GenomeNet

Database: RefSeq
Entry: NC_017172
LinkDB: NC_017172
Original site: NC_017172 
LOCUS       NC_017172              20301 bp    DNA     circular CON 01-MAR-2015
DEFINITION  Acinetobacter baumannii MDR-ZJ06 plasmid pMDR-ZJ06, complete
            sequence.
ACCESSION   NC_017172
VERSION     NC_017172.1  GI:384145110
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603878
            Assembly: GCF_000226275.1
KEYWORDS    RefSeq.
SOURCE      Acinetobacter baumannii MDR-ZJ06
  ORGANISM  Acinetobacter baumannii MDR-ZJ06
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii
            complex.
REFERENCE   1  (bases 1 to 20301)
  AUTHORS   Zhou,H., Zhang,T., Yu,D., Pi,B., Yang,Q., Zhou,J., Hu,S. and Yu,Y.
  TITLE     Genomic analysis of the multidrug-resistant Acinetobacter baumannii
            strain MDR-ZJ06 widely spread in China
  JOURNAL   Antimicrob. Agents Chemother. 55 (10), 4506-4512 (2011)
   PUBMED   21788470
REFERENCE   2  (bases 1 to 20301)
  AUTHORS   Zhang,T. and Yu,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2010) Key Laboratory of Diagnosis and Treatment
            for Infectious Disease, The 1st Affiliated Hospital of School of
            Medicine, Zhejiang University, 79 Qingchun Road, Hangzhou, Zhejiang
            310003, China
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Acinetobacter baumannii isolates MDR-ZJ06 studied here was obtained
            from a case in a hospital in Zhejiang of China in 2006; bacteria
            are available from the Key Laboratory of Diagnosis and Treatment
            for Infectious Disease.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 02/28/2015 12:13:45
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 460460)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 3,847
            CDS                          :: 3,711
            Pseudo Genes                 :: 48
            rRNAs                        :: 18 ( 5S, 16S, 23S )
            tRNAs                        :: 69
            ncRNA                        :: 1
            Frameshifted Genes           :: 48
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..20301
                     /organism="Acinetobacter baumannii MDR-ZJ06"
                     /mol_type="genomic DNA"
                     /strain="MDR-ZJ06"
                     /db_xref="taxon:497978"
                     /plasmid="pMDR-ZJ06"
                     /country="China: Zheijiang"
                     /collection_date="2006"
     gene            complement(145..540)
                     /locus_tag="ABZJ_RS19120"
                     /old_locus_tag="ABZJ_p00001"
     CDS             complement(145..540)
                     /locus_tag="ABZJ_RS19120"
                     /old_locus_tag="ABZJ_p00001"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P10018.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000570139.1"
                     /db_xref="GI:446492285"
                     /translation="MIEIQILDPQLQTLTDPHARSIQKLGEQTMLAFQKTEDANHFIR
                     GQHHRQAPRRPRSSDLLKPGQIRAQHLAVEEQQGRQCLTMRGDRNLALVRQPGQKCLD
                     FAAAQGCRVTHTVETDEGTNPVDISLFGS"
     gene            complement(592..804)
                     /locus_tag="ABZJ_RS19125"
                     /old_locus_tag="ABZJ_p00002"
     CDS             complement(592..804)
                     /locus_tag="ABZJ_RS19125"
                     /old_locus_tag="ABZJ_p00002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000190638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000190638.1"
                     /db_xref="GI:446112783"
                     /translation="MATHDTAPWIGRMRVLRKNPEPRPGMPGARILPLKGVGKRNAAA
                     ALGLVLQPPCPCTRQLLAQAGCQALG"
     gene            complement(905..1609)
                     /locus_tag="ABZJ_RS19130"
                     /old_locus_tag="ABZJ_p00003"
     CDS             complement(905..1609)
                     /locus_tag="ABZJ_RS19130"
                     /old_locus_tag="ABZJ_p00003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001067856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001067858.1"
                     /db_xref="GI:446990602"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            complement(1722..2537)
                     /locus_tag="ABZJ_RS19135"
