GenomeNet

Database: RefSeq
Entry: NC_017177
LinkDB: NC_017177
Original site: NC_017177 
LOCUS       NC_017177             300869 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Clostridium difficile BI1, complete genome.
ACCESSION   NC_017177
VERSION     NC_017177.1  GI:383843668
DBLINK      Project: 158363
            BioProject: PRJNA158363
KEYWORDS    RefSeq; complete genome.
SOURCE      Peptoclostridium difficile BI1 (Clostridium difficile BI1)
  ORGANISM  Peptoclostridium difficile BI1
            Bacteria; Firmicutes; Clostridia; Clostridiales;
            Peptostreptococcaceae; Peptoclostridium.
REFERENCE   1
  AUTHORS   He,M., Sebaihia,M., Lawley,T.D., Stabler,R.A., Dawson,L.F.,
            Martin,M.J., Holt,K.E., Seth-Smith,H.M., Quail,M.A., Rance,R.,
            Brooks,K., Churcher,C., Harris,D., Bentley,S.D., Burrows,C.,
            Clark,L., Corton,C., Murray,V., Rose,G., Thurston,S., van
            Tonder,A., Walker,D., Wren,B.W., Dougan,G. and Parkhill,J.
  TITLE     Evolutionary dynamics of Clostridium difficile over short and long
            time scales
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 107 (16), 7527-7532 (2010)
   PUBMED   20368420
REFERENCE   2  (bases 1 to 300869)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300869)
  AUTHORS   He,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-FEB-2010) He M., Wellcome Trust Sanger Institute,
            Sulston Building, Wellcome Trust Genome Campus, Hinxton,
            Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FN668943.
            Draft contiguous sequence
            454 data coverage: 15x
            capillary data coverage: 5.1x
            coverage with combined data (bases meeting finished standard) 86.7%
            coverage with combined data (bases below finished standard) 0.8%
            coverage with 454-only assembly 12.5%
            reference genomes: AM180355 and FN538970.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..300869
                     /organism="Peptoclostridium difficile BI1"
                     /mol_type="genomic DNA"
                     /strain="BI1"
                     /isolation_source="Homo sapiens"
                     /db_xref="taxon:699034"
                     /country="USA"
                     /collection_date="1988"
                     /note="non-chromosomal sequence, putative phage or
                     plasmid"
     gene            <1..229
                     /locus_tag="CDBI1_18738"
                     /db_xref="GeneID:12213182"
     CDS             <1..229
                     /locus_tag="CDBI1_18738"
                     /codon_start=2
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196893.1"
                     /db_xref="GI:384359038"
                     /db_xref="GeneID:12213182"
                     /translation="VYLKEMLLTENDIENIDISILLNMKIDTFYECKFIDNNFCWISR
                     NANGKMRYFTKRYILYGLDIYDLLCIFLIVD"
     gene            205..1035
                     /locus_tag="CDBI1_18743"
                     /db_xref="GeneID:12213172"
     CDS             205..1035
                     /locus_tag="CDBI1_18743"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196894.1"
                     /db_xref="GI:384359039"
                     /db_xref="GeneID:12213172"
                     /translation="MYFFNCRLTEISSILIEKGFGEKIKNNFGIQKYSENIKIIEELL
                     IDDKYLKNMLKEKIDIYIALNNYGKKVNTESIIFNNKELFFVSLRHLKKEYSLNYSIS
                     TISKTINLYNLFGLVKKIESDRIRDELDIKSNVCLYFIPSIKISIKELKSNDLYTKKE
                     LIKDCNLNRTGINKILKDEYNLEQDLYFYENKKKNTHIVEIERLFYFYLKEYNIVAKE
                     WILGSEKVSTSISTFNKKWKQLSEDNLFVGKSIKPNKNLKKKYSLKTNQDVFVLTRNS
                     "
     gene            1878..2285
                     /locus_tag="CDBI1_18748"
                     /db_xref="GeneID:12213173"
     CDS             1878..2285
                     /locus_tag="CDBI1_18748"
                     /EC_number="3.1.1.29"
                     /note="COG1990 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="YP_006196895.1"
                     /db_xref="GI:384359040"
                     /db_xref="GeneID:12213173"
                     /translation="MEENIKQVIIIRKDLKMPKGKMVAQGSHASLGAILETMRRKELN
                     KNSYELILDIEKHSDLDVWINGIFKKVCLYVNSESELTNIYNKAMEMKLPAYMTVDLG
                     LTVFNGVKQKTAVAIGPAKGDKIDEITGNLKLL"
     misc_feature    1890..2282
                     /locus_tag="CDBI1_18748"
                     /note="Peptidyl-tRNA hydrolase, type 2 (PTH2)_like .
