTPGRCLLWEVVPEGLSFDMINLEMTKKNISKLINSCYRKLGLKDTVI
                     FADQLMYLGFRQATRSGVSVGMEDMLIPPTKHTIIDKAETEVREIEQQFEQGFVTAGE
                     RYNKVVDIWARTNDQVAKAMMDNLSYTLVKNKQGEDEKQKSFNSIYMMSDSGARGSAA
                     QIRQLAGMRGLMAKPDGSIIETPIKANFREGLTVLQYFISTHGARKGLADTALKTANS
                     GYLTRRLVDVAQDLVITEPDCGTSGGLVMTPFIQGGDVIEPLRDRVLGRVTAEDVRRA
                     SDDEVVLPRGTLIDEKIAAQLEEAGVDEVKVRSVIACESTFGVCAKCYGRDLARGHLV
                     NPGESVGVMAAQSIGEPGTQLTMRTFHVGGAASRTSAANSVQVRNKGTVRFHNVKTVQ
                     HAKGHLVSVSRSGEIGIADELGRERERYKLPYGASILLKDGELVEAGGIVATWDPHTH
                     PLVTEVAGKARFSQIADGVTATSKTDDATGMTTVEILPVTARPASGKDLRPAIVLDTT
                     DGGEQFYFLPQNTIVTVRDGETIGVGDVIGRVPQESSRTRDITGGLPRVADLFEARKP
                     KEHAILAEVSGIVSFGKETKGKNRLVITPDDGSEIYEELIPKWRQINVFEGEHVNRGE
                     TISDGPQNPHDILRLKGEVALTNYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKVDI
                     IDGGDTSFIKGEQVDYIRVVQENQAVLAQNKFPAKFERQLMGITKASLSTDSFISAAS
                     FQETTRVLTEAAVTGKEDDLRGLKENVVVGRLIPAGTGLAYHLERRRQEAEAAEHALH
                     NDFSEVDQAFSQALNSEQF"
     misc_feature    360490..364551
                     /locus_tag="ABZJ_00331"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     misc_feature    360490..362883
                     /locus_tag="ABZJ_00331"
                     /note="Largest subunit (beta') of bacterial DNA-dependent
                     RNA polymerase (RNAP), N-terminal domain; Region:
                     RNAP_beta'_N; cd01609"
                     /db_xref="CDD:259845"
     misc_feature    order(360490..360513,360517..360519,360529..360531,
                     360538..360549,360583..360585,360589..360591,
                     360640..360642,360673..360675,360730..360735,
                     360739..360750,360781..360783,360787..360789,
                     361159..361161,361171..361173,361177..361179,
                     361186..361191,361195..361197,361201..361203,
                     361210..361215,361363..361365,361423..361425,
                     361432..361437,361453..361515,361519..361521,
                     361555..361560,361567..361572,361579..361584,
                     361588..361593,361636..361638,361714..361716,
                     361726..361728,361735..361740,361744..361749,
                     361777..361782,361795..361797,361822..361830,
                     361837..361839,361849..361872,361879..361881,
                     361891..361896,361909..361911,361951..361959,
                     361966..361968,361978..361980,361993..361995,
                     362329..362334,362338..362373,362599..362601,
                     362617..362619,362635..362637,362650..362652,
                     362659..362664,362674..362676,362689..362694,
                     362713..362715,362731..362754,362758..362763,
                     362770..362775,362779..362787,362791..362799,
                     362803..362808,362836..362838,362845..362847)
                     /locus_tag="ABZJ_00331"
                     /note="beta and beta' interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259845"
     misc_feature    order(360568..360576,360580..360582,360637..360639,
                     360643..360645,360673..360675,360679..360681,
                     360727..360729,360862..360867,361195..361200,
                     361207..361209,361219..361236,361243..361245,
                     361252..361254,361264..361269,361276..361278,
                     361282..361293,361303..361329,361333..361338,
                     361345..361347,361378..361380,361408..361410,
                     361417..361419,361444..361449,361633..361635,
                     361639..361644)
                     /locus_tag="ABZJ_00331"
                     /note="beta' and sigma factor interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(360652..360654,360658..360660,360697..360699,
                     360706..360708)
                     /locus_tag="ABZJ_00331"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(360805..360807,361375..361377,361444..361446,
                     361459..361461,361480..361482,361498..361500,
                     361717..361725,361822..361824,361828..361830,
                     361834..361836,362812..362817,362824..362829)
                     /locus_tag="ABZJ_00331"
                     /note="active site region [active]"
                     /db_xref="CDD:259845"
     misc_feature    order(361822..361824,361828..361830,361834..361836)
                     /locus_tag="ABZJ_00331"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259845"
     misc_feature    363163..364506
                     /locus_tag="ABZJ_00331"
                     /note="Largest subunit (beta') of Bacterial DNA-dependent
                     RNA polymerase (RNAP), C-terminal domain; Region:
                     RNAP_beta'_C; cd02655"
                     /db_xref="CDD:132721"
     misc_feature    order(363163..363165,363172..363177,363181..363183,
                     364498..364500)
                     /locus_tag="ABZJ_00331"
                     /note="Rpb1 (beta') - Rpb6 (omega) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(363193..363195,363205..363207,364438..364440,
                     364456..364458,364474..364476,364483..364488,
                     364498..364500)
                     /locus_tag="ABZJ_00331"
                     /note="Rpb1 (beta') - Rpb2 (beta) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    363238..363264
                     /locus_tag="ABZJ_00331"
                     /note="G-loop; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(363859..363861,364348..364350,364393..364398)
                     /locus_tag="ABZJ_00331"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132721"
     gene            364791..365156
                     /locus_tag="ABZJ_00332"
                     /db_xref="GeneID:12115422"
     CDS             364791..365156
                     /locus_tag="ABZJ_00332"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524288.1"
                     /db_xref="GI:384141578"
                     /db_xref="GeneID:12115422"
                     /translation="MKKMMMIAGVGLMSTTLFVGCQNASPESKRIGSAAIGGGAGGAV
                     GKHIGGNIGAGLGAALGAGVAANAKGSSSKTVRNSAIGAGVGAILGGAVIGGDAGAAA
                     GGALGGSAGAAYEEKKGKY"
     gene            365358..365726
                     /locus_tag="ABZJ_00333"
                     /db_xref="GeneID:12115423"
     CDS             365358..365726
                     /locus_tag="ABZJ_00333"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524289.1"
                     /db_xref="GI:384141579"
                     /db_xref="GeneID:12115423"
                     /translation="MSTVMNKKIGLISTVILSTVMFTGCQNMSPSDQRIGAAAAGGAL
                     GGGLGNHVGGGIGAGLGAAVGAGVGSNTQGGSKQTTTKSAIGAGIGSVVGKAIIGGDT
                     GAAIGGAIGGGAGAAIEEKK"
     gene            complement(365755..366252)
                     /locus_tag="ABZJ_00334"
                     /db_xref="GeneID:12115424"
     CDS             complement(365755..366252)
                     /locus_tag="ABZJ_00334"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524290.1"
                     /db_xref="GI:384141580"
                     /db_xref="GeneID:12115424"
                     /translation="MAILKKLQNIPSISKFLFNHYPPYRGAGIHIEVMNLELCHVRVK
                     MPLTWKNQNLVGTHFGGSLYSMVDPFYMLILMHHLGSKYIVWDKAAEINFLSPGRSTV
                     YADIRVDLAEIEQIRELAENYAPVLRTYHLNIFDESGVRIAEVQKTLYIRRKKAKPST
                     NKISA"
     misc_feature    complement(365800..366210)
                     /locus_tag="ABZJ_00334"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:271497"
     misc_feature    complement(order(365962..365973,366073..366078))
                     /locus_tag="ABZJ_00334"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    complement(order(365983..365988,365998..366000,
                     366040..366042,366049..366051,366058..366060))
                     /locus_tag="ABZJ_00334"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            366370..367248
                     /locus_tag="ABZJ_00335"
                     /db_xref="GeneID:12115425"
     CDS             366370..367248
                     /locus_tag="ABZJ_00335"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta superfamily
                     hydrolase/acyltransferase"
                     /protein_id="YP_005524291.1"
                     /db_xref="GI:384141581"
                     /db_xref="GeneID:12115425"
                     /translation="MIMQPKIYAVTTSDQQTLCAKAWGDEKNTPLVLVHGYPDNQEVW
                     ESVIEHLINDFYIVTYDVRGAGLSSIPKRIRDYRLERLSLDLQEVVDEVIPNRQFHMA
                     AHDWGSIQSWESATEPKFKGRLLSYTTISGPCLDHAALFLREKFKTSPAQILKILTKS
                     WYIGAFHLPLIAPTVWSLFSPEKWGKILNDLERKDNLPLNSNISSDGKYGINLYRANF
                     IPRLTRPRQRYAQCPVKAIILKYDTFVSPEYITEAMPKWVENFEYVELEANHWAILSQ
                     AEKVAAHIRQFINSQS"
     misc_feature    366460..367218
                     /locus_tag="ABZJ_00335"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    <367096..367245
                     /locus_tag="ABZJ_00335"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            367353..368777
                     /locus_tag="ABZJ_00336"
                     /db_xref="GeneID:12115426"
     CDS             367353..368777
                     /locus_tag="ABZJ_00336"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="YP_005524292.1"
                     /db_xref="GI:384141582"
                     /db_xref="GeneID:12115426"
                     /translation="MNAVVIAIAVMFLLSLARVSVVLTLVVSAIVGGLVAGLSLSQTV
                     EAFNAGLGDGAEVALAYAVLGAFALALSKSGLPDLLAHKLIGLLGMEAGKSRETKVKY
                     LLLGILLIAAIFSQNLIPVHIAFIPVLVPPLLRVMNHLKLDRRAAACVLTLGLVGTYI
                     FLPVGFGAIFLEQILMGNINKIGAAYGLHVERGMMPIGMAIPVLGMVLGTLVAVFISY
                     RKPRIYADRSISPVTTIDLDKPLRATAQDETADLKADAEELKHEAEQGPVIAKKTIFM
                     ALLAIGLTLVAQLYSGSMILGGLVGFAVLSTAGIFKWQDADDVFVQGMRMMALVGFIM
                     ISAAGFASVMTHTGDINQLVKGVVEIIGDNRALAAFLMLCIGLFVTIGIGSSFSSVPV
                     LAVIYVPLCVQFGFSPLATIALIGTAAALGDAGSPASDSTLGPTAGLGVDGQHDHIWD
                     TVIPTFIHFNIPLLIFGWIAAMVL"
     misc_feature    367353..368774
                     /locus_tag="ABZJ_00336"
                     /note="Predicted permease [General function prediction
                     only]; Region: COG2056"
                     /db_xref="CDD:224967"
     misc_feature    367356..367619
                     /locus_tag="ABZJ_00336"
                     /note="Na+-H+ antiporter family; Region: Na_H_antiport_2;
                     pfam13726"
                     /db_xref="CDD:258022"
     misc_feature    367800..368756
                     /locus_tag="ABZJ_00336"
                     /note="Na+/H+ antiporter family; Region: Na_H_antiporter;
                     pfam03553"
                     /db_xref="CDD:252025"
     gene            369065..369685
                     /locus_tag="ABZJ_00337"
                     /db_xref="GeneID:12115427"
     CDS             369065..369685
                     /locus_tag="ABZJ_00337"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein W"
                     /protein_id="YP_005524293.1"
                     /db_xref="GI:384141583"
                     /db_xref="GeneID:12115427"
                     /translation="MFIININKVGDIKVFKKVLVVALMGVSSFTFAGNWQVKFGGSVI
                     APSEDTTTALGVVKADHEYAFTPSVEYFFGQTPFSAELLLATPVNHDVLLDGQKVARI
                     KQLPPTITAKYHFKNSTRFTPYIGIGATAFIPWDEQGVADKVKEDFGVAGQVGFNFQP
                     ADAKNWGVFVDVRYADISPEVTLTNGAKFDLDINPFVYTLGYSYKF"
     misc_feature    369158..369682
                     /locus_tag="ABZJ_00337"
                     /note="OmpW family; Region: OmpW; cl17427"
                     /db_xref="CDD:266675"
     gene            369867..370223
                     /locus_tag="ABZJ_00338"
                     /db_xref="GeneID:12115428"
     CDS             369867..370223
                     /locus_tag="ABZJ_00338"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524294.1"
                     /db_xref="GI:384141584"
                     /db_xref="GeneID:12115428"
                     /translation="MMNRKFAMGLALFSGLAFTHSLQAASFSCNAAKTKTELSICKNR
                     SLNDADVKMATTYQIVLHALPMGGRDNQKDTQQQWLKKRNACAANVSCISKAYQQRQK
                     QLDTILQDRVLSHGPF"
     misc_feature    369951..370178
                     /locus_tag="ABZJ_00338"
                     /note="Protein of unknown function (DUF1311); Region:
                     DUF1311; pfam07007"
                     /db_xref="CDD:254020"
     gene            370326..372245
                     /locus_tag="ABZJ_00339"
                     /db_xref="GeneID:12115429"
     CDS             370326..372245
                     /locus_tag="ABZJ_00339"
                     /codon_start=1
                     /transl_table=11
                     /product="HSP90 family molecular chaperone"
                     /protein_id="YP_005524295.1"
                     /db_xref="GI:384141585"
                     /db_xref="GeneID:12115429"
                     /translation="MSEQASQNYSFQAEVAQLLHLVTHSLYSNPEIFLRELISNASDA
                     CDKLRFEGINHPEYYENDPNLHVRISLNKEDKTLTISDNGIGLSQQEAIDNLGTIAKS
                     GTKDFMSKLTGDQKADAQLIGQFGVGFYSGFIVADKITVESRRAGLDASEGVRWISGG
                     TGEFEVQQIDKASRGTDIILHLRDDALDYLESYKVKQIVNKYSDHISLPIEMQKEVWQ
                     EEEVAEGEEPKGGQMVKTDEWEAINSASALWTRNKSEVTEEQYVEFYKNLTHDFEAPL
                     AWAHNRVEGSTEYTQLLYIPSKAPHDIFTREAKAGIKLYVKRVFIMDDADNLIPNYLR
                     FVQGVVDSADLPLNVSRELLQESRDVKTIREGNARRVLTLLDGLAKSEDEKDQEKFKT
                     FYTEFGSVLKEGLGEDFGNRERILKLLRYATSTNDEVTTSFADYKARMKEGQKAIYYV
                     TAESLAAAKNSPQLELFKKKGIEVLLMAERVDEWAMNFVHEFDGTPLKNVSKGAVDLG
                     DLQDAEEKKALEQAAEQFKPVVEKLSDSLKAKTKEVRVTTRLVDSPACLVTSEGELSP
                     QLIRMLKQAGQAVPEIKPILEINPEHPLVKKLEGSEQFDDLANVIFDQAVIAEGGLPE
                     DPAAYVKRINSLLLK"
     misc_feature    370335..372242
                     /locus_tag="ABZJ_00339"
                     /note="heat shock protein 90; Provisional; Region:
                     PRK05218"
                     /db_xref="CDD:235366"
     misc_feature    370413..370766
                     /locus_tag="ABZJ_00339"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(370431..370433,370443..370445,370452..370454,
                     370563..370565,370569..370571,370575..370577,
                     370581..370586,370701..370712,370746..370748,
                     370752..370754)
                     /locus_tag="ABZJ_00339"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    370443..370445
                     /locus_tag="ABZJ_00339"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(370575..370577,370581..370583,370701..370703,
                     370707..370709)
                     /locus_tag="ABZJ_00339"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    370887..372236
                     /locus_tag="ABZJ_00339"
                     /note="Hsp90 protein; Region: HSP90; pfam00183"
                     /db_xref="CDD:249661"
     gene            complement(372329..373231)
                     /locus_tag="ABZJ_00340"
                     /db_xref="GeneID:12115430"
     CDS             complement(372329..373231)
                     /locus_tag="ABZJ_00340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524296.1"
                     /db_xref="GI:384141586"
                     /db_xref="GeneID:12115430"
                     /translation="MNQFSSFSFEYRSTALLCIYSLGMLVLIPHIQLFPTSLKHSRST
                     RRTLYSSVVTLKTKSQSVSFLHSPCEVEPSHSSDTALIQDLMAVFGNDTLWSRAAQHK
                     HPYKTFGKIKKKASTPHVSENNPLTASWNTISTWMPFENDLDLGSNSESDVYVQFLAK
                     KKWNLRHNISLDTEQIFRYGSTSRNYTETTLNLTQKMQDNTLFSNTFNVNKSGKEDYN
                     WGNWTFQQFEFVKDNRLTYGIYSGGVYANNDIRLNSWGPYISWRQPIWRDWIFMQNDL
                     NFFNYLDDDPKHQLSVQMNLEANF"
     gene            complement(373353..374492)
                     /locus_tag="ABZJ_00341"
                     /db_xref="GeneID:12115431"
     CDS             complement(373353..374492)
                     /locus_tag="ABZJ_00341"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524297.1"
                     /db_xref="GI:384141587"
                     /db_xref="GeneID:12115431"
                     /translation="MKTFHIITYRQLFALLTLGFGSVCMAHAEVNSSSTQQVNGLSSG
                     AQTEENKDENLLDQIPRWIDATPTIFPEQSNEPIVPPTEQTEDQTWFDRKQKKIRNWA
                     DRTSGKIDNWFGEVDPQKPASATIRVMIDNYWNEYDNYEIKPRIRGKIKLPTLEKRLS
                     VVFGDDSLDDEFNNSPANINQNPNQDPNKKLDGKRTRDDNSSIALRWSNFSKKLPFET
                     DADLGIRSGDDIYVRLKASRDWQLRNDFKFYAEQIYRYGIDSENYLRTNLELTHARPN
                     QPILSNQFSLTYADDQDDDLTWENRLFREHSFFANNRFNYGIYTGGYYNDNDLRLNSW
                     GPFVSWRQPVLREWFFVQGDLNYFNDHREDRNHYVSTFLRLEALF"
     gene            complement(374851..375555)
                     /locus_tag="ABZJ_00342"
                     /db_xref="GeneID:12115432"
     CDS             complement(374851..375555)
                     /locus_tag="ABZJ_00342"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524298.1"
                     /db_xref="GI:384141588"
                     /db_xref="GeneID:12115432"
                     /translation="MRVDVWSDVVCPFCYIGKKRLEHVAAEAGIELDIHWHSFELDPD
                     APAKHDTSNTERLAKKYGRTYEEMEEMERNIAAMAASEGIDFQWQKANSGNSFNAHRI
                     IHLAQSKGLGNEAKEAFFHAYMTEGLAIGEREVVEEIASRIGLDNAEVEYVLDTNELA
                     DFVRHDEKIAHEQLNVTGVPFFVFDQRIALAGAQPREVFLQVLEQAQLKANAENIEQD
                     DAAVCNDETCDIPQNK"
     misc_feature    complement(374944..375549)
                     /locus_tag="ABZJ_00342"
                     /note="DsbA family, FrnE subfamily; FrnE is a DsbA-like
                     protein containing a CXXC motif. It is presumed to be a
                     thiol oxidoreductase involved in polyketide biosynthesis,
                     specifically in the production of the aromatic antibiotics
                     frenolicin and nanaomycins; Region: DsbA_FrnE; cd03024"
                     /db_xref="CDD:239322"
     misc_feature    complement(order(375514..375516,375523..375525))
                     /locus_tag="ABZJ_00342"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239322"
     gene            375714..376490
                     /locus_tag="ABZJ_00343"
                     /db_xref="GeneID:12115433"
     CDS             375714..376490
                     /locus_tag="ABZJ_00343"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524299.1"
                     /db_xref="GI:384141589"
                     /db_xref="GeneID:12115433"
                     /translation="MEIGGVYAPSFDCNCKSGCYYEYCFFTYQHIKQQQAKDSSQMFD
                     VVMTEKMNQLYDQAQDWTKPVQLDIHDKRLAGHYKQVSEFLLSYWVQNVNARNEYLRE
                     LKAAKWDTFLNVDRLDHDKKQKYAETEKMLADVRRASDKYQSEYEKIHKTFLAKIQEL
                     SVDKEMRQILEIKLGAQQKADQDHAIFMIELQILDKAEEMFKLLKTYPWQKKDQMILF
                     HENAQVKKFNALYQDVLKLNAKIEKIKKKNVAALEGELKE"
     gene            complement(376511..376918)
                     /locus_tag="ABZJ_00344"
                     /db_xref="GeneID:12115434"
     CDS             complement(376511..376918)
                     /locus_tag="ABZJ_00344"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005524300.1"
                     /db_xref="GI:384141590"
                     /db_xref="GeneID:12115434"
                     /translation="MLNYDTTVKVNPYFMNLAKVSELTKVSPRMLRYYENLGLIQPHR
                     ASNNYRSYTQKDIENIKKIKILNDAGMNLKDIHVLLPCFDLDERVFTLCPVVQEKLQT
                     ELKHVSDQLNKLQTSQSLLQSFLAKGKAESTNI"
     misc_feature    complement(376541..376876)
                     /locus_tag="ABZJ_00344"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     misc_feature    complement(order(376769..376777,376823..376825,
                     376865..376873))
                     /locus_tag="ABZJ_00344"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     misc_feature    complement(376517..376864)
                     /locus_tag="ABZJ_00344"
                     /note="Hg(II)-responsive transcriptional regulator;
                     Region: MerR; TIGR02051"
                     /db_xref="CDD:131106"
     gene            376949..377593
                     /locus_tag="ABZJ_00345"
                     /db_xref="GeneID:12115435"
     CDS             376949..377593
                     /locus_tag="ABZJ_00345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524301.1"
                     /db_xref="GI:384141591"
                     /db_xref="GeneID:12115435"
                     /translation="MIRKLILLVIFGLMSFVTNAKTLELQEKNMRQIFVLHGYSASIN
                     DHWFLDLKHQIEDENTTVTLIPFPDSEHPDVDAWQKVLDEQIPAVNENTYFVAHSLGV
                     ITLLHFLQRHDYQNIGGMILVSGFSGPISDSSPLSPYITKSKVDTNYFRDIKKKLVYL
                     SDNDDLVPPQLTIQLAKDIDAPYITVPNGGHFLGREGYTEFPQLVDSLKEMLEN"
     misc_feature    377036..377584
                     /locus_tag="ABZJ_00345"
                     /note="Predicted esterase of the alpha/beta hydrolase fold
                     [General function prediction only]; Region: COG3545"
                     /db_xref="CDD:226075"
     misc_feature    377045..377524
                     /locus_tag="ABZJ_00345"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     gene            complement(377662..378378)
                     /locus_tag="ABZJ_00346"
                     /db_xref="GeneID:12115436"
     CDS             complement(377662..378378)
                     /locus_tag="ABZJ_00346"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524302.1"
                     /db_xref="GI:384141592"
                     /db_xref="GeneID:12115436"
                     /translation="MNFKILNQNILMSCLLASFFLTGCVSNRIIGENTRELFTKYDSG
                     YEWITLTEDDVIAFGKPSVSLPNEPEDSIVIAGKKYSYVISKGGNDFIQLISQLNPQY
                     IQISNELDFNAPASNSNHFYGHIRFSYTPPNGKLNEKESALFKQYGVIPCDYEKTLEL
                     HKFELNLRGTVYPPVNNLKKITPLSKPYHVRIQYLHDKSGKVPLSTKEKLASLPLLPF
                     TLTFDIIALPAKVMGIIYQP"
     misc_feature    complement(377695..378351)
                     /locus_tag="ABZJ_00346"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10215"
                     /db_xref="CDD:236663"
     gene            378654..379145
                     /locus_tag="ABZJ_00347"
                     /db_xref="GeneID:12115437"
     CDS             378654..379145
                     /locus_tag="ABZJ_00347"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524303.1"
                     /db_xref="GI:384141593"
                     /db_xref="GeneID:12115437"
                     /translation="MNFLKQSAFIAVFAFMGLPTVQAEEVATLPTIRVMAESELREEV
                     GFVPFQEDKKVRQALQHREYKTHNDIQNALVPEGMTTVDYQPVMAQPDLSQLSPFLRE
                     YILAVAGGIQSSDPTNGLFEMLKPLQINRSNVDAYREGTMKVNLDDILKLQQQIQDGL
                     KGR"
     gene            complement(379190..380362)
                     /locus_tag="ABZJ_00348"
                     /db_xref="GeneID:12115438"
     CDS             complement(379190..380362)
                     /locus_tag="ABZJ_00348"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="YP_005524304.1"
                     /db_xref="GI:384141594"
                     /db_xref="GeneID:12115438"
                     /translation="MATLNPRDVVIVDGVRSAMGKSKNGMFRNVRADSLSAELVRALV
                     ARNQFDVNEVEDLIWGCVNQTLEQGMNIGRNIGLLAGLPKTVAGQTVNRLCGSSMQAI
                     HTAAAQIATNQGDIFIIGGVEHMGHVGMMHGIDLNPEASKHYAKASNMMGLTAEMLGR
                     MNGITREEQDAFGVESHRRAWAATQEGRFKNEIIGVEGHDANGFKILCDIDEVIRPDA
                     NLEAFKALKPVFDPKGGSVTAATSSALSDGASAMLLMSAERAQALGLKPRAVIRSMAV
                     AGCDAAIMGYGPVPATQKALKRAGLSIADIQTVELNEAFAAQGLSVLKGLGLYDKQDI
                     VNLNGGAIALGHPLGCSGARITTTLLNVMEQQDTQIGLATMCIGLGQGIATVIERV"
     misc_feature    complement(379193..380347)
                     /locus_tag="ABZJ_00348"
                     /note="3-ketoacyl-CoA thiolase; Reviewed; Region: fadA;
                     PRK08947"
                     /db_xref="CDD:181592"
     misc_feature    complement(379196..380335)
                     /locus_tag="ABZJ_00348"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(379223..379228,379469..379471,
                     379529..379531,379535..379537,379541..379543,
                     379985..379987,380030..380032,380039..380044,
                     380063..380065,380087..380098,380129..380131,
                     380141..380143,380150..380152,380195..380197,
                     380276..380278))
                     /locus_tag="ABZJ_00348"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(379235..379237,379325..379327,
                     380078..380080))
                     /locus_tag="ABZJ_00348"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            complement(380375..382528)
                     /locus_tag="ABZJ_00349"
                     /db_xref="GeneID:12115439"
     CDS             complement(380375..382528)
                     /locus_tag="ABZJ_00349"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="YP_005524305.1"
                     /db_xref="GI:384141595"
                     /db_xref="GeneID:12115439"
                     /translation="MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAI
                     AAVKANNDIKGLVVTSGKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDL
                     DLPKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIG
                     IDNAVEWMAMATPKKPAAALKDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQE
                     KLEAVKLNPLEQMMAFNTAKGAVLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEA
                     EGFAKAAVTPQAEALIGLFINDQVVKKASKQHEKGAHPVNQAAVLGAGIMGGGIAYQA
                     ASKGTPIIMKDIGNPQLALGMKEANNLLTKQVERKKMKPAQMGETLARIRPTLSYEEF
                     KEVDIVIEAVTENPKVKEIVLAETEKNVRENTIIASNTSTISITRLAKALQRPENFVG
                     MHFFNPVHMMPLVEVIRGEKTSEEAIATTVVLAQKMGKTPIVVNDCPGFLVNRVLFPY
                     FGAFDLLVKDGADFQQIDNVMSKFGWPMGPAYLIDVVGIDTGVHGAEVMAEGFPDRMK
                     PDYKGAIEAMYEAKRLGQKNDVGFYKYELDKKGKKAKTVDPTAYEVIAPFVTGEKREF
                     DNQEIIDRMMLALCNETVRCLEDNIVATASEADMAMIMGIGFPPFRGGPCRYIDQTGV
                     AEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG"
     misc_feature    complement(380378..382528)
                     /locus_tag="ABZJ_00349"
                     /note="multifunctional fatty acid oxidation complex
                     subunit alpha; Reviewed; Region: fadB; PRK11730"
                     /db_xref="CDD:183293"
     misc_feature    complement(381917..382486)
                     /locus_tag="ABZJ_00349"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(382100..382102,382109..382114,
                     382178..382186,382190..382192,382316..382330,
                     382340..382342,382436..382438,382442..382444))
                     /locus_tag="ABZJ_00349"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(382178..382180,382322..382324))
                     /locus_tag="ABZJ_00349"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(381917..381919,381926..381928,
                     381971..381973,381980..381982,382013..382015,
                     382022..382027,382031..382036,382040..382045,
                     382058..382063,382067..382075,382079..382081,
                     382097..382108,382142..382153,382214..382216,
                     382238..382240))
                     /locus_tag="ABZJ_00349"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(381041..381535)
                     /locus_tag="ABZJ_00349"
                     /note="3-hydroxyacyl-CoA dehydrogenase, NAD binding
                     domain; Region: 3HCDH_N; pfam02737"
                     /db_xref="CDD:251505"
     misc_feature    complement(380750..381037)
                     /locus_tag="ABZJ_00349"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     gene            383100..384014
                     /locus_tag="ABZJ_00350"
                     /db_xref="GeneID:12115440"
     CDS             383100..384014
                     /locus_tag="ABZJ_00350"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-hydroxylase"
                     /protein_id="YP_005524306.1"
                     /db_xref="GI:384141596"
                     /db_xref="GeneID:12115440"
                     /translation="MIKWIILAIFVISALYIQHRGKVRHSFYRQFFDHSTLLAPINFL
                     MYIFSKVPNQPYIDTQHFKDLKVLDENWEMIRDEAKALYDQGGIKASSTYNDLGFNSF
                     FKTGWKRFYLKWYESSHPSAAELCPKTTALLKTLPTIKAAMFTELAPDSRLVRHRDPY
                     AGSLRYHLGLITPNDDRCFIDVDGERYSWRDGQSVVFDETYIHYAENKTDQNRIIFFA
                     DVERPMKVKWMERFNHWFGRNVMTAASSPNETGDQTGGLNKAFGYVYQIRIKAKALKA
                     KNRKLYYFLKWFLMLGIFFLIFVRPYVF"
     misc_feature    383112..383981
                     /locus_tag="ABZJ_00350"
                     /note="Aspartyl/asparaginyl beta-hydroxylase and related
                     dioxygenases [Posttranslational modification, protein
                     turnover, chaperones]; Region: COG3555"
                     /db_xref="CDD:226085"
     gene            complement(384091..384180)
                     /locus_tag="ABZJ_00351"
                     /db_xref="GeneID:12115441"
     CDS             complement(384091..384180)
                     /locus_tag="ABZJ_00351"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524307.1"
                     /db_xref="GI:384141597"
                     /db_xref="GeneID:12115441"
                     /translation="MIESEIDRVVIYGWQGSLIQVFKNDKLID"
     gene            complement(384362..384733)
                     /locus_tag="ABZJ_00352"
                     /db_xref="GeneID:12115442"
     CDS             complement(384362..384733)
                     /locus_tag="ABZJ_00352"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524308.1"
                     /db_xref="GI:384141598"
                     /db_xref="GeneID:12115442"
                     /translation="MNTKEFVKELINTISDEYIDTYKQIYSSTLIDNKIKEDPYWFDA
                     LTFYQSLSQKDKETLFKIIKQTTIDTTSIILGIIDGPVSLNQIPGDFTLTYTENEKTV
                     ILNGDLQDEFLTKIKERDRSQ"
     gene            384874..385404
                     /locus_tag="ABZJ_00353"
                     /db_xref="GeneID:12115443"
     CDS             384874..385404
                     /locus_tag="ABZJ_00353"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524309.1"
                     /db_xref="GI:384141599"
                     /db_xref="GeneID:12115443"
                     /translation="MAHAHHAAHAHVHHIEERKEDRSQGDLKTKVMLRQAASTTEKSK
                     RSRTKNHKTEDQNINLHKFSSKLESISAKHSKEKCAKNIRIALQAAGADVSKHPVAAS
                     DWGHTLEKNGYKKIKPAFNRPQEGDIYIIERTSGHTYGHIAGYTGNGWFSDFRQKTYA
                     VYKEKDVKYSYYRLDS"
     misc_feature    <385120..>385293
                     /locus_tag="ABZJ_00353"
                     /note="Cysteine hydrolases; This family contains
                     amidohydrolases, like CSHase (N-carbamoylsarcosine
                     amidohydrolase), involved in creatine metabolism and
                     nicotinamidase, converting nicotinamide to nicotinic acid
                     and ammonia in the pyridine nucleotide cycle. It...;
                     Region: cysteine_hydrolases; cl00220"
                     /db_xref="CDD:260273"
     gene            385529..387337
                     /locus_tag="ABZJ_00354"
                     /db_xref="GeneID:12115444"
     CDS             385529..387337
                     /locus_tag="ABZJ_00354"
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease subunit of the excinuclease complex"
                     /protein_id="YP_005524310.1"
                     /db_xref="GI:384141600"
                     /db_xref="GeneID:12115444"
                     /translation="MPIVNQNARPHIEKILANLTQLPGVYKMLGKEGELLYVGKAKNL
                     KNRVSSYFVKTIEHPKTQALVARIYDIETLVTRSETEALLLEQNLIKQHRPPYNIMLR
                     DDKSYVYIFVSADKPYPRIASGRGKGKHQIGKFFGPYPSAYSARDTLLVLQKLFNVRQ
                     CENSYFSQRKRPCLQYQIKRCSAPCVGLVSPEDYKEDVNNSIRFLQGDTKELNQELIA