                     /old_locus_tag="ABZJ_p00004"
     CDS             complement(1722..2537)
                     /locus_tag="ABZJ_RS19135"
                     /old_locus_tag="ABZJ_p00004"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P00551.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside 3'-phosphotransferase"
                     /protein_id="WP_000018326.1"
                     /db_xref="GI:445940471"
                     /translation="MSHIQRETSCSRPRLNSNLDADLYGYRWARDNVGQSGATIYRLY
                     GKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRTPDDAWLLTTAIP
                     GKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGL
                     VDASDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVG
                     RVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     gene            complement(2791..3495)
                     /locus_tag="ABZJ_RS19140"
                     /old_locus_tag="ABZJ_p00005"
     CDS             complement(2791..3495)
                     /locus_tag="ABZJ_RS19140"
                     /old_locus_tag="ABZJ_p00005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001067856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001067858.1"
                     /db_xref="GI:446990602"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            3486..4313
                     /locus_tag="ABZJ_RS19145"
                     /old_locus_tag="ABZJ_p00006"
     CDS             3486..4313
                     /locus_tag="ABZJ_RS19145"
                     /old_locus_tag="ABZJ_p00006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000534216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="WP_000534216.1"
                     /db_xref="GI:446456362"
                     /translation="MGSCAAPSAKGDDKFITTDYLQQCRVHRNTAYQALKDACDDLFA
                     RQFSYQSLSEKGNTINHKSRWVSEVAYIDNEAVVRLIFAPAIVPLITRLEEQFTKYEI
                     QQISNLTSAYAVRLYEILIAWRSTGKTPLITMYDFRQKIGVLETEYKRMYDFKKYVLD
                     IALKQVNEHTDIIVKVEQHKTGRSITGFSFSFKQKKSATHSVESKRDPNTLDLFSKIT
                     DKQRHLFANKLSELPEMSKYSQGTESYQQFAVRIAAMLQDAEKFKELLPLLRKLGFQ"
     gene            4380..>4691
                     /locus_tag="ABZJ_RS19150"
                     /old_locus_tag="ABZJ_p00007"
     CDS             4380..>4691
                     /locus_tag="ABZJ_RS19150"
                     /old_locus_tag="ABZJ_p00007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004896925.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication protein"
                     /protein_id="WP_029642154.1"
                     /db_xref="GI:658308028"
                     /translation="MKKLSVSELAKLYGYSRQAIYAHINKGNLSKGSDGLIDFSEALR
                     VFGEPQKKEDTVNQSQSINSQNLTEVDLLKRQVDILEKQLNQAIQRENQSLERESFYQ
                     GK"
     gene            4771..5055
                     /locus_tag="ABZJ_RS19155"
                     /old_locus_tag="ABZJ_p00008"
     CDS             4771..5055
                     /locus_tag="ABZJ_RS19155"
                     /old_locus_tag="ABZJ_p00008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008949250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000555098.1"
                     /db_xref="GI:446477244"
                     /translation="MHRTKEQWFALFAEQAQSGLTQTEFAKRQGIIPTYFSYRKRQLL
                     AFQDDDGGFIELTPQGLQLNKSILLRKRDVELQFPAGTDVLWLAALLRAL"
     gene            5058..5414
                     /locus_tag="ABZJ_RS19160"
                     /old_locus_tag="ABZJ_p00009"
     CDS             5058..5414
                     /locus_tag="ABZJ_RS19160"
                     /old_locus_tag="ABZJ_p00009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000781558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000781558.1"
                     /db_xref="GI:446704212"
                     /translation="MKMFLDVPQVYLHKQPVDFRKSINGLSLLVEQEMQLSPFSGALF
                     VFCNQQRTRLKVLYWDSTGFCLWYKRLEKDKFRWPRQMPGKILSISEQQWHWLLQGVD
                     IQKITAHQPLHYQSVG"
     gene            5507..7066
                     /locus_tag="ABZJ_RS19165"
                     /old_locus_tag="ABZJ_p00010"
     CDS             5507..7066
                     /locus_tag="ABZJ_RS19165"