                     Peptidyl-tRNA hydrolase activity releases tRNA from the
                     premature translation termination product peptidyl-tRNA.
                     Two structurally different enzymes have been reported to
                     encode such activity, Pth present in...; Region:
                     PTH2_family; cd02407"
                     /db_xref="CDD:239091"
     misc_feature    order(1932..1934,1953..1961,1968..1970,1977..1982,
                     1989..1991,2067..2069,2085..2087,2280..2282)
                     /locus_tag="CDBI1_18748"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239091"
     misc_feature    order(1938..1940,1950..1952,1959..1961,2085..2087,
                     2214..2216)
                     /locus_tag="CDBI1_18748"
                     /note="putative active site [active]"
                     /db_xref="CDD:239091"
     gene            2396..3115
                     /locus_tag="CDBI1_18753"
                     /db_xref="GeneID:12213174"
     CDS             2396..3115
                     /locus_tag="CDBI1_18753"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196896.1"
                     /db_xref="GI:384359041"
                     /db_xref="GeneID:12213174"
                     /translation="MLSFIKTKGSPVIIPIASTDYISIILFEEETLANKYLLDNKIDK
                     IMFFSEIKLNALLLLLNNLFYKGLSGIVFNTKIEKDYYSYYYSILDIFNKTENFNNDL
                     IKDENINLIRKLNNILFRNGQIYYIYHPTLCAQDILNCVIRYNIFKDSNDLKFIRVFL
                     EEKEIENYCKKNKIIDNSSKDFPITTIPKDHLCNSLVTLIGREKVDYIKIFSEGKIYK
                     ISLNDFITLILNIGFKQIIYN"
     gene            complement(3463..4203)
                     /locus_tag="CDBI1_18758"
                     /db_xref="GeneID:12213175"
     CDS             complement(3463..4203)
                     /locus_tag="CDBI1_18758"
                     /note="COG0745 Response regulators consisting of a
                     CheY-like receiver domain and a winged-helix DNA-binding
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196897.1"
                     /db_xref="GI:384359042"
                     /db_xref="GeneID:12213175"
                     /translation="MLDLFKNPIDKKKFDSTNEIWNEMHFNSPVKIGYTSKLVKEKKF
                     SDKLDWANFYFESGEKRKELLKLNPYDKNINLNYGRTKKEIAKIGCYLYKHLLETGNP
                     LKLTKEECMLTAYFRIIGETWNGIIWRESNTKDVLSKKITNLGYEVSLIDTPSDFDVL
                     FAVDYEIYFKGSIVCGIQIKPKSYSTNNSYLNKTIKLNEEKNQKYKKRFNRDVYYVYA
                     ETSGIILNENVIPKIIKDIKSNQINFFN"
     gene            complement(4347..5348)
                     /locus_tag="CDBI1_18763"
                     /db_xref="GeneID:12213176"
     CDS             complement(4347..5348)
                     /locus_tag="CDBI1_18763"
                     /note="COG0791 Cell wall-associated hydrolases
                     (invasion-associated proteins)"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall-associated hydrolase"
                     /protein_id="YP_006196898.1"
                     /db_xref="GI:384359043"
                     /db_xref="GeneID:12213176"
                     /translation="MKIKKKIISIMSLIIIGANLLPGVAYATPKEDLEEKIQILNSNI
                     TDNLIKIKDLEEKISITEKEILDKQHKIIDVKKEYNTKKIQLEMCNDSKLSKSIKGND
                     FKVLELILKSDSVSELLQNIELSKAIIKQNNKTLKLLNVKEKQLNELQDSLKNESENL
                     NKDKKNLKKEQESLNNSKKEAELALNNLIQEEKINQVNPIEFKDLDFKLPDPNATPSE
                     KAELLINNAKKFLGLSYVWGGTTPSGFDCSGLTQYVYRSIGINIPRVARDQQLDGKQI
                     KIDELLPGDLIFFGYPAHHVGFYIGNGEYLHAPRTGDVIKISQINWNKVSSATRFIE"
     misc_feature    complement(<4770..5261)
                     /locus_tag="CDBI1_18763"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3883"
                     /db_xref="CDD:226400"
     misc_feature    complement(4356..>4712)
                     /locus_tag="CDBI1_18763"
                     /note="Cell wall-associated hydrolases
                     (invasion-associated proteins) [Cell envelope biogenesis,
                     outer membrane]; Region: Spr; COG0791"
                     /db_xref="CDD:223862"
