GenomeNet

Database: RefSeq
Entry: NC_017172
LinkDB: NC_017172
Original site: NC_017172 
LOCUS       NC_017172              20301 bp    DNA     circular CON 17-DEC-2014
DEFINITION  Acinetobacter baumannii MDR-ZJ06 plasmid pMDR-ZJ06, complete
            sequence.
ACCESSION   NC_017172
VERSION     NC_017172.1  GI:384145110
DBLINK      BioProject: PRJNA158685
KEYWORDS    RefSeq.
SOURCE      Acinetobacter baumannii MDR-ZJ06
  ORGANISM  Acinetobacter baumannii MDR-ZJ06
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii
            complex.
REFERENCE   1  (bases 1 to 20301)
  AUTHORS   Zhou,H., Zhang,T., Yu,D., Pi,B., Yang,Q., Zhou,J., Hu,S. and Yu,Y.
  TITLE     Genomic Analysis of the Multidrug-Resistant Acinetobacter baumannii
            Strain MDR-ZJ06 Widely Spread in China
  JOURNAL   Antimicrob. Agents Chemother. 55 (10), 4506-4512 (2011)
   PUBMED   21788470
REFERENCE   2  (bases 1 to 20301)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 20301)
  AUTHORS   Zhang,T. and Yu,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2010) Key Laboratory of Diagnosis and Treatment
            for Infectious Disease, The 1st Affiliated Hospital of School of
            Medicine, Zhejiang University, 79 Qingchun Road, Hangzhou, Zhejiang
            310003, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP001938.
            Acinetobacter baumannii isolates MDR-ZJ06 studied here was obtained
            from a case in a hospital in Zhejiang of China in 2006; bacteria
            are available from the Key Laboratory of Diagnosis and Treatment
            for Infectious Disease.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..20301
                     /organism="Acinetobacter baumannii MDR-ZJ06"
                     /mol_type="genomic DNA"
                     /strain="MDR-ZJ06"
                     /db_xref="taxon:497978"
                     /plasmid="pMDR-ZJ06"
                     /country="China: Zheijiang"
                     /collection_date="2006"
     gene            complement(145..540)
                     /locus_tag="ABZJ_p00001"
                     /db_xref="GeneID:12117435"
     CDS             complement(145..540)
                     /locus_tag="ABZJ_p00001"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527820.1"
                     /db_xref="GI:384145111"
                     /db_xref="GeneID:12117435"
                     /translation="MIEIQILDPQLQTLTDPHARSIQKLGEQTMLAFQKTEDANHFIR
                     GQHHRQAPRRPRSSDLLKPGQIRAQHLAVEEQQGRQCLTMRGDRNLALVRQPGQKCLD
                     FAAAQGCRVTHTVETDEGTNPVDISLFGS"
     gene            complement(592..804)
                     /locus_tag="ABZJ_p00002"
                     /db_xref="GeneID:12117436"
     CDS             complement(592..804)
                     /locus_tag="ABZJ_p00002"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527821.1"
                     /db_xref="GI:384145112"
                     /db_xref="GeneID:12117436"
                     /translation="MATHDTAPWIGRMRVLRKNPEPRPGMPGARILPLKGVGKRNAAA
                     ALGLVLQPPCPCTRQLLAQAGCQALG"
     gene            complement(905..1621)
                     /locus_tag="ABZJ_p00003"
                     /db_xref="GeneID:12117437"
     CDS             complement(905..1621)
                     /locus_tag="ABZJ_p00003"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005527822.1"
                     /db_xref="GI:384145113"
                     /db_xref="GeneID:12117437"
                     /translation="MELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGV
                     NVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSR
                     GRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRC
                     PSDVEHRQIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQAS
                     AFYYGDPLGEMRLVSRVFEM"
     misc_feature    complement(968..1609)
                     /locus_tag="ABZJ_p00003"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3316"
                     /db_xref="CDD:225853"
     misc_feature    complement(<1433..1597)