                     /old_locus_tag="ABZJ_p00010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000753551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000753551.1"
                     /db_xref="GI:446676205"
                     /translation="MKKTPQSLPDDVELLKKMLLEQTQKLERKLAQKDKRIAKLERVN
                     QQLSDKLQQLLERYNLKKYQKFSPSSETYEGDGEVLNEAEQLIEDESVATEPDNQTTE
                     SAEKAAKPRRPRIAPELPRVDVIHDIDDKTCTCCGHALHQMGEEVSEQLEFVPAQIRV
                     LRNVRLKYSCRQCETNGTKVEIKIADVPPAVIPKSMATPSLLAQIISSKMHYGLPLYR
                     QEQLFNQAGIELSRQTMSRWLISCAEKLKPLLALMKAELLKQPVLWADETTVNVLDVE
                     KSTCYMWVYGCGLEQSTGPKLVLFDYQDSRSSIHPTDFLAGFAGYLQVDGYAGYEKTH
                     ATLVGCWAHARRKFVEAQKAQGKGKTGKADVALNHIQKLYALESQLKTVPPDKKYDAR
                     QTLAKPLLEQFKSWLDKSSESVTKESLLGAAITYSLNQWPKLMRYLDDGRLNIDNNRA
                     ERAIKPFVIGRKAWLFANTKSGAQASAALYSLVETAKINGLEPYDYLCRLLTELPKAN
                     THEQLQQLLPY"
     gene            <7109..7351
                     /locus_tag="ABZJ_RS19170"
                     /old_locus_tag="ABZJ_p00011"
     CDS             <7109..7351
                     /locus_tag="ABZJ_RS19170"
                     /old_locus_tag="ABZJ_p00011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004896925.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication protein"
                     /protein_id="WP_029642155.1"
                     /db_xref="GI:658308029"
                     /translation="YQEQIEAMQRLLEAPKANMTTFTDQSFKQDIATDPRSELATNYD
                     ELTTPQQDNKRIPIPEHVEPEQKKRGFLSRFFLPYG"
     gene            complement(7710..8594)
                     /locus_tag="ABZJ_RS19175"
                     /old_locus_tag="ABZJ_p00012"
     CDS             complement(7710..8594)
                     /locus_tag="ABZJ_RS19175"
                     /old_locus_tag="ABZJ_p00012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000155092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide 2'-phosphotransferase"
                     /protein_id="WP_000155092.1"
                     /db_xref="GI:446077237"
                     /translation="MTIQDIQSLAEAHGLLLTDKMNFNEMGIDFKVVFALDTKGQQWL
                     LRIPRRDGMREQIKKEKRILELVKKHLSVEVPDWRISSTELVAYPILKDNPVLNLDAE
                     TYEIIWNMDKDSPKYITSLAKTLFEIHSIPEKEVRENDLKIMKPSDLRPEIANNLQLV
                     KSEIGISEQLETRYRKWLDNDVLWADFTQFIHGDLYAGHVLASKDGAVSGVIDWSTAH
                     IDDPAIDFAGHVTLFGEESLKTLIIEYEKLGGKVWNKLYEQTLERAAASPLMYGLFAL
                     ETQNESLIVGAKAQLGVI"
     gene            complement(8650..10125)
                     /locus_tag="ABZJ_RS19180"
                     /old_locus_tag="ABZJ_p00013"
     CDS             complement(8650..10125)
                     /locus_tag="ABZJ_RS19180"
                     /old_locus_tag="ABZJ_p00013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000052512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_000052512.1"
                     /db_xref="GI:445974657"
                     /translation="MSLIIKARNIRLDYAGRDVLDIDELEIHSYDRIGLVGDNGAGKS
                     SLLKVLNGEIVLAEATLQRFGDFAHISQLGGIEIETVEDRAMLSRLGVSNVQNDTMSG
                     GEETRAKIAAAFSQQVHGILADEPTSHLDLNGIDLLIGQLKAFDGALLVISHDRYFLD
                     MVVDKIWELKDGKITEYWGGYSDYLRQKEEERQHQAVEYELMMKERERLESAVQEKRQ
                     QANRLDNKKKGEKSKNSTESAGRLGHAKMTGTKQRKLYQAAKSMEKRLAALEDIQAPE
                     HLRSIRFRQSSALELHNKFPITADGLSLKFGSRTIFDDANFIIPLGAKVAITGSNGTG
                     KTSLLKMISERADGLTISPKAEIGYFTQTGYKFNTHKSVLSFMQEECEYTVAEIRAVL
                     ASMGIGANDIQKNLSDLSGGEIIKLLLSKMLLGKYNILLMDEPGNYLDLKSIAALETM
                     MKSYAGTIIFVSHDKQLVDNIADIIYEIKDHKIIKTFERDC"
     gene            complement(10524..11699)
                     /locus_tag="ABZJ_RS19185"
                     /old_locus_tag="ABZJ_p00014"
     CDS             complement(10524..11699)
                     /locus_tag="ABZJ_RS19185"
                     /old_locus_tag="ABZJ_p00014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001101021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001101021.1"
                     /db_xref="GI:447023765"
                     /translation="MNVKAMLADFLTFVTPKSMHKARFSVLLDAVTALAKDACCTVTA
                     IGRAMPGSSDKVSIKRADRLLNNPNLQRELPLIYAALTASIVGHKTKPMILVDWSNAD
