GenomeNet

Database: RefSeq
Entry: NC_017176
LinkDB: NC_017176
Original site: NC_017176 
LOCUS       NC_017176              45258 bp    DNA     circular CON 08-JUN-2013
DEFINITION  Clostridium difficile BI1 plasmid pCDBI1, complete sequence.
ACCESSION   NC_017176
VERSION     NC_017176.1  GI:383843667
DBLINK      Project: 158363
            BioProject: PRJNA158363
KEYWORDS    RefSeq; complete genome.
SOURCE      Peptoclostridium difficile BI1 (Clostridium difficile BI1)
  ORGANISM  Peptoclostridium difficile BI1
            Bacteria; Firmicutes; Clostridia; Clostridiales;
            Peptostreptococcaceae; Peptoclostridium.
REFERENCE   1
  AUTHORS   He,M., Sebaihia,M., Lawley,T.D., Stabler,R.A., Dawson,L.F.,
            Martin,M.J., Holt,K.E., Seth-Smith,H.M., Quail,M.A., Rance,R.,
            Brooks,K., Churcher,C., Harris,D., Bentley,S.D., Burrows,C.,
            Clark,L., Corton,C., Murray,V., Rose,G., Thurston,S., van
            Tonder,A., Walker,D., Wren,B.W., Dougan,G. and Parkhill,J.
  TITLE     Evolutionary dynamics of Clostridium difficile over short and long
            time scales
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 107 (16), 7527-7532 (2010)
   PUBMED   20368420
REFERENCE   2  (bases 1 to 45258)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 45258)
  AUTHORS   He,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-FEB-2010) He M., Wellcome Trust Sanger Institute,
            Sulston Building, Wellcome Trust Genome Campus, Hinxton,
            Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FN668942.
            Draft contiguous sequence
            454 data coverage: 15x
            capillary data coverage: 5.1x
            coverage with combined data (bases meeting finished standard) 97.5%
            coverage with combined data (bases below finished standard) 0.2%
            coverage with 454-only assembly 2.2%
            reference genomes: AM180355 and FN538970.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..45258
                     /organism="Peptoclostridium difficile BI1"
                     /mol_type="genomic DNA"
                     /strain="BI1"
                     /isolation_source="Homo sapiens"
                     /db_xref="taxon:699034"
                     /plasmid="pCDBI1"
                     /country="USA"
                     /collection_date="1988"
     gene            <1..327
                     /locus_tag="CDBI1_18408"
                     /db_xref="GeneID:12212889"
     CDS             <1..327
                     /locus_tag="CDBI1_18408"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196829.1"
                     /db_xref="GI:384358974"
                     /db_xref="GeneID:12212889"
                     /translation="EESLKKEIKSFLNGKTSVNKIEKAIRDKYSTGAGQTSRLIENEV
                     ARCQSEVNEYFFKVQGIIKVMYCADLDSRTCSDCSMHNGVIFYVNEDRPSLPRHCHCR
                     CQYIPV"
     misc_feature    55..324
                     /locus_tag="CDBI1_18408"
                     /note="Phage Mu protein F like protein; Region:
                     Phage_Mu_F; cl10072"
                     /db_xref="CDD:263959"
     gene            386..712
                     /locus_tag="CDBI1_18413"
                     /db_xref="GeneID:12212900"
     CDS             386..712
                     /locus_tag="CDBI1_18413"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196830.1"
                     /db_xref="GI:384358975"
                     /db_xref="GeneID:12212900"
                     /translation="MKVEILGTEYLVIEKLESEDVLLKERAGYCDHSVKEIVIEKINS
                     EEGSLKDLSVYKNEVARHEIIHAFLSESGLKSCSSWATNEEMIDFFAIQFPKIVKVMD
                     KIECLN"
     gene            738..1340
                     /locus_tag="CDBI1_18418"
                     /db_xref="GeneID:12212890"
     CDS             738..1340
                     /locus_tag="CDBI1_18418"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196831.1"
                     /db_xref="GI:384358976"
                     /db_xref="GeneID:12212890"
                     /translation="MLKKEVLELLKEIEDDAEIDSLLQSTDLFKSASDKKLTIEEFRE
                     LINNDANFKAIIDNEKNKYHSEALENFKKKDMQTLISAEVLKRTGANETEEQKAIREL
                     RESLDKLKKEKQYAEKVSKYKDILVEKKIPTNLIEYLLSDDDDKTNANIEIFENSMKQ
                     YVQSKVDERIKDGSYVPPGKDSAGSLSEIRKQIKQGLNSL"
     misc_feature    885..1250
                     /locus_tag="CDBI1_18418"
                     /note="Domain of unknown function (DUF4355); Region:
                     DUF4355; pfam14265"
                     /db_xref="CDD:258450"
     gene            1369..2292
                     /locus_tag="CDBI1_18423"
                     /db_xref="GeneID:12212891"
     CDS             1369..2292
                     /locus_tag="CDBI1_18423"
                     /codon_start=1
                     /transl_table=11
                     /product="Lj928 prophage protein"
                     /protein_id="YP_006196832.1"
                     /db_xref="GI:384358977"
                     /db_xref="GeneID:12212891"
                     /translation="MANVLQYVTLFQQELDMQVTVGSTTGWMEKNAGQVIYNGGREVK
                     VPKVTMDGLGDYDRSKGYTQGAVTLEYETMKMEMDRGRTFMLDSMDVNESNFVINASS
                     VMGLFQKQHVIPEIDAYRYSKIFSETAKVDERVKYSYEATVTTILSELKNQLASIQDL
                     SGDIPLIISMSSIIASILEQSSQLDDIEFGDGDIKRIVKSIDNVPIIKVPSKRMKTEY
                     VFRDGKTSGQTEGGFTEGAKALDINWLITPASAPIAVSKTDKPRIFTPDQNQTADAYQ
                     IDYRKYHDLWILDEYLKLCRASVRQAKAAQE"
     gene            2306..2578
                     /locus_tag="CDBI1_18428"
                     /db_xref="GeneID:12212892"
     CDS             2306..2578
                     /locus_tag="CDBI1_18428"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196833.1"
                     /db_xref="GI:384358978"
                     /db_xref="GeneID:12212892"
                     /translation="MFALIKNNIIKVVEDENSRDKLISKGFKIYSEEVTKENIEKKEE
                     KVKSTSNDLFNLSKPELMEIAKGKNIKGYSTKTKEELIQLLDEYNA"
     misc_feature    2459..>2551
                     /locus_tag="CDBI1_18428"
                     /note="Rho termination factor, N-terminal domain; Region:
                     Rho_N; pfam07498"
                     /db_xref="CDD:254238"
     gene            2562..2942
                     /locus_tag="CDBI1_18433"
                     /db_xref="GeneID:12212893"
     CDS             2562..2942
                     /locus_tag="CDBI1_18433"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196834.1"
                     /db_xref="GI:384358979"
                     /db_xref="GeneID:12212893"
                     /translation="MSTMLDNVKLVLGIENDRYDKLIILYINKISEMVLEYCSRQELS
                     IALEGFVEEKVISILSSRFEELKKNSGLDNLEKSLKAITRGDTKIEYNALTLQTAENS
                     ISSSSFLTDTDKKFLSPFCIVNMY"
     misc_feature    2577..>2729
                     /locus_tag="CDBI1_18433"
                     /note="Head-Tail Connector Proteins gp6 and gp15, and
                     similar proteins; Region: gp6_gp15_like; cl12049"
                     /db_xref="CDD:264522"
     gene            2954..3301
                     /locus_tag="CDBI1_18438"
                     /db_xref="GeneID:12212894"
     CDS             2954..3301
                     /locus_tag="CDBI1_18438"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196835.1"
                     /db_xref="GI:384358980"
                     /db_xref="GeneID:12212894"
                     /translation="MTEADILEMTYLDKMTIIRKSKGWNQETCSNDFSNIIIAENIPC
                     AISRKEEAIISGDIGAIVINRKLFCRPEVDIKTGDTINATYSHGEEAVFKVSKANIYP
                     SHMEIPITEAERI"
     gene            3301..3657
                     /locus_tag="CDBI1_18443"
                     /db_xref="GeneID:12212895"
     CDS             3301..3657
                     /locus_tag="CDBI1_18443"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196836.1"
                     /db_xref="GI:384358981"
                     /db_xref="GeneID:12212895"