                     /locus_tag="ABZJ_p00003"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl21459"
                     /db_xref="CDD:271879"
     misc_feature    complement(1061..1387)
                     /locus_tag="ABZJ_p00003"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(1722..2537)
                     /locus_tag="ABZJ_p00004"
                     /db_xref="GeneID:12117438"
     CDS             complement(1722..2537)
                     /locus_tag="ABZJ_p00004"
                     /codon_start=1
                     /transl_table=11
                     /product="AphA1-IAB"
                     /protein_id="YP_005527823.1"
                     /db_xref="GI:384145114"
                     /db_xref="GeneID:12117438"
                     /translation="MSHIQRETSCSRPRLNSNLDADLYGYRWARDNVGQSGATIYRLY
                     GKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIP
                     GKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGL
                     VDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVG
                     RVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     misc_feature    complement(1725..2462)
                     /locus_tag="ABZJ_p00004"
                     /note="Aminoglycoside 3'-phosphotransferase; Region: APH;
                     cd05150"
                     /db_xref="CDD:270699"
     misc_feature    complement(1767..2459)
                     /locus_tag="ABZJ_p00004"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    complement(order(1725..1727,1731..1736,1824..1826,
                     1833..1838,1890..1895,1923..1925,1929..1934,1944..1946,
                     2034..2048,2223..2225,2235..2246,2292..2294,2373..2375,
                     2379..2381,2418..2420,2433..2441,2445..2447))
                     /locus_tag="ABZJ_p00004"
                     /note="active site"
                     /db_xref="CDD:270699"
     misc_feature    complement(order(1890..1895,1923..1925,1929..1934,
                     2223..2225,2235..2246,2373..2375,2379..2381,2418..2420,
                     2433..2435,2445..2447))
                     /locus_tag="ABZJ_p00004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270699"
     misc_feature    complement(order(1725..1727,1731..1736,1824..1826,
                     1833..1838,1944..1946,2034..2048))
                     /locus_tag="ABZJ_p00004"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:270699"
     gene            complement(2791..3507)
                     /locus_tag="ABZJ_p00005"
                     /db_xref="GeneID:12117439"
     CDS             complement(2791..3507)
                     /locus_tag="ABZJ_p00005"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005527824.1"
                     /db_xref="GI:384145115"
                     /db_xref="GeneID:12117439"
                     /translation="MELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGV
                     NVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSR
                     GRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRC
                     PSDVEHRQIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQAS
                     AFYYGDPLGEMRLVSRVFEM"
     misc_feature    complement(2854..3495)
                     /locus_tag="ABZJ_p00005"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3316"
                     /db_xref="CDD:225853"
     misc_feature    complement(<3319..3483)
                     /locus_tag="ABZJ_p00005"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl21459"
                     /db_xref="CDD:271879"
     misc_feature    complement(2947..3273)
                     /locus_tag="ABZJ_p00005"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            3486..4313
                     /locus_tag="ABZJ_p00006"
                     /db_xref="GeneID:12117440"
     CDS             3486..4313
                     /locus_tag="ABZJ_p00006"
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiator protein"
                     /protein_id="YP_005527825.1"
                     /db_xref="GI:384145116"
                     /db_xref="GeneID:12117440"