                     TAKRHFILRASIAADGRALTLLQKIAAAEDYTCPHLHGAFLKQLKAMLPKDCKPVIVT
                     DAGFKVPWLKQVRKLGWHYVARVRGNVKLKLAEQDKFISVNQLYRQAKKDPKSVGKIM
                     LAQTQHYETQAVLVGKGYKLLKRDKNKTYKEPWLLVSSLADCHGYADKIAKCYSSRMQ
                     IEESFRDQKSHRYGLGSDLHGTKKKSRLEILLLLAALVNWFHYLLGSAAEKAGLHLRY
                     QANTVKNRRVLALNFLGILLCKEPKQRIRRQYYQQGLKQILQWVVQWDWAVIKQADS"
     gene            11757..11942
                     /locus_tag="ABZJ_RS19190"
                     /old_locus_tag="ABZJ_p00015"
     CDS             11757..11942
                     /locus_tag="ABZJ_RS19190"
                     /old_locus_tag="ABZJ_p00015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002026779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002026779.1"
                     /db_xref="GI:487953313"
                     /translation="MFPNQLTFYFNYRISGDTSGGLQLFGLIGLIYGPIIFALTMVLL
                     RLYTIEFKDFLERQDNS"
     gene            complement(12424..13197)
                     /locus_tag="ABZJ_RS19195"
                     /old_locus_tag="ABZJ_p00016"
     CDS             complement(12424..13197)
                     /locus_tag="ABZJ_RS19195"
                     /old_locus_tag="ABZJ_p00016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000359986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_000359986.1"
                     /db_xref="GI:446282131"
                     /translation="MDKNDVVKKILESKKYENLDSDIVEKVVSISEKKYKLKEVENYS
                     KKKLHQIWGSYYSAYPNWDKLLKKYNQGQLSIEDLLKIHSSTNERVATLNDFYTYVFG
                     NIKHVSSILDFGCGFNPLALYQWNENEKIIYHAYDIDRAEIAFLSSIIGKLKTTIKYR
                     FLNKESDVYKGTYDVVFLLKMLPVLKQQDVNILDFLQLFHTQNFVISFPIKSLSGKEK
                     GMEENYQLWFESFTKGWIKILDSKVIGNELVYITSGFQK"
     gene            complement(13523..>14392)
                     /locus_tag="ABZJ_RS19200"
                     /old_locus_tag="ABZJ_p00017"
     CDS             complement(13523..>14392)
                     /locus_tag="ABZJ_RS19200"
                     /old_locus_tag="ABZJ_p00017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005351915.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_029642156.1"
                     /db_xref="GI:658308030"
                     /translation="QKGGLYFLYPWMDEQAIKQWHCLVHHGRRGRGFHYSDTAIETAL
                     MLKGLFKLPLRALEGFINSLFQLMAVPLQSPDYSCISKRAKTVDIKYRLPSQGPVAHL
                     VIDATGLKVYGEGEWKIRKHGKEKRRVWRKLHLAVDATTHAVIAAEVSLETVADNEVL
                     PTLLNPLRRKIKQVSADGAYDTKACHALLKKKGAKATIPPRKNAAPWEEGHPRNEAVT
                     ALKAGELKQWKKDSGYHQRSIAETAMYRFKQLIGPTLSLRNYNAQVGEILAGVKVMNK
                     LIGLGMPVRQPVN"
     gene            complement(14596..16143)
                     /locus_tag="ABZJ_RS19205"
                     /old_locus_tag="ABZJ_p00018"
     CDS             complement(14596..16143)
                     /locus_tag="ABZJ_RS19205"
                     /old_locus_tag="ABZJ_p00018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000050481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_024136353.1"
                     /db_xref="GI:582963892"
                     /translation="MPMSLARNATASQSPTQTNGYERHQPDQTLLYQLVEQHYPAFKA
                     SLEAQGQHLPRYIQQEFNDLLQCGRLEYGFMRVRCEDCHHERLVAFSCKRRGFCPSCG
                     ARRMAESAALLIDEVFPKEPIRQWVLSFPFQLRFLLARHPQLMGQVLSIVYRTLSTHL
                     IKKAGYTKASAQTGSVTLIQRFGSALNLNVHYHMLFLDGVYAEDDYGKQRFHRVKAPT
                     YDELNTLAHTLSHRIARCMEKRGILERDAENTWLTLEEGEDDTLTQLHGASVTYRIAV
                     GPQQGRKVFTLQTLPGREDKADSSSRVANHAGFSLHAGVMAEAHQRDKLERLCRYISR
                     PAVSEKRLALTANGQVRYELKTPYRNGTTHVIFEPLDFIAKLAALVPKPRVNLTRFHG
                     VFAPNSKHRVQVTPAKRGKKPDKSEGLDTNWRDKSPAERHRAMTWMQRLKRVFNIDIE
                     VCEHCGGHVKVIASIEDPKVIEQILKHLKQKTAKANAAKQRELPPERAPPLTPSLFDP
                     SQSRLFD"
     gene            complement(16542..17381)
                     /locus_tag="ABZJ_RS19210"
                     /old_locus_tag="ABZJ_p00020"
     CDS             complement(16542..17381)
                     /locus_tag="ABZJ_RS19210"
                     /old_locus_tag="ABZJ_p00020"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0C002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_000259031.1"