                     KMEQAAADLEFEKAVFYRDRLSLLREVQAQQAVFKVKGEADILAIAYQAGVTCVQIMH
                     VRNGRMLGGKSYFPDMLGDDLGQMLSDFMANFYFQVADEVPSELIVNTALPDRKELEE
                     ALAQQFGKKVQIKSSVRETRAEWLELAEMNVQHAIKGQLSNHLELNERFHQLEQVVGR
                     PIDRIECFDISHTMGEAPIASCVVFDQGGARKRDYRQFAIQDITAGDDYAAMRQALTR
                     RYKKAMLPDLLLIDGGKGQLHMAIEVMQELGLEAFMVGVSKGEGRKPGLETLHFTDGT
                     KIQLPEDSKALHLIQQVRDEAHRFAITKHRAKRDKRRSTSVLEAIPGLGPKRRRDLLT
                     HFGGIQGVLKASEKELTVVPGLGEVMARTIYKILHE"
     misc_feature    385553..387334
                     /locus_tag="ABZJ_00354"
                     /note="excinuclease ABC subunit C; Validated; Region:
                     uvrC; PRK00558"
                     /db_xref="CDD:234792"
     misc_feature    385595..385825
                     /locus_tag="ABZJ_00354"
                     /note="Catalytic GIY-YIG domain of nucleotide excision
                     repair endonucleases UvrC, Cho, and similar proteins;
                     Region: GIY-YIG_UvrC_Cho; cd10434"
                     /db_xref="CDD:198381"
     misc_feature    order(385598..385606,385637..385645)
                     /locus_tag="ABZJ_00354"
                     /note="GIY-YIG motif/motif A; other site"
                     /db_xref="CDD:198381"
     misc_feature    order(385604..385606,385637..385639,385643..385648,
                     385667..385669,385679..385681,385784..385786,
                     385820..385822)
                     /locus_tag="ABZJ_00354"
                     /note="active site"
                     /db_xref="CDD:198381"
     misc_feature    order(385637..385639,385667..385669,385784..385786)
                     /locus_tag="ABZJ_00354"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198381"
     misc_feature    order(385637..385639,385667..385669,385784..385786)
                     /locus_tag="ABZJ_00354"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:198381"
     misc_feature    385784..385786
                     /locus_tag="ABZJ_00354"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198381"
     misc_feature    386171..386260
                     /locus_tag="ABZJ_00354"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:251123"
     misc_feature    386702..387130
                     /locus_tag="ABZJ_00354"
                     /note="UvrC Helix-hairpin-helix N-terminal; Region:
                     UvrC_HhH_N; pfam08459"
                     /db_xref="CDD:254815"
     misc_feature    387185..387334
                     /locus_tag="ABZJ_00354"
                     /note="H3TH domains of structure-specific 5' nucleases (or
                     flap endonuclease-1-like) involved in DNA replication,
                     repair, and recombination; Region:
                     H3TH_StructSpec-5'-nucleases; cl14815"
                     /db_xref="CDD:265460"
     gene            387458..388252
                     /locus_tag="ABZJ_00355"
                     /db_xref="GeneID:12115445"
     CDS             387458..388252
                     /locus_tag="ABZJ_00355"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA thioesterase"
                     /protein_id="YP_005524311.1"
                     /db_xref="GI:384141601"
                     /db_xref="GeneID:12115445"
                     /translation="MSLLQLWEDVKQNEWIDIPAGWLQGRTVFGGLVAGVLMQKACSY
                     IQDSNKRLLSCSVIFVGPVQQGAARLTIEVLREGKSVTTLEARLWQDDAVQTILVASF
                     GASRASSIEVKQEPVVPAYVPPENLSVIPFAKHMPECFQHFEVCWAEGNYPVTGSKHP
                     DFGGWSRFSPEQHANRQMTLSDLIVLMDIWPPGVLPMFKQVAPASSLSWHITYVHPVR
                     HQLCDWFKYKVTTEYAAEGYSTEYAYLWDQNDHLIAILRQTVTVFT"
     misc_feature    387518..388240
                     /locus_tag="ABZJ_00355"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    387527..387766
                     /locus_tag="ABZJ_00355"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:271497"
     misc_feature    order(387542..387547,387632..387643)
                     /locus_tag="ABZJ_00355"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(387560..387562,387569..387574,387581..387583,
                     387608..387616)
                     /locus_tag="ABZJ_00355"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     misc_feature    387950..388243
                     /locus_tag="ABZJ_00355"
                     /note="Thioesterase II (TEII) is thought to regenerate
                     misprimed nonribosomal peptide synthetases (NRPSs) as well
                     as modular polyketide synthases (PKSs) by hydrolyzing
                     acetyl groups bound to the peptidyl carrier protein (PCP)
                     and acyl carrier protein (ACP)...; Region:
                     Thioesterase_II; cd00556"
                     /db_xref="CDD:238311"
     misc_feature    order(388007..388009,388016..388021,388073..388075,
                     388082..388084,388229..388231)
                     /locus_tag="ABZJ_00355"
                     /note="active site"
                     /db_xref="CDD:238311"
     misc_feature    order(388076..388093,388097..388099,388154..388156,
                     388181..388183,388226..388228,388238..388240)
                     /locus_tag="ABZJ_00355"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238311"
     gene            388323..388958
                     /locus_tag="ABZJ_00356"
                     /db_xref="GeneID:12115446"
     CDS             388323..388958
                     /locus_tag="ABZJ_00356"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="YP_005524312.1"
                     /db_xref="GI:384141602"
                     /db_xref="GeneID:12115446"
                     /translation="MSLSVKRCVKTKLAVFMTTGRILNIPNILTLARIALIPVFLVIA
                     YWPPAIGIGEHVGSMTRHIILTAIFVLAAVTDWFDGYLARTLNQTSAFGRFLDPVADK
                     LMVAAALIVLVQWKPTIAMAFAAIVIISREITVSALREWMAELGARTSVAVSTVGKYK
                     TAFQMIAISVFLLNWQPLEVLAYALLYTAVILTLWSMFIYLKAAWPYLKQP"
     misc_feature    388389..388955
                     /locus_tag="ABZJ_00356"
                     /note="CDP-alcohol phosphatidyltransferase; Region:
                     CDP-OH_P_transf; cl00453"
                     /db_xref="CDD:260431"
     gene            389081..389935
                     /locus_tag="ABZJ_00357"
                     /db_xref="GeneID:12115447"
     CDS             389081..389935
                     /locus_tag="ABZJ_00357"
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="YP_005524313.1"
                     /db_xref="GI:384141603"
                     /db_xref="GeneID:12115447"
                     /translation="MQMLSSRQFAAIATIIEYLYEHLDQQPSLEDVATYMNLSPSYIQ
                     RQFQEWVGISPKKFVQYMSLQQAKYYLMQQRSLLDAALNTGLSGTGRLHDLFIQLEGM
                     TPGEYKQQGDGVELNYSVETSPFGDLLVVSSDKGICSVRFVDHSENIQEIVKQYFPKA
                     QLKNHSPIWHQQIAQWFRQDFSEHLQQKLPLNLAGTPFQLQVWEALLTIPEGQLRTYQ
                     DIAEQIGKPKAVRAVATAIGQNPIAYLIPCHRVIRATGMVGEYHWQKGRKLALLAWEM
                     AKQQGEIA"
     misc_feature    389141..389260
                     /locus_tag="ABZJ_00357"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    389174..389410
                     /locus_tag="ABZJ_00357"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     misc_feature    389447..389905
                     /locus_tag="ABZJ_00357"
                     /note="Methylated DNA-protein cysteine methyltransferase
                     [DNA replication, recombination, and repair]; Region: Ada;
                     COG0350"
                     /db_xref="CDD:223427"
     misc_feature    389672..389905
                     /locus_tag="ABZJ_00357"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    order(389672..389677,389729..389734,389756..389758,
                     389765..389767,389771..389776,389780..389782,
                     389789..389794,389798..389800,389822..389824,
                     389837..389839,389858..389860)
                     /locus_tag="ABZJ_00357"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     misc_feature    order(389729..389731,389822..389827,389831..389833,
                     389903..389905)
                     /locus_tag="ABZJ_00357"
                     /note="active site"
                     /db_xref="CDD:119438"
     gene            389932..390543
                     /locus_tag="ABZJ_00358"
                     /db_xref="GeneID:12115448"
     CDS             389932..390543
                     /locus_tag="ABZJ_00358"
                     /codon_start=1
                     /transl_table=11
                     /product="alkylated DNA repair protein"
                     /protein_id="YP_005524314.1"
                     /db_xref="GI:384141604"
                     /db_xref="GeneID:12115448"
                     /translation="MTLDLFSPEPCSNLLPYDGEVQDYGCILTAEEAEQYFHYLYQYL
                     AWRHDEAKLYGKHFITPRKVAWYGDEHYRYKYSGVFRDSLPWDKALAQLKQQVEQILS
                     EKFNSCLANLYEDGTQGMAWHSDSDVSLARTTTIASLSFGATRKFSFRHIQTKEKVEM
                     WLQPGQLIVMRGETQQYWQHRLNRSTKILQPRINLTFRQFKFS"
     misc_feature    390013..390525
                     /locus_tag="ABZJ_00358"
                     /note="2OG-Fe(II) oxygenase superfamily; Region:
                     2OG-FeII_Oxy_2; pfam13532"
                     /db_xref="CDD:257851"
     gene            complement(390738..391511)
                     /locus_tag="ABZJ_00359"
                     /db_xref="GeneID:12115449"
     CDS             complement(390738..391511)
                     /locus_tag="ABZJ_00359"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005524315.1"
                     /db_xref="GI:384141605"
                     /db_xref="GeneID:12115449"
                     /translation="MAISSFGKILTVLDLFSVSRPVINVDIICEELGLSKPTSYRYLK
                     ELVSADLLKRINGTSGDYTLGSKIAVLDYVSRTTDPLVQISTPFMRNIVERTELCCLL
                     TYLNDDYCIDIHHEIFKDTELLSYGRGCPRPIYVGASPKTMVSHLSKQRMHDYYERFQ
                     HELSESGFAVDEPSFIQRMRKIKKQGFYFSQGEIDPNVSGLAVPVRFSSKEVPLALTL
                     VASKNRFDFLNIEKLIEILQENAALIEQRFMELSEKGEI"
     misc_feature    complement(391236..391505)
                     /locus_tag="ABZJ_00359"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl21459"
                     /db_xref="CDD:271879"
     misc_feature    complement(390771..391502)
                     /locus_tag="ABZJ_00359"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(390771..391127)
                     /locus_tag="ABZJ_00359"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            392007..394106
                     /locus_tag="ABZJ_00360"
                     /db_xref="GeneID:12115450"
     CDS             392007..394106
                     /locus_tag="ABZJ_00360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524316.1"
                     /db_xref="GI:384141606"
                     /db_xref="GeneID:12115450"
                     /translation="MLLKQILAFRPSKLDLIFAIKTFIAGMLALFVSFELDLINPMWS
                     IGTVLIIANPYSGMVSSKCVYRLLGTVGGAIIALTITPHLINTPWIFTVVLSLWVGFA
                     LYVSLLDRTPRSYAFMLAGYSTAMIVYNAITYIDQYNIFDIALARVLEISIGVISSAV
                     VSATILPMHIGSAIKQRVTKTLKDTENLFANLLNADQQQNNTQLLAAITRDTTDIHAL
                     AVHLSYEKGELHGMTKPLQEMLHQMSMVVANLVALSERIKQLQELNFIESHSDKLKQL
                     SGHVIHFLEQKDQMTDENILQLPDEFENDFLNLNDSASEHQQVLLAAMKMDVRHFISN
                     VLAVKVLWQRIKQGNKEIPDNITPMTTTYPSLHRDHGVAVRGGISAVLITFIVTGVWI
                     LSGWKAGFMMAQIGAVTACILTALDNPVPVLRIFIWGSVASAVLVFIYAFGIFPYVTT
                     FWELGLVLLPMFLFAVSMMANQALMPVGMVLGINTMMGLNLHNAYSMDAVSYLDSSFG
                     MVMGVLVSLVVIDVVRAMSPDTSANRILALHYRAMRQAIYIPYGIEFKVHLRGMLDRV
                     GVLNTKMVQSEEIKKSIQQALVESSAIIDLSRLQELANQVPTSSELAHHIGRLQQDLD
                     ELFRAKENEKGESDVLVQHIHQTLFELKQLASNIEDMTLRQRLFISLNNIAYSMCHVS
                     SNQMNADRTLTGATAHG"
     misc_feature    392031..>393608
                     /locus_tag="ABZJ_00360"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; cl19401"
                     /db_xref="CDD:271855"
     misc_feature    392049..394040
                     /locus_tag="ABZJ_00360"
                     /note="Fusaric acid resistance protein family; Region:
                     FUSC; pfam04632"
                     /db_xref="CDD:252713"
     gene            394099..394305
                     /locus_tag="ABZJ_00361"
                     /db_xref="GeneID:12115451"
     CDS             394099..394305
                     /locus_tag="ABZJ_00361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524317.1"
                     /db_xref="GI:384141607"
                     /db_xref="GeneID:12115451"
                     /translation="MGEFNVYGIYVPALLVQAIFAYICFRWLSPLTNKWIAQGWIALP
                     SIFNLCFYLLLLLVIHQIFVGLGA"
     misc_feature    394102..394275
                     /locus_tag="ABZJ_00361"
                     /note="Protein of unknown function (DUF1656); Region:
                     DUF1656; pfam07869"
                     /db_xref="CDD:254477"
     gene            394336..395346
                     /locus_tag="ABZJ_00362"
                     /db_xref="GeneID:12115452"
     CDS             394336..395346
                     /locus_tag="ABZJ_00362"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative FusE-MFP/HlyD membrane fusion protein"
                     /protein_id="YP_005524318.1"
                     /db_xref="GI:384141608"
                     /db_xref="GeneID:12115452"
                     /translation="MSKMNQLELKKVIRPVILIVALMIAVYTIVHLWNYYNAAPWTRD
                     GRVRGDVIQVSSDVAGLVTEVLVQDNQTVKKGQVLFKIDVSRRALDVEQAKSDLAKAK
                     AAYAQAQAGLAQAKANLIKSSTNIKLAEKNANRYSNLMDGAISKQEQDQVFATRDQSH
                     AEHEQLQAAIQQAEATIKQQQALVEAATSNLHLAELNMHRAAVVAPADGTLSNFDLRP
                     GNYVQVGQAVAALLDRKQLYVVGYFEETKLDRIHIGDEATVQLMGDRQKIKGHVQGIA
                     SGIEDRERSSSSKLLANVNPTFSWVRLAQRVPVKIVLDEAPKNELAFVSGRTATVHII
                     EK"
     misc_feature    394360..395337
                     /locus_tag="ABZJ_00362"
                     /note="Multidrug resistance efflux pump [Defense
                     mechanisms]; Region: EmrA; COG1566"
                     /db_xref="CDD:224482"
     misc_feature    394483..394629
                     /locus_tag="ABZJ_00362"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    394942..395190
                     /locus_tag="ABZJ_00362"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(395403..395843)
                     /locus_tag="ABZJ_00363"
                     /db_xref="GeneID:12115453"
     CDS             complement(395403..395843)
                     /locus_tag="ABZJ_00363"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Holliday junction resolvase"
                     /protein_id="YP_005524319.1"
                     /db_xref="GI:384141609"
                     /db_xref="GeneID:12115453"
                     /translation="MTATQSKSIMAFDFGTQKMGMAIGQSAIESANPLPLFVMKDGIP
                     NWDQLLKIVKEWQPDLFIVGLPLNMDDSESELSTRARKFARRLRHQTNIETWMVDERL
                     TTREAREELGFYQEQGRAKKLSADSFAAALLIQSWYRNPVGLTP"
     misc_feature    complement(395433..395831)
                     /locus_tag="ABZJ_00363"
                     /note="Holliday junction resolvase-like protein; Reviewed;
                     Region: PRK00109"
                     /db_xref="CDD:234639"
     gene            complement(395843..396397)
                     /locus_tag="ABZJ_00364"
                     /db_xref="GeneID:12115454"
     CDS             complement(395843..396397)
                     /locus_tag="ABZJ_00364"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524320.1"
                     /db_xref="GI:384141610"
                     /db_xref="GeneID:12115454"
                     /translation="MTKQYMTHRCLIAPPEMADDFFANTVIYLARHDEEGAQGIIINR
                     PAGIQIKELLNDLDIDADNVNPHEVLQGGPLRPEAGFVLHTGQPTWHSSIAVGENVCI
                     TTSKDILDAIAHNEGVGRYQIALGYASWGKNQLEDEIARGDWLICDADMDLIFNLPYD
                     DRWDAAYKKIGVDRTWLASEIGHA"
     misc_feature    complement(395885..396355)
                     /locus_tag="ABZJ_00364"
                     /note="Uncharacterized ACR, COG1678; Region: DUF179;
                     pfam02622"
                     /db_xref="CDD:251425"
     gene            complement(396524..398191)
                     /locus_tag="ABZJ_00365"
                     /db_xref="GeneID:12115455"
     CDS             complement(396524..398191)
                     /locus_tag="ABZJ_00365"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_005524321.1"
                     /db_xref="GI:384141611"
                     /db_xref="GeneID:12115455"
                     /translation="MLTHLTLINFALADHLAIDIEQGFNVLTGETGAGKSLLLDALSA
                     CLGERTDTNYVRYGSDKADVTAVFTYQDNSPEAKWLKEHELDDDSGEIHLRRVIFATG
                     RSKAWVNGRPSSLSELKELGRLLVQLYSQHSQQQLLEPPYPKHWLDRYSNFYAEANDV
                     REAYSTWQRNIRQHQAALDAQATRLQRIATLELQIEELEEVIQTDYKEIEQEFDRLSH
                     HEHIMQDCSYSLNALDEAEQNITQEMSSIIRRLESHAGRSEQLSEIYNSLLNAQSEID
                     DATSNLRQFIDRQSFDPERMEELNSKLEVFHRLARKYRTQPETLKEEYETWQSELEQL
                     HQLEDPETLAEQVEKSHQEFLEKAQHLDNIRREAASPLAKQLTEQVKPLALPEAHFEF
                     KFEPLEQPNAEGLSFIQLLFTANKGIPPQPLARVASGGELSRIALVMQVMNAEKTEAE
                     VLVFDEIDVGISGGTAEVVGRLLADLAQHVQLLCITHQAQVAAQSDQHLLVKKQQTDP
                     ASSTIVQLDENQIISELARMSGGVEINETTLQHAKQLRQLKFQASST"
     misc_feature    complement(396557..398191)
                     /locus_tag="ABZJ_00365"
                     /note="ATPase involved in DNA repair [DNA replication,
                     recombination, and repair]; Region: RecN; COG0497"
                     /db_xref="CDD:223571"
     misc_feature    complement(396599..398188)
                     /locus_tag="ABZJ_00365"
                     /note="ATP-binding cassette domain of RecN; Region:
                     ABC_RecN; cd03241"
                     /db_xref="CDD:213208"
     misc_feature    complement(397628..398179)
                     /locus_tag="ABZJ_00365"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:257800"
     misc_feature    complement(398084..398107)
                     /locus_tag="ABZJ_00365"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213208"
     misc_feature    complement(order(396731..396733,396824..396829,
                     397121..397123,398081..398089,398093..398098))
                     /locus_tag="ABZJ_00365"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213208"
     misc_feature    complement(397121..397132)
                     /locus_tag="ABZJ_00365"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213208"
     misc_feature    complement(396884..396913)
                     /locus_tag="ABZJ_00365"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213208"
     misc_feature    complement(396824..396841)
                     /locus_tag="ABZJ_00365"
                     /note="Walker B; other site"
                     /db_xref="CDD:213208"
     misc_feature    complement(396806..396817)
                     /locus_tag="ABZJ_00365"
                     /note="D-loop; other site"
                     /db_xref="CDD:213208"
     misc_feature    complement(396725..396745)
                     /locus_tag="ABZJ_00365"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213208"
     gene            398306..399616
                     /locus_tag="ABZJ_00366"
                     /db_xref="GeneID:12115456"
     CDS             398306..399616
                     /locus_tag="ABZJ_00366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524322.1"
                     /db_xref="GI:384141612"
                     /db_xref="GeneID:12115456"
                     /translation="MKKTLSLPKAPIGMINRHKKTNPAEMNKILNQHFNAFKQAAAQG
                     DYVKAYQHVKKAVSLVPGHPGALSDLAYTELRLRRYDDAYQHYMQSIKASGSNVNTNL
                     YDGLTEVCHHLNKKEEKIKFGRLAISTKKELTKNEPTLNIPTHKPVPFSPNPQENIIA
                     FSLFGANPRYCETSILNTKLAQEIYPEWTCRFYVDESVPELVQQRLQANGAQVVHVSP
                     TQKQLSGLFWRFLVMDDPVVKRFLVRDADSIVSYREKAAVDAWLKSDQWFHLMRDSYS
                     HTELILAGMWGGCTGIFHNIEAHIRDYVATGRYPDNRVIDQHYLRYCIWPTLKQSVLV
                     HDSQQFDENSADFPVYDLTSMQNDQDNFHVGMDNGSPIVTTAVNHPTAEKVYWILFDE
                     NHDEVCRYDAIVSKSRNIEVNLPHAFAKKIQLQQWKLQVYPYEN"
     misc_feature    398405..398701
                     /locus_tag="ABZJ_00366"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(398405..398410,398417..398422,398507..398512,
                     398516..398521,398528..398533,398615..398620,
                     398627..398632,398639..398644)
                     /locus_tag="ABZJ_00366"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(398414..398416,398450..398452,398462..398464,
                     398471..398473,398516..398518,398552..398554,
                     398564..398566,398573..398575,398624..398626,
                     398660..398662,398672..398674,398681..398683)
                     /locus_tag="ABZJ_00366"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            399687..400019
                     /locus_tag="ABZJ_00367"
                     /db_xref="GeneID:12115457"
     CDS             399687..400019
                     /locus_tag="ABZJ_00367"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524323.1"
                     /db_xref="GI:384141613"
                     /db_xref="GeneID:12115457"
                     /translation="MCMSSTQFDHVTVIKKSNVYFGGACISHTVQFEDGTKKTLGVIL
                     PTEQPLTFETHVPERMEIISGECRVKIADSNESELFRAGQSFYVPGNSVFKIETDEVL
                     DYVCHLEG"
     misc_feature    399726..400013
                     /locus_tag="ABZJ_00367"
                     /note="Protein of unknown function (DUF1255); Region:
                     DUF1255; pfam06865"
                     /db_xref="CDD:253951"
     gene            400121..400870
                     /locus_tag="ABZJ_00368"
                     /db_xref="GeneID:12115458"
     CDS             400121..400870
                     /locus_tag="ABZJ_00368"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tRNA/rRNA methyltransferase"
                     /protein_id="YP_005524324.1"
                     /db_xref="GI:384141614"
                     /db_xref="GeneID:12115458"
                     /translation="MAKPEYYYGVHSVESLLELEPERVLTLFTLKGRDDQRLQKILQL
                     AEPFGISVQKASRDSLEKLAGLPFHQGVVAAVRPHPTLNEKDLDQLLAETPDALLLAL
                     DQVTDPHNLGACIRTAAAMGVQAVIVPRDRSASLTPTARKVAAGGAEKVKFIQVTNLA
                     RTLAHLKETTHVRVIGTMLDENALPIQKCDFSGAVVIVMGAEDTGLRPITQAQCDQKA
                     YIPMSGNLQSLNVSVATGMALYEACRQRSEV"
     misc_feature    400127..400861
                     /locus_tag="ABZJ_00368"
                     /note="23S rRNA (guanosine-2'-O-)-methyltransferase;
                     Provisional; Region: PRK11181"
                     /db_xref="CDD:183021"
     misc_feature    400142..400366
                     /locus_tag="ABZJ_00368"
                     /note="RNA 2'-O ribose methyltransferase substrate
                     binding; Region: SpoU_sub_bind; pfam08032"
                     /db_xref="CDD:254595"
     misc_feature    400412..400840
                     /locus_tag="ABZJ_00368"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            400906..401820
                     /locus_tag="ABZJ_00369"
                     /db_xref="GeneID:12115459"
     CDS             400906..401820
                     /locus_tag="ABZJ_00369"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524325.1"
                     /db_xref="GI:384141615"
                     /db_xref="GeneID:12115459"
                     /translation="MSPRTQGYFFVLVTMCIWGGFTLFARLNAQWHISAWDIAALRFA
                     IAFLILMPILIYKKDLAFLWSKHAVILALIGGVIYCLTVYTAFLYAPAAHAAIFLNGC
                     IPICTAIAAYILFRQPFDKHTWVSLAIMITALALMSALMLKSSTSAFGIGDLLLFISA
                     IWWGIFTVLLKQWKLSAWHSMASVAIWSAIIYLPIYLLFLPKHFMDVDPLHLAVQSIF
                     HGVFVVIIATLTYVAAIQRLGAFKTGSIVTLAPFIAAILAVPLLGESLSPSIVVGLVG
                     MGIGALQPWRWFRQDSLTQKIKQQNTQN"
     misc_feature    400906..401751
                     /locus_tag="ABZJ_00369"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    400954..401319
                     /locus_tag="ABZJ_00369"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    401392..401751
                     /locus_tag="ABZJ_00369"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(401817..402413)
                     /locus_tag="ABZJ_00370"
                     /db_xref="GeneID:12115460"
     CDS             complement(401817..402413)
                     /locus_tag="ABZJ_00370"
                     /codon_start=1
                     /transl_table=11
                     /product="dephosphocoenzyme A kinase"
                     /protein_id="YP_005524326.1"
                     /db_xref="GI:384141616"
                     /db_xref="GeneID:12115460"
                     /translation="MAFILGITGGIGSGKSAATQWFESQGIQVVDADIVAREVVEKGQ
                     PALQKIQQTFGDWVLQPDGSLDRRALREYIFQNPQARHTLEQITHPAIRQSIIQQLQN
                     PKSPYVILVSPLLFETNQHELVNHTLLIDASEQTQIQRASQRDGQNQEQIQKIIAAQM
                     PRERKRELANDIVFNDGLLEHLYQQLEPLHQSYLKRAN"
     misc_feature    complement(401823..402413)
                     /locus_tag="ABZJ_00370"
                     /note="Dephospho-CoA kinase [Coenzyme metabolism]; Region:
                     CoaE; COG0237"
                     /db_xref="CDD:223315"
     misc_feature    complement(401871..402404)
                     /locus_tag="ABZJ_00370"
                     /note="Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24)
                     catalyzes the phosphorylation of dephosphocoenzyme A
                     (dCoA) to yield CoA, which is the final step in CoA
                     biosynthesis; Region: DPCK; cd02022"
                     /db_xref="CDD:238980"
     misc_feature    complement(order(401937..401939,402072..402077,
                     402147..402149,402315..402317,402390..402392))
                     /locus_tag="ABZJ_00370"
                     /note="CoA-binding site [chemical binding]; other site"
                     /db_xref="CDD:238980"
     misc_feature    complement(order(401889..401891,401994..401996,
                     402369..402374,402381..402389))
                     /locus_tag="ABZJ_00370"
                     /note="ATP-binding [chemical binding]; other site"
                     /db_xref="CDD:238980"
     gene            complement(402415..403275)
                     /locus_tag="ABZJ_00371"
                     /db_xref="GeneID:12115461"
     CDS             complement(402415..403275)
                     /locus_tag="ABZJ_00371"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretory pathway, prepilin signal
                     peptidase PulO"
                     /protein_id="YP_005524327.1"
                     /db_xref="GI:384141617"
                     /db_xref="GeneID:12115461"
                     /translation="MQDIIAYFIQNLTALYIAVALVSLCIGSFLNVVIYRTPRMMEQD
                     WQQECQMLLNPEQPIIDHERLTLNKPASSCPACQQPIRWYQNIPVISWLVLRGKCGHC
                     QHPISIRYPAIELLTMLCSLVVVMVFGPTIQMLFGLILTWVLIALTFIDFDTQLLPDR
                     FTLPLAALGLGINTFNIYTSPNSAIWGYLIGFLCLWIVYYLFKVITGKEGMGYGDFKL
                     LAALGAWMGPLMLPLIVLLSSLIGAIIGIILLKLRNDNQPFAFGPYIAIAGWVAFLWG
                     DQIMKIYLGG"
     misc_feature    complement(402421..403233)
                     /locus_tag="ABZJ_00371"
                     /note="Type II secretory pathway, prepilin signal
                     peptidase PulO and related peptidases [Cell motility and
                     secretion / Posttranslational modification, protein
                     turnover, chaperones / Intracellular trafficking and
                     secretion]; Region: PulO; COG1989"
                     /db_xref="CDD:224900"
     misc_feature    complement(402886..403215)
                     /locus_tag="ABZJ_00371"
                     /note="Bacterial Peptidase A24 N-terminal domain; Region:
                     DiS_P_DiS; pfam06750"
                     /db_xref="CDD:253893"
     misc_feature    complement(402559..402864)
                     /locus_tag="ABZJ_00371"
                     /note="Type IV leader peptidase family; Region:
                     Peptidase_A24; pfam01478"
                     /db_xref="CDD:250649"
     gene            complement(403275..404501)
                     /locus_tag="ABZJ_00372"
                     /db_xref="GeneID:12115462"
     CDS             complement(403275..404501)
                     /locus_tag="ABZJ_00372"
                     /codon_start=1
                     /transl_table=11
                     /product="type 4 fimbrial assembly protein"
                     /protein_id="YP_005524328.1"
                     /db_xref="GI:384141618"
                     /db_xref="GeneID:12115462"
                     /translation="MAVKKAQMMPTFAYEGVDRKGVKIKGELPAKNMALAKVTLRKQG
                     VTVRNIREKRKNILEGLFKKKVTTLDITIFTRQLATMMKAGVPLVQGFEIVAEGLENP
                     AMREVVLGIKGEVEGGSTFASALRKYPQHFDNLFCSLVESGEQSGALETMLDRVAIYK
                     EKSELLKQKIKKAMKYPATVIVVAIVVTIILMVKVVPVFQDLFASFGADLPAFTQMVV
                     NMSKWMQEYWFIMIIAIGAVIAAFLEAKKRSKKFRDGLDKLALKLPIFGDLVYKAIIA
                     RYSRTLATTFAAGVPLIDALESTAGATNNVIYEKAVMKIREDVATGQQLQFAMRVSNR
                     FPSMAIQMVAIGEESGALDSMLDKVATYYENEVDNAVDGLTSMMEPLIMAILGVLVGG
                     LVIAMYLPIFQMGSVV"
     misc_feature    complement(403278..404477)
                     /locus_tag="ABZJ_00372"
                     /note="Type II secretory pathway, component PulF [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: PulF; COG1459"
                     /db_xref="CDD:224376"
     misc_feature    complement(403971..404282)
                     /locus_tag="ABZJ_00372"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     misc_feature    complement(403302..403670)
                     /locus_tag="ABZJ_00372"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     gene            complement(404531..406243)
                     /locus_tag="ABZJ_00373"
                     /db_xref="GeneID:12115463"
     CDS             complement(404531..406243)
                     /locus_tag="ABZJ_00373"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretory pathway, ATPase PulE/Tfp pilus
                     assembly pathway, ATPase PilB"
                     /protein_id="YP_005524329.1"
                     /db_xref="GI:384141619"
                     /db_xref="GeneID:12115463"
                     /translation="MSALHTSPKFTGFFRRLVEEKHVSAATMQTALDAAKRAKQDTVA
                     YLIEEVHLSPSLLAETISAEFAEPYFDLDVYDTSQIPKDLVDQKLILKHRILPLIQRG
                     QILYVATSNPSNIEAIDAIRFNSKLLVEPVIVEHHKLEKVLGQHFAEESSFDFNDEEF
                     DLDVNLDGPTTQEDEEEAPQGDEAPIVKYINKLLIDAIRMGASDLHFEPYEKSYRVRY
                     RVDGMLRQIANPPLQLANRLASRLKVMSQMDISEKRVPQDGRIKLKLSKSKAIDFRVN
                     SLPTLFGEKLVLRILDPSSAMLGIDALGYEEDQKALFMEALDKPQGMLLITGPTGSGK
                     TVSLYTGLNILNTESSNISTAEDPVEINLEGINQVNVNPKVGLTFAAALKSFLRQDPD
                     IIMVGEIRDLETAEIAIKAAQTGHMVMSTLHTNSAPETLTRLRNMGVPSFNIATSVNL
                     VIAQRLARRLCSQCKIPADIPKQSLLEMGFTEQDLAHPDFRVFQPVGCPECREGYKGR
                     VGIYEVMKVTPEISKIIMEDGNALEIAAASEKLGFNNLRRSGLKKVMQGVTSLQEVNR
                     VTSE"
     misc_feature    complement(404534..406210)
                     /locus_tag="ABZJ_00373"
                     /note="type IV-A pilus assembly ATPase PilB; Region:
                     type_IV_pilB; TIGR02538"
                     /db_xref="CDD:233914"
     misc_feature    complement(405788..406108)
                     /locus_tag="ABZJ_00373"
                     /note="Type II secretion system (T2SS), protein E,
                     N-terminal domain; Region: T2SE_Nter; pfam05157"
                     /db_xref="CDD:253049"
     misc_feature    complement(404720..405523)
                     /locus_tag="ABZJ_00373"
                     /note="PulE/GspE The type II secretory pathway is the main
                     terminal branch of the general secretory pathway (GSP).