                     /translation="MGIDNLGVFEALALDLGLNASNFNRKIKKFTNKTGQELAENIRD
                     ETPVRTEKLKNGWEESQPEYDTYIVEDKVEYATLVNDGHATKNGGIIPGSFMVEKGIE
                     KTKENMTSAKANLFDW"
     misc_feature    3328..3546
                     /locus_tag="CDBI1_18443"
                     /note="Bacteriophage HK97-gp10, putative tail-component;
                     Region: HK97-gp10_like; pfam04883"
                     /db_xref="CDD:252854"
     gene            3651..4115
                     /locus_tag="CDBI1_18448"
                     /db_xref="GeneID:12212896"
     CDS             3651..4115
                     /locus_tag="CDBI1_18448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196837.1"
                     /db_xref="GI:384358982"
                     /db_xref="GeneID:12212896"
                     /translation="MVGGELLTNRDILIAVNEILKNEFIDIDIFINEDNIQGFEEACF
                     FVQLLPVSNNIANKILNTKKIFIDIEYYQKARKNKLNLYDIQSRLEKIFNRNIRVKDR
                     SLTIENISPSIVKDSVGHKLTFLMTISYFEEVYFSKETYVTMENVDLKIGSD"
     gene            4116..5171
                     /locus_tag="CDBI1_18453"
                     /db_xref="GeneID:12212897"
     CDS             4116..5171
                     /locus_tag="CDBI1_18453"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196838.1"
                     /db_xref="GI:384358983"
                     /db_xref="GeneID:12212897"
                     /translation="MGLPEINISFIQAGKTFVKRSGGIVALILKDTKNIGLVEIKEME
                     DIPENYSATNLDYIKMAMKGNVYPPNKVLVYTLDTDESIDDALDFLETCEFNYLCMPD
                     EEEGDLPKIKTWIKKMREDNKIKVKAITASNSADYEGIINFTATDIEVEGKKYTSNEF
                     LPRIAGFIAGTPSTQSVTYAEIPEVTNIPKLTRAEANTRINNGELILIKESGAIVIAR
                     GVTSFTTITDSKGDIFKKIKLVDTLDQIHNDIKKIIVKNYIGKTQNTYDNKCLLIVAI
                     QLYLQELEKDGLIDPGSTIEINLDAQRAWLKENHIDVSNMEEQQIKEYNTDTIVFLKA
                     KIKLIDAMEDVYLDISM"
     misc_feature    <4350..5162
                     /locus_tag="CDBI1_18453"
                     /note="Phage tail sheath protein; Region: Phage_sheath_1;
                     pfam04984"
                     /db_xref="CDD:252922"
     gene            5187..5627
                     /locus_tag="CDBI1_18458"
                     /db_xref="GeneID:12212898"
     CDS             5187..5627
                     /locus_tag="CDBI1_18458"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196839.1"
                     /db_xref="GI:384358984"
                     /db_xref="GeneID:12212898"
                     /translation="MKAKIDPSRIISGTFGECWIDGRQMMAVKGLEAKVELEKEEVKV
                     CGQLMVGQKLIGASGKGSVNLFKVSSLFGEYVESMLNEGKAFKFTIISKLQDPDSYGA
                     ERVALYGCMLDDLTLADWEAGKMGEIEVPFTFESFKYLDKITEK"
     misc_feature    5187..5609
                     /locus_tag="CDBI1_18458"
                     /note="Protein of unknown function (DUF2001); Region:
                     DUF2001; pfam09393"
                     /db_xref="CDD:150159"
     gene            5643..6059
                     /locus_tag="CDBI1_18463"
                     /db_xref="GeneID:12212899"
     CDS             5643..6059
                     /locus_tag="CDBI1_18463"
                     /note="'COG3842 ABC-type spermidine/putrescine transport
                     systems, ATPase components'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196840.1"
                     /db_xref="GI:384358985"
                     /db_xref="GeneID:12212899"
                     /translation="MNTVEKLLNMDAGKLKMPSSIFELYCKKLDDILEIECNAIDPER
                     FDEIRMNSMDVDSGNLENINVYELKVNTILESCPMFRNMEVVENLGLATPKDLLKKLL
                     LAGEIDNLYEEVNKVNGIDAEGDKKRQKERAKDIKN"
     misc_feature    5646..6023
                     /locus_tag="CDBI1_18463"
                     /note="Phage XkdN-like protein; Region: XkdN; pfam08890"
                     /db_xref="CDD:255091"
     gene            6239..9628
                     /locus_tag="CDBI1_18468"
                     /db_xref="GeneID:12212837"
     CDS             6239..9628
                     /locus_tag="CDBI1_18468"
                     /note="COG5283 Phage-related tail protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TP901 family phage tail tape measure protein"
                     /protein_id="YP_006196841.1"
                     /db_xref="GI:384358986"
                     /db_xref="GeneID:12212837"
                     /translation="MSSNAKVLQAIIKMRDEASSTLKRVAANTRALHDSSSQASRALN
                     NVQSNLKSVGTSALKAGGLITAGVGGAFAAATKVGTEFESAMSQVKATFGNSLKPGDF
                     EALSKAARDAGKATTKTAADSANALQYMGLAGWDVQKSMHALMPVLNLSEAASMDLGL
                     ASDLVTDSMSSMCLEVDKVSKSGKVLAGAGLSEYLDKVANASTKSNTSIQQLMEAFNV
                     AGGTFSNLKVPLSEATAIMGILANRGVKGTDAGHALNSIMVNLTTGAGQAGKAMKKLG
                     VSAFDNQGKFKGMSNVLKEVANKTKGMTDEQKNYYLSAIGGKTQLKTLQKLLDGVGNE
                     YDSLKKKIDNSKGALKTMSDVMKDNTKGGLATLKSALEETGITIYYQLKPAIASVVDN
                     LTKMTVWFNNLSEPIKRVITNVMLSVGAFGVLLLTIGAVSLIVSKAIGVFGFFVPIIL
                     RAKVAFRAFVIGMKPLSAVFLAVMGPVGWTITAVIALAVAFTIAYAKSEVFRNKVNSL
                     VKSFTEFAKPIVNFCMPALKQLGEKFKELLSAFGPLFASILNLGSVIMKVLGPVLIGV
                     IGFHIAKLVLILSTLATAFKAVVDTITNVLNGLASILNGVFNLIIGIVTGDSKKMMNG
                     VKQIFDGGVKIIKSIWKGFIDFVTAPIQAIADIADSLFKDKAKWLTDKWKDLRTFLEN
                     PIEATAKISTKTNVNIPGSKAADAAGKSTPNTGGLKQTIANLKGSFSDFKTFIKPMTD
                     SISQGVESGKTKFTELQNKILNDVKPALKVLEDSGVNFKDKFKESITSIKDKFNELKN
                     ILAGNIKTNIDNLVKAFEPLKPHLDNLKECFDKVKKAITDFFTPAKQVGDTVNKVSQP
                     MDSVKKSTDGIKLSFQSLTQALAPVKAWFQGFMPFLSQIGQQLLPSIGIAIAGVVGGI
                     ILAFTWVLNTLTAIITTVSGIINGIMSFISGIINVIMGLITGNADQTMDGLKQIFDSG
                     VGVIKSIWNGLVDLVSGVLEPVIDLADSFFKDKVKGVKEAWNKLKDFFKHPIKGTIEI
                     FKKGPSLQIGKGADAAGKSPRKAFGINRVPRNDYLIRAHEGEKLLTKQEANQYKRNSS
                     NGSLFLDKLADTIIVREEADIDKIVRKINKKISLAKVGGVL"
     misc_feature    6464..7510
                     /locus_tag="CDBI1_18468"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    7190..>8482
                     /locus_tag="CDBI1_18468"
                     /note="Phage-related protein [Function unknown]; Region:
                     COG5412"
                     /db_xref="CDD:227699"
     gene            9675..10151
                     /locus_tag="CDBI1_18473"
                     /db_xref="GeneID:12212838"
     CDS             9675..10151
                     /locus_tag="CDBI1_18473"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196842.1"
                     /db_xref="GI:384358987"
                     /db_xref="GeneID:12212838"
                     /translation="MNKKIPALAILIVLSLSLVGCSTNDSKNGDSKPKQNTEEIKNHK
                     IGEVVDLDGAKVSVKNVRKLESDSNVYAVEIEITNTGDTDLESDFLQNYILKTDDNTV
                     GNAINNQELNGELLFDTIHPGDTLKGEIAFELTKDTKPKTIEIAYENVGKYTVFDL"
     misc_feature    9675..>9881
                     /locus_tag="CDBI1_18473"
                     /note="Glycine zipper 2TM domain; Region: Rick_17kDa_Anti;
                     cl10470"
                     /db_xref="CDD:263979"
     misc_feature    9801..10109
                     /locus_tag="CDBI1_18473"
                     /note="Domain of unknown function (DUF4352); Region:
                     DUF4352; pfam11611"
                     /db_xref="CDD:256529"
     gene            10209..10844
                     /locus_tag="CDBI1_18478"
                     /db_xref="GeneID:12212839"
     CDS             10209..10844
                     /locus_tag="CDBI1_18478"
                     /note="COG1652 Uncharacterized protein containing LysM
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196843.1"
                     /db_xref="GI:384358988"
                     /db_xref="GeneID:12212839"
                     /translation="MEIWLRQANNTFRFPVIPPSFEINGSATINTSNILSVGDIAVFG
                     GLGLKTIELSSFFPNQEYSFCNYNGFPKPYDCVNLIESWMKEGYILRFIITETNINFE
                     CIIADFNYREQDYSRDVYFTLSLKEYRRIQISKVNINNDEKLSSEKDVPLTKGFDTKQ