                     /translation="MGSCAAPSAKGDDKFITTDYLQQCRVHRNTAYQALKDACDDLFA
                     RQFSYQSLSEKGNTINHKSRWVSEVAYIDNEAVVRLIFAPAIVPLITRLEEQFTKYEI
                     QQISNLTSAYAVRLYEILIAWRSTGKTPLITMYDFRQKIGVLETEYKRMYDFKKYVLD
                     IALKQVNEHTDIIVKVEQHKTGRSITGFSFSFKQKKSATHSVESKRDPNTLDLFSKIT
                     DKQRHLFANKLSELPEMSKYSQGTESYQQFAVRIAAMLQDAEKFKELLPLLRKLGFQ"
     misc_feature    <3561..4061
                     /locus_tag="ABZJ_p00006"
                     /note="Initiator Replication protein; Region: Rep_3;
                     pfam01051"
                     /db_xref="CDD:250324"
     gene            4380..4721
                     /locus_tag="ABZJ_p00007"
                     /db_xref="GeneID:12117441"
     CDS             4380..4721
                     /locus_tag="ABZJ_p00007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527826.1"
                     /db_xref="GI:384145117"
                     /db_xref="GeneID:12117441"
                     /translation="MKKLSVSELAKLYGYSRQAIYAHINKGNLSKGSDGLIDFSEALR
                     VFGEPQKKEDTVNQSQSINSQNLTEVDLLKRQVDILEKQLNQAIQRENQSLERESFYQ
                     GKRNANHTFQS"
     misc_feature    <4389..>4553
                     /locus_tag="ABZJ_p00007"
                     /note="Putative helix-turn-helix protein, YlxM / p13 like;
                     Region: UPF0122; cl17893"
                     /db_xref="CDD:266911"
     gene            4771..5055
                     /locus_tag="ABZJ_p00008"
                     /db_xref="GeneID:12117442"
     CDS             4771..5055
                     /locus_tag="ABZJ_p00008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527827.1"
                     /db_xref="GI:384145118"
                     /db_xref="GeneID:12117442"
                     /translation="MHRTKEQWFALFAEQAQSGLTQTEFAKRQGIIPTYFSYRKRQLL
                     AFQDDDGGFIELTPQGLQLNKSILLRKRDVELQFPAGTDVLWLAALLRAL"
     gene            5058..5414
                     /locus_tag="ABZJ_p00009"
                     /db_xref="GeneID:12117443"
     CDS             5058..5414
                     /locus_tag="ABZJ_p00009"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 Orf2 family protein"
                     /protein_id="YP_005527828.1"
                     /db_xref="GI:384145119"
                     /db_xref="GeneID:12117443"
                     /translation="MKMFLDVPQVYLHKQPVDFRKSINGLSLLVEQEMQLSPFSGALF
                     VFCNQQRTRLKVLYWDSTGFCLWYKRLEKDKFRWPRQMPGKILSISEQQWHWLLQGVD
                     IQKITAHQPLHYQSVG"
     misc_feature    <5082..5396
                     /locus_tag="ABZJ_p00009"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    5082..5393
                     /locus_tag="ABZJ_p00009"
                     /note="IS66 Orf2 like protein; Region: TnpB_IS66;
                     pfam05717"
                     /db_xref="CDD:253347"
     gene            5507..7066
                     /locus_tag="ABZJ_p00010"
                     /db_xref="GeneID:12117444"
     CDS             5507..7066
                     /locus_tag="ABZJ_p00010"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase (IS66)"
                     /protein_id="YP_005527829.1"
                     /db_xref="GI:384145120"
                     /db_xref="GeneID:12117444"
                     /translation="MKKTPQSLPDDVELLKKMLLEQTQKLERKLAQKDKRIAKLERVN
                     QQLSDKLQQLLERYNLKKYQKFSPSSETYEGDGEVLNEAEQLIEDESVATEPDNQTTE
                     SAEKAAKPRRPRIAPELPRVDVIHDIDDKTCTCCGHALHQMGEEVSEQLEFVPAQIRV
                     LRNVRLKYSCRQCETNGTKVEIKIADVPPAVIPKSMATPSLLAQIISSKMHYGLPLYR
                     QEQLFNQAGIELSRQTMSRWLISCAEKLKPLLALMKAELLKQPVLWADETTVNVLDVE
                     KSTCYMWVYGCGLEQSTGPKLVLFDYQDSRSSIHPTDFLAGFAGYLQVDGYAGYEKTH
                     ATLVGCWAHARRKFVEAQKAQGKGKTGKADVALNHIQKLYALESQLKTVPPDKKYDAR
                     QTLAKPLLEQFKSWLDKSSESVTKESLLGAAITYSLNQWPKLMRYLDDGRLNIDNNRA
                     ERAIKPFVIGRKAWLFANTKSGAQASAALYSLVETAKINGLEPYDYLCRLLTELPKAN
                     THEQLQQLLPY"
     misc_feature    <5537..5776
                     /locus_tag="ABZJ_p00010"