                     It is responsible for the export the majority of
                     Gram-negative bacterial exoenzymes and toxins. PulE is a
                     cytoplasmic protein of the GSP, which...; Region:
                     PulE-GspE; cd01129"
                     /db_xref="CDD:238549"
     misc_feature    complement(405239..405262)
                     /locus_tag="ABZJ_00373"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238549"
     misc_feature    complement(order(405050..405055,405173..405178,
                     405182..405184,405239..405247,405257..405259))
                     /locus_tag="ABZJ_00373"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238549"
     misc_feature    complement(405050..405067)
                     /locus_tag="ABZJ_00373"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238549"
     gene            406526..407329
                     /locus_tag="ABZJ_00374"
                     /db_xref="GeneID:12115464"
     CDS             406526..407329
                     /locus_tag="ABZJ_00374"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="YP_005524330.1"
                     /db_xref="GI:384141620"
                     /db_xref="GeneID:12115464"
                     /translation="MSSMSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIAD
                     ENCHVGVAPVSIALTTVQAQLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQI
                     NFVLVGHSERRDIFGDNVEILKAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQ
                     ICDIAPVVTAEQWQNQVVIAYEPIWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSN
                     IAILYGGSVKAENAVELAACPDINGALVGGASLNAASFYQIVQAFAQSK"
     misc_feature    406556..407308
                     /locus_tag="ABZJ_00374"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    order(406571..406573,406577..406579,406850..406852,
                     407069..407071,407087..407089,407201..407203,
                     407258..407260,407264..407269)
                     /locus_tag="ABZJ_00374"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    order(406571..406573,406580..406582,406688..406696,
                     406700..406702,406709..406711,406754..406756,
                     406811..406813,406820..406825,406856..406861)
                     /locus_tag="ABZJ_00374"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    order(406577..406579,406850..406852,407069..407071)
                     /locus_tag="ABZJ_00374"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            407342..407671
                     /locus_tag="ABZJ_00375"
                     /db_xref="GeneID:12115465"
     CDS             407342..407671
                     /locus_tag="ABZJ_00375"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="YP_005524331.1"
                     /db_xref="GI:384141621"
                     /db_xref="GeneID:12115465"
                     /translation="MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFG
                     ASGSGNFLTRVTAILTALFFVTSLTLAVFAKKQTTEAYSLKTVQTTVPVQTTSPETSP
                     NAPKTGQ"
     misc_feature    407345..407566
                     /locus_tag="ABZJ_00375"
                     /note="Preprotein translocase SecG subunit; Region: SecG;
                     pfam03840"
                     /db_xref="CDD:252199"
     gene            407728..407812
                     /locus_tag="ABZJ_tRNA12"
                     /db_xref="GeneID:12115466"
     tRNA            407728..407812
                     /locus_tag="ABZJ_tRNA12"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:12115466"
     gene            407854..407930
                     /locus_tag="ABZJ_tRNA13"
                     /db_xref="GeneID:12115467"
     tRNA            407854..407930
                     /locus_tag="ABZJ_tRNA13"
                     /product="tRNA-Met"
                     /db_xref="GeneID:12115467"
     gene            408145..408669
                     /locus_tag="ABZJ_00376"
                     /db_xref="GeneID:12115468"
     CDS             408145..408669
                     /locus_tag="ABZJ_00376"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524332.1"
                     /db_xref="GI:384141622"
                     /db_xref="GeneID:12115468"
                     /translation="MKLSNKSQALYDMIAPAVEACGVDLWGIEFLPQGKRSLLRIYID
                     RPVDENAEPVINEDGEVEQGRGIGVEDCVRVTQQVGAMLDVHDPISGEYALEVSSPGW
                     DRPFFQLEQLQGYIGQQVALRLIAAVENRRKFQAKLLAVDLENEEIQVEVEGKHVLDI
                     DSNNIDKANLIYQD"
     misc_feature    408199..>408498
                     /locus_tag="ABZJ_00376"
                     /note="Sm and related proteins; Region: Sm_like; cl00259"
                     /db_xref="CDD:271447"
     misc_feature    408445..408666
                     /locus_tag="ABZJ_00376"
                     /note="Bacillus subtilis YxlS-like, C-terminal domain;
                     Region: YlxS_C; cd01734"
                     /db_xref="CDD:212481"
     misc_feature    order(408511..408513,408517..408519,408538..408540,
                     408544..408546,408562..408564,408589..408591,
                     408613..408621,408625..408630,408634..408651)
                     /locus_tag="ABZJ_00376"
                     /note="putative oligomer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212481"
     misc_feature    order(408568..408570,408580..408582,408625..408627)
                     /locus_tag="ABZJ_00376"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:212481"
     gene            408707..410191
                     /locus_tag="ABZJ_00377"
                     /db_xref="GeneID:12115469"
     CDS             408707..410191
                     /locus_tag="ABZJ_00377"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor"
                     /protein_id="YP_005524333.1"
                     /db_xref="GI:384141623"
                     /db_xref="GeneID:12115469"
                     /translation="MGREILTVVETVSNEKGVSREAIFEALEQALVAATKKKFYEGTN
                     SEEAQLRVEIDRRTGDYRTFRQWTVVADEDHEMPACQDAISDVDPAKWSIGDVRELEV
                     ESIEFGRIAAQIAKQVIVQKIREAERALVADAYESKVGELIYGEVKKQTKDGFIIDLG
                     DNAEAYLAREEMIPKEILRPKQRVNAILYSVNREGRGAQLLLSRAKPEMLIALMKKEI
                     PEISEEIIEIKAAARQPGVRAKIAVKTNDHRIDPVGACIGMRGTRIQAVQQELNGERI
                     DVVVWSDDPAQYIASALEPADVSGIVLDEDAKSADIIFATNDQLARAIGSQGQNVRLA
                     SDLTGYKLDMMLEEEYRARQQNEAQQYLDMFVSRLDIEEDLAMALVEMGFTSLEEIAY
                     VPAETFDEIELDAELVELLQSRAKEAALTDALKQQENIQEPSADLLNMEGMTSEIAYS
                     LAARGIITVDDLADQATDDISDIEGLGHDKAGQLIMKARESWFN"
     misc_feature    408707..410131
                     /locus_tag="ABZJ_00377"
                     /note="transcription elongation factor NusA; Validated;
                     Region: nusA; PRK09202"
                     /db_xref="CDD:236410"
     misc_feature    408716..409090
                     /locus_tag="ABZJ_00377"
                     /note="NusA N-terminal domain; Region: NusA_N; pfam08529"
                     /db_xref="CDD:254856"
     misc_feature    409115..409318
                     /locus_tag="ABZJ_00377"
                     /note="S1_NusA: N-utilizing substance A protein (NusA),
                     S1-like RNA-binding domain. S1-like RNA-binding domains
                     are found in a wide variety of RNA-associated proteins.
                     NusA is a transcription elongation factor containing an
                     N-terminal catalytic domain and three...; Region: S1_NusA;
                     cd04455"
                     /db_xref="CDD:239902"
     misc_feature    order(409148..409150,409172..409174,409202..409204,
                     409208..409210)
                     /locus_tag="ABZJ_00377"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239902"
     misc_feature    order(409154..409156,409166..409168,409196..409198,
                     409202..409204,409301..409303)
                     /locus_tag="ABZJ_00377"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239902"
     misc_feature    <409418..409543
                     /locus_tag="ABZJ_00377"
                     /note="NusA_K homology RNA-binding domain (KH). NusA is an
                     essential multifunctional transcription elongation factor
                     that is universally conserved among prokaryotes and
                     archaea. NusA anti-termination function plays an important
                     role in the expression of...; Region: NusA_KH; cd02134"
                     /db_xref="CDD:239049"
     misc_feature    409478..409489
                     /locus_tag="ABZJ_00377"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239049"
     misc_feature    409559..409741
                     /locus_tag="ABZJ_00377"
                     /note="NusA_K homology RNA-binding domain (KH). NusA is an
                     essential multifunctional transcription elongation factor
                     that is universally conserved among prokaryotes and
                     archaea. NusA anti-termination function plays an important
                     role in the expression of...; Region: NusA_KH; cd02134"
                     /db_xref="CDD:239049"
     misc_feature    409679..409690
                     /locus_tag="ABZJ_00377"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239049"
     misc_feature    409817..409960
                     /locus_tag="ABZJ_00377"
                     /note="transcription termination factor NusA, C-terminal
                     duplication; Region: nusA_Cterm_rpt; TIGR01954"
                     /db_xref="CDD:131009"
     misc_feature    409997..410176
                     /locus_tag="ABZJ_00377"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     gene            410202..412901
                     /locus_tag="ABZJ_00378"
                     /db_xref="GeneID:12115470"
     CDS             410202..412901
                     /locus_tag="ABZJ_00378"
                     /codon_start=1
                     /transl_table=11
                     /product="protein chain initiation factor IF-2"
                     /protein_id="YP_005524334.1"
                     /db_xref="GI:384141624"
                     /db_xref="GeneID:12115470"
                     /translation="MTDKSIKELALSVGRPVEKLLEQAREAGLPQRTADDIITTEQQD
                     TLVNYLKKVHGQESGNTGKIALKRKTTSTAKVASTSGKAKTINVEVRKKQVFAKPNPE
                     QIAAEAKARAEAEAKARAEQQAREAAEQKARLQTEQKAKATLDAMRAAHQQDSAAQSA
                     PKAAVVVKKRGGGTVKPAPKPAETLEQKKAREAQTAQLKATEEAARRKAAEEAQQRTL
                     EQMRKMASKYSNDDATATIRVIDDSPLASGLVGQAYEDSFNQEDREIKRGGATTNPRA
                     GKKGGRRGQEEQSFVNHNKRGLKSSQANKHGFEKPVKKQVYDVEIGSSIVVADLAQKM
                     AIKVREVIKTLMKMGELVNQNQTIDQDTAALVVEEMGHNPVLVSDTQAEDNLLEAAEE
                     ARGEQTTRPPVVTIMGHVDHGKTSLLDRIRRSKVAAGEAGGITQHIGAYHVETDKGII
                     TFLDTPGHAAFTSMRARGAKATDIVVLVVAADDGVMPQTAEAIDHARAAGTPIIVAIN
                     KMDKESADPDRVLNELTTKEIVPEEWGGDVPVAKVSAHTGQGIDELLDLILIQSELME
                     LKASAEGAAQGVVIEARVDKGRGAVTSILVQNGTLNIGDLVLAGSSYGRVRAMSDENG
                     KPIKSAGPSIPVEILGLPEAPMAGDEVLVVNDEKKAREVADARADREREKRIERQSAM
                     RLENIMASMGKKDVPTVNVVLRTDVRGTLEALNAALHELSTDEVKVRVISSGVGAITE
                     SDVILAESSEAVLLGFNVRADTAARQKSDQDGIDIRYYSIIYELIDDVKDAMSGKLAP
                     EHRETILGVAQVREVFRSSKFGAAAGCMVMEGVIHRNKPIRVLRDDVVIFQGELESLR
                     RYKDVVDEVRAGMECGLAVKGYNDIKPLDKIEVYDVQMVKRSL"
     misc_feature    410388..410501
                     /locus_tag="ABZJ_00378"
                     /note="Bacterial translation initiation factor IF-2
                     associated region; Region: IF2_assoc; pfam08364"
                     /db_xref="CDD:254758"
     misc_feature    410682..412895
                     /locus_tag="ABZJ_00378"
                     /note="translation initiation factor IF-2; Validated;
                     Region: infB; PRK05306"
                     /db_xref="CDD:235401"
     misc_feature    411168..411317
                     /locus_tag="ABZJ_00378"
                     /note="Translation initiation factor IF-2, N-terminal
                     region; Region: IF2_N; pfam04760"
                     /db_xref="CDD:252785"
     misc_feature    411405..411896
                     /locus_tag="ABZJ_00378"
                     /note="Initiation Factor 2 (IF2)/ eukaryotic Initiation
                     Factor 5B (eIF5B) family; Region: IF2_eIF5B; cd01887"
                     /db_xref="CDD:206674"
     misc_feature    411423..411446
                     /locus_tag="ABZJ_00378"
                     /note="G1 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    order(411426..411428,411432..411434,411444..411449,
                     411456..411458,411465..411470,411516..411521,
                     411573..411578,411645..411650,411753..411755,
                     411765..411767)
                     /locus_tag="ABZJ_00378"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206674"
     misc_feature    order(411429..411449,411576..411578,411723..411728,
                     411732..411737,411831..411839)
                     /locus_tag="ABZJ_00378"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206674"
     misc_feature    411498..411518
                     /locus_tag="ABZJ_00378"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206674"
     misc_feature    411504..411506
                     /locus_tag="ABZJ_00378"
                     /note="G2 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    411561..411572
                     /locus_tag="ABZJ_00378"
                     /note="G3 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    411567..411623
                     /locus_tag="ABZJ_00378"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206674"
     misc_feature    411723..411734
                     /locus_tag="ABZJ_00378"
                     /note="G4 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    411831..411839
                     /locus_tag="ABZJ_00378"
                     /note="G5 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    411924..412208
                     /locus_tag="ABZJ_00378"
                     /note="This family represents the domain II of bacterial
                     Initiation Factor 2 (IF2) and its eukaryotic mitochondrial
                     homologue mtIF2. IF2, the largest initiation factor is an
                     essential GTP binding protein. In E. coli three natural
                     forms of IF2 exist in the cell; Region: IF2_mtIF2_II;
                     cd03702"
                     /db_xref="CDD:239673"
     misc_feature    412245..412571
                     /locus_tag="ABZJ_00378"
                     /note="Translation-initiation factor 2; Region: IF-2;
                     pfam11987"
                     /db_xref="CDD:256778"
     misc_feature    412617..412868
                     /locus_tag="ABZJ_00378"
                     /note="mtIF2_IVc: this family represents the C2 subdomain
                     of domain IV of mitochondrial translation initiation
                     factor 2 (mtIF2) which adopts a beta-barrel fold
                     displaying a high degree of structural similarity with
                     domain II of the translation elongation factor...; Region:
                     mtIF2_IVc; cd03692"
                     /db_xref="CDD:239663"
     gene            412901..413302
                     /locus_tag="ABZJ_00379"
                     /db_xref="GeneID:12115471"
     CDS             412901..413302
                     /locus_tag="ABZJ_00379"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="YP_005524335.1"
                     /db_xref="GI:384141625"
                     /db_xref="GeneID:12115471"
                     /translation="MAGGQRLKRMADSVQRELSELIRQELKDPRLGGLVTISGVKVSP
                     DLGYADVYVTVMGRELSDDQNEVAHRETLDILNKASGFLRQELSRRIKTRITPRLRFH
                     YDKTNAYGNYMFGLIEKAVQDLPKRESDDKE"
     misc_feature    412907..413299
                     /locus_tag="ABZJ_00379"
                     /note="ribosome-binding factor A; Provisional; Region:
                     PRK13816"
                     /db_xref="CDD:184344"
     gene            complement(413359..413763)
                     /locus_tag="ABZJ_00380"
                     /db_xref="GeneID:12115472"
     CDS             complement(413359..413763)
                     /locus_tag="ABZJ_00380"
                     /codon_start=1
                     /transl_table=11
                     /product="pH adaptation potassium efflux system protein G"
                     /protein_id="YP_005524336.1"
                     /db_xref="GI:384141626"
                     /db_xref="GeneID:12115472"
                     /translation="MQITMEIIVSIFLVFGAFFMLVGSIGMVRLPDLFMRLHAPTKSS
                     TLGLGSFLIASMIFFAFQGRFGFAELLITLLAFITAPVSANLIAQAALHLRLRSLSGE
                     VPEAIERPLPWDRYKIGQRFSQNKPPMEPPQE"
     misc_feature    complement(413473..413751)
                     /locus_tag="ABZJ_00380"
                     /note="putative monovalent cation/H+ antiporter subunit G;
                     Reviewed; Region: PRK12674"
                     /db_xref="CDD:237169"
     gene            complement(413776..414051)
                     /locus_tag="ABZJ_00381"
                     /db_xref="GeneID:12115473"
     CDS             complement(413776..414051)
                     /locus_tag="ABZJ_00381"
                     /codon_start=1
                     /transl_table=11
                     /product="multicomponent K+:H+ antiporter subunit F"
                     /protein_id="YP_005524337.1"
                     /db_xref="GI:384141627"
                     /db_xref="GeneID:12115473"
                     /translation="MTILPYALGISLVAITISMLLCLFRMVMGPSIVDRLLALDTLFL
                     NATCLIIVLGIYWTTTSLFEGALLVAMLGFVSTAALARYFTTGHVID"
     misc_feature    complement(413782..414045)
                     /locus_tag="ABZJ_00381"
                     /note="Multiple resistance and pH regulation protein F
                     (MrpF / PhaF); Region: MrpF_PhaF; cl09154"
                     /db_xref="CDD:245022"
     gene            complement(414576..416390)
                     /locus_tag="ABZJ_00382"
                     /db_xref="GeneID:12115474"
     CDS             complement(414576..416390)
                     /locus_tag="ABZJ_00382"
                     /codon_start=1
                     /transl_table=11
                     /product="formate hydrogenlyase subunit 3/multisubunit
                     Na+/H+ antiporter, MnhD subunit"
                     /protein_id="YP_005524338.1"
                     /db_xref="GI:384141628"
                     /db_xref="GeneID:12115474"
                     /translation="MMFDFLSFWQANTPIFSILIPAFTGFILLLLGNPGAGALKEDWR
                     QPWRRGISLISAIAGLITAVSYLLVANTGQITVYQLSEWSAPFGIVLVLDRLSAFMLV
                     LTYALAVPVLWYASENWDTRGRYFHAIFHFLLMGLCGAFLTGDLFNLFVFFEILLMAS
                     YVLLLHGQGKPRFQLGVHYVIINLLASALFLIGLGMIYGSVGSLNMADVSRLLPTLDA
                     DQHKLAVAGALLLFVVFGIKAAMLPVGFWLPKTYAVASTPVAAIFTIMTKVGIYAILR
                     VNGTVFNDVLSQEIFKSWLLPIGLVTSLYGVIGAIGADRLRRFVGFMVLSSIGTLLIA
                     IAMSNTQAWSGALFYLVHSTLIGAAFYLFCGWMTSQRGDFKDHLKIAPRIKQEKAAML
                     TYFLIAMMLAGLPPFSGFFGKVFILQATVETAYQGWVIGIVLLVSLLSIIALTRVGFI
                     LFWRASPPEEDPINPAYIIYRALPEKAPPRNDTVIYILLAGLVAYVAFASPVLHYTTN
                     TAQQIQDHALYQQSILKTDQNGEVISVQPYDSTYLPETKYGGEVEDHNAYLIPDIISK
                     DTFNGEHISEYKHRQIQQQEKLQTPTIADESQLKPMEP"
     misc_feature    complement(414783..416372)
                     /locus_tag="ABZJ_00382"
                     /note="putative monovalent cation/H+ antiporter subunit D;
                     Reviewed; Region: PRK12666"
                     /db_xref="CDD:237166"
     misc_feature    complement(415134..415961)
                     /locus_tag="ABZJ_00382"
                     /note="NADH-Ubiquinone/plastoquinone (complex I), various
                     chains; Region: Oxidored_q1; pfam00361"
                     /db_xref="CDD:201180"
     gene            complement(416387..416755)
                     /locus_tag="ABZJ_00383"
                     /db_xref="GeneID:12115475"
     CDS             complement(416387..416755)
                     /locus_tag="ABZJ_00383"
                     /codon_start=1
                     /transl_table=11
                     /product="multisubunit Na+/H+ antiporter subunit MnhC"
                     /protein_id="YP_005524339.1"
                     /db_xref="GI:384141629"
                     /db_xref="GeneID:12115475"
                     /translation="MISLEFLLATAIGLLVATGIYLILRARTFPVVLGLAVLGYAVNL
                     FLFAMGRLQVSSPAILTETTNITDPLPQALVLTAIVIGFATTAFIVQLALRSRYESGS
                     DHVDAKEDISPTYDPREDEP"
     misc_feature    complement(416420..416746)
                     /locus_tag="ABZJ_00383"
                     /note="putative monovalent cation/H+ antiporter subunit C;
                     Reviewed; Region: PRK09094"
                     /db_xref="CDD:236377"
     gene            complement(416752..419601)
                     /locus_tag="ABZJ_00384"
                     /db_xref="GeneID:12116124"
     CDS             complement(416752..419601)
                     /locus_tag="ABZJ_00384"
                     /codon_start=1
                     /transl_table=11
                     /product="putative monovalent cation/H+ antiporter subunit
                     A"
                     /protein_id="YP_005524340.1"
                     /db_xref="GI:384141630"
                     /db_xref="GeneID:12116124"
                     /translation="MDTSVLPIIILLPLILGTTLVSLLQRFSRGVTALGAIGVSLTSF
                     GLLLTQAKTVLGGASIQQSWDWLPQLGINLSFRLDALGLLFSLLITGIGTLIYIYAYY
                     YLGPKNSLSKLYLLLMLFMAAMLGISLSNNLIILLVFWELTSISSFLLVGYWSHYEAA
                     QRGSRMALTITGMGGLAMLGGFVLLGQITGTYEINDIVGMKDLIQSHYLFVPTLLLIL
                     LGAFTKSAQFPFHFWLPNAMAAPTPVSAYLHSATMVKAGIFLLARLAPIFIGAALYHN
                     IVTFVGLFTLCMAACFAIFKEDLKGLLAYSTISHLGLIVCLLGIGSPLAVAAAIFHII
                     NHATFKAALFMIAGIIDHETGTRDLRKLSGIWQLLPFTATLTMITAASMAGVPLTNGF
                     ISKEMFFTELLASLSGSTVIFASIIATLAGIFAVSYSIRLVHGVFFDGPVGKQVPNKN
                     AHEPPIGMRAPAILLATLCILVGIFPALLVEPLVNSVTRASLMQPDFAGTHLAIWHGF
                     NAPLIMSIIALVGGTLFYFALAKDGMIRKIDLDPRLGRLQGRILFDLFLKHLLLTSRK
                     IKQKTENGSLQSYLFLIIAFSIVMVTLPLFNQGLTTGTRELTHAPWIAVVLWLTLFSG
                     CWMMLWFHHERIKAVLISGAIGLVVTMVFVTMSAPDLALTQITVDVVTTVLLLMSLSL
                     LPQLTPYESRRSRRWRDAALAIIGGLGIGWITWLILTRDHNSISWFFAQQSLPLGGGS
                     NIVNVILVDFRGFDTFGEITVLGIAAIGALCLMDGMRVHGTTMTQGLTYRFNPSPLMF
                     RITASWVLPLALVVSVYIFMRGHNYPGGGFIAGLITSMALIIQYIALGQDQAEQMLKA
                     QSGRLYEIWIGSGLTIAGLTGIAAWFWARPFLTSAHVYVELPVLGKLHLASAASFDLG
                     VYITVVGATMLLISVLGDSRHSSMSGPVPHGEKSS"
     misc_feature    complement(416755..419553)
                     /locus_tag="ABZJ_00384"
                     /note="putative monovalent cation/H+ antiporter subunit A;
                     Reviewed; Region: PRK12648"
                     /db_xref="CDD:237157"
     misc_feature    complement(418405..419214)
                     /locus_tag="ABZJ_00384"
                     /note="NADH-Ubiquinone/plastoquinone (complex I), various
                     chains; Region: Oxidored_q1; pfam00361"
                     /db_xref="CDD:201180"
     misc_feature    complement(417271..417711)
                     /locus_tag="ABZJ_00384"
                     /note="Multisubunit Na+/H+ antiporter, MnhB subunit
                     [Inorganic ion transport and metabolism]; Region: MnhB;
                     COG2111"
                     /db_xref="CDD:225022"
     misc_feature    complement(416803..417219)
                     /locus_tag="ABZJ_00384"
                     /note="Domain of unknown function (DUF4040); Region:
                     DUF4040; cl00676"
                     /db_xref="CDD:260566"
     gene            complement(419916..421298)
                     /locus_tag="ABZJ_00385"
                     /db_xref="GeneID:12116125"
     CDS             complement(419916..421298)
                     /locus_tag="ABZJ_00385"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_005524341.1"
                     /db_xref="GI:384141631"
                     /db_xref="GeneID:12116125"
                     /translation="MKLESIQFKHIALFHDLKIQFQYDKQPITLILGEQATGKSMLLK
                     HIYHALTWFPARLKDARTPGIVMPDQDISHSRLQSKIEVSIQIPPEFGQLPETASTQQ
                     TDTSLCSWKLFKTLNSSGVGISQVETQQLDQTITLYHQVTRKDPLQGLPLLAYYPSER
                     FVNDINLLNKNLPGITQSISAYDISFIPFTTFARFFEWLREISDIENAQAAHVVQRII
                     SKQSNSQDQEEILRQLQLELAGHPKQLPSPNLYALKSTLKIIFPELEDFYLQYHPKLQ
                     LMAHYKGEVLAFQQLSNTTKTWIALVGDVVRRLCLLNPLSLDPCLEGEGVLLIDQIDS
                     QLDAAHCSEILNRLHRAFPRLQIIVTGSREELLEHAAVYQCFKLEHGKISPLDLSTTQ
                     QQLEHLYTLLQRDEALTPHIDPLPLDTEPATTQIDSLYQQIQNLNEQQKNELLRMIHA
                     GDTSEETSSL"
     misc_feature    complement(420678..421286)
                     /locus_tag="ABZJ_00385"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:257800"
     gene            complement(421322..422824)
                     /locus_tag="ABZJ_00386"
                     /db_xref="GeneID:12116126"
     CDS             complement(421322..422824)
                     /locus_tag="ABZJ_00386"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA helicase"
                     /protein_id="YP_005524342.1"
                     /db_xref="GI:384141632"
                     /db_xref="GeneID:12116126"
                     /translation="MSNIEKPKATYEQAIAIDNARLGQSFKVIAYAGTGKTTTLQMIS
                     DAMPERRGMYLAFNKAIAGEAQNKFHRNVDCRTFHSLAFRSVPRGVTDKLRLPRLSPS
                     FIAKEYRLEPITLRRMMGGRYEKYVLMPSRLASLVANAVSYFCSTSSQYPAPRHIQAP
                     NWLHPDDITALQTHLYPAVERRWLESIDPNHQAGIGHDIYLKLWALSEPNIPADYVLF
                     DEAQDADPLMLGILLRQKSTQVIYVGDAHQQIYAWRGAVNAMQQLPLPESRLTTSFRF
                     GEAIADVANALLGGLNETVPLLGNPNQKSSVVNKPHTKMRDAILCRTNARAMELLLAG
                     LVHGDKVSLQADHQKLNRFVDAASLLKQGKRVTDVPELAWFNSWHDVHEYCETNEGSD
                     IKPLVKLVDDHGTDPLKKALAKITPLEQADYVISTAHKAKGLEWNRVHIEDDYQFKIN
                     GLEHKITDEELRLLYVACTRAKVSLNIHHLYDLIQQLKLRAPLSLRQSVG"
     misc_feature    complement(421394..>422185)
                     /locus_tag="ABZJ_00386"
                     /note="Superfamily I DNA and RNA helicases [DNA
                     replication, recombination, and repair]; Region: UvrD;
                     COG0210"
                     /db_xref="CDD:223288"
     misc_feature    complement(421394..>421555)
                     /locus_tag="ABZJ_00386"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            complement(422834..423607)
                     /locus_tag="ABZJ_00387"
                     /db_xref="GeneID:12116127"
     CDS             complement(422834..423607)
                     /locus_tag="ABZJ_00387"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein GlmU"
                     /protein_id="YP_005524343.1"
                     /db_xref="GI:384141633"
                     /db_xref="GeneID:12116127"
                     /translation="MNNTQWLDEVKFNEQGLIPAIAQHHQTGRILMVAWMNRESLALT
                     AEKNQAVYFSRSRQKLWHKGEESGHFQTVYEIRLDCDGDVIVLQVEQHGGIACHTGRE
                     SCFYRKLTPQGWEIVDAQLKDPTAIYGDKAKAESHDHAHTTEQVDVLAHLGQLMQERK
                     QAEADTSYVASLYKKGINKILEKVGEEGVETIIAAKDYAAQNTESNLNDLIYETADLW
                     FHSIVMLGYFDLNPQLIIDELGRRQGLSGLVEKANRNKV"
     misc_feature    complement(422882..423601)
                     /locus_tag="ABZJ_00387"
                     /note="bifunctional phosphoribosyl-AMP
                     cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein;
                     Reviewed; Region: PRK02759"
                     /db_xref="CDD:235067"
     misc_feature    complement(423221..423592)
                     /locus_tag="ABZJ_00387"
                     /note="phosphoribosyl-AMP cyclohydrolase; Reviewed;
                     Region: hisI; PRK00051"
                     /db_xref="CDD:234598"
     misc_feature    complement(422891..423163)
                     /locus_tag="ABZJ_00387"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) MazG-like domain found in Escherichia coli
                     phosphoribosyl-ATP pyrophosphohydrolase (HisIE or
                     PRATP-PH) and its homologs; Region: NTP-PPase_HisIE_like;
                     cd11534"
                     /db_xref="CDD:212141"
     misc_feature    complement(order(422960..422962,422969..422971,
                     423038..423040,423047..423049))
                     /locus_tag="ABZJ_00387"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212141"
     gene            complement(423761..425074)
                     /locus_tag="ABZJ_00388"
                     /db_xref="GeneID:12116128"
     CDS             complement(423761..425074)
                     /locus_tag="ABZJ_00388"
                     /codon_start=1
                     /transl_table=11
                     /product="2-polyprenyl-6-methoxyphenol hydroxylase"
                     /protein_id="YP_005524344.1"
                     /db_xref="GI:384141634"
                     /db_xref="GeneID:12116128"
                     /translation="MKTPHFAIIGAGTAGLATAILLAREGNHVTIFEQVDELSPVGAG
                     LLLQPAGLAVFEHLGVLDKALTLGAKVTGLEGQLPDKRLLVNSHYREASTNLYGLGIH
                     RATLCHVLTQKLNEYSSQITWYMNHSVERFEEHNDEVQIFGSHQNQKFDACFDGLLIA