                     KTHKVVEGDTLFKIAKKYYGNGDLWEKIYKANEDKIKDPSVIKNGWILIIP"
     misc_feature    10689..10838
                     /locus_tag="CDBI1_18478"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     gene            10925..12601
                     /locus_tag="CDBI1_18483"
                     /db_xref="GeneID:12212840"
     CDS             10925..12601
                     /locus_tag="CDBI1_18483"
                     /note="COG0791 Cell wall-associated hydrolases
                     (invasion-associated proteins)"
                     /codon_start=1
                     /transl_table=11
                     /product="phage cell wall hydrolase"
                     /protein_id="YP_006196844.1"
                     /db_xref="GI:384358989"
                     /db_xref="GeneID:12212840"
                     /translation="MDKCTWSGDYRSPSRTLEFSIIQSASDINFRQIDIPVASTVCFY
                     VDDKELFRGMIIDRSKDSSNNNIDFTAKDMGFLLLQSEVSYNFKDKLVEDIAKQVFVD
                     NKFPLGNLPKTNVKYTKMFIGVTGYDTIMSVYTEASKTTKKKYMIESNLDKFNVIEKG
                     VVTLNITFEEGFNLINTNFSESMENVKNKVLVVDQYGNKISEKINDSIFKDVGVIMQK
                     VIQQQENSTIDIDGEFKGIEKTCSLKGYGDITCVTGRGVKVKDSYTKLIGLFYIDTDK
                     HTWQNGDYQIELELNFENIMDEKSAGQDEQKEDGSEYTGGTEYSAEFTAYCPRKSEGG
                     DKDCRGKKLDPSKKTCAAPMVGTYEKSYYTKDFLNKHPLMRYGDEIQLVTGVSSRDGT
                     YKVNDNGPAIIIEKDGTYHIDILFGNVEEANNFGRRKGKIIIGGYSGNVTEKAKTVIS
                     EARKHLGKPYKWGGNGPSSFDCSGLMVYCFKKVNVNLPRTSSQQSKVGKKVEKNNLQA
                     GDLVFFHNPVSHVGLYVGNGEFLHAPQTGDVVKISKLSNRKDFNTARRVL"
     misc_feature    <12266..12577
                     /locus_tag="CDBI1_18483"
                     /note="Cell wall-associated hydrolases
                     (invasion-associated proteins) [Cell envelope biogenesis,
                     outer membrane]; Region: Spr; COG0791"
                     /db_xref="CDD:223862"
     misc_feature    12293..12568
                     /locus_tag="CDBI1_18483"
                     /note="NlpC/P60 family; Region: NLPC_P60; pfam00877"
                     /db_xref="CDD:189752"
     gene            12615..12947
                     /locus_tag="CDBI1_18488"
                     /db_xref="GeneID:12212841"
     CDS             12615..12947
                     /locus_tag="CDBI1_18488"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196845.1"
                     /db_xref="GI:384358990"
                     /db_xref="GeneID:12212841"
                     /translation="MADPINEFIGIMRQEGKFHNEPSFFIGKIKSKLPDLKIEINNII
                     LEKEDILVDSWMLDRQIELFDTETSQEHKHEIKNPFIDTFESGNTVIMFKIGEKFAVV
                     SKLVSLDE"
     misc_feature    12633..12929
                     /locus_tag="CDBI1_18488"
                     /note="Protein of unknown function (DUF2577); Region:
                     DUF2577; pfam10844"
                     /db_xref="CDD:256179"
     gene            12940..13374
                     /locus_tag="CDBI1_18493"
                     /db_xref="GeneID:12212842"
     CDS             12940..13374
                     /locus_tag="CDBI1_18493"
                     /note="COG0515 Serine/threonine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="phage protein"
                     /protein_id="YP_006196846.1"
                     /db_xref="GI:384358991"
                     /db_xref="GeneID:12212842"
                     /translation="MNNTIFPFMGVPEDYISPDNEELPIFKEFAWDFDKDEKVIENGD
                     FKIVERNEAIKVWIYKTIKTDKYVYLIYDWDYGTDIKNLIGQKYTKGLTESEAKRYIQ
                     EALLTNPYILEVNVTNAEFKDDNLSISLNVKTIYGEEEITFV"
     misc_feature    13021..13353
                     /locus_tag="CDBI1_18493"
                     /note="Protein of unknown function (DUF2634); Region:
                     DUF2634; pfam10934"
                     /db_xref="CDD:151381"
     gene            13367..14419
                     /locus_tag="CDBI1_18498"
                     /db_xref="GeneID:12212843"
     CDS             13367..14419
                     /locus_tag="CDBI1_18498"
                     /note="COG3299 Uncharacterized homolog of phage Mu protein
                     gp47"
                     /codon_start=1
                     /transl_table=11
                     /product="phage protein"
                     /protein_id="YP_006196847.1"
                     /db_xref="GI:384358992"
                     /db_xref="GeneID:12212843"
                     /translation="MYSGQSFSTLNNRTLNNINLPLYKNQGSSLYNIVSPINSELAQL
                     YIELSYIHKRVFIQDNFDDFLDRRVNEFGVYRKLGTEAIGEVIFEGKIGTKIPNGTIV
                     SHSDLLFVVIKDVTIDEDSKLNVSLIQALEVGIKYNLSANTEFKLIEEINGVTKIYNE
                     LDLKGGTEIETDEELKERFYKIQKNQATSGNKAHYQSWALEVEGVYNAKVIPRWDGPG
                     TIKILIYGQNNQSVDNEVLQRCIEHIEEEKPIGPTITIVTPSTFDINISATLTLENGY
                     DIESIKVVFLDIINSYLIENSREIIYIKIMSLLASIEGVHDIKNLLVNDDVKNIIVDE
                     EKAPAVSSAIFDIEVS"
     misc_feature    13367..14317
                     /locus_tag="CDBI1_18498"
                     /note="Uncharacterized homolog of phage Mu protein gp47
                     [Function unknown]; Region: XkdT; COG3299"
                     /db_xref="CDD:225836"
     gene            14421..15035
                     /locus_tag="CDBI1_18503"
                     /db_xref="GeneID:12212844"
     CDS             14421..15035
                     /locus_tag="CDBI1_18503"
                     /note="COG4385 Bacteriophage P2-related tail formation
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage protein"
                     /protein_id="YP_006196848.1"
                     /db_xref="GI:384358993"
                     /db_xref="GeneID:12212844"
                     /translation="MKLIDYLPSFANNEIDIQIQEALENELLTLIDEKDDLLEQFFID
                     TATWGLDDWENLLSIKVNYKLDFDTRRSNIKAKMRGKGTTTIEVIKAISEAYTKTNVD
                     VEVFSNLFSFTLSFITNDCSYNTILELDKKIEEIKPAHLEHKFEMILFNENGLYAGAM
                     SSTGETVTIYPYTPKNIECFGEIILASGNNKSAERVTLYPQEVI"
     misc_feature    14427..14858
                     /locus_tag="CDBI1_18503"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2313); Region: DUF2313; pfam10076"
                     /db_xref="CDD:255737"
     gene            15036..15818
                     /locus_tag="CDBI1_18508"
                     /db_xref="GeneID:12212845"
     CDS             15036..15818
                     /locus_tag="CDBI1_18508"
                     /note="COG5301 Phage-related tail fibre protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail fiber protein"
                     /protein_id="YP_006196849.1"
                     /db_xref="GI:384358994"
                     /db_xref="GeneID:12212845"
                     /translation="MAQAQYYTLLTEIGKAAIANATALGTRVDFAKIKVGDGGGSAYI
                     PTETQTELKNVVWESTLEHVQADEKNPNWVVIQKTITGDTGSFTIREIGVFDSKDQLL
                     AVSSYPETYKPAPDSGTVKEILIKIILAVSNTASINLKIDPTVVLATLRDIQDLDAKI
                     DTTKTELTSNIETTKTELNTKIGDTTQLTTTDKTNIVSALNEVKSSVDSIETTAEKTS
                     IKDTDNLFSSDNVEGALKEVMQEVKGNRSSIISTVNNNLIPM"
     misc_feature    15036..15497
                     /locus_tag="CDBI1_18508"
                     /note="Phage tail-collar fibre protein; Region: DUF3751;
                     pfam12571"
                     /db_xref="CDD:257135"
     gene            15838..17325
                     /locus_tag="CDBI1_18513"
                     /db_xref="GeneID:12212846"
     CDS             15838..17325
                     /locus_tag="CDBI1_18513"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196850.1"
                     /db_xref="GI:384358995"
                     /db_xref="GeneID:12212846"
                     /translation="MSTTVLERTVKRRRGYYRMTDIHASRLTYNDGSPYYTDFVAYYT
                     LDQYERVSISATKKFVAYSTRACQIINGREVDISRNFTQETTVQFVPDPTIFISNDLG
                     VIGNACSINYRISDSDSSVRFKIIEKINGVKIAEKNNVVDGNYELIITDELLSELAFN
                     SVNNITIELDNGYGGIFLDKTVTFTKGNTKPKLNITSYNSTSATFTAIDTDNNLSKIE