                     /db_xref="GI:446181176"
                     /translation="MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDV
                     GPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLND
                     IQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSAL
                     RRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGAT
                     VGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGL
                     DHA"
     gene            complement(17375..17722)
                     /locus_tag="ABZJ_RS19215"
                     /old_locus_tag="ABZJ_p00021"
     CDS             complement(17375..17722)
                     /locus_tag="ABZJ_RS19215"
                     /old_locus_tag="ABZJ_p00021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000679416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_000679427.1"
                     /db_xref="GI:446602081"
                     /translation="MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAF
                     YFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLAR
                     SPSWKSLRRPTPW"
     gene            complement(17886..18677)
                     /locus_tag="ABZJ_RS19220"
                     /old_locus_tag="ABZJ_p00022"
     CDS             complement(17886..18677)
                     /locus_tag="ABZJ_RS19220"
                     /old_locus_tag="ABZJ_p00022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001682441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-adenylyltransferase"
                     /protein_id="WP_001206316.1"
                     /db_xref="GI:447129060"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKP
                     HSDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYP
                     AKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQ
                     DLFEALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPA
                     QYQPVILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
     gene            complement(18769..19074)
                     /locus_tag="ABZJ_RS19225"
                     /old_locus_tag="ABZJ_p00023"
     CDS             complement(18769..19074)
                     /locus_tag="ABZJ_RS19225"
                     /old_locus_tag="ABZJ_p00023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000995519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000995519.1"
                     /db_xref="GI:446918263"
                     /translation="MNCARCGRQNFVDAHRCAHCGHHFFDGSDVVNLLDKAQKRTWLR
                     PRNIAIFLAAWALLVVEIVTYAGKAPSSPQGWAALILLGPIVYVVLATCADTIFRKP"
     gene            complement(19090..19602)
                     /locus_tag="ABZJ_RS19230"
                     /old_locus_tag="ABZJ_p00024"
     CDS             complement(19090..19602)
                     /locus_tag="ABZJ_RS19230"
                     /old_locus_tag="ABZJ_p00024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001102919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_001102919.1"
                     /db_xref="GI:447025663"
                     /translation="MNVRTCTESDVASIAVVFTESIHVLGASHYDASQRNAWAPRPAD
                     IEAWSARLSGLQTLLAIEGDAVIGFISYELSGHIEFLYTAPGSERRGVASVLYREVEK
                     ALPGVSLFTEASLVAKPFFLRHGFSVVEEQNVSRGGVMFRRYAMRKAVVAQHGAQADR
                     PALRAVRRLS"
     gene            complement(19721..20254)
                     /locus_tag="ABZJ_RS19235"
                     /old_locus_tag="ABZJ_p00025"
     CDS             complement(19721..20254)
                     /locus_tag="ABZJ_RS19235"
                     /old_locus_tag="ABZJ_p00025"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P23181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gentamicin 3'-acetyltransferase"
                     /protein_id="WP_000946488.1"
                     /db_xref="GI:446869232"
                     /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAAL
                     DLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQA
                     RSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKL
                     GIREEVMHFDIDPSTAT"
CONTIG      join(CP001938.1:1..20301)
//
DBGET integrated database retrieval system