                     NGARSQLRPKAWVKVNKAYPWGAAWSIVPECQVLDPEILHQFYDRSKIMMGILPTGAI
                     PTEPQQRLSSVFWSLPTPQLQSFLQDEQAKQAWLKQVSERWPKVAEWLKEILYNCQTQ
                     PKWLSANYRDVVMTQFGQGRIGVIGDAAHAMSPQLGQGANMALLDAWAFSQSLRQAQK
                     NQNIDWPLLWQHYHQFRGSSTQFYQFLSRLLTPLYQSDHWWAGGLRDLVFPWMYQIPY
                     FRKEMAITISGLKTGPFRHLEYDQVAQLPKESSTFHLKSESLADF"
     misc_feature    complement(423860..425056)
                     /locus_tag="ABZJ_00388"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases [Coenzyme metabolism
                     / Energy production and conversion]; Region: UbiH;
                     COG0654"
                     /db_xref="CDD:223727"
     misc_feature    complement(423902..425056)
                     /locus_tag="ABZJ_00388"
                     /note="Short-chain dehydrogenases/reductases (SDR);
                     Region: SDR; cl21454"
                     /db_xref="CDD:271874"
     gene            complement(425199..426818)
                     /locus_tag="ABZJ_00389"
                     /db_xref="GeneID:12116129"
     CDS             complement(425199..426818)
                     /locus_tag="ABZJ_00389"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone biosynthetic 2-octaprenylphenol
                     hydroxylase"
                     /protein_id="YP_005524345.1"
                     /db_xref="GI:384141635"
                     /db_xref="GeneID:12116129"
                     /translation="MIPHVSRLLELWRIAAHYRLDTLFPADELPVKAKHALNIIKMHP
                     AAWSSRERKNPLKLKEALEDMGPLAIKLGQLLSTRRDLIPPEILAQLVLLQDQVKPFD
                     GEVAKQRIQDSLKADVNTLFARFDDQPLAAASIAQVHTAALHDGREVVVKVTRPDIRS
                     QILQDFEILAWLGNTLESRLEAARALHLSEIIQDYRQIILNELDLSIEADNTRRMRHY
                     FTGSTMMYVPEVYMDTKDVMVAERITGVPISDTATFDRLGMDRAQLAEKGLTIFFTQV
                     FRDNFFHADMHPGNVFVETINPSNPRFIALDCAIMGELSKHDQMTVARMLLAVMNSNF
                     MQLIQIVHQAGWIPPGTDQDALAREMRRTVGPMVSKPMDQLDFAGILIQVMDIARRFH
                     LEIPPQLMLLLKTLVHVEGLGTDLYPQLDIWKLAKPILTEWVKSNMNPVKNVKELGQQ
                     LPDLLLGAQDFPSLIIDSLNGLKNQSAWQDRQLREIQQLRLQMEHQQRRSWMFGSTML
                     ILLTIAIISPWFVSIILIVLSSLLALWRVLK"
     misc_feature    complement(425211..426803)
                     /locus_tag="ABZJ_00389"
                     /note="Catalytic domain of the Protein Kinase superfamily;
                     Region: PKc_like; cl21453"
                     /db_xref="CDD:271873"
     misc_feature    complement(425499..426800)
                     /locus_tag="ABZJ_00389"
                     /note="2-polyprenylphenol 6-hydroxylase; Region: UbiB;
                     TIGR01982"
                     /db_xref="CDD:233667"
     misc_feature    complement(order(425898..425903,425943..425945,
                     425949..425954,425964..425966,426090..426101,
                     426150..426152,426336..426338,426342..426344,
                     426372..426374,426378..426392))
                     /locus_tag="ABZJ_00389"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270870"
     gene            complement(426831..427499)
                     /locus_tag="ABZJ_00390"
                     /db_xref="GeneID:12116130"
     CDS             complement(426831..427499)
                     /locus_tag="ABZJ_00390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524346.1"
                     /db_xref="GI:384141636"
                     /db_xref="GeneID:12116130"
                     /translation="MWSILALGAVERIIHHLIDLDALTRIQLNQLQGKMLRVIIDSPQ
                     LSVDVFFDQEKVRLEPTVTGHSEKPSIFEQRPFDPQFKISEATATLHVKDVVELIKLL
                     LSDPDQIGNIPLQGDYHLLQDIQKIMQQAEPDLAAHLSKWVGPQLAHEIGKIQLAPKH
                     LKRSLQSHLFFAEDALKEDSGLFAPRWEMDDLNQATRKLNQDIDRLEAKLQQLNAQLQ
                     PTQD"
     misc_feature    complement(426843..427487)
                     /locus_tag="ABZJ_00390"
                     /note="SCP-2 sterol transfer family; Region: SCP2;
                     cl01225"
                     /db_xref="CDD:271549"
     gene            complement(427511..428458)
                     /locus_tag="ABZJ_00391"
                     /db_xref="GeneID:12116131"
     CDS             complement(427511..428458)
                     /locus_tag="ABZJ_00391"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine: 2-DMK methyltransferase
                     and 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase"
                     /protein_id="YP_005524347.1"
                     /db_xref="GI:384141637"
                     /db_xref="GeneID:12116131"
                     /translation="MSNENQKPTSPTEQAQSSDKVSPFLSSPLPQGTPQGQQQSLQQT
                     LTDTPVSGSVPKYNLPRGAGNTGNVGETTHFGYSTVRTEDKAQKVAEVFHSVASKYDL
                     MNDLMSFGIHRLWKRFAINMSGVRRGQHVLDIAGGTGDLAKVFSREVGPQGHVVLSDI
                     NESMLNVGRDRLIDAGCTNVDFVLANAETLEPFADNSFDLVTISFGLRNVTDKDAALA
                     SMFRVLKPGGRLLVLEFSKPVFEPFSKLYDLYSFTALPIMGKLVANDSESYKYLAESI
                     RMHPDQRTLKGMMENAGFQNCDYHNLTGGIVAVHRGFKL"
     misc_feature    complement(<427943..428245)
                     /locus_tag="ABZJ_00391"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:271798"
     misc_feature    complement(427514..428230)
                     /locus_tag="ABZJ_00391"
                     /note="Methylase involved in ubiquinone/menaquinone
                     biosynthesis [Coenzyme metabolism]; Region: UbiE; COG2226"
                     /db_xref="CDD:225136"
     misc_feature    complement(427763..428068)
                     /locus_tag="ABZJ_00391"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(427850..427852,427898..427906,
                     427979..427984,428039..428059))
                     /locus_tag="ABZJ_00391"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     misc_feature    complement(427535..>427885)
                     /locus_tag="ABZJ_00391"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:271798"
     gene            complement(428607..429314)
                     /locus_tag="ABZJ_00392"
                     /db_xref="GeneID:12116132"
     CDS             complement(428607..429314)
                     /locus_tag="ABZJ_00392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524348.1"
                     /db_xref="GI:384141638"
                     /db_xref="GeneID:12116132"
                     /translation="MSKLAAFDELLQQYKTFNYHDNPVLAQRLQDVQTWLKERMKETH
                     HDFFNLPEHKLMAQYFLNRLYGGPEFDALAAQIERLLKYAHKAEKVLPENAIKTGTKS
                     VSLAVLATQLDEQVAMQLLEDYPADTVLTDEIMRLTLIKLDQAEARYQQLALLDDLGA
                     ALDKYMRSFMMFTAFKMCKGIAQKYHFELMYDFIQDGFSAMKPLKSAEAFIKTFTEKE
                     RQIVEKVHSGHPNPFRV"
     gene            429522..430940
                     /locus_tag="ABZJ_00393"
                     /db_xref="GeneID:12116133"
     CDS             429522..430940
                     /locus_tag="ABZJ_00393"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524349.1"
                     /db_xref="GI:384141639"
                     /db_xref="GeneID:12116133"
                     /translation="MSEQQPKFEIRDEEQLSVDLIEAQYALKESRGKPNAKSTLILMS
                     GIELAGKGEAVKQLREWLDPRYLRVKADAPRVLTDSEAFWQSYSAFIPTEGQIVVMFG
                     NWYSDLLVTATHVSEPLDDARFDAYVENMRAFEQDLKNNYVDVIKVWFDLSWKSLQKR
                     LDKIDPSEQHWHKLHGLDWRNKKQYDTLQKLRRRFTDDWYIIDGEDEKQRDQFFAQYL
                     LQHMRQLPEHETEVKGKWQQAKIPESLLKPAQEKMDKAEYKKELDKLSKKIADNMRFD
                     KRNVVIAFEGMDAAGKGGAIKRIVKNLDPREYDIHCIGAPERFEARHPYLWRFWNRIN
                     EAEKITIFDRTWYGRVLVERVEGFASPIEWQRAYDEINRFEKDLFDSQTIVVKIWLAI
                     SKDEQEQRFKAREETPHKRFKITAEDWRNRDKWDDYLKAAADMLERTSTEYAPWYIVA
                     TDDKYTARLEVLRAILKQLRAD"
     misc_feature    429552..430187
                     /locus_tag="ABZJ_00393"
                     /note="Polyphosphate kinase 2 (PPK2); Region: PPK2;
                     cl11971"
                     /db_xref="CDD:245821"
     misc_feature    429558..430934
                     /locus_tag="ABZJ_00393"
                     /note="polyphosphate:AMP phosphotransferase; Region:
                     poly_P_AMP_trns; TIGR03708"
                     /db_xref="CDD:234321"
     misc_feature    430260..430928
                     /locus_tag="ABZJ_00393"
                     /note="Polyphosphate kinase 2 (PPK2); Region: PPK2;
                     cl11971"
                     /db_xref="CDD:245821"
     gene            complement(430963..431469)
                     /locus_tag="ABZJ_00394"
                     /db_xref="GeneID:12116134"
     CDS             complement(430963..431469)
                     /locus_tag="ABZJ_00394"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524350.1"
                     /db_xref="GI:384141640"
                     /db_xref="GeneID:12116134"
                     /translation="MKIDNIPDYIDPSLNLEQIRDECQELIQKRAYVSAGAAIVPIPF
                     FDVVVDLGILSQLIPDINSRFGLAPEHVSVYDPKTKTIHWDELRKRGFQFSGFVVART
                     TVKKTFNGFFGKIVTKQVTKFVPLGGQLVAASLGYFMMKKIAQTHLNDSYNLAKRIQQ
                     KSRGTVVN"
     misc_feature    complement(<431020..431406)
                     /locus_tag="ABZJ_00394"
                     /note="Domain of unknown function (DUF697); Region:
                     DUF697; cl12064"
                     /db_xref="CDD:271742"
     gene            431641..435276
                     /locus_tag="ABZJ_00395"
                     /db_xref="GeneID:12116135"
     CDS             431641..435276
                     /locus_tag="ABZJ_00395"
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease V (RecBCD complex) subunit gamma"
                     /protein_id="YP_005524351.1"
                     /db_xref="GI:384141641"
                     /db_xref="GeneID:12116135"
                     /translation="MGIHVIQSQRIDVLLQGVLASTSQPSTHPLQVLKAQHFIVPSPA
                     IEQWLIQKLAEQQGMSANYQFHQRVRGFQWYAYQQVLTAHKEQVRKANIPRLIFKWRV
                     HQALQEFIQPDVMSIDSSHPLHSIVQRIYDSADRLEQGIEKQLKKQKMLYWVAEQVAD
                     LFSNYMVYRGQCQRGCENMCTCPNNWLAAWGQGRSLDIEKYIAHKDKEVSAFTLQQTQ
                     ELERWQRWLWQQHFHEDFMQMQQIDELFWQELEHPERQKKALSRLPQQIVIFTLLDLP
                     PSQLQFLRRLGQYIDVLILHYNPSQEYWADSVDPLWKQRYDLGVKERFIAKNPQATDA
                     EIADFFNKFTLNFNAEARESRHPLLTRLGKQARDHFSLLSNLSTGEEGKWVDAFVDDF
                     PESLLGKVQSDILHLVEPQAKQYELAPNDDSIQIHVCHSTLRQLEVLKEQLIGWLAKP
                     HEQPRRPNDILVLVPNLAEVEPLIRSVFPATATEQGVHLPVKIAGIASLDALNAWRAV
                     IGRIHLMQGRFSFDEFADWLGLHATQQRYALEYAQVERILNLLADAGFKRGLDAEHLK
                     RSLCDGDDDYRYSFKFALERLALGIAIPEHATFNQVLSYAKVQPGDFELIGTLIQIYQ
                     DLNERRDWLIMHEQKKSHTVEYWLQTLSQDIIEFEQAGVTALKTAREIVKKQERMLTL
                     ASYYAETETGTLRKITLPLPYILDEIQRTLENQTAQAEPTGQITFAQIGQIRPLPYRL
                     IVMLNLDAGQFPNRDTHVPFDLMDALRQQLGDRSRLEDDQGAFLDALLLAQENLWLFY
                     NGFDVNDGEVRDPSSILQEFREHLALIVKPEPNAPDREVIEGIEIPTQLKQLYHLHYL
                     QPFDPKGFMAENRYIRYQDHWFNVAMQIQQASGVLKPWANISYPLEIPDMLVLDSHQW
                     IQDVTFPARLYLKTLGVENLGNVSVLDQNEPLLLDGLGRYTIRHFLQQNEQQAQPEVL
                     LDQLPVGKVQYSAWQQGIFEQECLLERLHHYAPAVTQTTQRVWRIAKQLHMNITVPKS
                     ETQDWVSMEASSARAKRRAKVWLEYLLWLAYLNEGSAGTERRRIVVFSDQTVICKGIS
                     SEQARQYLQPWFKIWRYAQQQPLVLPAALLLKPLEKAKAYQWETTNPTEKIKLDEKSY
                     AELLKYWNETGTFTSIDMTQNEACKLHQDWRFILQEQDAQALLQHACDEFAYDLYHPV
                     FQFQHSE"
     misc_feature    431647..434370
                     /locus_tag="ABZJ_00395"
                     /note="Exodeoxyribonuclease V, gamma subunit; Region:
                     Exonuc_V_gamma; pfam04257"
                     /db_xref="CDD:252486"
     misc_feature    431650..434967
                     /locus_tag="ABZJ_00395"
                     /note="exodeoxyribonuclease V, gamma subunit; Region:
                     recC; TIGR01450"
                     /db_xref="CDD:233419"
     gene            435280..438978
                     /locus_tag="ABZJ_00396"
                     /db_xref="GeneID:12116136"
     CDS             435280..438978
                     /locus_tag="ABZJ_00396"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent exonuclease V subunit beta"
                     /protein_id="YP_005524352.1"
                     /db_xref="GI:384141642"
                     /db_xref="GeneID:12116136"
                     /translation="MNSRVQVSYQPIIDIEFSGLHLIEASAGTGKTYTLSSLMVRIFL
                     EKYLPGQVIATTFTRAAAAELKSRIRARLVETHRYLDAKRSLTEKEILLQAEQESDLL
                     LQHILKHFATRIAYACERLKLVIDQLDELFVGTLDSFSQKLLREFAFESGKIERAQIT
                     DDAKTYSRQLIHDVLREWIQSQPQTVIDALYLAGELKSVDSFVKLVEDSLNFSSAHFK
                     LPEKPTIQFEQLAQLKQLAAEIDISLLEPYYSLDGDHYKHVSGTIFRNGAFNKLFSEC
                     LPQLLQVLKQSDSILVFDGSLAIQRELVFKFLGQLADQKVFKKCPAEISDGFYQHPCI
                     QQIQQLFGVLKNYAEQFDQLHIYLKAYLCIEVKKRLPQVLQNKGETTFSQQIRTLSEA
                     LKGEQGQRFAVFVQARYPLILVDEFQDTNQDQDDMLASIWRHPERYQKGCMIMVGDRK
                     QAIYGFRGGDMLTFLNAYKDIQAKHGREYKLIHNHRSVADLVEVVDALFQRQIDFGEQ
                     VQYDPIRAGTRPHPVLIDQNQPNPHPLRWLMLKDKETEAQQVAWKIRDLLNQSHAGQL
                     YFQKDAQTQTLNEDDIAVLSRNHDGLDKVQFELERLGIRVNRPSKRSVFDCTIAQDVG
                     ALLTAILHPYDEAKVKRALISRLFAMDLKQLLQLEQTAEGLSQFMTGFDTIRELWSAQ
                     GFLVAWQQCLNQFGIWKNLVAVQSKDNERVVVNLRHLTEILSQHSEKYQGAQNLYHWY
                     LKQLQSPLDREWELERRLSSEAGVQLMTIHQSKGLEFKIVFLLGADKPFRENNKTLNF
                     STQDITVSESAQTLTQRVVAIADKTYLNENELKQHEERALAEQNRLWYVALTRASHRV
                     YALLQDTDGKSVSGLAFWKNRAEPFQHRCCTDEIILEQPPAARHLNQHINIIEIQAQH
                     FPDQRFYSRGKTSFSYLAQHLRHKVGTDLLASQSHEAVLAEDELDQVISVEAPAAQPI
                     SWIKSNFPRGTLAGNFLHEIFEHIDFQCSDEWVSEIRRRFKNDYSSLWQDLLIKYQES
                     FPEEQEAEYSLYHAVAEWLQEILSTPLYQGFRLNRLQPEHYLSECPFYLALSDRVLAM
                     KRIQQLFAEYGMEMPELLEARSARYLNGSIDLVYFDGQRYHIADYKSNYLGENLADYS
                     VESIAQSMSLASYWLQAGLYLVALHRYLKVKMQNYDIEQHLGGATYLYLRGMNGEAEQ
                     GYYYWQPSTEFVLRLDAILGYFAEDKIA"
     misc_feature    435313..438948
                     /locus_tag="ABZJ_00396"
                     /note="exodeoxyribonuclease V, beta subunit; Region: recB;
                     TIGR00609"
                     /db_xref="CDD:233050"
     misc_feature    437434..437850
                     /locus_tag="ABZJ_00396"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; cl21743"
                     /db_xref="CDD:272163"
     gene            439075..440838
                     /locus_tag="ABZJ_00397"
                     /db_xref="GeneID:12116137"
     CDS             439075..440838
                     /locus_tag="ABZJ_00397"
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease V subunit alpha"
                     /protein_id="YP_005524353.1"
                     /db_xref="GI:384141643"
                     /db_xref="GeneID:12116137"
                     /translation="MDKCVDNLNSPEQSDLSWLTTWSTFLNQAPFTAQTQAPEAAYFL
                     QQLIEASLQGDSCIEISPEQIETLGQLVISAEQAKSQVAPCVHDEQGLALYRYWNLEQ
                     RLAEQIRRLKQQPIQPVSCEEHLDLLTDPHQQAALQMVTRQSLSIITGGPGTGKTYTL
                     ARIIAVLSQAIPHIRVAMAAPTGKAAQRMQEALQNSFNDPKLLESGLISAELRNQSTQ
                     TIHRLLGMGHSQTPRFNQKQPLPYDVIVVDEASMLDLNLATLLFEAVPESCRIILLGD
                     ANQLASVDVGAVLADLQQIEALSENRVHLQTSRRFAEGALIGQVARFIQMQTSQINHE
                     QILQKFEIDIVQVSELRSIPLETDMPDVVQLEYLPEESPIALETYYQKLMVDFQGYVQ
                     SLKAYIQDDRSLEHIENIVRSFDDYRILTAVRHGPFGLQQLNQYAERWLQQQLGIVTL
                     GGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQPQQFEVYFPSLNKWVAANRLPKSI
                     QSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELIYTAITRAKKVVSLLVDPEALLQ
                     SFTVRTTRKSGLVEKVNRLVR"
     misc_feature    439462..439914
                     /locus_tag="ABZJ_00397"
                     /note="AAA domain; Region: AAA_11; pfam13086"
                     /db_xref="CDD:257489"
     misc_feature    439513..439896
                     /locus_tag="ABZJ_00397"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    439531..439545
                     /locus_tag="ABZJ_00397"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    439816..439824
                     /locus_tag="ABZJ_00397"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    440431..440748
                     /locus_tag="ABZJ_00397"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            complement(441555..442853)
                     /locus_tag="ABZJ_00398"
                     /db_xref="GeneID:12116138"
     CDS             complement(441555..442853)
                     /locus_tag="ABZJ_00398"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-lactamase class C"
                     /protein_id="YP_005524354.1"
                     /db_xref="GI:384141644"
                     /db_xref="GeneID:12116138"
                     /translation="MKIFSTNTCPVPNDLESVIHHKDEVPAELGGMSEQQVQKIWKSI
                     ESLYKTGNYPLITFCLRRQGKILLNRSIGYAQGNSPAGLQENALIATPDTPVCLFSAS
                     KMITAMLIHLLDEKGEINLLDPVSYYIPEYGVNGKRRATIFHLLSHRGGIPYVDGDVT
                     PELLFDKDEILRRLYAARPVSPAGNHLAYHAVTAGYILGEIIERVTGQDLRQFVHETI
                     EKPMDMPYFNYGLKPEYRAEVALNCATGLHPRLGTDHYLNHVLGGGLQLAVDVTNDSR
                     FMDTICPAGNIYTSAEQAGRFFEMLLSGGSYQGKQILSEKTIFRATLPTTGVNIDRTL
                     LIPMRYALGPMLGSNPVGLFGPMTGQAFGHLGFSNILCWADPERDISVSLLTTGKSVV
                     GTHLPALANLLYQISTQCPRIPRDQRRSLFGSDSHETDLV"
     misc_feature    complement(441690..442724)
                     /locus_tag="ABZJ_00398"
                     /note="Beta-lactamase; Region: Beta-lactamase; pfam00144"
                     /db_xref="CDD:249626"
     gene            complement(442881..443030)
                     /locus_tag="ABZJ_00399"
                     /db_xref="GeneID:12116139"
     CDS             complement(442881..443030)
                     /locus_tag="ABZJ_00399"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524355.1"
                     /db_xref="GI:384141645"
                     /db_xref="GeneID:12116139"
                     /translation="MNQLSATDCRASLQQVAYFKVSIYGLQNCFLLPVILDTDISFLT
                     LHTWP"
     gene            443066..443335
                     /locus_tag="ABZJ_00400"
                     /db_xref="GeneID:12116140"
     CDS             443066..443335
                     /locus_tag="ABZJ_00400"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="YP_005524356.1"
                     /db_xref="GI:384141646"
                     /db_xref="GeneID:12116140"
                     /translation="MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFK
                     AHKHDHHSRRGLIRMVNQRRKLLDYLNGKDHERYTALIGALGLRR"
     misc_feature    443087..443323
                     /locus_tag="ABZJ_00400"
                     /note="Ribosomal protein S15 (prokaryotic)_S13
                     (eukaryotic) binds the central domain of 16S rRNA and is
                     required for assembly of the small ribosomal subunit and
                     for intersubunit association, thus representing a key
                     element in the assembly of the whole ribosome; Region:
                     Ribosomal_S15p_S13e; cd00353"
                     /db_xref="CDD:238213"
     misc_feature    order(443087..443089,443138..443140,443147..443149,
                     443168..443170,443180..443182,443189..443191,
                     443201..443203,443207..443212,443216..443221,
                     443258..443260,443270..443272)
                     /locus_tag="ABZJ_00400"
                     /note="16S/18S rRNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    order(443153..443155,443162..443167,443174..443176,
                     443183..443185,443303..443305,443315..443317)
                     /locus_tag="ABZJ_00400"
                     /note="S13e-L30e interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    order(443243..443245,443255..443257,443318..443323)
                     /locus_tag="ABZJ_00400"
                     /note="25S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238213"
     gene            443587..445680
                     /locus_tag="ABZJ_00401"
                     /db_xref="GeneID:12116141"
     CDS             443587..445680
                     /locus_tag="ABZJ_00401"
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase
                     (polynucleotide phosphorylase) (PNPase)"
                     /protein_id="YP_005524357.1"
                     /db_xref="GI:384141647"
                     /db_xref="GeneID:12116141"
                     /translation="MSMFNIVRKEFQFGQHQVVLETGRVARQANTVLITMGGVTVLVA
                     VVAAPTAKAGQDFFPLTVNYQEKQYAAGRIPGGYGKREGRASEAETLISRLIDRPIRP
                     LFPEGYYNEIQVTATVVSSDKTMEADIAAMLGTSAALAIAGTPFRGPIGAARVGLING
                     EYVLNPNFEQMAQSDLDLVVAGTESAVLMVESEAKELSEDQMLGAVLFGHDEMQIAIQ
                     AINEFAAAAGAKPSDWVAPAHNEELRAKLKEAFEAKISEAYTIAVKQDRYAALDALHA
                     EAVAQFVPEEDVDGIADEVDYLFEDLKYRTVRDNILSGKPRIDGRDTKTVRALDVQVG
                     VLERAHGSALFTRGETQALVTTTLGNTRDALMVDTLAGTKTDNFMLHYNFPAYSVGET
                     GRESGPKRREIGHGRLARRGVQAVLPAADRFPYVIRIVSDITESNGSSSMASVCGASL
                     SLMDAGVPLKAPVAGIAMGLVKEGERFAVLSDILGDEDHLGDMDFKVAGSANGITALQ
                     MDIKIEGITEEIMEVALNQAFAGRMHILNEMNKVISRARPEISMHAPTFEVITINPDK
                     IRDVIGKGGATIRQITEETKAAIDIEDNGTVRVFGETKAAAKAAIAKIQAITAEVEPG
                     KIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEGQEVKVQVQDVD
                     NRGRIKLTMKDIEQA"
     misc_feature    443593..445671
                     /locus_tag="ABZJ_00401"
                     /note="polynucleotide phosphorylase/polyadenylase;
                     Provisional; Region: PRK11824"
                     /db_xref="CDD:236995"
     misc_feature    443608..444288
                     /locus_tag="ABZJ_00401"
                     /note="Polyribonucleotide nucleotidyltransferase, repeat
                     1; Region: RNase_PH_PNPase_1; cd11363"
                     /db_xref="CDD:206768"
     misc_feature    order(443608..443610,443614..443616,443641..443643,
                     443647..443649,443656..443658,443683..443685,
                     443689..443691,443695..443697,443704..443706)
                     /locus_tag="ABZJ_00401"
                     /note="RNase E interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206768"
     misc_feature    order(443656..443673,443683..443685,443710..443712,
                     443716..443718,443722..443724,443728..443730,
                     443773..443775,443779..443781,443785..443796,
                     443800..443811,443818..443832,443842..443844,
                     443917..443919,443923..443925,443929..443931,
                     443941..443955)
                     /locus_tag="ABZJ_00401"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206768"
     misc_feature    444310..444552
                     /locus_tag="ABZJ_00401"
                     /note="Polyribonucleotide nucleotidyltransferase, RNA
                     binding domain; Region: PNPase; pfam03726"
                     /db_xref="CDD:252128"
     misc_feature    444559..445218
                     /locus_tag="ABZJ_00401"
                     /note="Polyribonucleotide nucleotidyltransferase, repeat
                     2; Region: RNase_PH_PNPase_2; cd11364"
                     /db_xref="CDD:206769"
     misc_feature    order(444559..444588,444595..444597,445174..445176,
                     445186..445188,445198..445200,445210..445215)
                     /locus_tag="ABZJ_00401"
                     /note="RNase E interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206769"
     misc_feature    order(444574..444576,444580..444582,444592..444606,
                     444628..444633,444643..444645,444649..444651,
                     444655..444663,444673..444681,444727..444729,
                     444733..444735,444742..444753,444757..444765,
                     444772..444774,444778..444780,444868..444870,
                     444874..444876,444880..444882,444886..444894)
                     /locus_tag="ABZJ_00401"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206769"
     misc_feature    order(444730..444732,444736..444738,444787..444789,
                     444799..444801,444901..444909,445048..445050,
                     445066..445068,445072..445074,445108..445110,
                     445114..445116)
                     /locus_tag="ABZJ_00401"
                     /note="active site"
                     /db_xref="CDD:206769"
     misc_feature    445249..>445389
                     /locus_tag="ABZJ_00401"
                     /note="Polynucleotide phosphorylase (PNPase) K homology
                     RNA-binding domain (KH). PNPase is a polyribonucleotide
                     nucleotidyl transferase that degrades mRNA in prokaryotes
                     and plant chloroplasts. The C-terminal region of PNPase
                     contains domains homologous to...; Region: PNPase_KH;
                     cd02393"
                     /db_xref="CDD:239086"
     misc_feature    order(445279..445281,445285..445293,445297..445311,
                     445318..445323,445330..445335,445348..445359)
                     /locus_tag="ABZJ_00401"
                     /note="putative nucleic acid binding region [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239086"
     misc_feature    445300..445311
                     /locus_tag="ABZJ_00401"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239086"
     misc_feature    445456..445659
                     /locus_tag="ABZJ_00401"
                     /note="S1_PNPase: Polynucleotide phosphorylase (PNPase),
                     ), S1-like RNA-binding domain. PNPase  is a
                     polyribonucleotide nucleotidyl transferase that degrades
                     mRNA. It is a trimeric multidomain protein. The C-terminus
                     contains the S1 domain which binds ssRNA; Region:
                     S1_PNPase; cd04472"
                     /db_xref="CDD:239918"
     misc_feature    order(445480..445482,445504..445506,445534..445536,
                     445540..445542)
                     /locus_tag="ABZJ_00401"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239918"
     misc_feature    445597..445602
                     /locus_tag="ABZJ_00401"
                     /note="domain interface; other site"
                     /db_xref="CDD:239918"
     gene            445765..446976
                     /locus_tag="ABZJ_00402"
                     /db_xref="GeneID:12116142"
     CDS             445765..446976
                     /locus_tag="ABZJ_00402"
                     /codon_start=1
                     /transl_table=11
                     /product="CorA-like Mg2+ transporter family protein"
                     /protein_id="YP_005524358.1"
                     /db_xref="GI:384141648"
                     /db_xref="GeneID:12116142"
                     /translation="MQVYYFYRHQSDGYVFISREKHTEHILEFFWIDSVRSDVVSQNE
                     EWQQKIQQLADVSINEFHMRDIANIEHPCAFDTLEEYDLLIFRKLVTPDDEIKNGESH
                     ESVFGLATTPISFIFTPKVLISVREQGNKSIENYIQRLENILCKTLEEQNKTRKLPNS
                     PVDLCLRLLNSMVDGYLDIRSPLTRRVEHWQQQLLQGNRRFKQWHQLFHENMAFQQVE
                     NLCEEQIETLQEFRDEIVENYHHVIGEKTHSSQDLLLVRLNDLMSHVERIQKHTLRLR
                     SAIQSAIDLHFSAIANQTNENMRILAIITAVFAPLTLLTGIYGMNFEFIPGLKSPVGF
                     WIMLGVMLLSTILLLYYFYRQHLVGRGEKSVIDLLAQQHRQDRMNLFWFLEYEPIKQT
                     LKEVEKITRLK"
     misc_feature    445855..446826
                     /locus_tag="ABZJ_00402"
                     /note="CorA-like Mg2+ transporter protein; Region: CorA;
                     pfam01544"
                     /db_xref="CDD:250695"
     misc_feature    445855..446826
                     /locus_tag="ABZJ_00402"
                     /note="Thermotoga maritima CorA-like family; Region:
                     TmCorA-like; cd12822"
                     /db_xref="CDD:213356"
     misc_feature    order(445945..445947,445954..445959,445984..445986,
                     445990..445992,446167..446169,446179..446181,
                     446251..446253,446260..446262,446284..446286,
                     446293..446295,446305..446307,446323..446328,
                     446335..446337,446374..446379,446386..446388,
                     446395..446400,446407..446409,446419..446421,
                     446530..446535,446539..446544,446551..446556,
                     446560..446565,446572..446577,446581..446586,
                     446590..446598,446605..446628,446632..446670,
                     446674..446682,446686..446703,446707..446730,
                     446761..446766,446773..446778,446785..446787,
                     446818..446820)
                     /locus_tag="ABZJ_00402"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213356"
     misc_feature    order(445954..445956,446272..446274,446542..446544)
                     /locus_tag="ABZJ_00402"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213356"
     misc_feature    order(445957..445959,446542..446544)
                     /locus_tag="ABZJ_00402"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213356"
     misc_feature    order(446179..446181,446251..446253)
                     /locus_tag="ABZJ_00402"
                     /note="putative Cl binding site [ion binding]; other site"
                     /db_xref="CDD:213356"
     misc_feature    446614..446616
                     /locus_tag="ABZJ_00402"