                     /note="Modifier of rudimentary (Mod(r)) protein; Region:
                     Mod_r; pfam07200"
                     /db_xref="CDD:254100"
     misc_feature    5660..5878
                     /locus_tag="ABZJ_p00010"
                     /note="Transposase C of IS166 homeodomain; Region:
                     LZ_Tnp_IS66; pfam13007"
                     /db_xref="CDD:257454"
     misc_feature    5831..6316
                     /locus_tag="ABZJ_p00010"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    5891..6028
                     /locus_tag="ABZJ_p00010"
                     /note="zinc-finger binding domain of transposase IS66;
                     Region: zf-IS66; pfam13005"
                     /db_xref="CDD:257452"
     misc_feature    6086..6931
                     /locus_tag="ABZJ_p00010"
                     /note="Transposase IS66 family; Region: DDE_Tnp_IS66;
                     pfam03050"
                     /db_xref="CDD:251693"
     misc_feature    6947..7060
                     /locus_tag="ABZJ_p00010"
                     /note="IS66 C-terminal element; Region: DDE_Tnp_IS66_C;
                     pfam13817"
                     /db_xref="CDD:258097"
     gene            7088..7351
                     /locus_tag="ABZJ_p00011"
                     /db_xref="GeneID:12117445"
     CDS             7088..7351
                     /locus_tag="ABZJ_p00011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527830.1"
                     /db_xref="GI:384145121"
                     /db_xref="GeneID:12117445"
                     /translation="MVGVTLTYQEQIEAMQRLLEAPKANMTTFTDQSFKQDIATDPRS
                     ELATNYDELTTPQQDNKRIPIPEHVEPEQKKRGFLSRFFLPYG"
     gene            complement(7710..8594)
                     /locus_tag="ABZJ_p00012"
                     /db_xref="GeneID:12117421"
     CDS             complement(7710..8594)
                     /locus_tag="ABZJ_p00012"
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide 2'-phosphotransferase"
                     /protein_id="YP_005527831.1"
                     /db_xref="GI:384145122"
                     /db_xref="GeneID:12117421"
                     /translation="MTIQDIQSLAEAHGLLLTDKMNFNEMGIDFKVVFALDTKGQQWL
                     LRIPRRDGMREQIKKEKRILELVKKHLSVEVPDWRISSTELVAYPILKDNPVLNLDAE
                     TYEIIWNMDKDSPKYITSLAKTLFEIHSIPEKEVRENDLKIMKPSDLRPEIANNLQLV
                     KSEIGISEQLETRYRKWLDNDVLWADFTQFIHGDLYAGHVLASKDGAVSGVIDWSTAH
                     IDDPAIDFAGHVTLFGEESLKTLIIEYEKLGGKVWNKLYEQTLERAAASPLMYGLFAL
                     ETQNESLIVGAKAQLGVI"
     misc_feature    complement(7758..8573)
                     /locus_tag="ABZJ_p00012"
                     /note="Macrolide 2'-Phosphotransferase; Region:
                     MPH2'; cd05152"
                     /db_xref="CDD:270701"
     misc_feature    complement(order(7890..7892,7899..7904,7947..7949,
                     7956..7961,7992..7994,7998..8003,8007..8009,8013..8015,
                     8322..8333,8379..8381,8457..8459,8463..8465,8499..8501,
                     8508..8510,8514..8519,8526..8528))
                     /locus_tag="ABZJ_p00012"
                     /note="putative active site [active]"
                     /db_xref="CDD:270701"
     misc_feature    complement(order(7956..7961,7992..7994,7998..8003,
                     8013..8015,8322..8333,8379..8381,8457..8459,8463..8465,
                     8499..8501,8514..8516,8526..8528))
                     /locus_tag="ABZJ_p00012"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270701"
     misc_feature    complement(order(7890..7892,7899..7904,7947..7949,
                     7956..7958,7998..8000,8007..8009,8013..8015,8508..8510,
                     8514..8519))
                     /locus_tag="ABZJ_p00012"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:270701"
     misc_feature    complement(7821..8516)
                     /locus_tag="ABZJ_p00012"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     gene            complement(8650..10125)
                     /locus_tag="ABZJ_p00013"