                     WFIDDVLKETITTDLTTEKTINYELADNAIHTLKIVATDSENATAEKVLSISKEIMPL
                     QSDASLSDISTKLIEIGEGFRNGKTSIINTLALKNIEASLNNTLVELSEKIKQSFDSG
                     DASLQDLMNQLTQANNTISQLNSKYKVASGTVTSFADSAKIAYPYLTDRTFKPGTWVK
                     ISNLDFKPNIFFADFDYYDTEYKNNYKLFLFACRGVATQRGVDFSSVTAFIRKNSDEN
                     FHANGWLYNNSEGDVYFNNTGVQIPAYNFDSTQRHIYKWYAIKFI"
     misc_feature    <16834..17070
                     /locus_tag="CDBI1_18513"
                     /note="Viral coat protein; Region: Flexi_CP; pfam00286"
                     /db_xref="CDD:249741"
     gene            17341..17634
                     /locus_tag="CDBI1_18518"
                     /db_xref="GeneID:12212847"
     CDS             17341..17634
                     /locus_tag="CDBI1_18518"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196851.1"
                     /db_xref="GI:384358996"
                     /db_xref="GeneID:12212847"
                     /translation="MNVPNRVIYDQTGKIIFETGESCGDVLPHNKITELDYIDIPYGS
                     IDYIKNRIIGINIETKQPILEEIPVYVSEEKKRIQELENQVLLNENEKVGGLL"
     gene            17634..17816
                     /locus_tag="CDBI1_18523"
                     /db_xref="GeneID:12212848"
     CDS             17634..17816
                     /locus_tag="CDBI1_18523"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196852.1"
                     /db_xref="GI:384358997"
                     /db_xref="GeneID:12212848"
                     /translation="MNINNVVVRILAERILNGGLNPLKNREFELDDVTNTEYRKAVED
                     YIIRESGVVEGAEPTK"
     gene            17914..18132
                     /locus_tag="CDBI1_18528"
                     /db_xref="GeneID:12212849"
     CDS             17914..18132
                     /locus_tag="CDBI1_18528"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196853.1"
                     /db_xref="GI:384358998"
                     /db_xref="GeneID:12212849"
                     /translation="MKKIIVICILVLMLIIPTMGEIFIMVENIKLEGLEQNPTSCYIS
                     NPGIMGEAKCDAAYFIIAADFVNNLKVK"
     misc_feature    17920..>18000
                     /locus_tag="CDBI1_18528"
                     /note="Inner membrane protein CreD; Region: CreD; cl01844"
                     /db_xref="CDD:261093"
     gene            18200..18631
                     /locus_tag="CDBI1_18533"
                     /db_xref="GeneID:12212850"
     CDS             18200..18631
                     /locus_tag="CDBI1_18533"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall hydrolase protein"
                     /protein_id="YP_006196854.1"
                     /db_xref="GI:384358999"
                     /db_xref="GeneID:12212850"
                     /translation="MNLTIVFLATNIFIKLVILAIAFDTLLGCLRAIKTHQFNSSFGI
                     NGGIRKVAMIACIFFLAVVDILTKFNFLFMLPQDWIDFLRLNHLGISEFFSILFILYE
                     SVSILKNMYLCGLPVPKKLKEKIGNLLDTMTDELNIKGGNK"
     misc_feature    18206..18595
                     /locus_tag="CDBI1_18533"
                     /note="Holin family; Region: Phage_holin_4; cl01989"
                     /db_xref="CDD:242822"
     gene            18631..19467
                     /locus_tag="CDBI1_18538"
                     /db_xref="GeneID:12212851"
     CDS             18631..19467
                     /locus_tag="CDBI1_18538"
                     /note="COG0860 N-acetylmuramoyl-L-alanine amidase"
                     /codon_start=1
                     /transl_table=11
                     /product="n-acetylmuramoyl-l-alanine amidase"
                     /protein_id="YP_006196855.1"
                     /db_xref="GI:384359000"
                     /db_xref="GeneID:12212851"
                     /translation="MKICITVGHSILKSGACTSADGVINEYQYNKSLAPVLADIFRKE
                     GHKVDVIICPEKQFKTKSEEKSYKIPKINSGNYNLLIELHLNSSGVGAFGTEVFYYSE
                     KGKEYAQRVVDKLSKPFIRKKGDKEVGNRGAKLDKSLYILNSSKPTAVLIESFFCDNK
                     EDYEKAKKLGHEGIAKLIVEGILNKNINNEGVKQMYKHTIVYDGEVDKIPATVVGWGY
                     NDGKILICDIKDYVPGQTQNLYVVGGGACEKIGSITKEHYTMIKGNDRFDTLYKALDF
                     IK"
     misc_feature    18634..19179
                     /locus_tag="CDBI1_18538"
                     /note="N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA
                     (also known as peptidoglycan aminohydrolase, NAMLA
                     amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC
                     3.5.1.28) is an autolysin that hydrolyzes the amide bond
                     between N-acetylmuramoyl and L-amino...; Region:
                     MurNAc-LAA; cd02696"
                     /db_xref="CDD:119407"
     misc_feature    order(18655..18657,18706..18708,18880..18882,19087..19089)
                     /locus_tag="CDBI1_18538"
                     /note="active site"
                     /db_xref="CDD:119407"
     misc_feature    order(18655..18657,18706..18708,18880..18882)
                     /locus_tag="CDBI1_18538"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119407"
     misc_feature    19526..20295
                     /note="potential frameshift: common BLAST hit:
                     gi|299769744|ref|YP_003731770.1| phage DNA methylase"
     gene            20629..20964
                     /locus_tag="CDBI1_18553"
                     /db_xref="GeneID:12212852"
     CDS             20629..20964
                     /locus_tag="CDBI1_18553"
                     /note="COG3682 Predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="YP_006196856.1"
                     /db_xref="GI:384359001"
                     /db_xref="GeneID:12212852"
                     /translation="MLIQSLKRGELIVMKIFWKRNSRISRKEIIRICNEKHKWQKSTT
                     KILLKRLVKKRVLLKRIKIFHIYYIPIVTEKEYFKYKINDLEPDYLDGYFIRLMSTVH
                     KFKNLDEED"
     misc_feature    20656..>20859
                     /locus_tag="CDBI1_18553"
                     /note="Penicillinase repressor; Region: Penicillinase_R;
                     cl17580"
                     /db_xref="CDD:266753"
     gene            complement(20975..21490)
                     /locus_tag="CDBI1_18558"
                     /db_xref="GeneID:12212853"
     CDS             complement(20975..21490)
                     /locus_tag="CDBI1_18558"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196857.1"
                     /db_xref="GI:384359002"
                     /db_xref="GeneID:12212853"
                     /translation="MTWSDLKEKNINEVVDCINNKLSEFESLKKVGDELGANESTIRK
                     WLNKKGYKRVGNRFLEDNKSYDDKYQIDSINSKIDDDIKYLSNEIDNIKSVIEWFKTK
                     DDKCHIDSIKENDISIDLPDQSIKRTTIRVNNTVWEMFNKFADENKHYDKHDLLSQLL
                     LESLLKYVKSR"
     gene            complement(21572..22477)
                     /locus_tag="CDBI1_18563"
                     /db_xref="GeneID:12212854"
     CDS             complement(21572..22477)
                     /locus_tag="CDBI1_18563"
                     /note="COG1077 Actin-like ATPase involved in cell
                     morphogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="StbA family protein"
                     /protein_id="YP_006196858.1"
                     /db_xref="GI:384359003"
                     /db_xref="GeneID:12212854"
                     /translation="MSKLGIDIGNYAVKTSTDDIFESKVTEVKNFGSDSDSIKIGNKT
                     YYLGEGDEEINIVKYEKENFLPLLLGAICRNTDDEVIDLALGLPVKQFGGLRKDLIEK
                     LQGKEYHVEFEKGNETTKRDITIRSVQVFPEGVTGYLYYAKDIVDQIAGRDVVLVDIG
                     GKTTDIALVQGNKATDPYSVNVGTINIYDAIKKSLEMDERFLGKVEIKREKIQDYIDK
                     GFYLNGEKQDIKKNIDASVGLFKQIYNELKLNYPISTSAVVVMGGGAKLLGEAFKKNI
                     PGIIVMSDVDKHVFANAKGYKKMMK"
     misc_feature    complement(21584..22471)
                     /locus_tag="CDBI1_18563"
                     /note="Plasmid segregation protein ParM and similar
                     proteins; Region: ParM_like; cd10227"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(22004..22006,22457..22459))