                     /note="aspartate ring; other site"
                     /db_xref="CDD:213356"
     misc_feature    order(446641..446643,446659..446661,446821..446826)
                     /locus_tag="ABZJ_00402"
                     /note="basic sphincter; other site"
                     /db_xref="CDD:213356"
     misc_feature    order(446656..446658,446665..446667)
                     /locus_tag="ABZJ_00402"
                     /note="hydrophobic gate; other site"
                     /db_xref="CDD:213356"
     misc_feature    order(446710..446712,446716..446721)
                     /locus_tag="ABZJ_00402"
                     /note="periplasmic entrance; other site"
                     /db_xref="CDD:213356"
     gene            complement(447223..447552)
                     /locus_tag="ABZJ_00403"
                     /db_xref="GeneID:12116143"
     CDS             complement(447223..447552)
                     /locus_tag="ABZJ_00403"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524359.1"
                     /db_xref="GI:384141649"
                     /db_xref="GeneID:12116143"
                     /translation="MTTIHYREIVCDGHTFSAEVVDEQCTFDLQQFAQACGQSPDWIL
                     QLIEYDILAIDTPPEKHQFMGEDVIRARKAYRLQRDFDASLAAVAVMLDLIDEVQQLR
                     KQLKHFH"
     misc_feature    complement(447235..447474)
                     /locus_tag="ABZJ_00403"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:271598"
     gene            complement(447564..448520)
                     /locus_tag="ABZJ_00404"
                     /db_xref="GeneID:12116144"
     CDS             complement(447564..448520)
                     /locus_tag="ABZJ_00404"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaJ-class molecular chaperone"
                     /protein_id="YP_005524360.1"
                     /db_xref="GI:384141650"
                     /db_xref="GeneID:12116144"
                     /translation="MAKNYYEELGVKREASADEIKKAYRKLARKYHPDISKEKDAEEK
                     MQAINVAYDTLSNPEKKAEYDQMLDHPQGFNGFGQGAAQSGFDGARFYRQGFTGGEQA
                     DFSGFEDLFGRFGAGFGGGQQQYQRQQRSYRGEDQHASIEVDLDIAYHGSTQHITLQI
                     PTINAYGEPEVQRKTLQVKIPKGMKEGQQIRLSGQGQSGINGGANGDLYIEIQYKDTD
                     RVHVEGSDVYLTVDVAPWEAALGQGIEVKTPAGPLHVNLPKNAKQGQQLRLKDKGIPN
                     KTPGHLYLILNIVFPPAHSEKEKEAYQQLAEAFASFEPRSSH"
     misc_feature    complement(448350..448511)
                     /locus_tag="ABZJ_00404"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    complement(447594..448508)
                     /locus_tag="ABZJ_00404"
                     /note="chaperone protein DnaJ; Region: DnaJ_bact;
                     TIGR02349"
                     /db_xref="CDD:233829"
     misc_feature    complement(order(448371..448376,448383..448388,
                     448395..448397,448419..448427))
                     /locus_tag="ABZJ_00404"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    complement(447648..448118)
                     /locus_tag="ABZJ_00404"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    complement(order(447930..447932,448002..448004,
                     448044..448061,448104..448106))
                     /locus_tag="ABZJ_00404"
                     /note="substrate binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199909"
     misc_feature    complement(order(447648..447653,447732..447743,
                     447801..447806,447813..447818))
                     /locus_tag="ABZJ_00404"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199909"
     gene            complement(448671..449282)
                     /locus_tag="ABZJ_00405"
                     /db_xref="GeneID:12116145"
     CDS             complement(448671..449282)
                     /locus_tag="ABZJ_00405"
                     /codon_start=1
                     /transl_table=11
                     /product="putative amino-acid efflux transmembrane
                     protein"
                     /protein_id="YP_005524361.1"
                     /db_xref="GI:384141651"
                     /db_xref="GeneID:12116145"
                     /translation="MNYFDYFLFIFSVIIMIATPGPVMILVASAGLKGGYKKALETIF
                     GTNLASLVLIFISVLVLKGVLGINENYLNIIRVLGCLYIGYLGFSILKEVIQAPHPEA
                     IQTVSAQNGGFKKGFLVGISNPKDIIFFSAFFPQFVSISPHLDLSLTILTLTWIVLDF
                     LTLSLVYIFFRRLSNSHLYPKILGLCGLLLLVIAVYGLYQTFI"
     misc_feature    complement(448785..449282)
                     /locus_tag="ABZJ_00405"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            complement(449421..450296)
                     /locus_tag="ABZJ_00406"
                     /db_xref="GeneID:12116146"
     CDS             complement(449421..450296)
                     /locus_tag="ABZJ_00406"
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide bond chaperones of the HSP33 family"
                     /protein_id="YP_005524362.1"
                     /db_xref="GI:384141652"
                     /db_xref="GeneID:12116146"
                     /translation="MSDLRQRFYIEDFPVRGEVVHLEEALKTILAQRDYMLAVQILLG
                     EMLSATALLASTLKIKGRISLQIQANGSFKWAMAECNHLGEVRALADYETDPRFGEAT
                     DSSTVLAALVNPVLFINIEPEHGERYQGIVPLDQANLAGCLMQYYDLSAQIPTRIVLA
                     STAQRSGGLLIQLLPRHDEEEQKLVDEDLWPRLTMLTETLKSEELTELSANEILYRLY
                     NEEEVRLPEVEHLKFGCTCSKERCAKALIQIGVDAVHETLEAQNPIQMDCQFCNTRYE
                     FTAEEALGLFGEHLS"
     misc_feature    complement(449433..450296)
                     /locus_tag="ABZJ_00406"
                     /note="Hsp33-like chaperonin; Reviewed; Region: hslO;
                     PRK00114"
                     /db_xref="CDD:234643"
     misc_feature    complement(449463..450281)
                     /locus_tag="ABZJ_00406"
                     /note="Heat shock protein 33 (Hsp33):  Cytosolic protein
                     that acts as a molecular chaperone under oxidative
                     conditions.  In normal (reducing) cytosolic conditions,
                     four conserved Cys residues are coordinated by a Zn ion.
                     Under oxidative stress (such as heat...; Region: Hsp33;
                     cd00498"
                     /db_xref="CDD:238278"
     misc_feature    complement(order(449592..449594,449781..449783,
                     449841..449849,449859..449861,450249..450251))
                     /locus_tag="ABZJ_00406"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238278"
     misc_feature    complement(order(449772..449783,449793..449795,
                     449799..449801,450249..450251))
                     /locus_tag="ABZJ_00406"
                     /note="domain crossover interface; other site"
                     /db_xref="CDD:238278"
     misc_feature    complement(order(449484..449486,449493..449495,
                     449586..449588,449592..449594))
                     /locus_tag="ABZJ_00406"
                     /note="redox-dependent activation switch; other site"
                     /db_xref="CDD:238278"
     gene            complement(450462..452303)
                     /locus_tag="ABZJ_00407"
                     /db_xref="GeneID:12116147"
     CDS             complement(450462..452303)
                     /locus_tag="ABZJ_00407"
                     /codon_start=1
                     /transl_table=11
                     /product="Kef-type K+ transport system membrane protein"
                     /protein_id="YP_005524363.1"
                     /db_xref="GI:384141653"
                     /db_xref="GeneID:12116147"
                     /translation="MSFLLQATIFLGASLILVPLGKRLGIATVLGYLFTGILLGPSVL
                     NIAHDPEAIMELAEFGVILLMFLIGLELRPQRLWEMRDSIFVMGSLQVVITGIILMLT
                     VLLLFQQHLAASFVIGFALALSSTAFVLQLLTEKQQLNTTYGQQSFSILLFQDIAAIP
                     LLAVIPLLAGTESTHHGIAYFAAIIATFTGLFLFSRYVMRPFFRFVAKSGATELITAV
                     GLFIILAVVLLMDTLGISTTLGAFLTGVLLADSEFRHELEASIAPFKGLLLGLFFMTV
                     GMTTQLSLLIEMPWLIIGGAIGLLVIKTLVLTAIARYKKYSWNNSLLLGTCLAQGGEF
                     AFVILSLAKSEKILTDALLEPVTLIVTLSMVLTPVIYWIMACKIIPLFHKELPPEYDE
                     IPQQDNPIIIAGFGRFGQIIARIARLQHLGFTAIDNNLHQVDFVRRYGGKLYYGDVTQ
                     PDLLRSAGIEKAKVFILAIDDVEDSMNVARHLRLNYPNLKLLARARDRHHVHLLRDLG
                     VEHIWRETYLSSLGMAYRALRELGISDEQAYNNIEIFRDYDEKLLIQQQSIYTDEQKV
                     FETHRNALAELEHLFESDAQQATSKHDVNLKRHLQPNRIDITRDHEE"
     misc_feature    complement(451179..452303)
                     /locus_tag="ABZJ_00407"
                     /note="Kef-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: KefB;
                     COG0475"
                     /db_xref="CDD:223551"
     misc_feature    complement(450543..452297)
                     /locus_tag="ABZJ_00407"
                     /note="glutathione-regulated potassium-efflux system
                     protein KefC; Provisional; Region: PRK03562"
                     /db_xref="CDD:235131"
     misc_feature    complement(450768..451106)
                     /locus_tag="ABZJ_00407"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     gene            complement(452380..454608)
                     /locus_tag="ABZJ_00408"
                     /db_xref="GeneID:12116148"
     CDS             complement(452380..454608)
                     /locus_tag="ABZJ_00408"
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein N'"
                     /protein_id="YP_005524364.1"
                     /db_xref="GI:384141654"
                     /db_xref="GeneID:12116148"
                     /translation="MTITPKPDSVVYRVRVAVPVHLYDTFDYTLTKAQYERAQVGSRV
                     AISFGRQNLIGIITEKVDPQESFTGHFQLKAISELLDDEPILDEQVLNLLTWSAQYYQ
                     FPIGEVMQTALPALLRQGKPMDVLFHLWKIIPCDNAEALLKRSIKQQDAYQILKLHPA
                     GTTENILNLSGVETATLKALQKKGLVDCTLEPHDFSPSPVQLAQMPLTLNEDQKKATQ
                     HVLNAQHQYQAFLLDGLTGSGKTEVYLHIMHEVLKQGKQVLVLVPEIGLTPQTISRFK
                     SRFNCDIALLHSGLNDSKRLQAWQQAQTGKASIILGTRSAIYTPLPRLGLIILDEEHD
                     LSYKQQEGFRYHARDVALYRGHLQGCPVLLGSATPSIDSYHLVETGKLTALQLNQRAG
                     HALLPKMHLIDLKIVKKQHGISQPLIEQIKNTLARKEQVLIFLNRRGYAPVLVCESCG
                     WQANCPHCDAHFTLHTQPYSYLHCHHCGTVHRLPDHCPECQQKSLKTLGAGTAKVEEH
                     LQELFPDHDVIRVDRDSTSRVGSWQKIYDRIQQNKPSILLGTQMLAKGHHFPHVTLVA
                     ILDIDAGLLSVDIRAPERTAQLIVQVAGRAGRGEHKGHVYLQTLRPDHPLLTTLIEKD
                     YRAVAKQTLAERKVALLPPYRYAVLIRAESKDRDYTLHFLNEAAEQLRQIAGDIVDIW
                     GPIPAPMERKAGRYRAHMVILSADRARLHFYLRQWWAQLVHAPRQHQLRLSIDVDPQE
                     FS"
     misc_feature    complement(452386..454572)
                     /locus_tag="ABZJ_00408"
                     /note="primosome assembly protein PriA; Validated; Region:
                     PRK05580"
                     /db_xref="CDD:235514"
     misc_feature    complement(453502..453921)
                     /locus_tag="ABZJ_00408"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(453886..453900)
                     /locus_tag="ABZJ_00408"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(453610..453621)
                     /locus_tag="ABZJ_00408"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(<453121..453249)
                     /locus_tag="ABZJ_00408"
                     /note="FYVE domain; Zinc-binding domain; targets proteins
                     to membrane lipids via interaction with
                     phosphatidylinositol-3-phosphate, PI3P; present in Fab1,
                     YOTB, Vac1, and EEA1; Region: FYVE; cl17764"
                     /db_xref="CDD:271819"
     misc_feature    complement(452815..453099)
                     /locus_tag="ABZJ_00408"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     misc_feature    complement(order(452815..452817,452824..452826,
                     452836..452838,452935..452937))
                     /locus_tag="ABZJ_00408"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            454757..455962
                     /locus_tag="ABZJ_00409"
                     /db_xref="GeneID:12116149"
     CDS             454757..455962
                     /locus_tag="ABZJ_00409"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretory pathway, component PulF"
                     /protein_id="YP_005524365.1"
                     /db_xref="GI:384141655"
                     /db_xref="GeneID:12116149"
                     /translation="MPAYQFTAIDASGKQQKGVLEGDSARQIRQQLRDKAWTPISVDP
                     VEQKDKHQSHGLFQKKFSAYDLALMTRQLSVLVAAAIPLEEALRAVSRQSEKAHVQNL
                     LLSVRSKVLEGHSLAQGMQQSGRFPDLYIATVAAGERSGHLDLILDQLSDYTENRFAM
                     QKKVQGAMIYPIILMLMSFGIVMGLMTYVVPEIVKTFDQSKDALPWITVALMKASDFI
                     RHAWVFIILFAIVGVVAFVRFLKTTAGHYAFDRLTLKLPLFGKLSRGINAARFASTLS
                     ILTRSGVPLVDALKIGAAVTNNWVIRDSISQAAERVTEGGNLGTQLERSGYFPPMMVQ
                     MIRSGEASGELDRMLERASTMQDREVTTFISTLLALLEPLMLVLMASIVLVIVIAVML
                     PIVNMNNMI"
     misc_feature    454766..455959
                     /locus_tag="ABZJ_00409"
                     /note="type II secretion system protein F; Region: GspF;
                     TIGR02120"
                     /db_xref="CDD:233734"
     misc_feature    454961..455329
                     /locus_tag="ABZJ_00409"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     misc_feature    455567..455935
                     /locus_tag="ABZJ_00409"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     gene            456018..456566
                     /locus_tag="ABZJ_00410"
                     /db_xref="GeneID:12116150"
     CDS             456018..456566
                     /locus_tag="ABZJ_00410"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretory pathway, pseudopilin PulG"
                     /protein_id="YP_005524366.1"
                     /db_xref="GI:384141656"
                     /db_xref="GeneID:12116150"
                     /translation="MKQHSESVVSNQFEPTCHSEHSSVSDVCSSSAFGLATRSSRARM
                     KRASGFTLIEVMVVIVILGVLAALIVPNVMGRSEKAKIDTTQITLKGVAGALDQYKLD
                     NGHFPTMQEGGLDALINQPATAKNWMPGGYVKGGYPKDSWKNDIQYVVPGKDGHPFDL
                     YSFGADGKEGGEGNDADIYYQP"
     misc_feature    456156..456227
                     /locus_tag="ABZJ_00410"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     misc_feature    456159..456563
                     /locus_tag="ABZJ_00410"
                     /note="type II secretion system protein G; Region:
                     typeII_sec_gspG; TIGR01710"
                     /db_xref="CDD:130771"
     misc_feature    456237..456560
                     /locus_tag="ABZJ_00410"
                     /note="Type II secretion system (T2SS), protein G; Region:
                     T2SG; pfam08334"
                     /db_xref="CDD:254737"
     gene            456833..457177
                     /locus_tag="ABZJ_00411"
                     /db_xref="GeneID:12116151"
     CDS             456833..457177
                     /locus_tag="ABZJ_00411"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524367.1"
                     /db_xref="GI:384141657"
                     /db_xref="GeneID:12116151"
                     /translation="MKAFLVLDELNQFHWAMLKSVLLILALLPIAEVSLKLWLSTEGS
                     SQIMIGFFALSIVSAWLMVSFFTALKTSVWQTKQMASKYEQLLFKAYRYVPMVFLSSL
                     VAYLSLQLSIAF"
     gene            457322..457660
                     /locus_tag="ABZJ_00412"
                     /db_xref="GeneID:12116152"
     CDS             457322..457660
                     /locus_tag="ABZJ_00412"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion chaperone CsaA"
                     /protein_id="YP_005524368.1"
                     /db_xref="GI:384141658"
                     /db_xref="GeneID:12116152"
                     /translation="MEQIEWNDFLKVELRVGKIIQAEVFEKARKPAYILHVDFGEELG
                     VRKSSAQITKLYQPQDLIGKLVVAVVNFPKKQIGPIQSECLVTGFHNADGDVALCIPE
                     FEVPLGTKLL"
     misc_feature    457331..457654
                     /locus_tag="ABZJ_00412"
                     /note="tRNA-binding-domain-containing CsaA-like proteins.
                     CsaA is a molecular chaperone with export related
                     activities. CsaA has a putative tRNA binding activity. The
                     functional unit of CsaA is a homodimer and this domain
                     acts as a dimerization domain; Region: tRNA_bind_CsaA;
                     cd02798"
                     /db_xref="CDD:239197"
     misc_feature    order(457334..457345,457349..457357,457367..457369,
                     457484..457489,457511..457513,457532..457537,
                     457580..457591,457607..457609,457613..457621,
                     457625..457630,457634..457636,457649..457654)
                     /locus_tag="ABZJ_00412"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239197"
     misc_feature    order(457412..457414,457454..457456,457532..457534,
                     457544..457546,457565..457567,457574..457576)
                     /locus_tag="ABZJ_00412"
                     /note="putative tRNA-binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239197"
     gene            complement(457662..459221)
                     /locus_tag="ABZJ_00413"
                     /db_xref="GeneID:12116153"
     CDS             complement(457662..459221)
                     /locus_tag="ABZJ_00413"
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="YP_005524369.1"
                     /db_xref="GI:384141659"
                     /db_xref="GeneID:12116153"
                     /translation="MRAYFEKLLDSSQQQKQLPLIFPLLIALFSGAVFSFALAPYYWW
                     WLAILSPALLYATLHNRSAKQAFAIGWSYGFGLWFVGAFWLYTSIHVYGDTNAFLSVC
                     MIAVMALVMGLFTAFQTWIYRRFFPETPLTFAPLWIIFEWAKTWVFTGFPWLFVGYAF
                     TERLLDGYAPLFGIYAISFVVIVLACALVEILRKRIFWIIPAALLVLGAWGASYIQFV
                     QPKAAKPLSVSLIQGNIPQDLKWLTEYQVRTLEIYAGLTQSEWGRDLIVWPESSIPLF
                     QTDIEPFLDAMDAQAKKNHTAWVTGIPYWDVAKSHQVGSPLYYNSIMASGSDSSGLYK
                     KQRLVPFGEYIPLSGLLSWVLPAMQNDISMSGFTRGESDQKPLLIKGHALAAAICYEV
                     AYPNLTRRNAEDSDFLVTVSNDAWFTGTAGPWQHLQMVQMRAKENGRWFIRATNTGVT
                     AFIDQNGHITEQAPIDKEFVLRGDLPAMQGQTLYNRLGDYPILGFAILLLVLGWIYRP
                     RKVDVSYKSRR"
     misc_feature    complement(457692..459161)
                     /locus_tag="ABZJ_00413"
                     /note="apolipoprotein N-acyltransferase; Reviewed; Region:
                     lnt; PRK00302"
                     /db_xref="CDD:234721"
     misc_feature    complement(457728..458546)
                     /locus_tag="ABZJ_00413"
                     /note="Apolipoprotein N-acyl transferase (class 9
                     nitrilases); Region: ALP_N-acyl_transferase; cd07571"
                     /db_xref="CDD:143595"
     misc_feature    complement(order(457983..457985,458043..458048,
                     458052..458057,458193..458195,458205..458207,
                     458217..458219,458412..458414))
                     /locus_tag="ABZJ_00413"
                     /note="putative active site [active]"
                     /db_xref="CDD:143595"
     misc_feature    complement(order(458055..458057,458217..458219,
                     458412..458414))
                     /locus_tag="ABZJ_00413"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143595"
     misc_feature    complement(order(457737..457751,457875..457880,
                     457914..457919,457923..457931,457935..457940,
                     458022..458027,458034..458048,458052..458054,
                     458169..458177,458196..458198,458205..458216))
                     /locus_tag="ABZJ_00413"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143595"
     gene            complement(459218..460057)
                     /locus_tag="ABZJ_00414"
                     /db_xref="GeneID:12116154"
     CDS             complement(459218..460057)
                     /locus_tag="ABZJ_00414"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium and cobalt efflux protein"
                     /protein_id="YP_005524370.1"
                     /db_xref="GI:384141660"
                     /db_xref="GeneID:12116154"
                     /translation="MQEEPSPSWGMRGLRKWLGTAPETRDELLKLVQNSRRFLEPDTV
                     AMLEGVLDLPATKIREVMTPRTAMISMQEDDQLLDILHVLVESAHSRFPVFSADQPDN
                     VVGILLAKDLLPFLTEPNTKLDIGSLMRQPLFVPESARSDQVLRMLKHTQTHIAIVID
                     EYGSTAGLVTLEDILEEIVGEIEDEHDTADEDAQYIVPDNDHTIANAWMVQALTPIEH
                     FNTVLDADFSDDEVETVGGLLLQEIGLVSDLQGQTVELGNWLFTIVEADARTIHLIRA
                     VRQ"
     misc_feature    complement(459533..459886)
                     /locus_tag="ABZJ_00414"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     misc_feature    complement(459527..459856)
                     /locus_tag="ABZJ_00414"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    complement(459224..459442)
                     /locus_tag="ABZJ_00414"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     smart01091"
                     /db_xref="CDD:215020"
     gene            460242..460499
                     /locus_tag="ABZJ_00415"
                     /db_xref="GeneID:12116155"
     CDS             460242..460499
                     /locus_tag="ABZJ_00415"
                     /codon_start=1
                     /transl_table=11
                     /product="small ubiquitous protein required for normal
                     growth"
                     /protein_id="YP_005524371.1"
                     /db_xref="GI:384141661"
                     /db_xref="GeneID:12116155"
                     /translation="MSEQPISPTVQLNTRGLRCPEPVMMLHQAIRKAKSGDVVEVLAT
                     DPSTSWDIPKFCMHLGHELLLKEEVLDEQNHKEYRYLVQKG"
     misc_feature    460272..460493
                     /locus_tag="ABZJ_00415"
                     /note="SirA (also known as UvrY,  and YhhP) belongs to a
                     family of two-component response regulators that controls
                     secondary metabolism and virulence. The other member of
                     this two-component system is a sensor kinase called BarA
                     which phosphorylates SirA.  A...; Region: SirA; cd03423"
                     /db_xref="CDD:239515"
     misc_feature    order(460275..460280,460287..460289,460296..460307,
                     460311..460313)
                     /locus_tag="ABZJ_00415"
                     /note="CPxP  motif; other site"
                     /db_xref="CDD:239515"
     gene            complement(460595..462307)
                     /locus_tag="ABZJ_00416"
                     /db_xref="GeneID:12116156"
     CDS             complement(460595..462307)
                     /locus_tag="ABZJ_00416"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase"
                     /protein_id="YP_005524372.1"
                     /db_xref="GI:384141662"
                     /db_xref="GeneID:12116156"
                     /translation="MEHIERESMEFDVVIVGAGPAGLSAAIKIRQLAIENNLPDLSVC
                     VVEKGSEVGAHILSGAVLEPRAINELFPNWKEEGAPLNVPVTEDKTFFLLSETTSKEA
                     PHWMVPKTMHNDGNYVISLGNVVRWLGQKAEELEVSIFPGFAASEVLYHEDGTVKGIQ
                     TGDMGIGKDGEPTHNFTPGYELHAKYTLFAEGCRGHLGKRLIAKYNLDKDADPQHYGI
                     GIKELWEIDPAKHKPGLVMHGAGWPLSETGSSGGWWLYHAENNQVTLGMIVDLSYENP
                     HMYPFMEMQRWKTHPLIKQYLEGGKRISYGARAVVKGGFNSLPKLTFPGGCLIGDDAG
                     FLNFAKIKGSHTAMKSGMLCGEAVFEAIAAGVEKGGDLAVARVTEGEDLFVKELTSYT
                     DKFNNSWLKEELYNARNFGPAMHKFGQWIGGAFNFIDQNVFKVPFTLHDLKQDFAVLK
                     TVDATSFKPTYPKPDGKLTFDRLSSVFISNTVHEENQPAHLKLTDPSIPVNVNLPKWD
                     EPAQRYCPAGVYEIMENDDGSKRFQINAANCVHCKTCDIKDPSQNITWVTPEGGGGPN
                     YPNM"
     misc_feature    complement(460859..462286)
                     /locus_tag="ABZJ_00416"
                     /note="Dehydrogenases (flavoproteins) [Energy production
                     and conversion]; Region: FixC; COG0644"
                     /db_xref="CDD:223717"
     misc_feature    complement(<461225..462280)
                     /locus_tag="ABZJ_00416"
                     /note="Short-chain dehydrogenases/reductases (SDR);
                     Region: SDR; cl21454"
                     /db_xref="CDD:271874"
     misc_feature    complement(460730..461056)
                     /locus_tag="ABZJ_00416"
                     /note="Electron transfer flavoprotein-ubiquinone
                     oxidoreductase; Region: ETF_QO; pfam05187"
                     /db_xref="CDD:218485"
     misc_feature    complement(460607..>460840)
                     /locus_tag="ABZJ_00416"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:271836"
     misc_feature    complement(<460673..460840)
                     /locus_tag="ABZJ_00416"
                     /note="Ferredoxin [Energy production and conversion];
                     Region: NapF; COG1145"
                     /db_xref="CDD:224068"
     gene            462494..463105
                     /locus_tag="ABZJ_00417"
                     /db_xref="GeneID:12116157"
     CDS             462494..463105
                     /locus_tag="ABZJ_00417"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524373.1"
                     /db_xref="GI:384141663"
                     /db_xref="GeneID:12116157"
                     /translation="MVNQNNSPSDMGKIPLSDDKNLMNIAQYLKGVQQSHKRSIPPLE
                     QWHPKHCGKMDLTVKANGEWWHEGQLIKRQALLDLFTKVLWKEEGKFYLKTPVEQIEI
                     EVEDEPLLVNQVDQIEISGDEFLQLTTTNQDVILVDAEHPIFMREYAGELRPYVHVRF
                     GINALIQRQAFYHLVNYGTLVENDKGETILQLKSGNLHLQLGT"
     misc_feature    462662..463078
                     /locus_tag="ABZJ_00417"
                     /note="Protein of unknown function (DUF1285); Region:
                     DUF1285; pfam06938"
                     /db_xref="CDD:253982"
     gene            463154..464020
                     /locus_tag="ABZJ_00418"
                     /db_xref="GeneID:12116158"
     CDS             463154..464020
                     /locus_tag="ABZJ_00418"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="YP_005524374.1"
                     /db_xref="GI:384141664"
                     /db_xref="GeneID:12116158"
                     /translation="MTAIQPLFTELEPMPKALADAPIGIFDSGIGGMSVAAEIAKYLP
                     NERIVYYADTAYVPYGPRSDEEIRELTARAVDWLYRQGCKIAVVACNTASAFSLDHLR
                     EHYGEHFPIVGLVPALKPAVLQTRSKVVAVLATPATFRGQLIKDVVEKFAVPAGVKVM
                     TLTSLELVPCVEAGQQMSPACLNALREVLQPAVEQGADYLVLGCTHYPFLNEAIHYLF
                     DNQFTLVDSGLAVARQTARILIKNELLCDQMRQNVARIECYVSGNNADALQPVLQNMI
                     PQELTWTLHNLS"
     misc_feature    463208..463972
                     /locus_tag="ABZJ_00418"
                     /note="glutamate racemase; Provisional; Region: PRK00865"
                     /db_xref="CDD:234851"
     gene            464141..465145
                     /locus_tag="ABZJ_00419"
                     /db_xref="GeneID:12116159"
     CDS             464141..465145
                     /locus_tag="ABZJ_00419"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524375.1"
                     /db_xref="GI:384141665"
                     /db_xref="GeneID:12116159"
                     /translation="MLDTRYQIFISTSGREMQPERMVLSQTLVNMGFFAWGLEYRNPL
                     TTTLARRQIDESDYVVLLLGSQYGEQSISGASYFSLEYEYALSRAKPIVVFMHEQPES
                     RDMHLQETHPQLKEKFLAFRKKLLHEANHIFYFKSPRDLELAVRLNMPLMVEQYMGQG
                     WVPARQAHHLEDEINRLKSKILQLEQQLSESSIQANEVAPQDVFAFEYQIQAFQDGNF
                     KELKRQRQMTWSQLLSILAKHFETAMPEENFGTCLNEYLNQDGLEDARQELPRAHAVA
                     GAQINHKALFRIKKQMQSQGWIVPTKIDQQHSLWKVTTKAQKLLLSYKWNHRSTRLKA
                     "
     misc_feature    464159..464395
                     /locus_tag="ABZJ_00419"
                     /note="Domain of unknown function (DUF4062); Region:
                     DUF4062; pfam13271"
                     /db_xref="CDD:205451"
     gene            465219..466235
                     /locus_tag="ABZJ_00420"
                     /db_xref="GeneID:12116160"
     CDS             465219..466235
                     /locus_tag="ABZJ_00420"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="YP_005524376.1"
                     /db_xref="GI:384141666"
                     /db_xref="GeneID:12116160"
                     /translation="MSFEQKPKVTVILANLGTPDEATVPAVRRFLKQFLSDPRVIEIP
                     KFIWWIILNLFVLPFRPKRVAHAYASVWSTDSPMREIVFEQTQRVQAYLERENKQFDL
                     TVLPAMTYGNPGIDAVLEKLATNPQEHVILLPLFPQYSATSTAPLYDAFAKWIPTQRN
                     LPGLTIIKDYYQHPMFIQALAESVLAYQEQHGKPEKLLMSFHGIPQPYADKGDPYADR
                     CRITAKLVAEALHLKDDEWAISFQSRFGKQEWVKPYTDQLLQDWAKQGVKSVQVLSPA
                     FSADCLETLEELAIQNAELFQQAGGGSYAYIPALNSDQAHIDLLAGLVQANLDALTHT
                     LAHR"
     misc_feature    465231..466229
                     /locus_tag="ABZJ_00420"
                     /note="ferrochelatase; Reviewed; Region: hemH; PRK00035"
                     /db_xref="CDD:234585"
     misc_feature    465243..465737
                     /locus_tag="ABZJ_00420"
                     /note="Ferrochelatase, N-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_N;
                     cd03411"
                     /db_xref="CDD:239504"
     misc_feature    order(465261..465263,465417..465419,465429..465431,
                     465459..465461,465471..465473,465621..465623,
                     465630..465641,465723..465725,465729..465731)
                     /locus_tag="ABZJ_00420"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239504"
     misc_feature    order(465264..465266,465306..465308,465318..465326,