                     /db_xref="GeneID:12117422"
     CDS             complement(8650..10125)
                     /locus_tag="ABZJ_p00013"
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide efflux protein"
                     /protein_id="YP_005527832.1"
                     /db_xref="GI:384145123"
                     /db_xref="GeneID:12117422"
                     /translation="MSLIIKARNIRLDYAGRDVLDIDELEIHSYDRIGLVGDNGAGKS
                     SLLKVLNGEIVLAEATLQRFGDFAHISQLGGIEIETVEDRAMLSRLGVSNVQNDTMSG
                     GEETRAKIAAAFSQQVHGILADEPTSHLDLNGIDLLIGQLKAFDGALLVISHDRYFLD
                     MVVDKIWELKDGKITEYWGGYSDYLRQKEEERQHQAVEYELMMKERERLESAVQEKRQ
                     QANRLDNKKKGEKSKNSTESAGRLGHAKMTGTKQRKLYQAAKSMEKRLAALEDIQAPE
                     HLRSIRFRQSSALELHNKFPITADGLSLKFGSRTIFDDANFIIPLGAKVAITGSNGTG
                     KTSLLKMISERADGLTISPKAEIGYFTQTGYKFNTHKSVLSFMQEECEYTVAEIRAVL
                     ASMGIGANDIQKNLSDLSGGEIIKLLLSKMLLGKYNILLMDEPGNYLDLKSIAALETM
                     MKSYAGTIIFVSHDKQLVDNIADIIYEIKDHKIIKTFERDC"
     misc_feature    complement(8656..10116)
                     /locus_tag="ABZJ_p00013"
                     /note="ATPase components of ABC transporters with
                     duplicated ATPase domains [General function prediction
                     only]; Region: Uup; COG0488"
                     /db_xref="CDD:223562"
     misc_feature    complement(9607..10113)
                     /locus_tag="ABZJ_p00013"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    complement(9277..9627)
                     /locus_tag="ABZJ_p00013"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    complement(8680..9237)
                     /locus_tag="ABZJ_p00013"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     gene            complement(10524..11708)
                     /locus_tag="ABZJ_p00014"
                     /db_xref="GeneID:12117423"
     CDS             complement(10524..11708)
                     /locus_tag="ABZJ_p00014"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005527833.1"
                     /db_xref="GI:384145124"
                     /db_xref="GeneID:12117423"
                     /translation="MLTMNVKAMLADFLTFVTPKSMHKARFSVLLDAVTALAKDACCT
                     VTAIGRAMPGSSDKVSIKRADRLLNNPNLQRELPLIYAALTASIVGHKTKPMILVDWS
                     NADTAKRHFILRASIAADGRALTLLQKIAAAEDYTCPHLHGAFLKQLKAMLPKDCKPV
                     IVTDAGFKVPWLKQVRKLGWHYVARVRGNVKLKLAEQDKFISVNQLYRQAKKDPKSVG
                     KIMLAQTQHYETQAVLVGKGYKLLKRDKNKTYKEPWLLVSSLADCHGYADKIAKCYSS
                     RMQIEESFRDQKSHRYGLGSDLHGTKKKSRLEILLLLAALVNWFHYLLGSAAEKAGLH
                     LRYQANTVKNRRVLALNFLGILLCKEPKQRIRRQYYQQGLKQILQWVVQWDWAVIKQA
                     DS"
     misc_feature    complement(10782..>11276)
                     /locus_tag="ABZJ_p00014"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            11757..11942
                     /locus_tag="ABZJ_p00015"
                     /db_xref="GeneID:12117424"
     CDS             11757..11942
                     /locus_tag="ABZJ_p00015"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527834.1"
                     /db_xref="GI:384145125"
                     /db_xref="GeneID:12117424"
                     /translation="MFPNQLTFYFNYRISGDTSGGLQLFGLIGLIYGPIIFALTMVLL
                     RLYTIEFKDFLERQDNS"
     gene            complement(12424..13239)
                     /locus_tag="ABZJ_p00016"
                     /db_xref="GeneID:12117425"
     CDS             complement(12424..13239)
                     /locus_tag="ABZJ_p00016"
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methylase"
                     /protein_id="YP_005527835.1"
                     /db_xref="GI:384145126"
                     /db_xref="GeneID:12117425"
                     /translation="MTVPIKYLTCRFFQMDKNDVVKKILESKKYENLDSDIVEKVVSI
                     SEKKYKLKEVENYSKKKLHQIWGSYYSAYPNWDKLLKKYNQGQLSIEDLLKIHSSTNE
                     RVATLNDFYTYVFGNIKHVSSILDFGCGFNPLALYQWNENEKIIYHAYDIDRAEIAFL
                     SSIIGKLKTTIKYRFLNKESDVYKGTYDVVFLLKMLPVLKQQDVNILDFLQLFHTQNF