                     /locus_tag="CDBI1_18563"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(21677..21679,21689..21694,21995..22003,
                     22436..22438,22442..22453))
                     /locus_tag="CDBI1_18563"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(21968..21970,22019..22021,22085..22087,
                     22280..22282,22325..22333,22340..22342,22394..22396,
                     22400..22402))
                     /locus_tag="CDBI1_18563"
                     /note="putative protofilament interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212669"
     gene            complement(22496..22699)
                     /locus_tag="CDBI1_18568"
                     /db_xref="GeneID:12212855"
     CDS             complement(22496..22699)
                     /locus_tag="CDBI1_18568"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196859.1"
                     /db_xref="GI:384359004"
                     /db_xref="GeneID:12212855"
                     /translation="MSRIVLTFKNNDKEKAIEKFLDEKLSATAYLKELVWEKMNEKKD
                     NAVVEQKKEIEDPANNFDFGSLE"
     gene            complement(22929..23387)
                     /locus_tag="CDBI1_18573"
                     /db_xref="GeneID:12212856"
     CDS             complement(22929..23387)
                     /locus_tag="CDBI1_18573"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196860.1"
                     /db_xref="GI:384359005"
                     /db_xref="GeneID:12212856"
                     /translation="MKKTIALLLTLCAVMIPFTAFADGNDYEGTGNSQTVELIGQPNS
                     DSPSTKSIVVPGGTANLTAMSGGQLSWRVTSTLGNILGFEGEINVYKAGKIVSSQLVG
                     FRLAGTTKTGVVSFKGLKKGSYIAKFKGKGVCTGGIILFSSPAEASFTIR"
     gene            complement(23422..23724)
                     /locus_tag="CDBI1_18578"
                     /db_xref="GeneID:12212857"
     CDS             complement(23422..23724)
                     /locus_tag="CDBI1_18578"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196861.1"
                     /db_xref="GI:384359006"
                     /db_xref="GeneID:12212857"
                     /translation="MEVNLHTGKDEFFKNHEVAKNYIGGLYKLIDVYKFSMESVSVLT
                     RIDLDKLNNFYAGEASLNYDELCLIESVIITPLVGAFETAEHNYNMIIKARKERKL"
     gene            complement(24112..24264)
                     /locus_tag="CDBI1_18583"
                     /db_xref="GeneID:12212858"
     CDS             complement(24112..24264)
                     /locus_tag="CDBI1_18583"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196862.1"
                     /db_xref="GI:384359007"
                     /db_xref="GeneID:12212858"
                     /translation="MDNFLFNVLASLTASVVVYLISELFKKAKSHSRAKSDLQVEFKF
                     IFKFKK"
     gene            complement(24384..25118)
                     /locus_tag="CDBI1_18588"
                     /db_xref="GeneID:12212859"
     CDS             complement(24384..25118)
                     /locus_tag="CDBI1_18588"
                     /note="COG0322 Nuclease subunit of the excinuclease
                     complex"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196863.1"
                     /db_xref="GI:384359008"
                     /db_xref="GeneID:12212859"
                     /translation="MYYVYKYINQDTEECLYVGKTENICDRHASHLSNKKENWCNKNL
                     RLEYMELDNKYTMDFYEIYLINKLEPKFNITGKGEMDIAKTSFSYNGQWVIYLERDLM
                     SSLASKRYGINYEVNAKMLGIMRKLKKISSNEEIFIGNENIRIKYYFETVLEGINLEP
                     CILSVAYKTLKESTVGTVISVKREYLSENVCLIIDSIFLNEIMKDPLMSKSDIKDLNS
                     QVNDILKIIGVDCEWNKLSDYCSANS"
     misc_feature    complement(24900..25118)
                     /locus_tag="CDBI1_18588"
                     /note="GIY-YIG catalytic domain; Region: GIY-YIG;
                     pfam01541"
                     /db_xref="CDD:250694"
     misc_feature    complement(order(25062..25070,25104..25109))
                     /locus_tag="CDBI1_18588"
                     /note="GIY-YIG motif/motif A; other site"
                     /db_xref="CDD:198380"
     misc_feature    complement(order(24936..24938,25026..25028,25038..25040,
                     25062..25064,25068..25070,25104..25106))
                     /locus_tag="CDBI1_18588"
                     /note="active site"
                     /db_xref="CDD:198380"
     misc_feature    complement(order(24936..24938,25038..25040))
                     /locus_tag="CDBI1_18588"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198380"
     misc_feature    complement(24936..24938)
                     /locus_tag="CDBI1_18588"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198380"
     gene            complement(25138..25938)
                     /locus_tag="CDBI1_18593"
                     /db_xref="GeneID:12212860"
     CDS             complement(25138..25938)
                     /locus_tag="CDBI1_18593"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196864.1"
                     /db_xref="GI:384359009"
                     /db_xref="GeneID:12212860"
                     /translation="MYYVYKYIDPATEECLYVGKTEDIYARHSSHLSNKEEDWCTKEL
                     ILKYIELPRRYNMDFFEVYLINELNPIFNKLSKGDMDTEHIFFDYKEEDWSTYSEEDF
                     KEKTKGKRRFRERKIDMKYEVSKKSINFLKRIEKLDAKVEMLYENNVLSVLYNFENMD
                     IEFCENELDINLISYDFETLERFGSCSLISVYPRWKEYTATNKKILINITLEIRIGSL
                     ANLMELMPTFEYKITEIFQQIEDIFHILEVGYTWQELFEIYKGCKYDN"
     misc_feature    complement(25717..25929)
                     /locus_tag="CDBI1_18593"
                     /note="GIY-YIG nuclease domain superfamily; Region:
                     GIY-YIG_SF; cl15257"
                     /db_xref="CDD:265657"
     misc_feature    complement(order(25882..25890,25924..25929))
                     /locus_tag="CDBI1_18593"
                     /note="GIY-YIG motif/motif A; other site"
                     /db_xref="CDD:198380"
     misc_feature    complement(order(25756..25758,25846..25848,25858..25860,
                     25882..25884,25888..25890,25924..25926))
                     /locus_tag="CDBI1_18593"
                     /note="active site"
                     /db_xref="CDD:198380"
     misc_feature    complement(order(25756..25758,25858..25860))
                     /locus_tag="CDBI1_18593"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198380"
     misc_feature    complement(25756..25758)
                     /locus_tag="CDBI1_18593"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198380"
     gene            complement(25958..27145)
                     /locus_tag="CDBI1_18598"
                     /db_xref="GeneID:12212861"
     CDS             complement(25958..27145)
                     /locus_tag="CDBI1_18598"
                     /note="COG5527 Protein involved in initiation of plasmid
                     replication"
                     /codon_start=1
                     /transl_table=11
                     /product="putative replication initiator protein"
                     /protein_id="YP_006196865.1"
                     /db_xref="GI:384359010"
                     /db_xref="GeneID:12212861"
                     /translation="MEKKEILMQPNNLIKSKYDFTNVENKLFYKILFNAQKQQNSSYV
                     TTISKEELKVFMKNNNDYEHKNIKEILNMFQQSVLEFDYIEETTGKLKTFGSGLINTY
                     ELDHTDQIYTIMMHEVLYNHITDFVKMQKKKNGYTAINLSVLFNFRGAYTQRLYTLFR
                     LWSRENKEVEIKYKLDELRFYLKLKDNVYPEYKYFKQNVLKRAMNEINKKGNMVVSIK
                     EEKRKNRKIDEIIFSVIDYEPRKYFDKDILVEDYIPKKKQDNEVSFSFYIPNENIFTT
                     GTIKLFKEDFKEFDFKKDVYLNAFNKSIAIAFERDNTDIINTKNYDFFKSTLSNKISE
                     VIIHQKDDLKFKEELDKYWDDEDVKKEEREVDYSKDPVRLETVRRNLFDQGLVNEEGY
                     YYK"
     misc_feature    complement(26447..27139)
                     /locus_tag="CDBI1_18598"
                     /note="Initiator Replication protein; Region: Rep_3;
                     pfam01051"
                     /db_xref="CDD:250324"