                     465642..465647)
                     /locus_tag="ABZJ_00420"
                     /note="active site"
                     /db_xref="CDD:239504"
     misc_feature    465750..466151
                     /locus_tag="ABZJ_00420"
                     /note="Ferrochelatase, C-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_C;
                     cd00419"
                     /db_xref="CDD:238240"
     misc_feature    order(465822..465824,465837..465839,465966..465968,
                     466065..466067)
                     /locus_tag="ABZJ_00420"
                     /note="active site"
                     /db_xref="CDD:238240"
     misc_feature    order(465855..465863,465870..465872,465882..465884,
                     466044..466046,466050..466058,466062..466064,
                     466074..466076,466149..466151)
                     /locus_tag="ABZJ_00420"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238240"
     gene            466259..466903
                     /locus_tag="ABZJ_00421"
                     /db_xref="GeneID:12116161"
     CDS             466259..466903
                     /locus_tag="ABZJ_00421"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase, including glyoxylase"
                     /protein_id="YP_005524377.1"
                     /db_xref="GI:384141667"
                     /db_xref="GeneID:12116161"
                     /translation="MLQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVE
                     ALGLKVKALWLTHGHLDHAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGFPI
                     PQPVKVDQWLEGGEVLKLGEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIG
                     RTDFPRGNHDQLIESIQRECFSLPDETQFISGHGPMSTIGYEKQFNPFVASKAG"
     misc_feature    466259..466885
                     /locus_tag="ABZJ_00421"
                     /note="Zn-dependent hydrolases, including glyoxylases
                     [General function prediction only]; Region: GloB; COG0491"
                     /db_xref="CDD:223565"
     gene            complement(466900..467094)
                     /locus_tag="ABZJ_00422"
                     /db_xref="GeneID:12116162"
     CDS             complement(466900..467094)
                     /locus_tag="ABZJ_00422"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Zinc-binding protein"
                     /protein_id="YP_005524378.1"
                     /db_xref="GI:384141668"
                     /db_xref="GeneID:12116162"
                     /translation="MPRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRL
                     PTQDAPQQDKGSQHEDDYED"
     misc_feature    complement(466936..467088)
                     /locus_tag="ABZJ_00422"
                     /note="Domain of unknown function (DUF329); Region:
                     DUF329; pfam03884"
                     /db_xref="CDD:252227"
     gene            467182..467820
                     /locus_tag="ABZJ_00423"
                     /db_xref="GeneID:12116163"
     CDS             467182..467820
                     /locus_tag="ABZJ_00423"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="YP_005524379.1"
                     /db_xref="GI:384141669"
                     /db_xref="GeneID:12116163"
                     /translation="MIMQIRQFQAQRMQAPRDFTPIENTPICVEIGAGKGKHALLFSG
                     QNPQHTLYAIERTREKFLAMQKQHGLEPRDNLVPVHADALPWVVHALYPAQVEHFFIL
                     YPNPEPHNPAQRWLNMPFFEFLLSRLKTGGTITLASNIPEYIEEAEQQLLNVWKLPYQ
                     KEKIAQTSARTHFEIKYLERGELCQQLIMTKPEGYKTRFDEFAPLQGQTHVE"
     misc_feature    467224..467724
                     /locus_tag="ABZJ_00423"
                     /note="Putative methyltransferase; Region: Methyltransf_4;
                     cl17290"
                     /db_xref="CDD:266610"
     gene            467780..469015
                     /locus_tag="ABZJ_00424"
                     /db_xref="GeneID:12116164"
     CDS             467780..469015
                     /locus_tag="ABZJ_00424"
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein"
                     /protein_id="YP_005524380.1"
                     /db_xref="GI:384141670"
                     /db_xref="GeneID:12116164"
                     /translation="MSLHRYKGKHMSNKQIAIIGAGPAGLMAAEVLSQYAYEIDVFEQ
                     KPSAARKFLMAGKTGLNISHAEPLPQFIERYDHAEWLKPWVEKWDAVWIQNWMKGLGI
                     DSYVGSSGRIFPVEMKAAPLLRAWLKRLAEQQVKFFYRHRCINLHGTTVTFENQNKQN
                     TETFTQQYDAVVLACGAVSWSQLGSDGAWQQWMDQSSIEPFQASNAGVLHTWSAFMES
                     CFGEPLKRINAWVEPSQVTHGDIVITHYGLESGVIYKLGRALREQQKQGKSLNLFLDL
                     LPDVELTQLVKKLQASKKQSLTNIWRKAGLDTAKINLIREVVDKALWSQPETMAQKMK
                     ALQIKLDGFRPIEESISCAGGVKQDALTERLELKQTSGVFCCGEMLDWDAPTGGYLLT
                     ACFATGRAAGEGVHSFLEK"
     misc_feature    467810..468994
                     /locus_tag="ABZJ_00424"
                     /note="Predicted flavoproteins [General function
                     prediction only]; Region: COG2081"
                     /db_xref="CDD:224992"
     misc_feature    467831..>467917
                     /locus_tag="ABZJ_00424"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    467885..469009
                     /locus_tag="ABZJ_00424"
                     /note="uncharacterized flavoprotein, PP_4765 family;
                     Region: flavo_PP4765; TIGR03862"
                     /db_xref="CDD:163574"
     gene            469093..469503
                     /locus_tag="ABZJ_00425"
                     /db_xref="GeneID:12116165"
     CDS             469093..469503
                     /locus_tag="ABZJ_00425"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524381.1"
                     /db_xref="GI:384141671"
                     /db_xref="GeneID:12116165"
                     /translation="MSQASPVYQGSCLCQGIRYEIKGDIGDIIQCHCQRCRKSNGTAF
                     ATNAPINSADFKITQGEDLVKKFAVNGVYRWFCSECGSPLISSRDAQPELYRLRIGTL
                     DTPLDQKPTMHIFAASKAEWECIHDDLPQYDERP"
     misc_feature    469177..469437
                     /locus_tag="ABZJ_00425"
                     /note="Glutathione-dependent formaldehyde-activating
                     enzyme; Region: GFA; pfam04828"
                     /db_xref="CDD:252822"
     gene            469739..470119
                     /locus_tag="ABZJ_00426"
                     /db_xref="GeneID:12116166"
     CDS             469739..470119
                     /locus_tag="ABZJ_00426"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="YP_005524382.1"
                     /db_xref="GI:384141672"
                     /db_xref="GeneID:12116166"
                     /translation="MYYPLLSIALGSVLGAWLRWLLGLKLNPIYPQIPLGTVTVNLAG
                     GFIIGFAMAYFAHSDLSPNYKLFVITGFCGALTTFSTFSIEIVTLLQSGKWGMAMLAI
                     SIHLIGSLIFTCLGLATYYWVAGN"
     misc_feature    469739..470116
                     /locus_tag="ABZJ_00426"
                     /note="chromosome condensation membrane protein;
                     Provisional; Region: PRK14196"
                     /db_xref="CDD:184564"
     gene            complement(470548..470880)
                     /locus_tag="ABZJ_00427"
                     /db_xref="GeneID:12116167"
     CDS             complement(470548..470880)
                     /locus_tag="ABZJ_00427"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type III effector HopPmaJ"
                     /protein_id="YP_005524383.1"
                     /db_xref="GI:384141673"
                     /db_xref="GeneID:12116167"
                     /translation="MAQELLAQLQAGTAKFSDVLAYIEARYQHTPTAFQNGAQHNAAT
                     ENQGSAKVFSFAKLQGLDQAQTLSLFAEHYASVLATPEGTDHQNIRQFMQNGWDGVKF
                     EGQALTEK"
     misc_feature    complement(470560..470874)
                     /locus_tag="ABZJ_00427"
                     /note="HopJ type III effector protein; Region: HopJ;
                     pfam08888"
                     /db_xref="CDD:204088"
     gene            complement(471133..471387)
                     /locus_tag="ABZJ_00428"
                     /db_xref="GeneID:12116168"
     CDS             complement(471133..471387)
                     /locus_tag="ABZJ_00428"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="YP_005524384.1"
                     /db_xref="GI:384141674"
                     /db_xref="GeneID:12116168"
                     /translation="MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQGQVYPY
                     VTLDISSASHPFYTGEVRQASNEGRVASFNKRFARFNRKS"
     misc_feature    complement(471136..471387)
                     /locus_tag="ABZJ_00428"
                     /note="50S ribosomal protein L31 type B; Reviewed; Region:
                     rpmE2; PRK01678"
                     /db_xref="CDD:234969"
     gene            complement(471488..472786)
                     /locus_tag="ABZJ_00429"
                     /db_xref="GeneID:12116169"
     CDS             complement(471488..472786)
                     /locus_tag="ABZJ_00429"
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="YP_005524385.1"
                     /db_xref="GI:384141675"
                     /db_xref="GeneID:12116169"
                     /translation="MAKNASSPGKRFMKLAGMTASIATKTVSNSIRNLTADEEQKLAA
                     KTKLFQDIGLQIADTLGEMKGAVMKVGQIASQYKDIFPPEVAKAISKLQRQAPAMPFA
                     AIQQQVERELGKPLNVAFKSFEQEPFAAASIGQVHKAVLPSGEQVVVKVQYPGVDEAC
                     ESDLKQVRLALRLMGVLKIDKKLQDQLFAEIQDSLSAELNYEIEAQNLEVFKTFHSKL
                     DDKIIIPTVYKDYSSRRILTLSLEQGDSIETASSWPIEIRNTIGRRLIRALGQEMFFL
                     KRFHCDPHPGNFAFRQDGSVIIYDYGSVKTLSNEIVYSFKRLVNAARHEDIDLIETEL
                     LELHSLAEKGKFPSDLYKLWIEVLLRPLTTTYDFAENSSHHDGMLLVKKSLKYWDVFK
                     PSPDTLMVNRTISGHYWNLIHLKVHDNLNDLFEELVPPSN"
     misc_feature    complement(472511..>472741)
                     /locus_tag="ABZJ_00429"
                     /note="Phage-related minor tail protein; Region:
                     PhageMin_Tail; cl21711"
                     /db_xref="CDD:272131"
     misc_feature    complement(<471797..472681)
                     /locus_tag="ABZJ_00429"
                     /note="Predicted unusual protein kinase [General function
                     prediction only]; Region: AarF; COG0661"
                     /db_xref="CDD:223733"
     misc_feature    complement(471776..472528)
                     /locus_tag="ABZJ_00429"
                     /note="Activator of bc1 complex (ABC1) kinases, also
                     called aarF domain containing kinase 3; Region:
                     ABC1_ADCK3; cd13970"
                     /db_xref="CDD:270872"
     misc_feature    complement(order(471887..471892,471920..471922,
                     471926..471931,471941..471943,472061..472072,
                     472127..472129,472310..472312,472316..472318,
                     472346..472348,472352..472366))
                     /locus_tag="ABZJ_00429"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:270872"
     gene            473044..474291
                     /locus_tag="ABZJ_00430"
                     /db_xref="GeneID:12116170"
     CDS             473044..474291
                     /locus_tag="ABZJ_00430"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase"
                     /protein_id="YP_005524386.1"
                     /db_xref="GI:384141676"
                     /db_xref="GeneID:12116170"
                     /translation="MTSLNSSYGRSQAVPLSVFEQSKDAHIIRSDEEAIEIAKQLAQE
                     FAQEASDRDRERRLPLNEIQQFSQSGLWAITVPKQFGGAQVKYRTLAEVIKTIASVDP
                     SLAQLPQNHLAFIEHLRLDAKPEQQQFFFNLVLRGIRFGNAFSEKHSKTVADLTTKLQ
                     KTEHGYEINGKKFFATGALLAHWIPIVAINEQGQPYAALVPRETSGVNIINDWSGFGQ
                     RTTASGTVELNQVPVREEYLVPIYQAFERPTPAGAISQFIQAAVDAGIARGAIEETIQ
                     YVKNHSRAWIDSGLEKASDDPYTIANIGDLKIKLRAAEAVLDLAGDAIDQAIANTTEE
                     HVNQATLLVAEAKVLTTEIAILAANKLFELSGTRSTLSELNLDRHWRNARTHTLHDPV
                     RWKYHIVGNYYLNGVQPPRHAWS"
     misc_feature    473116..474288
                     /locus_tag="ABZJ_00430"
                     /note="sulfur acquisition oxidoreductase, SfnB family;
                     Region: sulfur_SfnB; TIGR04022"
                     /db_xref="CDD:188537"
     misc_feature    473149..474270
                     /locus_tag="ABZJ_00430"
                     /note="Dibenzothiophene (DBT) desulfurization enzyme C;
                     Region: DszC; cd01163"
                     /db_xref="CDD:173852"
     misc_feature    order(473563..473565,473569..473571)
                     /locus_tag="ABZJ_00430"
                     /note="Flavin binding site [chemical binding]; other site"
                     /db_xref="CDD:173852"
     gene            474325..475575
                     /locus_tag="ABZJ_00431"
                     /db_xref="GeneID:12116171"
     CDS             474325..475575
                     /locus_tag="ABZJ_00431"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase"
                     /protein_id="YP_005524387.1"
                     /db_xref="GI:384141677"
                     /db_xref="GeneID:12116171"
                     /translation="MTTAQIELEELSVGADYEKVANRFRPIFEKIAQGAIQREKERIL
                     PFEPIQWLKEAKLGAVRIPRKYGGDGVSLPQLFQLLAELAEADSNIVQALRGHFAFVE
                     DRLVAHKEHSQEVWFQRFVQGDLVGNAWTEVGNVQIGDVVTRVTKDASGNLVVNGEKY
                     YSTGSIFADWIDLFAYDEVNDRHVIAAIYRHETGVSVIDDWDGFGQKTTGSGTLKVHQ
                     VHLPASHLIPFDQRFKYQTAFYQVVHLATLTGIARAAVETFSQEIRERKRIFSHGNGD
                     LVRHDPQVLQVVGKASAQAYASEAITLKTAEALQKAYESHFAESEVKEHQFNVDAELE
                     SAQGQVVISNLVLDLTSQLFNALGASASSQVKQLDRFWRNARTVASHNPLIYKEKVIG
                     DWEVNRTDLPFVWQIGASPRAKSA"
     misc_feature    474391..475521
                     /locus_tag="ABZJ_00431"
                     /note="Dibenzothiophene (DBT) desulfurization enzyme C;
                     Region: DszC; cd01163"
                     /db_xref="CDD:173852"
     misc_feature    474409..475515
                     /locus_tag="ABZJ_00431"
                     /note="sulfur acquisition oxidoreductase, SfnB family;
                     Region: sulfur_SfnB; TIGR04022"
                     /db_xref="CDD:188537"
     misc_feature    order(474805..474807,474811..474813)
                     /locus_tag="ABZJ_00431"
                     /note="Flavin binding site [chemical binding]; other site"
                     /db_xref="CDD:173852"
     gene            complement(475610..476956)
                     /locus_tag="ABZJ_00432"
                     /db_xref="GeneID:12116172"
     CDS             complement(475610..476956)
                     /locus_tag="ABZJ_00432"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter"
                     /protein_id="YP_005524388.1"
                     /db_xref="GI:384141678"
                     /db_xref="GeneID:12116172"
                     /translation="MSNVTSFRSELKQLFHLMLPILITQFAQAGFGLIDTIMAGHLSA
                     ADLAAIAVGVGLWIPVMLLFSGIMIATTPLVAEAKGARNTEQIPVIVRQSLWVAVILG
                     VLAMLILQLMPFFLHVFGVPESLQPKASLFLHAIGLGMPAVTMYAALRGYSEALGHPR
                     PVTVISLLALVVLIPLNMIFMYGLGPIPALGSAGCGFATSILQWLMLITLAGYIYKAS
                     AYRNTSIFSRFDKINLTWVKRILQLGLPIGLAVFFEVSIFSTGALVLSPLGEVFIAAH
                     QVAISVTSVLFMIPLSLAIALTIRVGTYYGEKNWASMYQVQKIGLSTAVFFALLTMSF
                     IALGREQIVSVYTQDINVVPVAMYLLWFAMAYQLMDALQVSAAGCLRGMQDTQAPMWI
                     TLMAYWVIAFPIGLYLARYTDWGVAGVWLGLIIGLSIACVLLLSRLYLNTKRLSQT"
     misc_feature    complement(475616..476956)
                     /locus_tag="ABZJ_00432"
                     /note="multidrug efflux protein; Reviewed; Region:
                     PRK01766"
                     /db_xref="CDD:234981"
     misc_feature    complement(475625..476929)
                     /locus_tag="ABZJ_00432"
                     /note="Subfamily of the multidrug and toxic compound
                     extrusion (MATE)-like proteins similar to Vibrio cholerae
                     NorM; Region: MATE_NorM_like; cd13131"
                     /db_xref="CDD:240536"
     misc_feature    complement(order(475676..475678,475688..475690,
                     475766..475768,475847..475849,475859..475861,
                     476096..476098,476105..476107,476183..476185,
                     476195..476197))
                     /locus_tag="ABZJ_00432"
                     /note="cation binding site [ion binding]; other site"
                     /db_xref="CDD:240536"
     gene            complement(476990..477451)
                     /locus_tag="ABZJ_00433"
                     /db_xref="GeneID:12116173"
     CDS             complement(476990..477451)
                     /locus_tag="ABZJ_00433"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524389.1"
                     /db_xref="GI:384141679"
                     /db_xref="GeneID:12116173"
                     /translation="MMKFSSQLFLILPLAMGIGVAMAFQTAINAQLREQLHSPLQAAL
                     LSFFIGTIVLAIMVFFQSAEKPSLSEISNIPWLLWTGGFLGVYAISMSIYTAPKLGFL
                     TFTGLVVFGQLVISMLLDHFGWLGTEKTPVTWQRFLGGVVIFVGVLLTLQR"
     misc_feature    complement(477005..477424)
                     /locus_tag="ABZJ_00433"
                     /note="Protein of unknown function, DUF606; Region:
                     DUF606; pfam04657"
                     /db_xref="CDD:252723"
     gene            477569..478723
                     /locus_tag="ABZJ_00434"
                     /db_xref="GeneID:12116174"
     CDS             477569..478723
                     /locus_tag="ABZJ_00434"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidase, coproporphyrinogen III
                     oxidase"
                     /protein_id="YP_005524390.1"
                     /db_xref="GI:384141680"
                     /db_xref="GeneID:12116174"
                     /translation="MAVLNPASVPLSLYIHMPWCVRKCPYCDFNSHAVPDGALSAELE
                     QTYLKALVADFETQVEMAQGRSIHSVFIGGGTPSLISAKGYAWLFEQLKSLLNFEDDC
                     EITLEANPGTLEHDPFAGYLEAGINRLSIGVQTFNTDHLQKLGRIHSANNAMDAIEQA
                     RQAGFKRVNVDLMHGLPEQTLEQALYDLKTAVEQGATHISWYQLTIEPNTVFFRTQPV
                     LPQDEVLEDIQEQGEAYLKANGFINYEVSAWRKEQPSAHNLNYWQFGDYLAIGAGAHG
                     KVTRPDGVYRFQKTRLPKDYLAKVPAEHLQMKKIEADELPFEFMMNALRLNDGVKAEL
                     YEQRTGLSLDDLNDLLTSLRSRELLVEDSDRLACTEQGHIFLNSVLEEFL"
     misc_feature    477596..478720
                     /locus_tag="ABZJ_00434"
                     /note="HemN family oxidoreductase; Provisional; Region:
                     PRK05660"
                     /db_xref="CDD:235550"
     misc_feature    477623..478255
                     /locus_tag="ABZJ_00434"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(477626..477628,477632..477634,477638..477640,
                     477644..477652,477785..477787,477791..477796,
                     477887..477895,477962..477964,478085..478087,
                     478175..478180)
                     /locus_tag="ABZJ_00434"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    478505..478684
                     /locus_tag="ABZJ_00434"
                     /note="HemN C-terminal domain; Region: HemN_C; pfam06969"
                     /db_xref="CDD:253997"
     gene            complement(478774..479529)
                     /locus_tag="ABZJ_00435"
                     /db_xref="GeneID:12116175"
     CDS             complement(478774..479529)
                     /locus_tag="ABZJ_00435"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005524391.1"
                     /db_xref="GI:384141681"
                     /db_xref="GeneID:12116175"
                     /translation="MTTHSLKDKVVLITGGAKNLGGLISRKFAEQGAKLAIHYNSSET
                     QADAEQTLADVKALGADAILIQADLTHIENIEKLFIDTKQHFGGIDIAINTVGKVLKK
                     PFLETTEQEFDSMSDINSKIAYFFIQSAGRHLNNGGKICSIVTSLLAAYTGFYSTYEG
                     LKAPVEHYTRAASKEFGDRQISVTAVAPGPMDTPFFYGQESAEAVAYHKSASALGGLT
                     KIEDIEPLVRFLVTDGWWITGQTIFANGGYTTR"
     misc_feature    complement(478777..479529)
                     /locus_tag="ABZJ_00435"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK12744"
                     /db_xref="CDD:183716"
     misc_feature    complement(478783..479514)
                     /locus_tag="ABZJ_00435"
                     /note="Short-chain dehydrogenases/reductases (SDR);
                     Region: SDR; cl21454"
                     /db_xref="CDD:271874"
     misc_feature    complement(order(478957..478968,479044..479046,
                     479056..479058,479095..479103,479239..479247,
                     479407..479415,479470..479472,479476..479481,
                     479485..479487))
                     /locus_tag="ABZJ_00435"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(479044..479046,479056..479058,
                     479095..479097,479173..479175))
                     /locus_tag="ABZJ_00435"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            479642..480538
                     /locus_tag="ABZJ_00436"
                     /db_xref="GeneID:12116176"
     CDS             479642..480538
                     /locus_tag="ABZJ_00436"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005524392.1"
                     /db_xref="GI:384141682"
                     /db_xref="GeneID:12116176"
                     /translation="MDRLQQFYIFTEVAKRQSFSEVANQLDLPRSTVTSAIQQLETHY
                     GVRLFHRTTRKVSLTQDGQRILPECQNLLFDYEQLEQLIQTQKQHYRGTLKISMPSRI
                     VHQVIIPELPDFYHRYPDIHLQLNSSDDLTDLIEKGIDCVVRVGELDNSSLIARFIGH
                     LVMVNCASPQYLQDYGVPEQLNDLEQHKLINYAGAVGEKQGEFIYQGGIVMMDSALSV
                     NNTEAYIAAACAGLGIIQLPYYDVQDKIEQGILVEVLSAYSAPSLPLNILYPNRSYIP
                     KRLEVFMNWVGEVLNRKCIVIF"
     misc_feature    479648..480517
                     /locus_tag="ABZJ_00436"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    479651..479830
                     /locus_tag="ABZJ_00436"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    <479825..>479938
                     /locus_tag="ABZJ_00436"
                     /note="Dock Homology Region 2, a GEF domain, of Dedicator
                     of Cytokinesis proteins; Region: DHR2_DOCK; cl06123"
                     /db_xref="CDD:262791"
     misc_feature    order(479828..479830,479861..479863,479867..479872,
                     479876..479881,479888..479893,479897..479902,
                     479909..479914)
                     /locus_tag="ABZJ_00436"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:212566"
     misc_feature    479915..480508
                     /locus_tag="ABZJ_00436"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_3; cd08472"
                     /db_xref="CDD:176161"
     misc_feature    order(479945..479947,479957..479959,480074..480076,
                     480116..480118,480122..480124,480302..480304,
                     480353..480355,480434..480436)
                     /locus_tag="ABZJ_00436"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176161"
     misc_feature    order(479948..479953,479963..479968,479972..479977,
                     479984..479986,479996..479998,480002..480022,
                     480203..480205,480284..480298,480317..480322,
                     480329..480331)
                     /locus_tag="ABZJ_00436"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176161"
     gene            complement(480602..480677)
                     /locus_tag="ABZJ_tRNA14"
                     /db_xref="GeneID:12116177"
     tRNA            complement(480602..480677)
                     /locus_tag="ABZJ_tRNA14"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:12116177"
     gene            complement(480700..480775)
                     /locus_tag="ABZJ_tRNA15"
                     /db_xref="GeneID:12116178"
     tRNA            complement(480700..480775)
                     /locus_tag="ABZJ_tRNA15"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:12116178"
     gene            complement(481008..482927)
                     /locus_tag="ABZJ_00437"
                     /db_xref="GeneID:12116179"
     CDS             complement(481008..482927)
                     /locus_tag="ABZJ_00437"
                     /codon_start=1
                     /transl_table=11
                     /product="putative very-long-chain acyl-CoA synthetase"
                     /protein_id="YP_005524393.1"
                     /db_xref="GI:384141683"
                     /db_xref="GeneID:12116179"
                     /translation="MVNHENYWTFCPHNLFWIDRKINRIDMSQTTQTDIITLGDVATR
                     LPSFIPKVPHILNGLKQAYLRTSNTPTGLGIAFEKAVKRNPKGTALLFEDQSYSYEAL
                     NEWANQISHYYLSLGARKGDVIAVMIENRSELIATIVGLAKIGVTIALVNTSQVGKVL
                     AHSINLVKPIAVIAGEEVRAAIDEIRQDLNVPKDRFHWFADQATRQNSGTAPEGYVNL
                     ADQIDQFPKFNPSTTRSVTGNDGLFYIYTSGTTGLPKAVIFKHSRWTLAYGTYGHILN
                     LGPDDVMYVTLPLYHATGVVVCWCGVIAGSATLAIRRKYSTSAFWKDVQKFNASAIGY
                     VGELCRYLMDAPVTELDRNHRVTKMIGNGMRPNIWDKFKQRFGVKEVLELYASSEGNV
                     GFSNIFNFDNTVGFSPTPYAIIQFDKEKNEPVRDKNGWCQKVKAGEVGLLIGKITSRS
                     PFDGYTDPEKNKSVIWKDVFKKGDSYFNTGDLVRDIGFRHAQFVDRLGDTFRWKGENV
                     STTEVENMVCEYDKIAEAVVYGVEIPNTNGRAGMAAITLADGEELNDADLTEMVTVFK
                     KCLPTYAVPVFLRVQKKVETTGTFKYQKNKLKEEAFNPSKTSERLLALLPGASSYCDI
                     TTEIFDNIQAYKYRF"
     misc_feature    complement(481011..482825)
                     /locus_tag="ABZJ_00437"
                     /note="long-chain-acyl-CoA synthetase; Validated; Region:
                     PRK08279"
                     /db_xref="CDD:236217"
     misc_feature    complement(481116..482648)
                     /locus_tag="ABZJ_00437"
                     /note="Fatty acid transport proteins (FATP) play dual
                     roles as fatty acid transporters and its activation
                     enzymes; Region: FATP_FACS; cd05940"
                     /db_xref="CDD:213306"
     misc_feature    complement(order(482163..482168,482172..482189,
                     482196..482198))
                     /locus_tag="ABZJ_00437"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213306"
     misc_feature    complement(order(481155..481157,481407..481409,
                     481440..481442,481449..481451,481485..481487,
                     481764..481781,481839..481844,482187..482189))
                     /locus_tag="ABZJ_00437"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213306"
     misc_feature    complement(order(481212..481214,481407..481418,
                     481440..481442,481449..481451,481485..481487,
                     481764..481781,481839..481844,481878..481880,
                     481887..481892,481896..481898,482064..482069,
                     482187..482189))
                     /locus_tag="ABZJ_00437"
                     /note="putative active site [active]"
                     /db_xref="CDD:213306"
     misc_feature    complement(order(481212..481214,481239..481241,
                     481410..481418,481842..481844,481878..481880,
                     481887..481892,482067..482069))
                     /locus_tag="ABZJ_00437"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213306"
     gene            complement(483042..486374)
                     /locus_tag="ABZJ_00438"
                     /db_xref="GeneID:12116180"
     CDS             complement(483042..486374)
                     /locus_tag="ABZJ_00438"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease G and E"
                     /protein_id="YP_005524394.1"
                     /db_xref="GI:384141684"
                     /db_xref="GeneID:12116180"
                     /translation="MKRMLINATHAEEVRVALITGNRLYDFDLENRTREQKKSNIYKG
                     HVTRVEPSLEAVFVEYGAGRQGFLSMREIANSYFQADPRQTSNIRELITEGTELLVQV
                     EKEERGNKGAALSTFISLAGRYLVLMPNNPKGGGISRQISGSVREELKEILASLNVPR
                     GMSVIVRTAGIGRTQEELQLDLQHLLDLWAQIQGTASSGPSPMLVHQEAGVVTRAIRD
                     YLRDDVAEILIDSEQAYNEAYNFVKAVMPRQLDKLKTYTLNEPLFAHFGIESQIQTAY
                     EREVKLPSGGSIVIDQTEALVSIDINSAKSTRGHDVEETALNTNLEAAEEIARQLRLR
                     DIGGLVVIDFIDMTKERNQRMVEAKLREATQSDRARIQFGQLSRFGLMEMSRQRLRPS
                     LEEATGYVCPRCHGTGMVRDLRSLSLSIMHKVEEIALRERHGEVQVEVPVEIAAFLLN
                     EKRHSLVYLEQTSGVRVTVLPHPHLETPHYEIAYNPDGFAPSSYERTEATRSSEKELG
                     YESSEWHLEEADHGHAHVTATASTHAAAQKKANHATQPVAQPSAQKAASPCAWLENLF
                     VQKQAQTVDQSRSAQNAAAAIEQMVNTGAVSRGQFGQVAVPAVAEVAPVQSNNAYISQ
                     SPVKQDVREHVEKDDKSQQQRQNNKKRKHKEQREQHHQSHEQQHQVHEEVVQLSRQEQ
                     RELKRQQKRQQQQDQQHQNNDVQHTENAVPRRDRNNQQRPNRPNRHRDPSVLNENQNT
                     PVVIDEKQIKVDVIDAPKHDVMNTALIINVDQGQSEIVALTPEHRHVERVETTSTEVA
                     QEPTPAPVVAEKAAVVETKEEAQPSQEAAQPQIKRASNDPRMRRRQQREAKHAKAATP
                     SIAPSQIPTLAQHTIGSLIRHVYGEDCTVLIEQFGLVPTFNRALQKFAEQYASTLVVE
                     VTAETEEKKPVTRDAELPSHKPAEEAEPAPVLPLTPPQAPAPRVANDPRERRRLAKLA
                     AEQAFEQVKQQHSAQEEVATPAPVAEETVAAPTAETQATVEPAQQPLELNQSTEVVQP
                     EAAPAEEKATEETVAEAPAAKEPAPSKAASKAKAAAEETVAPTEATTDAESEDVKADK
                     DKPSRPRRPRGRPPKKANPVAE"
     misc_feature    complement(483246..486374)
                     /locus_tag="ABZJ_00438"
                     /note="ribonuclease E; Reviewed; Region: rne; PRK10811"
                     /db_xref="CDD:236766"
     misc_feature    complement(486006..486281)
                     /locus_tag="ABZJ_00438"
                     /note="S1_RNase_E: RNase E and RNase G, S1-like
                     RNA-binding domain. RNase E is an essential
                     endoribonuclease in the processing and degradation of RNA.