                     VISFPIKSLSGKEKGMEENYQLWFESFTKGWIKILDSKVIGNELVYITSGFQK"
     misc_feature    complement(12445..13164)
                     /locus_tag="ABZJ_p00016"
                     /note="Ribosomal RNA methyltransferase (FmrO); Region:
                     FmrO; pfam07091"
                     /db_xref="CDD:254051"
     gene            complement(13523..14359)
                     /locus_tag="ABZJ_p00017"
                     /db_xref="GeneID:12117426"
     CDS             complement(13523..14359)
                     /locus_tag="ABZJ_p00017"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005527836.1"
                     /db_xref="GI:384145127"
                     /db_xref="GeneID:12117426"
                     /translation="MDEQAIKQWHCLVHHGRRGRGFHYSDTAIETALMLKGLFKLPLR
                     ALEGFINSLFQLMAVPLQSPDYSCISKRAKTVDIKYRLPSQGPVAHLVIDATGLKVYG
                     EGEWKIRKHGKEKRRVWRKLHLAVDATTHAVIAAEVSLETVADNEVLPTLLNPLRRKI
                     KQVSADGAYDTKACHALLKKKGAKATIPPRKNAAPWEEGHPRNEAVTALKAGELKQWK
                     KDSGYHQRSIAETAMYRFKQLIGPTLSLRNYNAQVGEILAGVKVMNKLIGLGMPVRQP
                     VN"
     misc_feature    complement(14051..14356)
                     /locus_tag="ABZJ_p00017"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_5;
                     pfam13737"
                     /db_xref="CDD:258032"
     misc_feature    complement(13586..14092)
                     /locus_tag="ABZJ_p00017"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(14596..16137)
                     /locus_tag="ABZJ_p00018"
                     /db_xref="GeneID:12117427"
     CDS             complement(14596..16137)
                     /locus_tag="ABZJ_p00018"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527837.1"
                     /db_xref="GI:384145128"
                     /db_xref="GeneID:12117427"
                     /translation="MSLARNATASQSPTQTNGYERHQPDQTLLYQLVEQHYPAFKASL
                     EAQGQHLPRYIQQEFNDLLQCGRLEYGFMRVRCEDCHHERLVAFSCKRRGFCPSCGAR
                     RMAESAALLIDEVFPKEPIRQWVLSFPFQLRFLLARHPQLMGQVLSIVYRTLSTHLIK
                     KAGYTKASAQTGSVTLIQRFGSALNLNVHYHMLFLDGVYAEDDYGKQRFHRVKAPTYD
                     ELNTLAHTLSHRIARCMEKRGILERDAENTWLTLEEGEDDTLTQLHGASVTYRIAVGP
                     QQGRKVFTLQTLPGREDKADSSSRVANHAGFSLHAGVMAEAHQRDKLERLCRYISRPA
                     VSEKRLALTANGQVRYELKTPYRNGTTHVIFEPLDFIAKLAALVPKPRVNLTRFHGVF
                     APNSKHRVQVTPAKRGKKPDKSEGLDTNWRDKSPAERHRAMTWMQRLKRVFNIDIEVC
                     EHCGGHVKVIASIEDPKVIEQILKHLKQKTAKANAAKQRELPPERAPPLTPSLFDPSQ
                     SRLFD"
     misc_feature    complement(15703..16050)
                     /locus_tag="ABZJ_p00018"
                     /note="Transposase zinc-binding domain; Region:
                     Zn_Tnp_IS91; pfam14319"
                     /db_xref="CDD:258494"
     misc_feature    complement(14947..15624)
                     /locus_tag="ABZJ_p00018"
                     /note="Putative transposase; Region: Y2_Tnp; pfam04986"
                     /db_xref="CDD:252923"
     gene            complement(16313..16468)
                     /locus_tag="ABZJ_p00019"
                     /db_xref="GeneID:12117428"
     CDS             complement(16313..16468)
                     /locus_tag="ABZJ_p00019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527838.1"
                     /db_xref="GI:384145129"
                     /db_xref="GeneID:12117428"
                     /translation="MKKKVLCDGVEDRTVKLLCGMVQSSTTTDKTQPPQTDKKKPQLI
                     TVGASVL"
     gene            complement(16542..17468)
                     /locus_tag="ABZJ_p00020"
                     /db_xref="GeneID:12117429"
     CDS             complement(16542..17468)
                     /locus_tag="ABZJ_p00020"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="YP_005527839.1"
                     /db_xref="GI:384145130"
                     /db_xref="GeneID:12117429"
                     /translation="MGLCRYGAHNCCLFARPIPIVEVAAEADAMVTVFGILNLTEDSF
                     FDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPADEIRRIAPLLDALS
                     DQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHSAQRD
                     GIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFLSPAPETSLH
                     VLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAELHAIGNGADYVRT
                     HAPGDLRSAITFSETLAKFRSRDARDRGLDHA"
     misc_feature    complement(16599..17378)
                     /locus_tag="ABZJ_p00020"
                     /note="DHPS subgroup of Pterin binding enzymes. DHPS
                     (dihydropteroate synthase), a functional homodimer,
                     catalyzes the condensation of p-aminobenzoic acid (pABA)
                     in the de novo biosynthesis of folate, which is an
                     essential cofactor in both nucleic acid and...; Region:
                     DHPS; cd00739"
                     /db_xref="CDD:238380"
     misc_feature    complement(16635..17372)
                     /locus_tag="ABZJ_p00020"
                     /note="Dihydropteroate synthase and related enzymes
                     [Coenzyme metabolism]; Region: FolP; COG0294"
                     /db_xref="CDD:223371"
     misc_feature    complement(order(16638..16640,16644..16646,16746..16748,
                     16758..16760,16863..16865,17007..17009,17073..17075,
                     17079..17081,17136..17138,17355..17357))
                     /locus_tag="ABZJ_p00020"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238380"
     misc_feature    complement(order(16614..16619,16662..16664,16674..16676,
                     16686..16688,16803..16808,16818..16820))
                     /locus_tag="ABZJ_p00020"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238380"
     misc_feature    complement(16746..16754)
                     /locus_tag="ABZJ_p00020"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238380"
     gene            complement(17375..17722)
                     /locus_tag="ABZJ_p00021"
                     /db_xref="GeneID:12117430"
     CDS             complement(17375..17722)
                     /locus_tag="ABZJ_p00021"
                     /codon_start=1
                     /transl_table=11
                     /product="Orf3/QacEdelta1 fusion protein"
                     /protein_id="YP_005527840.1"
                     /db_xref="GI:384145131"
                     /db_xref="GeneID:12117430"
                     /translation="MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAF
                     YFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLAR
                     SPSWKSLRRPTPW"
     misc_feature    complement(17441..17716)
                     /locus_tag="ABZJ_p00021"
                     /note="Small Multidrug Resistance protein; Region:
                     Multi_Drug_Res; pfam00893"
                     /db_xref="CDD:250210"
     gene            complement(17886..18677)
                     /locus_tag="ABZJ_p00022"
                     /db_xref="GeneID:12117431"
     CDS             complement(17886..18677)
                     /locus_tag="ABZJ_p00022"
                     /codon_start=1
                     /transl_table=11
                     /product="streptomycin/spectinomycin adenyltransferase"
                     /protein_id="YP_005527841.1"
                     /db_xref="GI:384145132"
                     /db_xref="GeneID:12117431"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKP
                     HSDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYP
                     AKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQ
                     DLFEALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPA
                     QYQPVILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
     misc_feature    complement(17892..18677)
                     /locus_tag="ABZJ_p00022"
                     /note="aminoglycoside resistance protein; Provisional;
                     Region: PRK13746"
                     /db_xref="CDD:184296"
     misc_feature    complement(18357..18644)
                     /locus_tag="ABZJ_p00022"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(18411..18413,18417..18419,18531..18533,