     gene            27564..28253
                     /locus_tag="CDBI1_18603"
                     /db_xref="GeneID:12212862"
     CDS             27564..28253
                     /locus_tag="CDBI1_18603"
                     /note="COG1846 Transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196866.1"
                     /db_xref="GI:384359011"
                     /db_xref="GeneID:12212862"
                     /translation="MLENRKQIQKEIYLPIATYCLKDKQYYIKEYGALLIKSAENSDI
                     FNTHKNRILYKNKLDIQEIANELNVNKATIQRNIKKLEKLDFKILKIENTLNGIVYCL
                     PSENNIDLNKFALINYEMLKKMVNKFKSNTIKVYFLLKTITTETNFKPATNSFIAENI
                     GLSSKSKNNLDIITSSVKTLEENKYIETKKVNVYEYDKEKLREVPKIRKVYRICNFDE
                     WKKEIDKNKVY"
     misc_feature    27714..27827
                     /locus_tag="CDBI1_18603"
                     /note="HTH domain; Region: HTH_11; cl17392"
                     /db_xref="CDD:266661"
     gene            complement(28402..28785)
                     /locus_tag="CDBI1_18608"
                     /db_xref="GeneID:12212863"
     CDS             complement(28402..28785)
                     /locus_tag="CDBI1_18608"
                     /note="COG3682 Predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="YP_006196867.1"
                     /db_xref="GI:384359012"
                     /db_xref="GeneID:12212863"
                     /translation="MKIKKIPESELLVMMYIWDSEDEEVASTEILKTLGEKYEWKKST
                     MLTFLRRLVGRGFLEVVKKDRFTYYKALVEKEDYLKVETKSFFSFFHKNSFESLLSAL
                     HDDEEVSENKLKSLEKFIEDWEEDK"
     misc_feature    complement(28420..28770)
                     /locus_tag="CDBI1_18608"
                     /note="Penicillinase repressor; Region: Penicillinase_R;
                     pfam03965"
                     /db_xref="CDD:252282"
     gene            29159..29674
                     /locus_tag="CDBI1_18613"
                     /db_xref="GeneID:12212864"
     CDS             29159..29674
                     /locus_tag="CDBI1_18613"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196868.1"
                     /db_xref="GI:384359013"
                     /db_xref="GeneID:12212864"
                     /translation="MSKMIQCKSCSKEIASNAKSCPNCGAKNKKPFYKRGWFIVVVVL
                     VLLYAIGTSGSGTDDTAESNDDGTSKTASVDKPEEPKKEKYEIVGDITSETDSMATYI
                     KGVIKNNSGHDISYAQVTFTLYDKDGNQLGTAMDNINDLKKDGTWKFKAMGMNTDGEI
                     ASYELSEITGF"
     misc_feature    29168..29239
                     /locus_tag="CDBI1_18613"
                     /note="zinc-ribbon domain; Region: zf-ribbon_3; pfam13248"
                     /db_xref="CDD:257604"
     misc_feature    29177..>29248
                     /locus_tag="CDBI1_18613"
                     /note="Double zinc ribbon; Region: DZR; pfam12773"
                     /db_xref="CDD:257289"
     gene            complement(30258..30629)
                     /locus_tag="CDBI1_18618"
                     /db_xref="GeneID:12212865"
     CDS             complement(30258..30629)
                     /locus_tag="CDBI1_18618"
                     /note="COG1396 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196869.1"
                     /db_xref="GI:384359014"
                     /db_xref="GeneID:12212865"
                     /translation="MENIKDESVLKTLREALGLNQSELANILKMTPSAISKIEKNGKP
                     LSDRISSQLSKEFGVREEWLKNKEGKMFADSSDDDLVAEIAANIINSDDKFMKNVIIA
                     FNKLTEDQRNFLINFMKELDK"
     misc_feature    complement(30438..30602)
                     /locus_tag="CDBI1_18618"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(30510..30512,30585..30587,30597..30599))
                     /locus_tag="CDBI1_18618"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(30513..30515,30588..30590))
                     /locus_tag="CDBI1_18618"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(30507..30512,30522..30524,30531..30533,
                     30564..30569))
                     /locus_tag="CDBI1_18618"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            30981..31199
                     /locus_tag="CDBI1_18623"
                     /db_xref="GeneID:12212866"
     CDS             30981..31199
                     /locus_tag="CDBI1_18623"
                     /note="COG0162 Tyrosyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196870.1"
                     /db_xref="GI:384359015"
                     /db_xref="GeneID:12212866"
                     /translation="MNDEMITKMFSLNKTYKMTSIRLNLEVKGVITHIDKNEIVLEYY
                     DNELECITTKILTIDDIKYNDYNLKPLH"
     gene            31229..31960
                     /locus_tag="CDBI1_18628"
                     /db_xref="GeneID:12212867"
     CDS             31229..31960
                     /locus_tag="CDBI1_18628"
                     /codon_start=1
                     /transl_table=11
                     /product="phage replication initiation protein"
                     /protein_id="YP_006196871.1"
                     /db_xref="GI:384359016"
                     /db_xref="GeneID:12212867"
                     /translation="MDLLKDARKREWFWLENDLVDREDLGIYEKMIYIVLARYSDNES
                     CCFPSYKTIALKCGCSERQAKSVVKILENKGLIKKENRIKSNSNEKESNIYFVLTAKL
                     GGEYDAQQVVNMMHNPSAPHALPVVHEVHSKKTYNKKTYIKSNTTPQNEPKTDYLDLS
                     FLDLDIEKVKLTKDEYDKLISKFGKKYIHDKIVSLENYIVNGKGSRYKSHYRALLTWG
                     NADTSKGILQPVTKAKNPLSGFKEL"
     misc_feature    31295..31459
                     /locus_tag="CDBI1_18628"
                     /note="Helix-turn-helix domain; Region: HTH_36; pfam13730"
                     /db_xref="CDD:258026"
     gene            31989..32174
                     /locus_tag="CDBI1_18633"
                     /db_xref="GeneID:12212868"
     CDS             31989..32174
                     /locus_tag="CDBI1_18633"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196872.1"
                     /db_xref="GI:384359017"
                     /db_xref="GeneID:12212868"
                     /translation="MNEKEEAVYLNSSNVKLFLGVRDIKEFEELIENVNERICQLQES
                     INKLAQFNIEFDIKSDI"
     gene            32200..32418
                     /locus_tag="CDBI1_18638"
                     /db_xref="GeneID:12212869"
     CDS             32200..32418
                     /locus_tag="CDBI1_18638"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196873.1"
                     /db_xref="GI:384359018"
                     /db_xref="GeneID:12212869"
                     /translation="MKEEKLELTEKDLHCIARHLQNEVMEMVFRGNIEAPTSCEVCDY
                     LQECKGYFTHIDTFIKLSEMTGVDIFTK"
     gene            complement(32437..32643)
                     /locus_tag="CDBI1_18643"
                     /db_xref="GeneID:12212870"
     CDS             complement(32437..32643)
                     /locus_tag="CDBI1_18643"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196874.1"
                     /db_xref="GI:384359019"
                     /db_xref="GeneID:12212870"
                     /translation="MCKIKTLREKCSLIDDKVEFSGEYKTFPGFTGSKLLECECNKNY
                     ICKIQIMTANSNCPLFKKARQLQY"
     gene            32781..33098
                     /locus_tag="CDBI1_18648"
                     /db_xref="GeneID:12212871"
     CDS             32781..33098
                     /locus_tag="CDBI1_18648"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196875.1"
                     /db_xref="GI:384359020"
                     /db_xref="GeneID:12212871"
                     /translation="MERKKHELTDQDIQRLIEGLRTDPKIREMIFESKDCETRTSTRS
                     KCEQFVEEKLAYRSYGFETPKYYAKLIADIIDILVYKNVPRDRICGVLYDVERVIPLV
                     VTF"
     gene            33120..34451
                     /locus_tag="CDBI1_18653"
                     /db_xref="GeneID:12212872"
     CDS             33120..34451
                     /locus_tag="CDBI1_18653"
                     /note="COG0305 Replicative DNA helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="YP_006196876.1"