                     In addition to its role in mRNA degradation, RNase E has
                     also been implicated in the processing of rRNA, and...;
                     Region: S1_RNase_E; cd04453"
                     /db_xref="CDD:239900"
     misc_feature    complement(order(486084..486086,486096..486098,
                     486246..486248))
                     /locus_tag="ABZJ_00438"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239900"
     misc_feature    complement(order(486012..486014,486042..486047,
                     486054..486056,486063..486065,486174..486176))
                     /locus_tag="ABZJ_00438"
                     /note="oligonucleotide binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239900"
     misc_feature    complement(485205..486020)
                     /locus_tag="ABZJ_00438"
                     /note="Ribonuclease E/G family; Region: RNase_E_G;
                     pfam10150"
                     /db_xref="CDD:255792"
     gene            complement(486561..486677)
                     /locus_tag="ABZJ_00439"
                     /db_xref="GeneID:12116181"
     CDS             complement(486561..486677)
                     /locus_tag="ABZJ_00439"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524395.1"
                     /db_xref="GI:384141685"
                     /db_xref="GeneID:12116181"
                     /translation="MSIPYQTSNKEVTSRPMTVKVINQCTAHPPVKQKGIPI"
     gene            486745..486948
                     /locus_tag="ABZJ_00440"
                     /db_xref="GeneID:12116182"
     CDS             486745..486948
                     /locus_tag="ABZJ_00440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524396.1"
                     /db_xref="GI:384141686"
                     /db_xref="GeneID:12116182"
                     /translation="MSDVYQFTFHNQLELVTYFFEQTELNATVCHFADIISLRRRHNS
                     LGPVRAGDESIILIEVSIREISL"
     gene            487097..488029
                     /locus_tag="ABZJ_00441"
                     /db_xref="GeneID:12116183"
     CDS             487097..488029
                     /locus_tag="ABZJ_00441"
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA pseudouridylate synthase"
                     /protein_id="YP_005524397.1"
                     /db_xref="GI:384141687"
                     /db_xref="GeneID:12116183"
                     /translation="MNSTQQWQSVTWFEVDEHQAGQRIDNFLFSRLKGVPKSRIYRLI
                     REGQVRVNKKRIKAETKLAIGDQIRVAPIRYEQKDETAVPVSDSVAQGLLSRVVYEDE
                     GLLVVNKPSGIAVHGGSGVAYGLIEALRAATGKKYLELIHRIDRDTSGLVMISKKRST
                     LKLLQDMLREHKIRKTYAAIVKGQVSLDKQLIDAPLFRYELANGERRVRVSKEGKPSK
                     TEWVVAERFKNATLVHASPLSGRTHQIRVHGLSIGHPLVGDDKYGHNTAYTGPEARRL
                     CLHAMRLDIPGYPTIEAPLPEDMTQLLEALRVAK"
     misc_feature    487118..488026
                     /locus_tag="ABZJ_00441"
                     /note="23S rRNA pseudouridylate synthase C; Provisional;
                     Region: PRK11025"
                     /db_xref="CDD:182909"
     misc_feature    487160..>487306
                     /locus_tag="ABZJ_00441"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(487163..487165,487199..487204,487208..487213,
                     487217..487222,487229..487234,487238..487240,
                     487259..487264,487265..487279,487283..487285)
                     /locus_tag="ABZJ_00441"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    487406..487951
                     /locus_tag="ABZJ_00441"
                     /note="Pseudouridine synthase, RsuA/RluD family; Region:
                     PseudoU_synth_RluCD_like; cd02869"
                     /db_xref="CDD:211346"
     misc_feature    order(487520..487531,487832..487834)
                     /locus_tag="ABZJ_00441"
                     /note="active site"
                     /db_xref="CDD:211346"
     gene            488026..488700
                     /locus_tag="ABZJ_00442"
                     /db_xref="GeneID:12116184"
     CDS             488026..488700
                     /locus_tag="ABZJ_00442"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="YP_005524398.1"
                     /db_xref="GI:384141688"
                     /db_xref="GeneID:12116184"
                     /translation="MSLKTELVIFDWDGTLYNSVGQIVASLQHAAEEHKLTLTDEAAK
                     SIIGLGLPEVMQTLFPEVPDLHDSILKAYGDHYIANSTNDAWFEGISELLHDLKAQGL
                     KLAVATGKNRRGLDRVIAKTQSTHLFDVTRAANETRSKPDPLMLQEILTVTGVSVEQA
                     VMIGDSSYDLEMAQRLGMPRIGVGYGVHSVEVLQQFQPLTIAKDVPELHNFLREYAKL
                     STVDVA"
     misc_feature    488044..488667
                     /locus_tag="ABZJ_00442"
                     /note="Predicted phosphatases [General function prediction
                     only]; Region: Gph; COG0546"
                     /db_xref="CDD:223620"
     misc_feature    488044..488574
                     /locus_tag="ABZJ_00442"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(488056..488064,488347..488352)
                     /locus_tag="ABZJ_00442"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    488056..488073
                     /locus_tag="ABZJ_00442"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    488347..488349
                     /locus_tag="ABZJ_00442"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            488775..489470
                     /locus_tag="ABZJ_00443"
                     /db_xref="GeneID:12116185"
     CDS             488775..489470
                     /locus_tag="ABZJ_00443"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005524399.1"
                     /db_xref="GI:384141689"
                     /db_xref="GeneID:12116185"
                     /translation="MSRSIRLLNLLQQLRESRYPVTAQVLAERLGISIRSIYRDIDSL
                     RAQGVRIDASAGLGFQLKEDILLPPVTFNENEAEALFLALEWLKDVPDQAMKSAAVSI
                     YSKLYAVLPEHRKYLIDDMTLGVTHYWHPVDEALVEQVRLAIRKQVKIKVDYCDEHKR
                     ISQRSLWPFALGYLHDKVVLAAWCELRQAFRHFRIDRIHDLQMSEEIYPEFKKHLFQR
                     WWKQEMQRTTDKN"
     misc_feature    488820..488951
                     /locus_tag="ABZJ_00443"
                     /note="HTH domain; Region: HTH_11; pfam08279"
                     /db_xref="CDD:254705"
     misc_feature    488835..>489452
                     /locus_tag="ABZJ_00443"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2378"
                     /db_xref="CDD:225253"
     misc_feature    489177..>489464
                     /locus_tag="ABZJ_00443"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            489520..490125
                     /locus_tag="ABZJ_00444"
                     /db_xref="GeneID:12116186"
     CDS             489520..490125
                     /locus_tag="ABZJ_00444"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_005524400.1"
                     /db_xref="GI:384141690"
                     /db_xref="GeneID:12116186"
                     /translation="MSLKLYTNNESRGVVIDWLLVELGVECERIEVAYRTEMKSPEYL
                     KLNPFGKVPVLVDGDVVIYELGAICAYLADKFSDKGLAPALDDPKRGLYYRWLFMMAG
                     PWEAAGVDKALGIEISPEQKMFVGYGDYNDAYQALVQGLSEANPYVCGEQFTAADISV
                     GAMLLWQLKMKTIESHPAIARYVETIKQREGLKQSSMGQLL"
     misc_feature    489526..490086
                     /locus_tag="ABZJ_00444"
                     /note="GSH-dependent disulfide bond oxidoreductase;
                     Provisional; Region: PRK13972"
                     /db_xref="CDD:172475"
     misc_feature    489526..489747
                     /locus_tag="ABZJ_00444"
                     /note="GST_N family, Saccharomyces cerevisiae GTT1-like
                     subfamily; composed of predominantly uncharacterized
                     proteins with similarity to the S. cerevisiae GST protein,
                     GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are
                     cytosolic dimeric proteins involved...; Region:
                     GST_N_GTT1_like; cd03046"
                     /db_xref="CDD:239344"
     misc_feature    order(489553..489555,489559..489564,489568..489573,
                     489580..489585,489715..489717,489724..489729)
                     /locus_tag="ABZJ_00444"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    order(489553..489555,489670..489678,489709..489714)
                     /locus_tag="ABZJ_00444"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    order(489670..489672,489706..489711,489715..489720,
                     489727..489729)
                     /locus_tag="ABZJ_00444"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239344"
     misc_feature    489796..490086
                     /locus_tag="ABZJ_00444"
                     /note="C-terminal, alpha helical domain of an unknown
                     subfamily 8 of Glutathione S-transferases; Region:
                     GST_C_8; cd03207"
                     /db_xref="CDD:198316"
     misc_feature    order(489802..489807,489811..489816,489820..489831,
                     489847..489849,489883..489885,489892..489894,
                     489916..489918,489925..489927,489937..489939)
                     /locus_tag="ABZJ_00444"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198316"
     misc_feature    order(489808..489810,489820..489822,489832..489834,
                     489844..489846,489976..489984,489991..489996,
                     490000..490005,490012..490017)
                     /locus_tag="ABZJ_00444"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198316"
     misc_feature    order(489820..489822,489832..489837,489844..489849,
                     490006..490008,490015..490017)
                     /locus_tag="ABZJ_00444"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198316"
     gene            complement(490184..490861)
                     /locus_tag="ABZJ_00445"
                     /db_xref="GeneID:12116187"
     CDS             complement(490184..490861)
                     /locus_tag="ABZJ_00445"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524401.1"
                     /db_xref="GI:384141691"
                     /db_xref="GeneID:12116187"
                     /translation="MVGLFQHLGRSVQNRPHFFIALIFGVVVASLLAWLTSWKWSTIL
                     LASWNGSISLYLLHVWKLMRSADHSQMQQQAKKQDESKWVIMLIVLLAITMSLVAILV
                     QLSQLPSGHYEKLGHVALALLTIISAWLFMHTVFALHYAHDFYMALSRNEENGGLDFP
                     GTEHPTYPDFLYFSYIIGTSAQTADVSITNKHMRLLNLFHAVLSFGFNTTILAICINV
                     AAGFLTN"
     misc_feature    complement(490220..490753)
                     /locus_tag="ABZJ_00445"
                     /note="Protein of unknown function (DUF1345); Region:
                     DUF1345; pfam07077"
                     /db_xref="CDD:254047"
     gene            complement(491125..492024)
                     /locus_tag="ABZJ_00446"
                     /db_xref="GeneID:12116188"
     CDS             complement(491125..492024)
                     /locus_tag="ABZJ_00446"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005524402.1"
                     /db_xref="GI:384141692"
                     /db_xref="GeneID:12116188"
                     /translation="MELRHLRYFITVAEELNFSKAALKLYTAQPSLSQQIKDLEEDVG
                     VRLLNRTKRKVELTEEGEVFLEHARLTLAQADKAVAMARQVSKAKQQLLRIGFVPIAE
                     MKIFPYVLPNLRLQHPDLTIELSSLNNAEQLKALKRGELDITFTRDNTENDEIQSQFV
                     LTEPLIFLLPRNHPLAKYDRIPVKALHGIDFIIPAAEQSNTLHNTILEFTKTHGIDLN
                     IVQKADSILLNINSIGSGLGCTILPAYVAPLGVSNTVVRPLDVELPSLDLFVSYRKNT
                     ESVGVKRFIDQLNKVFHLDKNLD"
     misc_feature    complement(491134..492024)
                     /locus_tag="ABZJ_00446"
                     /note="DNA-binding transcriptional regulator HcaR;
                     Provisional; Region: PRK09906"
                     /db_xref="CDD:182137"
     misc_feature    complement(491839..492018)
                     /locus_tag="ABZJ_00446"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(491161..491748)
                     /locus_tag="ABZJ_00446"
                     /note="Type 2 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_2; cl21456"
                     /db_xref="CDD:271876"
     misc_feature    complement(order(491320..491325,491329..491334,
                     491350..491367,491647..491667,491671..491673,
                     491683..491685,491692..491697,491701..491706))
                     /locus_tag="ABZJ_00446"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            492759..493811
                     /locus_tag="ABZJ_00447"
                     /db_xref="GeneID:12116189"
     CDS             492759..493811
                     /locus_tag="ABZJ_00447"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase"
                     /protein_id="YP_005524403.1"
                     /db_xref="GI:384141693"
                     /db_xref="GeneID:12116189"
                     /translation="MKDKPTLTYQLPTQSCWTHTWIKPPFCHPELGHENDTRFYNQQP
                     RSPARGSKELLRWLVTRESYTWNVDIQNEYDVRVNTPIALPQNRPHADLDDWQVWFVG
                     HATVLIQIGPYNFITDPVWCDYASPLHGRGPRRVCPAGFALEQLPTIHGVLLSHNHYD
                     HMDLATLEWLHKKFAMPIYTGLGNGFYLPKEFHVIEMDWWQEIPYHELRIVYTPAQHG
                     SGRGLRDQNKALWGGFSVLAKTGHCFFAGDTGYAGHFKQIHTRYGAPRVALLPIGAYE
                     PRKLMSYVHMNPQDAVHAHLDLQAHRSVAIHYRTFQLTDEGREDPEHALAQAIKASSK
                     LANPFYCIREGHKLTV"
     misc_feature    493047..493775
                     /locus_tag="ABZJ_00447"
                     /note="Predicted Zn-dependent hydrolases of the
                     beta-lactamase fold [General function prediction only];
                     Region: COG2220"
                     /db_xref="CDD:225130"
     gene            complement(493878..496034)
                     /locus_tag="ABZJ_00448"
                     /db_xref="GeneID:12116190"
     CDS             complement(493878..496034)
                     /locus_tag="ABZJ_00448"
                     /codon_start=1
                     /transl_table=11
                     /product="catalase (peroxidase I)"
                     /protein_id="YP_005524404.1"
                     /db_xref="GI:384141694"
                     /db_xref="GeneID:12116190"
                     /translation="MSNESKCPFSGHNSKPQVTVGGGTANLHWWPNQLRVDLLNQHSE
                     RSNPLGKDFNYRQEFKKLDYYALKADIKNVLTDSQDWWPADWGNYTGLFIRLAWHAAG
                     TYRMGDGRGGAGRGQQRFAPLNSWPDNASLDKARRLLWPVKQKYGQKISWADLFILAG
                     NIALESSGFRTFGFGAGREDVWEPDNDVNWGDEKEWLAHRNSEALAGSNLAATEMGLI
                     YVNPEGPQASGDPRSAAPFIRATFGNMAMDDEEIVALIAGGHTLGKTHGAASADHVQA
                     DPEGAPIEQMGFGWANSYGTGVGKDAITSGLEVIWSQTPTQWSNYFFENLFKYEWVQE
                     RSPAGAIQWVAADAEAIIPDPFDPSIKRKPTMLTTDLTLRFDPEFEKISRRFLNDPQA
                     FANAFARAWFKLTHRDMGPKARYLGPEVPAEDLIWQDPLPAASATPSSASIADAKAKI
                     VALGLSTGELVSLAWASASTFRGGDKRGGANGARIALSPQREWEVNKKAVETLTKIEE
                     LKASTQLSLADLIVLAGNVGVEQAAQAAGFNITVPFAPGRVDALQSQTDVESFQLLLG
                     LADGFRNWKKQGVNTPAEVLLIDKAQQLTLTAPELTALIGGLRVLGTNWDGSQHGVFT
                     QQVGVLSTDFFTNLLDMSNVWAPVDSTSEVFEGKDRKSGTVKFTATRNDLVFGSNSIL
                     RALAEVYAQADGKEKFVQDFVAAWTKVMNLDRFDLA"
     misc_feature    complement(493881..496031)
                     /locus_tag="ABZJ_00448"
                     /note="catalase/hydroperoxidase HPI(I); Provisional;
                     Region: PRK15061"
                     /db_xref="CDD:237891"
     misc_feature    complement(494760..495974)
                     /locus_tag="ABZJ_00448"
                     /note="Heme-dependent peroxidases similar to plant
                     peroxidases; Region: plant_peroxidase_like; cl00196"
                     /db_xref="CDD:260251"
     misc_feature    complement(order(494832..494834,494844..494846,
                     494928..494930,494934..494936,495234..495251,
                     495255..495260,495267..495272,495309..495311,
                     495369..495377,495741..495743,495750..495755,
                     495759..495764))
                     /locus_tag="ABZJ_00448"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:173823"
     misc_feature    complement(493893..494708)
                     /locus_tag="ABZJ_00448"
                     /note="Heme-dependent peroxidases similar to plant
                     peroxidases; Region: plant_peroxidase_like; cl00196"
                     /db_xref="CDD:260251"
     misc_feature    complement(order(493917..493919,493929..493931,
                     494019..494021,494025..494027,494187..494204,
                     494208..494213,494220..494225,494262..494264,
                     494316..494324,494640..494642,494649..494654,
                     494658..494663))
                     /locus_tag="ABZJ_00448"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:173823"
     gene            complement(496548..498842)
                     /locus_tag="ABZJ_00449"
                     /db_xref="GeneID:12116191"
     CDS             complement(496548..498842)
                     /locus_tag="ABZJ_00449"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="YP_005524405.1"
                     /db_xref="GI:384141695"
                     /db_xref="GeneID:12116191"
                     /translation="MSNMQLDTLRRIVQEINASVSLHESLDIMVNQVAEAMKVDVCSI
                     YLLDERNQRYVLMASKGLNPESVGHVSLQLGEGLVGLVGQREEIVNLDNAPKHERFLY
                     LPETGEEIYNSFLGVPVMYRRKVMGVLVVQNRLPQDFSEAAESFLVTLCAQLSGVIAH
                     AHAVGNIDVFRKPSNGPAYKTFQGVSGAGGVALGRAIILYPPADLGSVPDREAEDISD
                     ELRILDQAISSVRSEIRSLDEKMHDSLMAEERALFSVFLRMLDENALPAEIKELIRDG
                     HWAQGAVRRVIEKHTALFAQMEDDYLRERVSDLKDLGRRILAYLQEEDSSHRELSPDS
                     ILIGEEISTAALVELPVDNIAAIVTSEGAANSHMVIVARALGIPTVVGVTELPVNTLD
                     DAEMIVDAYQGRVFVNPPRRLRQRYKEIQKEDEQIAKDLKQYETKEAITPDGVSVQLF
                     VNTGLMIDVVRGVQRGAQGVGLYRSEIPFMLRERFPGEEEQRAIYRQQLSHFANKPVV
                     MRTLDIGADKDLPYFSIEEENSALGWRGIRFTLDHPEIFSAQIRAMLKASIGLNNLHI
                     LLPMVTTVSEVEEVLYLLERDWIAVQEEEQVKITKPKIGIMVEVPSVLLQIDEFAELV
                     DFFSVGSNDLTQYLLAVDRNNPHVANVYSHFHPSILRALTRLVKECHKYQKPVSICGE
                     MAGDPLSAILLMAMGFNTLSMSSSNILRVRKAICHVPMSDAQKLLDDVMKMNNPLIVK
                     SWLEYYFKTHGLADMVKSNRLVSV"
     misc_feature    complement(496572..498827)
                     /locus_tag="ABZJ_00449"
                     /note="Signal transduction protein containing GAF and PtsI
                     domains [Signal transduction mechanisms]; Region: PtsP;
                     COG3605"
                     /db_xref="CDD:226133"
     misc_feature    complement(498351..498779)
                     /locus_tag="ABZJ_00449"
                     /note="Domain present in phytochromes and cGMP-specific
                     phosphodiesterases; Region: GAF; smart00065"
                     /db_xref="CDD:214500"
     misc_feature    complement(497925..498299)
                     /locus_tag="ABZJ_00449"
                     /note="PEP-utilizing enzyme, N-terminal; Region:
                     PEP-utilizers_N; pfam05524"
                     /db_xref="CDD:253237"
     misc_feature    complement(497637..497855)
                     /locus_tag="ABZJ_00449"
                     /note="PEP-utilizing enzyme, mobile domain; Region:
                     PEP-utilizers; pfam00391"
                     /db_xref="CDD:249825"
     misc_feature    complement(496689..497552)
                     /locus_tag="ABZJ_00449"
                     /note="Pyruvate kinase (PK):  Large allosteric enzyme that
                     regulates glycolysis through binding of the substrate,
                     phosphoenolpyruvate, and one or more allosteric effectors.
                     Like other allosteric enzymes, PK has a high substrate
                     affinity R state and a low...; Region: Pyruvate_Kinase;
                     cl21481"
                     /db_xref="CDD:271901"
     gene            complement(498928..499413)
                     /locus_tag="ABZJ_00450"
                     /db_xref="GeneID:12116192"
     CDS             complement(498928..499413)
                     /locus_tag="ABZJ_00450"
                     /codon_start=1
                     /transl_table=11
                     /product="dinucleoside polyphosphate hydrolase"
                     /protein_id="YP_005524406.1"
                     /db_xref="GI:384141696"
                     /db_xref="GeneID:12116192"
                     /translation="MIDSEGFRPNVGIILANDDGQVLWAKRIGHNAWQFPQGGIQFGE
                     TPEQALFRELREEIGLLPEHVQIIAQTKGWLRYRLPHRYIRSDSDPVCIGQKQKWFLL
                     KLTAPAKNIQLNLADPPEFDEWQWVSYWYPLGQVVNFKRDVYRKAMVELCTQLPVQQL
                     P"
     misc_feature    complement(498961..499398)
                     /locus_tag="ABZJ_00450"
                     /note="Diadenosine tetraphosphate (Ap4A) hydrolase is a
                     member of the Nudix hydrolase superfamily. Members of this
                     family are well represented in a variety of prokaryotic
                     and eukaryotic organisms. Phylogenetic analysis reveals
                     two distinct subgroups where plant...; Region:
                     Ap4A_hydrolase_plant_like; cd03671"
                     /db_xref="CDD:239643"
     misc_feature    complement(order(498994..498999,499003..499005,
                     499129..499131,499153..499158,499165..499167,
                     499177..499179,499183..499185,499243..499248,
                     499255..499257,499300..499305,499312..499314,
                     499333..499335,499384..499386))
                     /locus_tag="ABZJ_00450"
                     /note="putative active site [active]"
                     /db_xref="CDD:239643"
     misc_feature    complement(order(498994..498999,499003..499005,
                     499129..499131,499153..499158,499165..499167,
                     499177..499179,499183..499185,499300..499305,
                     499312..499314,499333..499335,499384..499386))
                     /locus_tag="ABZJ_00450"
                     /note="Ap4A binding site [chemical binding]; other site"
                     /db_xref="CDD:239643"
     misc_feature    complement(499234..499302)
                     /locus_tag="ABZJ_00450"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239643"
     misc_feature    complement(order(499243..499248,499255..499257))
                     /locus_tag="ABZJ_00450"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239643"
     gene            499596..500246
                     /locus_tag="ABZJ_00451"
                     /db_xref="GeneID:12116193"
     CDS             499596..500246
                     /locus_tag="ABZJ_00451"
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase-like family hydrolase"
                     /protein_id="YP_005524407.1"
                     /db_xref="GI:384141697"
                     /db_xref="GeneID:12116193"
                     /translation="MKLALFDLDHTLLNTDSDHSWGEFLVNEGLVDPVHHRQMNDKFY
                     EDYKAGQLDPYAYNEFVFGFLTKHDNNYLTELHQLFMEKVIRPQMRPKGFDAIKKHQD
                     LGHTIVGITATSDFITAPIFREFGITEILATNAEVADGKYTGKVAGLACYQKGKLARL
                     EAWLDGRSVSESWAYSDSINDRFLLEYATHAIAVNPDDRLEKLAQEHNWEIQDWSI"
     misc_feature    499596..500228
                     /locus_tag="ABZJ_00451"
                     /note="Phosphoserine phosphatase [Amino acid transport and
                     metabolism]; Region: SerB; COG0560"
                     /db_xref="CDD:223634"
     misc_feature    499596..500138
                     /locus_tag="ABZJ_00451"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase; pfam00702"
                     /db_xref="CDD:250068"
     gene            complement(500301..500897)
                     /locus_tag="ABZJ_00452"
                     /db_xref="GeneID:12116194"
     CDS             complement(500301..500897)
                     /locus_tag="ABZJ_00452"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane protein"
                     /protein_id="YP_005524408.1"
                     /db_xref="GI:384141698"
                     /db_xref="GeneID:12116194"
                     /translation="MIVKNQYSKIIKIGLYLFITLAILVLVTFIWFKRIRVIFAHHLS
                     LLHCDGQVCVDDPKTQPLAKTLYNQALKETQNKVGAFHQQPTMVFCSTPQCANTFGME
                     KAAAKAIGNLGLLVAPRGWKDFYITHELIHHRQAEEWGNIAMLTKPKWLVEGMAYSLS
                     DDPRPTLSVPFQQWRAQFKLWHQQNPDSNIWLTTEKIK"
     gene            500993..501229
                     /locus_tag="ABZJ_00453"
                     /db_xref="GeneID:12116195"
     CDS             500993..501229
                     /locus_tag="ABZJ_00453"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524409.1"
                     /db_xref="GI:384141699"
                     /db_xref="GeneID:12116195"
                     /translation="MTKNKRTKSKGSNGFFQEFIDQLITAIFGELLIYIIALLFMSAL
                     GGIIFAAICFSWGVLFLLLPFAALIYILVKKYSH"
     gene            complement(501235..502095)
                     /locus_tag="ABZJ_00454"
                     /db_xref="GeneID:12116196"
     CDS             complement(501235..502095)
                     /locus_tag="ABZJ_00454"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005524410.1"
                     /db_xref="GI:384141700"
                     /db_xref="GeneID:12116196"
                     /translation="MNLAAFEAFVKVMETGSISVAADQLFITQPAVTKRIHSLEEYFG
                     VKLFESAGRGVQATHAAHSLLPKVKSWLNELRDIHHTLSHEQTQIQGRLKIGTSHHIG
                     LHHLPAPLKHFVQQFPQVTLDVHFVDSEQAHEQVLAGDLELAFLTLPPSGDERLNYIT
                     IWNDPLVFVAAPFHPLAQKKNLTLQDLIEYPSLLPAAQTYTAQITLAEFEKQGLKPKI
                     TMSNNPLESIRMLVSIGLGWSVLPKTLLNQDMQQLDLNVEMNRQLGMVWHPARTQSRA
                     MQELIKMMQE"
     misc_feature    complement(501238..502095)
                     /locus_tag="ABZJ_00454"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(501910..502089)
                     /locus_tag="ABZJ_00454"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(501244..501822)
                     /locus_tag="ABZJ_00454"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(501394..501399,501403..501408,
                     501424..501441,501718..501738,501742..501744,
                     501754..501756,501763..501768,501772..501777))
                     /locus_tag="ABZJ_00454"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(502213..502467)
                     /locus_tag="ABZJ_00455"
                     /db_xref="GeneID:12116197"
     CDS             complement(502213..502467)
                     /locus_tag="ABZJ_00455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524411.1"
                     /db_xref="GI:384141701"
                     /db_xref="GeneID:12116197"
                     /translation="MVMANIQKFVVNNQRTLKKTLSYYIMHITVAMLVAYFVTGNIWM
                     ALTLSMLEPTVQAFAFFFHEKVWAAKDRRISALSENETTA"
     misc_feature    complement(502264..502419)
                     /locus_tag="ABZJ_00455"
                     /note="Predicted membrane protein (DUF2061); Region:
                     DUF2061; pfam09834"
                     /db_xref="CDD:150497"
     gene            502690..504123
                     /locus_tag="ABZJ_00456"
                     /db_xref="GeneID:12116198"
     CDS             502690..504123
                     /locus_tag="ABZJ_00456"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase (isomerase),
                     subunit with LeuD"
                     /protein_id="YP_005524412.1"
                     /db_xref="GI:384141702"
                     /db_xref="GeneID:12116198"
                     /translation="MEQDDMAGKTLYDKLWDDHVVTQRDDGSCLLYIDRHLLHEVTSP
                     QAFEGLQLAGRQPWRLSANVATPDHNVPTSKKERDQGIAGIEDDTSRIQVQTLDDNCK
                     AFNIVEFGINDIRQGIVHVVGPEQGLTLPGMTVVCGDSHTATHGAFGCLAHGIGTSEV
                     EHVLATQCLVQKKSKNMLVRVDGVLGKGVTPKDVVLAIIGKIGTAGGTGYAIEFGGQV
                     FRDMSIEGRMTVCNMAIEAGARVGMVAVDDKTIEYVKGRSYAPKGEQWEQAVAYWNTL
                     HSDVDAVFDAVVELNGAEIEPQVSWGTSPEMVIPVSKAVPTLEQAKDDVQRNDWTRAY
                     QYMGLNAGQALADIQLDRVFIGSCTNSRIEDIRAAAEVVKGRKVAPSIKQAMIVPGSG
                     LVKQQAEKEGLDKIFLEAGFEWREPGCSMCLAMNADKLQPGEHCASTSNRNFEGRQGN
                     GGRTHLVSPAMAAAAAIAGHFVDVRSF"
     misc_feature    502792..504066
                     /locus_tag="ABZJ_00456"
                     /note="3-isopropylmalate dehydratase catalyzes the
                     isomerization between 2-isopropylmalate and
                     3-isopropylmalate; Region: IPMI; cd01583"
                     /db_xref="CDD:153133"
     misc_feature    order(502804..502806,502813..502815,503104..503109,
                     503956..503958,504013..504015,504028..504030)
                     /locus_tag="ABZJ_00456"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153133"
     misc_feature    order(503110..503112,503761..503763,503944..503946,
                     503953..503958,504010..504012)
                     /locus_tag="ABZJ_00456"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:153133"
     gene            504142..504789
                     /locus_tag="ABZJ_00457"
                     /db_xref="GeneID:12116199"
     CDS             504142..504789
                     /locus_tag="ABZJ_00457"
                     /codon_start=1
                     /transl_table=11
                     /product="isopropylmalate isomerase small subunit"
                     /protein_id="YP_005524413.1"
                     /db_xref="GI:384141703"
                     /db_xref="GeneID:12116199"
                     /translation="MKAYTVEQGIVAPLDRANVDTDLIIPKQFLKSIKRTGFGDNLFD
                     ELRYLDEGYPGQDNSVRPKNPDFVLNQPRYQGATVLIARTNFGCGSSREHAPWALNEY
                     GFRTVIAPSFADIFFNNCFKNGMLPVILPEDIVDQLFKECAAQEGYQLTIDLAAQEVR
                     TPTGEAFKFEVDPFRKHCLLNGLDDIGLTLQNADAIRAYEEKTKQVRPWVFQEIN"
     misc_feature    504181..504603
                     /locus_tag="ABZJ_00457"
                     /note="Aconatase-like swivel domain of 3-isopropylmalate
                     dehydratase and related uncharacterized proteins.