                     18537..18542,18561..18563,18570..18578))
                     /locus_tag="ABZJ_p00022"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(18531..18533,18537..18542,18561..18563,
                     18570..18578))
                     /locus_tag="ABZJ_p00022"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(18411..18413,18531..18533,18537..18539))
                     /locus_tag="ABZJ_p00022"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(18411..18413,18417..18419))
                     /locus_tag="ABZJ_p00022"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     misc_feature    complement(17907..18230)
                     /locus_tag="ABZJ_p00022"
                     /note="Domain of unknown function (DUF4111); Region:
                     DUF4111; pfam13427"
                     /db_xref="CDD:257752"
     gene            complement(18769..19074)
                     /locus_tag="ABZJ_p00023"
                     /db_xref="GeneID:12117432"
     CDS             complement(18769..19074)
                     /locus_tag="ABZJ_p00023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527842.1"
                     /db_xref="GI:384145133"
                     /db_xref="GeneID:12117432"
                     /translation="MNCARCGRQNFVDAHRCAHCGHHFFDGSDVVNLLDKAQKRTWLR
                     PRNIAIFLAAWALLVVEIVTYAGKAPSSPQGWAALILLGPIVYVVLATCADTIFRKP"
     misc_feature    complement(<19009..>19068)
                     /locus_tag="ABZJ_p00023"
                     /note="Ribosomal protein L37e; Region: Ribosomal_L37e;
                     cl00932"
                     /db_xref="CDD:260703"
     gene            complement(19090..19623)
                     /locus_tag="ABZJ_p00024"
                     /db_xref="GeneID:12117433"
     CDS             complement(19090..19623)
                     /locus_tag="ABZJ_p00024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005527843.1"
                     /db_xref="GI:384145134"
                     /db_xref="GeneID:12117433"
                     /translation="MGNKKTDMNVRTCTESDVASIAVVFTESIHVLGASHYDASQRNA
                     WAPRPADIEAWSARLSGLQTLLAIEGDAVIGFISYELSGHIEFLYTAPGSERRGVASV
                     LYREVEKALPGVSLFTEASLVAKPFFLRHGFSVVEEQNVSRGGVMFRRYAMRKAVVAQ
                     HGAQADRPALRAVRRLS"
     misc_feature    complement(19225..19575)
                     /locus_tag="ABZJ_p00024"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    complement(19291..19431)
                     /locus_tag="ABZJ_p00024"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(19321..19326,19354..19362))
                     /locus_tag="ABZJ_p00024"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(19721..20254)
                     /locus_tag="ABZJ_p00025"
                     /db_xref="GeneID:12117434"
     CDS             complement(19721..20254)
                     /locus_tag="ABZJ_p00025"
                     /codon_start=1
                     /transl_table=11
                     /product="gentamicin 3'-acetyltransferase (gentamicin
                     acetyltransferase I) (aminoglycoside
                     N(3')-acetyltransferase I) (AAC(3)-I)"
                     /protein_id="YP_005527844.1"
                     /db_xref="GI:384145135"
                     /db_xref="GeneID:12117434"
                     /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAAL
                     DLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQA
                     RSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKL
                     GIREEVMHFDIDPSTAT"
     misc_feature    complement(19733..20134)
                     /locus_tag="ABZJ_p00025"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    complement(19823..20020)
                     /locus_tag="ABZJ_p00025"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(19883..19888,19916..19924))
                     /locus_tag="ABZJ_p00025"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
CONTIG      join(CP001938.1:1..20301)
//
DBGET integrated database retrieval system