                     /db_xref="GI:384359021"
                     /db_xref="GeneID:12212872"
                     /translation="MNYSLEAEQNILGSFLINDSIGYKIRELKENDFYFESHKIILSC
                     MKKIIDSNKPLDLLLLKNELEKIDRLVDIGGVSYITSLTTIVITTSNIDHYIKIIKEK
                     LLKRQISELANELINNSNSDTSIDELIVDINDLKALVTTSSSINDNYIDASKIKREKG
                     VHKSIDTGFNKLNNMLDGFRYGTLTILTGKPASGKSTIVNQFIAEAIVNKEKAFLYSG
                     ELPAFMAMEWFRKTVANDYHIKEYKSVYGGTYTDIPDYASELISDWIEDKLFLYDEDA
                     ISDEVNLLNTIEHLYLKKGVRFFVLDNLMTIKTGNKADKYERQEQIVSNLKNLAKKYN
                     LVIVLVAHPRKNMGDMKPTMYDVSGASEIVNYADYILSTYRVVDEEEETDDTYLLILK
                     NRITGKQNISFKMNFSERRKRLYTTSEELNRDYKYDVNKQYVQVEIPEDVF"
     misc_feature    33120..33422
                     /locus_tag="CDBI1_18653"
                     /note="DnaB-like helicase N terminal domain; Region: DnaB;
                     pfam00772"
                     /db_xref="CDD:250122"
     misc_feature    33129..34301
                     /locus_tag="CDBI1_18653"
                     /note="phage replicative helicase, DnaB family, HK022
                     subfamily; Region: phage_DnaB; TIGR03600"
                     /db_xref="CDD:213836"
     misc_feature    33621..34370
                     /locus_tag="CDBI1_18653"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(33684..33689,33699..33707)
                     /locus_tag="CDBI1_18653"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(33687..33689,33699..33707,33762..33764,33768..33773,
                     34023..34028)
                     /locus_tag="CDBI1_18653"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    34011..34025
                     /locus_tag="CDBI1_18653"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            34827..35213
                     /locus_tag="CDBI1_18658"
                     /db_xref="GeneID:12212873"
     CDS             34827..35213
                     /locus_tag="CDBI1_18658"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196877.1"
                     /db_xref="GI:384359022"
                     /db_xref="GeneID:12212873"
                     /translation="MIALEKFAGGVLKEKFNTELQKVLDNIADPNTDFKKTRKISLEI
                     VFKANEDRDLAEVDIKSKATIVEAKATTTKVIIGKDLETGRVEASEFKNQLAGQLSID
                     VSDSNETDEIEENSSGVIDFRNASSK"
     gene            35263..35967
                     /locus_tag="CDBI1_18663"
                     /db_xref="GeneID:12212874"
     CDS             35263..35967
                     /locus_tag="CDBI1_18663"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196878.1"
                     /db_xref="GI:384359023"
                     /db_xref="GeneID:12212874"
                     /translation="MIRNVMEYLVKLGKRETVCVDGFKYTTDALEIIKEPKANELEIT
                     TLSGLVDYIKSGIDHEEDELLLIQVLTPRKVLLKSALRKNRDRETYIECVALLPDKRF
                     DRPLDLDTFNIMLQSAFIKNNDRDTLLKIAGNIQESTVKNVGDDGVSQSVTIKTGVAS
                     VSEAIVPNRVKLIPYRTFQEVEQPESEFIFRMSTGPAAGLYEADGGAWKNQAMLNIKA
                     YLQEELKDFKNVNIIA"
     gene            36025..36207
                     /locus_tag="CDBI1_18668"
                     /db_xref="GeneID:12212875"
     CDS             36025..36207
                     /locus_tag="CDBI1_18668"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196879.1"
                     /db_xref="GI:384359024"
                     /db_xref="GeneID:12212875"
                     /translation="MKSISHMNILERAEFTDKIANAIMSANKEIERGCAFNEAVEIVK
                     QMEYRENKYNEGDIAI"
     gene            36204..36581
                     /locus_tag="CDBI1_18673"
                     /db_xref="GeneID:12212876"
     CDS             36204..36581
                     /locus_tag="CDBI1_18673"
                     /note="COG0629 Single-stranded DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand binding protein"
                     /protein_id="YP_006196880.1"
                     /db_xref="GI:384359025"
                     /db_xref="GeneID:12212876"
                     /translation="MNNVVLVGRLARDPELRYIPEYGTPVATFALAVDRGYAKKDGTR
                     EVDFIPIEVMGGSAEFCANYLTKGRMVSIQGQIRIEKYEKDGEKKTFTKVRTKIVNAL
                     DHKPKDEEKEIGFQVLDDEDIPF"
     misc_feature    36204..>36500
                     /locus_tag="CDBI1_18673"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    36213..36488
                     /locus_tag="CDBI1_18673"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    order(36213..36224,36300..36308,36342..36344,36348..36350,
                     36411..36413,36438..36440,36468..36470,36477..36479)
                     /locus_tag="CDBI1_18673"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(36228..36236,36252..36254,36285..36287,36306..36311,
                     36339..36341,36345..36347,36351..36353,36357..36359,
                     36363..36365,36402..36407,36429..36431,36435..36437,
                     36441..36446,36480..36482,36486..36488)
                     /locus_tag="CDBI1_18673"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    order(36411..36413,36417..36419,36423..36425)
                     /locus_tag="CDBI1_18673"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            36562..37143
                     /locus_tag="CDBI1_18678"
                     /db_xref="GeneID:12212877"
     CDS             36562..37143
                     /locus_tag="CDBI1_18678"
                     /note="'COG0568 DNA-directed RNA polymerase, sigma subunit
                     (sigma70/sigma32)'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196881.1"
                     /db_xref="GI:384359026"
                     /db_xref="GeneID:12212877"
                     /translation="MKIFHFKLDGDYMRSLEEKNKLFEDNINLVHFIINRYFKSFLRR
                     YPYLKEDLFQEGYIGLYKTTCCFDESKGKFSTIAFSYISGHLKRFTTGYVKKHYRNDI
                     DSFEKCIYRDNYGEEIRIEDRLAGNENVDIENVRVIRSCIKRSEIKDIQKIVCLREKG
                     YTQQEISKVLGTSQTSIYRRLKKLKTEINILGK"
     misc_feature    36610..37116
                     /locus_tag="CDBI1_18678"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     misc_feature    36625..36828
                     /locus_tag="CDBI1_18678"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    37015..>37116
                     /locus_tag="CDBI1_18678"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     misc_feature    order(37045..37053,37078..37089,37093..37098,37105..37110,
                     37114..37116)
                     /locus_tag="CDBI1_18678"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(37045..37047,37054..37056)
                     /locus_tag="CDBI1_18678"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            37332..37661
                     /locus_tag="CDBI1_18683"
                     /db_xref="GeneID:12212878"
     CDS             37332..37661
                     /locus_tag="CDBI1_18683"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196882.1"
                     /db_xref="GI:384359027"
                     /db_xref="GeneID:12212878"
                     /translation="MSCVIKCDFCGETIAEILNIKVFRIDDEGNIMSVGKDVCDKCYD
                     RLFGSNLNKKMTNYEKIKNMSKIEMAEFLANGGSGCTSCAYDFQDCLGGCLEGRKKWL
                     ESEEGQI"
     gene            37734..38219
                     /locus_tag="CDBI1_18688"
                     /db_xref="GeneID:12212879"
     CDS             37734..38219
                     /locus_tag="CDBI1_18688"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196883.1"
                     /db_xref="GI:384359028"
                     /db_xref="GeneID:12212879"
                     /translation="MDLKLISSIPNWKVEDQLAKIDEEVTEFKEAIDTGMTKDIIAEG
                     LDVCQTILTMFQILELEDYIAEGIEIHNKKLNGRGWDLKEIGDGILNLIKNSMINELI
                     NMNNKLKCVDEKEFNSKIQFLDVNKLWDLCVPLVNLSAMKGINENIDEMKMGEFLKNI
                     N"
     gene            38239..38496
                     /locus_tag="CDBI1_18693"