                     3-isopropylmalate dehydratase catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate, via the
                     formation of 2-isopropylmaleate...; Region: IPMI_Swivel;
                     cd01577"
                     /db_xref="CDD:238809"
     misc_feature    504409..504417
                     /locus_tag="ABZJ_00457"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238809"
     gene            504902..505492
                     /locus_tag="ABZJ_00458"
                     /db_xref="GeneID:12116200"
     CDS             504902..505492
                     /locus_tag="ABZJ_00458"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524414.1"
                     /db_xref="GI:384141704"
                     /db_xref="GeneID:12116200"
                     /translation="MKRNVTHSFLLSLCAITLSACQSTYNVVDTVRIKQAEQENLGQN
                     AAIYCSGAKSCEFERLNDITVVDAQTRRISNQAIHQGIVRLNGSVLSQSNSLYLSVPA
                     KQYEVVIRYYPISPDRAETIHVIHQFKANHRYMFKMYRDKSNRSGSLLNVSVPDPLCV
                     DLEQDGRVIRRFCRPFDVTTGLGEFLEQKKLTPRQS"
     gene            505512..506603
                     /locus_tag="ABZJ_00459"
                     /db_xref="GeneID:12116201"
     CDS             505512..506603
                     /locus_tag="ABZJ_00459"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="YP_005524415.1"
                     /db_xref="GI:384141705"
                     /db_xref="GeneID:12116201"
                     /translation="MENFMSKQILILAGDGIGPEIVGAAEKVLNKVNEKFNLSLTWEH
                     GLLGGAAIDAHGEPYPAVTSEQAKKADAILLGAVGGPKWDTIERSIRPERGLLKIRSE
                     LNLFANLRPAILYPQLADASSLKPEIVAGLDILIVRELTGGIYFGQPRGIRELENGEK
                     QGYNTDVYSESEIKRIAKVAFELAGLRGGKVCSVDKANVLEVTELWKQTVTDLQQANY
                     PNIQLSHMYVDNAAMQLVRAPKQFDVIVTGNLFGDILSDEAAMLTGSIGMLPSASLDE
                     NGKGMYEPCHGSAPDIAGQNVANPLATILSVAMMLRYTFREEAAAKAIEDAVGQVLDQ
                     GLRTADIMSEGMTKVGTAEMGEAVVAALA"
     misc_feature    505524..506600
                     /locus_tag="ABZJ_00459"
                     /note="3-isopropylmalate dehydrogenase; Provisional;
                     Region: PRK00772"
                     /db_xref="CDD:234832"
     gene            complement(506657..507064)
                     /locus_tag="ABZJ_00460"
                     /db_xref="GeneID:12116202"
     CDS             complement(506657..507064)
                     /locus_tag="ABZJ_00460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524416.1"
                     /db_xref="GI:384141706"
                     /db_xref="GeneID:12116202"
                     /translation="MNISTLCQMSLLSFMLLNINGCASHPRQSIDLQEYLKNFIGKSS
                     TTIQQDLNLRSLGFQVARTPQKTSDQLIYTILRPLSIPIPMVSNVDMRGGSVPIQSGN
                     LSGNSYDLNFNCKVIFKLKNDIAESIQYEGKAC"
     gene            507233..507601
                     /locus_tag="ABZJ_00461"
                     /db_xref="GeneID:12116203"
     CDS             507233..507601
                     /locus_tag="ABZJ_00461"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524417.1"
                     /db_xref="GI:384141707"
                     /db_xref="GeneID:12116203"
                     /translation="MKKIVFAFLCFGITTVYADNCDSARNTYDDIYCTNKIYASADAD
                     LNKNYQALRAKLNTAQRNTLKKSQLAWIRQRDAECTDSNRNSVDVQCRLQTTQERNHW
                     LQERLRECQTVGCKTSRLSE"
     misc_feature    507284..507562
                     /locus_tag="ABZJ_00461"
                     /note="Protein of unknown function (DUF1311); Region:
                     DUF1311; cl01530"
                     /db_xref="CDD:260983"
     gene            complement(507653..507874)
                     /locus_tag="ABZJ_00462"
                     /db_xref="GeneID:12116204"
     CDS             complement(507653..507874)
                     /locus_tag="ABZJ_00462"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="YP_005524418.1"
                     /db_xref="GI:384141708"
                     /db_xref="GeneID:12116204"
                     /translation="MANKEELIEFEGVVTETLPNTMFRVRLENGHEVIAHISGKMRKH
                     YIRILTGDSVKVEMTPYDLTKGRITYRAR"
     misc_feature    complement(507662..507853)
                     /locus_tag="ABZJ_00462"
                     /note="S1_IF1: Translation Initiation Factor IF1, S1-like
                     RNA-binding domain. IF1 contains an S1-like RNA-binding
                     domain, which is found in a wide variety of RNA-associated
                     proteins. Translation initiation includes a number of
                     interrelated steps preceding the...; Region: S1_IF1;
                     cd04451"
                     /db_xref="CDD:239898"
     misc_feature    complement(order(507674..507676,507680..507682,
                     507731..507742,507755..507760,507767..507769,
                     507803..507805,507821..507829))
                     /locus_tag="ABZJ_00462"
                     /note="rRNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239898"
     misc_feature    complement(order(507662..507664,507755..507757,
                     507767..507769))
                     /locus_tag="ABZJ_00462"
                     /note="predicted 30S ribosome binding site; other site"
                     /db_xref="CDD:239898"
     gene            508124..509149
                     /locus_tag="ABZJ_00463"
                     /db_xref="GeneID:12116205"
     CDS             508124..509149
                     /locus_tag="ABZJ_00463"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC-type DNA-binding domain-containing protein"
                     /protein_id="YP_005524419.1"
                     /db_xref="GI:384141709"
                     /db_xref="GeneID:12116205"
                     /translation="MEGHCVGQLTDASVVLRFGYQAIRRAGLPTEEILTKAGVALNQV
                     DTNARTPLSAQYAFWTAAQEVSKDPDIGLHLGEHLPLYRGQVIEHLFISSETFGEGLK
                     RALAYQRLISDAFDAKLVVEDGRCYLTNGEQVGADNLVNRHFSECAISGVLRFFKFIT
                     EGQFHPIFIDFNFSEGASEDEYFRVYGCPVSLGQKETRLYFDPAILDFQLWQAEPELL
                     QLHEQLAIEKLQELARYDLVGEVRRAIGSTLESGETTLETVAAQLNITPRRLRTQLSE
                     ANTSFQQILSDYRCRLAKKLLANTNESVERIVYLTGFSEPSTFYRAFKRWTNETPVEY
                     RKRKQHR"
     misc_feature    508202..508744
                     /locus_tag="ABZJ_00463"
                     /note="Arabinose-binding domain of AraC transcription
                     regulator, N-term; Region: Arabinose_bd; pfam12625"
                     /db_xref="CDD:257172"
     misc_feature    508772..509146
                     /locus_tag="ABZJ_00463"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    509021..509131
                     /locus_tag="ABZJ_00463"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(509169..509966)
                     /locus_tag="ABZJ_00464"
                     /db_xref="GeneID:12116206"
     CDS             complement(509169..509966)
                     /locus_tag="ABZJ_00464"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridylate synthase"
                     /protein_id="YP_005524420.1"
                     /db_xref="GI:384141710"
                     /db_xref="GeneID:12116206"
                     /translation="MQRYAVGIEFSGIQYRGWQTQQPGVASVQETIELVLSKIADEPI
                     TLHGAGRTDAGVHATNMVAHFDTNAIRPERGWIMGANSQLPKDISIQWIKQMDEEFHA
                     RFKATARRYRYVVYNAPHRPALLHKQVTHIYQKLDVQKMIKAASKFEGTHNFETFRAA
                     ACQSNQPVRHVKHCRLFEHGRYLVLDIQADGFLHHMVRNIMGCLLEIGQGMYEIDHID
                     AMFAAEDRKAAGITAPPDGLYFIQCYYPEQFDLPQPPLGPHWLNLPE"
     misc_feature    complement(509232..509966)
                     /locus_tag="ABZJ_00464"
                     /note="tRNA pseudouridine synthase A; Validated; Region:
                     truA; PRK00021"
                     /db_xref="CDD:234577"
     misc_feature    complement(509232..509951)
                     /locus_tag="ABZJ_00464"
                     /note="Eukaryotic and bacterial pseudouridine synthases
                     similar to E.  coli TruA; Region: PseudoU_synth_EcTruA;
                     cd02570"
                     /db_xref="CDD:211337"
     misc_feature    complement(order(509694..509717,509724..509726,
                     509940..509942))
                     /locus_tag="ABZJ_00464"
                     /note="dimerization interface 3.5A [polypeptide binding];
                     other site"
                     /db_xref="CDD:211337"
     misc_feature    complement(order(509373..509375,509808..509819))
                     /locus_tag="ABZJ_00464"
                     /note="active site"
                     /db_xref="CDD:211337"
     gene            complement(509981..510952)
                     /locus_tag="ABZJ_00465"
                     /db_xref="GeneID:12116207"
     CDS             complement(509981..510952)
                     /locus_tag="ABZJ_00465"
                     /codon_start=1
                     /transl_table=11
                     /product="putative L-asparaginase I (AnsA)"
                     /protein_id="YP_005524421.1"
                     /db_xref="GI:384141711"
                     /db_xref="GeneID:12116207"
                     /translation="MKKIALFYMGGTFGCIGEPLAPMPYDQFLPQLEKVIPPHLTVHC
                     FAAPNIVDSSACTAPDWLRLIQRIQQLQLEGYQHFVVIHGTDTLSYAAATLARFLGQS
                     CHIVITGSQYPLLNIQGDNTREFTDAIENLYLALEQVIALPVGAYLAFHHQVFHAQTA
                     LKTHTTELDAFSGLSSNVEFTPQQNELIVQDAQIEKAASFQILNWMMQPIATQHLVQQ
                     LRHLLPAPPHFLVLQGFGTGNIAVNDEFLATLDELYTRGCVPILATQVTFGGMDQRYA
                     ISAWAKTAKIVINDAHSHADLYAKALQIYLKYPTPEQWLNHWNENLH"
     misc_feature    complement(510011..510949)
                     /locus_tag="ABZJ_00465"
                     /note="Type I (cytosolic) bacterial L-asparaginase;
                     Region: L-asparaginase_I; cd08963"
                     /db_xref="CDD:199207"
     misc_feature    complement(order(510467..510469,510623..510625,
                     510695..510703,510791..510796,510917..510922))
                     /locus_tag="ABZJ_00465"
                     /note="active site"
                     /db_xref="CDD:199207"
     misc_feature    complement(order(510047..510049,510059..510061,
                     510071..510073,510128..510130,510137..510151,
                     510158..510160,510230..510232,510242..510250,
                     510254..510256,510281..510286,510293..510295,
                     510302..510307,510311..510313,510323..510349,
                     510452..510469,510617..510622,510683..510685,
                     510692..510697,510770..510775,510779..510799,
                     510809..510811,510893..510901,510917..510919))
                     /locus_tag="ABZJ_00465"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199207"
     gene            complement(511011..512273)
                     /locus_tag="ABZJ_00466"
                     /db_xref="GeneID:12116208"
     CDS             complement(511011..512273)
                     /locus_tag="ABZJ_00466"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524422.1"
                     /db_xref="GI:384141712"
                     /db_xref="GeneID:12116208"
                     /translation="MLYVIPFIILLVVAVILKKRENSQKQEATSPKNINRKSGKKASA
                     KSSKSSREKTKAKVIEENTPAIPQSNPVPEALRHNIQQLIQEKQFSAAEAQVNQALKK
                     DNTQHELYLLLLEIHIAQKDEFAIQQLISHIRSLGLNEIAAQAETRQKEYESSRQPDA
                     IDFPQAQTYEEPKNTDTTAQFDELTTSSSEASFDDLQKDYTPVKQEPAVEIEPLEFNF
                     SFEQTSATENTNQPAQQPELSSTQETNELADLEFSFDLAPLHGTEEKSQPVELKADQE
                     NSINALDFNFDLNPSSSETKSVEQAPSLDEIKLVEQTPLEAASIAPLEFSLDEPALVP
                     APELETQSHIDVVNEAATQTQIEDPLLEAFPELKQINENELDLKLAEQYIKFGANQAA
                     CNLLQGDEQKFNTEQQQHAKNLLNRIAS"
     gene            complement(512452..513696)
                     /locus_tag="ABZJ_00467"
                     /db_xref="GeneID:12116209"
     CDS             complement(512452..513696)
                     /locus_tag="ABZJ_00467"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524423.1"
                     /db_xref="GI:384141713"
                     /db_xref="GeneID:12116209"
                     /translation="MTAYNKLKIAIFTIMSSPSIYAITLDPIQIQSAPGELLYAEMNF
                     QQADPNTPLQVSLATQDDLNGLGVTHQPPGNLNFYTRQNGQGSGVIVITSSRPIIDPE
                     LNIVVKVSEGNATRLQHIKTVLKPSPIKKAAMNESPLSPQFIVNEKDIALNLPESTQY
                     TSTENTSTVAETTSNEHNLNISTGTAPALNSSSPAPVAPFTEKPSTQTLQPTIATMNT
                     ESSAVEKQPSTSLKSSDGNQTTTVKKAAQSKTAQQKNVLSKNTPKKQKISAYKGPAPT
                     GKYVVQRNESLWSIANRIAAQTKQPVAKIMRDIQAQNRHAFIQGDVNRLRQGSSLNLT
                     TNTTKASHLKPKSSEAHLAKPSSGRAKYRLQQAEMSIVAENSPNSAHGSAKKSTQQSQ
                     NNTELAVKVMTTRKKTVHYKGM"
     misc_feature    complement(512596..512844)
                     /locus_tag="ABZJ_00467"
                     /note="FimV N-terminal domain; Region: FimV_core;
                     TIGR03505"
                     /db_xref="CDD:132544"
     gene            complement(513845..515026)
                     /locus_tag="ABZJ_00468"
                     /db_xref="GeneID:12116210"
     CDS             complement(513845..515026)
                     /locus_tag="ABZJ_00468"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="YP_005524424.1"
                     /db_xref="GI:384141714"
                     /db_xref="GeneID:12116210"
                     /translation="MSTFDTLNSPFNNFNAPRQNDMKVGLVGWRGMVGSVLMQRMVEE
                     NDFAHIEPFYFSTSNAGGEAPSFGGKTAPALMEATDITSLKQMDVIITCQGGDYTSEV
                     FPKLKATGWDGYWIDAASTLRMTDDAIIVLDPVNLNVIKDGLAKGTKTFVGGNCTVSL
                     MLMGVGALFQNNLVEWMTAMTYQAASGAGAQNMRELLTGMGYLYNNTKTLLDDPKSAI
                     LDIDRQVAELQRGEGFPSANFGVPLAGSLIPYIDKQLESGQSKEEWKGQVETNKILGN
                     SQIVPIDGHCVRIGAMRCHSQALTIKLKKDVPLDEIEDMIRNSNQWAKVVPNTREASM
                     TDLTPVAVTGTLTVPVGRLRKLNMGKEYLGAFTVGDQLLWGAAEPLRRMLRILVEYKS
                     S"
     misc_feature    complement(513860..514963)
                     /locus_tag="ABZJ_00468"
                     /note="aspartate-semialdehyde dehydrogenase; Reviewed;
                     Region: PRK06598"
                     /db_xref="CDD:235839"
     misc_feature    complement(514601..514960)
                     /locus_tag="ABZJ_00468"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; smart00859"
                     /db_xref="CDD:214863"
     misc_feature    complement(513905..514510)
                     /locus_tag="ABZJ_00468"
                     /note="Semialdehyde dehydrogenase, dimerization domain;
                     Region: Semialdhyde_dhC; pfam02774"
                     /db_xref="CDD:251521"
     gene            515153..516274
                     /locus_tag="ABZJ_00469"
                     /db_xref="GeneID:12116211"
     CDS             515153..516274
                     /locus_tag="ABZJ_00469"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524425.1"
                     /db_xref="GI:384141715"
                     /db_xref="GeneID:12116211"
                     /translation="MIYIEVLAVVVIWLSFWSLIPRDEWWFRGADFPRLQILFIGLIA
                     LIGMLFWPTEWDVWRELLLAVLIAAIAYQLKMVLPYTLFWKKQVKKVKQHQLDPTKQI
                     SLIVSNVLTPNDKYHLLLEHVRTLKPDLLLTLESDTTWENALKEIEKDYPYRVPVPLD
                     NLYGMHLYSRLPLKNTEVKFILSNEIPSIHTTVILRSGMPVQLYCLHPKPPSPTEAKD
                     STLRDAELLIVGDQIKDLDESCIVMGDLNDVAWSRTTRLFQRISGLLDPRVGRHFINT
                     FHADYPLLRWSLDHIFHSTDFGLVKMQRLSHIGSDHFPVYVVLQTGRIFEEIHEELEQ
                     TQADEEEAQAAIQEGIAKAEKEEKIVTDEIAQPYKEKNI"
     misc_feature    515207..516121
                     /locus_tag="ABZJ_00469"
                     /note="Exonuclease-Endonuclease-Phosphatase (EEP) domain
                     superfamily; Region: EEP; cl00490"
                     /db_xref="CDD:260458"
     misc_feature    order(515555..515557,515771..515773,515885..515887,
                     515891..515893,516017..516019,516083..516088)
                     /locus_tag="ABZJ_00469"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197306"
     misc_feature    order(515555..515557,516083..516085)
                     /locus_tag="ABZJ_00469"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197306"
     misc_feature    order(515771..515773,515891..515893,516086..516088)
                     /locus_tag="ABZJ_00469"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197306"
     gene            516946..518250
                     /locus_tag="ABZJ_00470"
                     /db_xref="GeneID:12116212"
     CDS             516946..518250
                     /locus_tag="ABZJ_00470"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+-dicarboxylate symporter"
                     /protein_id="YP_005524426.1"
                     /db_xref="GI:384141716"
                     /db_xref="GeneID:12116212"
                     /translation="MHKDCLMKNFKFSLAWQILIALILGIVVGAVLHNQPEIKDSIVN
                     NVLTPLGKIFISLIKMIVIPIVFSTLILGIAGVGSTKSLGRLGFKTILYFEIITTIAI
                     LVGLFAANIFHPGSGIDMSQLVQTDISQYKHTTEEVQSQSHGIIQTILSLIPTNIISS
                     MAHGEMLPVIFFAVLFGIGLSSLPATTKDPLLNVFHAVSETMFRVTHIIMKYAPVGVF
                     GLIAVTVANFGFASLIPLGKLVVLVYGAILFFALVVLGITAKMFSINIFTLFKILKDE
                     LILAYSTASSETVLPRIMQKMEAYGAPKAISSFVIPTGYSFNLDGSTLYQSIAAIFIA
                     QLYGIEMTISQQVILVVTLMITSKGIAGVPGVSFVVLLATLGSVGIPVEGLAFIAGVD
                     RIMDMARTALNVVGNALAVLVISKWEKQYDYEKAAAYEASLK"
     misc_feature    516964..518247
                     /locus_tag="ABZJ_00470"
                     /note="glutamate/aspartate:proton symporter; Provisional;
                     Region: gltP; PRK11283"
                     /db_xref="CDD:183075"
     gene            complement(518307..519407)
                     /locus_tag="ABZJ_00471"
                     /db_xref="GeneID:12116213"
     CDS             complement(518307..519407)
                     /locus_tag="ABZJ_00471"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="YP_005524427.1"
                     /db_xref="GI:384141717"
                     /db_xref="GeneID:12116213"
                     /translation="MKVMQLLPELNSGGVERGTLEIARALVAQGHQSLVVSNGGRLVS
                     QLEAEGSTHLTLPIHKKSLSSLWQIRPLRQLIEEHQPDIVHVRSRVPAWLTHFALRKI
                     PANKRPHLISTVHGFYSVNRYSAIMTQAEKVIAVSDSVVKYITDHYKNCPPQDIVRIY
                     RGIDPAAFPHNYQPSAQWFNQVFNDFPELENKFLLCLPGRITRLKGHESLIELMQKLG
                     EQYPQLHAVVVGGADVKKQAYLSELQNTIQSKGLADKITFVGHRSDIREWLAFSDIVL
                     SLSNQAETFGRTALEALSVGTPVIGWNRGGVAEILSHVYPQGLVEAENEKALVETVKN
                     HIEQPQTVAPVTMFSLKDMCDQTLELYQSVLK"
     misc_feature    complement(518310..519407)
                     /locus_tag="ABZJ_00471"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(518316..519398)
                     /locus_tag="ABZJ_00471"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. WavL in Vibrio cholerae
                     has been shown to be involved in the biosynthesis of the
                     lipopolysaccharide core; Region: GT1_WavL_like; cd03819"
                     /db_xref="CDD:99989"
     misc_feature    complement(order(518532..518534,518613..518615,
                     518808..518816,519366..519368))
                     /locus_tag="ABZJ_00471"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99989"
     gene            complement(519673..520608)
                     /locus_tag="ABZJ_00472"
                     /db_xref="GeneID:12116214"
     CDS             complement(519673..520608)
                     /locus_tag="ABZJ_00472"
                     /codon_start=1
                     /transl_table=11
                     /product="lauroyl/myristoyl acyltransferase"
                     /protein_id="YP_005524428.1"
                     /db_xref="GI:384141718"
                     /db_xref="GeneID:12116214"
                     /translation="MSQKQPYTPGEFQWSFLLPKYWGVWIAITFLMLLAILPWAIQWR
                     LAHGLANLAWKYLKSRRKTTIRNLEVCFPEWTPEKVQQQAKQVFVDMMLGIFETLNAW
                     YKPYWFKNRVTIEGLEHITNAQAQGKGVLLLGTHSTLLDAGGYVCAQYFEPDVVYRPQ
                     NNPLLDMLIYRCRGTIYKAQIDHDDMRGLIRHLKEGDAIWYSPDQDFGLKQGIMAPFF
                     GVPAATVTAHRRLLKISKAVAVPLYFYRHGDVQDPKYHILIEPAVDNMPSEDEVDDAT
                     RVNKIIENQLRIAPTQYMWFHRRFKTRPEGYEEIY"
     misc_feature    complement(519706..520284)
                     /locus_tag="ABZJ_00472"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LABLAT-like; Region:
                     LPLAT_LABLAT-like; cd07984"
                     /db_xref="CDD:153246"
     misc_feature    complement(order(519988..519996,520129..520140,
                     520186..520188,520192..520194,520201..520203))
                     /locus_tag="ABZJ_00472"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153246"
     gene            complement(520728..521360)
                     /locus_tag="ABZJ_00473"
                     /db_xref="GeneID:12116215"
     CDS             complement(520728..521360)
                     /locus_tag="ABZJ_00473"
                     /codon_start=1
                     /transl_table=11
                     /product="putative threonine efflux protein"
                     /protein_id="YP_005524429.1"
                     /db_xref="GI:384141719"
                     /db_xref="GeneID:12116215"
                     /translation="MLDLSQILAFGFICLAMVLTPGPNMIYLISRSISQGKIAGFISL
                     GGVAVGFVFYMLCASFGITALVVAVPYAYDTIRIAGAMYLLWLAWKALRPNAAPIFNI
                     KDLAVDSPLKLFLMGFLTNLLNPKIAIMYLSLLPQFIHPQQGSILAQSIQLGTIQIFV
                     SVSVNALIVFSAGSIALFLQKKPLWASIQRWVMGTVLAGLAVRILLEHRR"
     misc_feature    complement(520734..521354)
                     /locus_tag="ABZJ_00473"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            complement(521506..523416)
                     /locus_tag="ABZJ_00474"
                     /db_xref="GeneID:12116216"
     CDS             complement(521506..523416)
                     /locus_tag="ABZJ_00474"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_005524430.1"
                     /db_xref="GI:384141720"
                     /db_xref="GeneID:12116216"
                     /translation="MAYITLRDVQLAFGGPALLDGANFNLERGERVCLIGRNGEGKST
                     LLKLIEGSLLPDSGEVSVQNGLTVSMLAQDVPMSSGKVADIVAEGAGEAAAVLKAYHE
                     ASDACVLGDMEACDRMGSLQHKLDQLDGWALENKVNTILGKMELDPNADLADLSGGRK
                     RRVLLARALLTQPDVLLLDEPTNHLDVESIEWLEKFLLDQNNLTLLFISHDRSFVDRL
                     ATRIVELDRGILRSYEGNYSRYLDLKAQQLEAEEKQNALFEKKLAEEEAWIRQGIKAR
                     RTRNEGRVRALKALREESKARRFQQSKVNMGVQEAQRSGKLVFDIEHLSVSYDGQTLI
                     RDFSAIVMRGDRIGLVGDNGVGKTTLIKAILGEVQHEGVVKTGTQLEIAYFDQLRNQL
                     DLEKSVSENVSEGSDFVDVNGQRRHILSYLQDFLFSPERARTPVKALSGGERNRVLLA
                     KLLLKPSNLIVMDEPTNDLDMVTLELLEEMLSEYKGTLLLISHDRAFMDNVVTSTWVF
                     DGKGGIAEYIGGYQDYLIQRPNERVVDQKGDVKKAQAKAEAEKNAAQTNVKKVKLSYK
                     DQRELEQLPAEIEKLENEQAELSDKLADGSWFVTDADAATKASQRLAEIEELLLEKLE
                     RWDELEQMGKGN"
     misc_feature    complement(521509..523416)
                     /locus_tag="ABZJ_00474"
                     /note="ABC transporter ATPase component; Reviewed; Region:
                     PRK11147"
                     /db_xref="CDD:236861"
     misc_feature    complement(522733..523407)
                     /locus_tag="ABZJ_00474"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    complement(522523..522750)
                     /locus_tag="ABZJ_00474"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    complement(521881..522456)
                     /locus_tag="ABZJ_00474"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     gene            523449..523694
                     /locus_tag="ABZJ_00475"
                     /db_xref="GeneID:12116217"
     CDS             523449..523694
                     /locus_tag="ABZJ_00475"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005524431.1"
                     /db_xref="GI:384141721"
                     /db_xref="GeneID:12116217"
                     /translation="MTKPPYHDDQASFSAPIEDLQVRIAFLDDLVEELNQQLAIQTLE
                     IADLKKQMQLLYQRVESADLSEGVAPFDPLTNKPPHY"
     misc_feature    523482..523691
                     /locus_tag="ABZJ_00475"
                     /note="SlyX; Region: SlyX; pfam04102"
                     /db_xref="CDD:252374"
     gene            complement(523742..524785)
                     /locus_tag="ABZJ_00476"
                     /db_xref="GeneID:12116218"
     CDS             complement(523742..524785)
                     /locus_tag="ABZJ_00476"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH:quinone reductase"
                     /protein_id="YP_005524432.1"
                     /db_xref="GI:384141722"
                     /db_xref="GeneID:12116218"
                     /translation="MIKLSTRGMMIMKAVAYQKAGPITSPEALVDIEIDTPVAKGHDL
                     LVRVQAVSVNPVDTKIRKNVSAEQSGWKVLGWDAVGTVEAIGDKVTQFKIGDVVWYAG
                     ALNRQGSNSELQLVDERIVGHKPKTLEVTEAAALPLTAITAWEMLFDRLQVPKTAPTN
                     TTILVIGGAGGVGSITIQLLKQLTNLTIIATASRPETKEWVEQLGADYVLDHRQPLAA
                     QIKQLGLSAPLYVFSTTETDQHLSDIVELIAPQGHFGLIDDPDQLDIKPFKSKSVSVH
                     WEFMFTRSMFQTEDMEKQSELLNEVSKLVDEGKIKTTVTQVLSPINAENLTRVHEQIE
                     SGSTKGKIVLHGF"
     misc_feature    complement(523754..524752)
                     /locus_tag="ABZJ_00476"
                     /note="Arginate lyase and other MDR family members;
                     Region: AL_MDR; cd08252"
                     /db_xref="CDD:176214"
     misc_feature    complement(523745..524749)
                     /locus_tag="ABZJ_00476"
                     /note="zinc-binding alcohol dehydrogenase family protein;
                     Region: adh_fam_1; TIGR02817"
                     /db_xref="CDD:234024"
     misc_feature    complement(order(523946..523954,524012..524017,
                     524075..524077,524081..524086,524150..524152,
                     524195..524197,524207..524212,524267..524272,
                     524276..524287,524360..524362,524372..524374,
                     524609..524611,524618..524626))
                     /locus_tag="ABZJ_00476"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xr