                     /db_xref="GeneID:12212880"
     CDS             38239..38496
                     /locus_tag="CDBI1_18693"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196884.1"
                     /db_xref="GI:384359029"
                     /db_xref="GeneID:12212880"
                     /translation="MLIEVTENNRELKVGDIVEINGGNKLYMILSLKETIGGYVIINM
                     QNGYGSFGAYKSLSQLELDLKVRGYKLYSSDDYKLQLVPKE"
     gene            38604..39047
                     /locus_tag="CDBI1_18698"
                     /db_xref="GeneID:12212881"
     CDS             38604..39047
                     /locus_tag="CDBI1_18698"
                     /note="'COG0568 DNA-directed RNA polymerase, sigma subunit
                     (sigma70/sigma32)'"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="YP_006196885.1"
                     /db_xref="GI:384359030"
                     /db_xref="GeneID:12212881"
                     /translation="MQSSKKDNLFSSAEGKLYNYKKIKAEIEKIDIDMQMIKNDYRGC
                     SGVEIKEKTSKTYDIKSVIEIETEEKEKKIALKEKEKRHKELIIEKIDNAMKILSEEE
                     KKIVQYKYFSSSRTSWEYVGRMIGFSASKCKQMRFDIIDKIKGLL"
     gene            39239..39736
                     /locus_tag="CDBI1_18703"
                     /db_xref="GeneID:12212882"
     CDS             39239..39736
                     /locus_tag="CDBI1_18703"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196886.1"
                     /db_xref="GI:384359031"
                     /db_xref="GeneID:12212882"
                     /translation="MKIKRDITEEISSAAYVPDNLKYYDSVMRETHSMYGRECSLDFI
                     KKKQEKLLKLKKKIKKNYDSNINKIDSYLKILEESIIDESDHVELVVFKLYLQLENVV
                     KVTETVNDLGFRIKTNTYARERKYSTNDITSIITDPFANVVEDLKILVQDRQRKNYHG
                     NKECF"
     gene            39740..40384
                     /locus_tag="CDBI1_18708"
                     /db_xref="GeneID:12212883"
     CDS             39740..40384
                     /locus_tag="CDBI1_18708"
                     /note="COG0582 Integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="YP_006196887.1"
                     /db_xref="GI:384359032"
                     /db_xref="GeneID:12212883"
                     /translation="MEAHSGQKVNPIKDIEDVFRLLNFLEEWNERNYLLALFGMCTGL
                     RIGDILALKVADVTDIKLDKKGKKIRVSKDWIRVIEEKRDYDREVFLSDVIKSAIENY
                     TQDKPGEEFLFKSGKRKKFNRPIQTRQAGRIIKGAAEKVGIKENVATHSLRKTFARHI
                     YDEEENKTYALELIRKILGHKTIEMTRRYIGIDKDEEVKAITKFTNKLKKRKRN"
     misc_feature    39758..40351
                     /locus_tag="CDBI1_18708"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    order(39872..39877,39983..39985,40181..40189,40304..40306)
                     /locus_tag="CDBI1_18708"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    order(39872..39874,39983..39985,40187..40189,40196..40198,
                     40277..40279,40304..40306)
                     /locus_tag="CDBI1_18708"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    order(39872..39874,40187..40189,40196..40198,40277..40279,
                     40304..40306)
                     /locus_tag="CDBI1_18708"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            40599..41057
                     /locus_tag="CDBI1_18713"
                     /db_xref="GeneID:12212884"
     CDS             40599..41057
                     /locus_tag="CDBI1_18713"
                     /note="COG3415 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196888.1"
                     /db_xref="GI:384359033"
                     /db_xref="GeneID:12212884"
                     /translation="MDVNEVEIIDSSYEKGKELTEDQCNMVTLLITGATVTETARIIG
                     VNRKTIYNWMNKEHVRKEMDRRKQELTNQGNLMILKDLDSYINNIKELASDKSDKRVM
                     LAANQYLINRIYGTPTSTVIQAEDNSVGMGMDATEIEAAIAKIRIRTSKK"
     misc_feature    40650..>40901
                     /locus_tag="CDBI1_18713"
                     /note="Terminase small subunit; Region: Terminase_2;
                     cl01513"
                     /db_xref="CDD:260975"
     misc_feature    40671..>40766
                     /locus_tag="CDBI1_18713"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     gene            41613..43352
                     /locus_tag="CDBI1_18718"
                     /db_xref="GeneID:12212885"
     CDS             41613..43352
                     /locus_tag="CDBI1_18718"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196889.1"
                     /db_xref="GI:384359034"
                     /db_xref="GeneID:12212885"
                     /translation="MDNLERNIQLIFSYLAKTFIRNGASIKDAEKEANEIIKANSNNL
                     WGVNGLAYQLGKINLEFFCMYFMQDTYLPKEDNAAAPIAKVHHELWEDIQESIIGDGS
                     QQLGRIYPRGTGKSAFGDLATTVWSHCYKHKTYTLICSDIGSTAEKFVKDIKNALLEN
                     EYIKKAFGVLLNDNDRKYICNSTQLELTNKTFIEAISSSSPMRGRKYNNNRPDLIILD
                     DYQSEENVRTEDAREKKFKRFSDDVKYAAQKPVIRNGKTIKRGTTFIALGTLQHKECF
                     YSRLKNLPTWKFKCEKGVLVDNVDELFNSGLWLKFKEILFDFKNTNHLEDAKEFYWEN
                     EKEMKFPILWPSFWDCLDMALSYYENPTSFKQEVQNDVNSIGEKWFKTVRTETREEIE
                     SHTFKKTMLLCDPASAGGSKHDYSAFLVGSESENGLLYGRLAELAKINARTDFDKYID
                     HMIYLLKVYSDITHIYIEKNTFNGADANQLEFKIKNDNVLSYRDIEIINEQQKKNKDD
                     KISTLIPVLSKGQMIFAEEDKEFIQQILDFTGQKYSLHDDAPDISSEFINRINNIKVS
                     ETVNIFDRKLLGF"
     gene            43368..43556
                     /locus_tag="CDBI1_18723"
                     /db_xref="GeneID:12212886"
     CDS             43368..43556
                     /locus_tag="CDBI1_18723"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196890.1"
                     /db_xref="GI:384359035"
                     /db_xref="GeneID:12212886"
                     /translation="MANRSKFEEVQKTLTKKGKKFNVGIGKDEKGYFAYTHRARSKSY
                     ISKQDIPIKVLKFIESTG"
     gene            43569..44846
                     /locus_tag="CDBI1_18728"
                     /db_xref="GeneID:12212887"
     CDS             43569..44846
                     /locus_tag="CDBI1_18728"
                     /codon_start=1
                     /transl_table=11
                     /product="phage portal protein"
                     /protein_id="YP_006196891.1"
                     /db_xref="GI:384359036"
                     /db_xref="GeneID:12212887"
                     /translation="MELDLDLIKDIYDDWNSNKSEYDTMYKYYKGETDAISNYKMVTK
                     RSNNKINTNFLKKFINEEVAYSLANKITYTSRSGDEKIINDLEYYTCHWSKKHDSDLL
                     RYALLFGLCYELYYVKDDEIQVKIIKPTDGCHYENENGEIVCFIREFTKGFEDDTYVD
                     VYDKEYIYHFDSNFKEVESPTVNNIFDGNVPISICKRSEELGKNTIFNDIKGLQDAYE
                     TNLSDISNEISDFRNAYLTFSGCNIKEDDLPRMKELGILQVNGDGKIEWLIKDMNDTF
                     VQNTLSSIKENMYEITSHINHNEKMQSNTSSLAVIARLISTEWICSQNNDSIADTLFN
                     RYKLLCIWLNKKYGFDYDYKDIKAKFTPKIPRDDLVVANILSQLGDKLSTETGLSQLS
                     FIDNPHAEIEKAKKEQEIVSEGEILLDESKDYN"
     misc_feature    43578..44828
                     /locus_tag="CDBI1_18728"
                     /note="Phage portal protein, SPP1 Gp6-like; Region:
                     Phage_prot_Gp6; cl19531"
                     /db_xref="CDD:267884"
     gene            44824..>45258
                     /locus_tag="CDBI1_18733"
                     /db_xref="GeneID:12212888"
     CDS             44824..>45258
                     /locus_tag="CDBI1_18733"
                     /note="COG1185 Polyribonucleotide nucleotidyltransferase
                     (polynucleotide phosphorylase)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196892.1"
                     /db_xref="GI:384359037"
                     /db_xref="GeneID:12212888"
                     /translation="MNQKIITKLTEDIYKSAENRTKPFYKYQRENRDKLLLEIAKILL
                     THDIINEYLNINNKDKKNLRSKLNKIINEYSNSYDEEVKDIETILSDSSKNKYSNLII
                     LLGVILKIKDVSNINNKVINKIVNNKVDGKHWSDRLWKNKKGI"
CONTIG      join(FN668942.1:1..45258)
//
DBGET integrated database retrieval system