     misc_feature    complement(4386..4655)
                     /locus_tag="CDBI1_18763"
                     /note="NlpC/P60 family; Region: NLPC_P60; pfam00877"
                     /db_xref="CDD:189752"
     gene            5570..5869
                     /locus_tag="CDBI1_18768"
                     /db_xref="GeneID:12213177"
     CDS             5570..5869
                     /locus_tag="CDBI1_18768"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196899.1"
                     /db_xref="GI:384359044"
                     /db_xref="GeneID:12213177"
                     /translation="MELLELIKYNYSKKNSDISIILKEILNKESDIVIKEKLSRIFYM
                     AEGYTEYKIKDLAINLNVSKTAIKYMLKSLLEENKIELLKINNTTFIIPIIENIF"
     gene            complement(5903..6331)
                     /locus_tag="CDBI1_18773"
                     /db_xref="GeneID:12213178"
     CDS             complement(5903..6331)
                     /locus_tag="CDBI1_18773"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196900.1"
                     /db_xref="GI:384359045"
                     /db_xref="GeneID:12213178"
                     /translation="MLKELNEILKNSILKKFLIEILKNYKIMVITKGENGYKYTLYSY
                     TELEGIYIEIREGISFEYFEYLSKNEPTECLNYLIYSNNMYYNNANFNTLYNLIKKFN
                     LKDISDFYKVFNSYKEDESEALKDYMLYNSSINTYLLNKI"
     gene            6546..7088
                     /locus_tag="CDBI1_18778"
                     /db_xref="GeneID:12213179"
     CDS             6546..7088
                     /locus_tag="CDBI1_18778"
                     /note="COG4895 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196901.1"
                     /db_xref="GI:384359046"
                     /db_xref="GeneID:12213179"
                     /translation="MYVDTSKLDNIFKGLLVEIVAKEDKESQKLTRGYVDTIISKKDK
                     KGGIIVELTNGKKGAVKDIVNKNQLKKENFKFYNLFINESKIYSIWDKLNKKFLVVRH
                     LNKISGSHENIAYLFDDIEMAKKELNKISDKNYVLKPISRKKFITDNFKESNVKAFSI
                     NKKRKITKEKLLELEIYLKR"
     misc_feature    6555..6737
                     /locus_tag="CDBI1_18778"
                     /note="Uncharacterized conserved protein (DUF2196);
                     Region: DUF2196; cl02044"
                     /db_xref="CDD:261160"
     gene            7261..8055
                     /locus_tag="CDBI1_18783"
                     /db_xref="GeneID:12213180"
     CDS             7261..8055
                     /locus_tag="CDBI1_18783"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196902.1"
                     /db_xref="GI:384359047"
                     /db_xref="GeneID:12213180"
                     /translation="MDKIVNIEGPLLLSIGIGIDSIILLIVSMFSTNLALLIFFIVVL
                     SRFIQFIFLAWNCVKLKKAINKEIIEVTEEYKTVLIGITLDKLDICFKWKYLVPILGL
                     FCINTDYKKGINNLNNYREKILFEFIDFLCIKKFIINNLDGSILNYKTRTYVEDIEVN
                     CKNKYYILIIETFLNLEELVKLNNKIISGNYSLNEKEKVIKVKNEAILTFVKLLHDLN
                     YRAQNEKSFSIEEENNFHKLKKCEILLKGIDKDVIEEKAVFMKYFN"
     gene            8082..9227
                     /locus_tag="CDBI1_18788"
                     /db_xref="GeneID:12213181"
     CDS             8082..9227
                     /locus_tag="CDBI1_18788"
                     /note="COG3853 Uncharacterized protein involved in
                     tellurite resistance"
                     /codon_start=1
                     /transl_table=11
                     /product="toxic anion resistance family protein"
                     /protein_id="YP_006196903.1"
                     /db_xref="GI:384359048"
                     /db_xref="GeneID:12213181"
                     /translation="MESLALNEVSVNEYAVKLTEEYKLNLRNDKDVKCIMTKIDISDI
                     ENILAFGDKSANSISRLSNEILSTTQKIQKEKDIGLILNKLNKTFKGFNLEDLQKEEK
                     GFFKKVFNKAQNSFDNIVDRCTTVGNEVDKIYLDLKKHEVDIKEQVKNLANLYESNIL
                     YYRDLEKYIVAGEMALEKLDNELIPSLEEKALNSGENISLQKINILKNNRDMLEQRVY
                     DLKIAENVSLQNIPMLQQMQKGNFDLMRAIKSSFIITLPIFKQCLINAIVLKKQEKMY
                     KDIESVRNMTNDFLMQNAEHLSKQAPGISKLAGNSQISLDSLETSYKKIMEGIDECRR
                     IEIENKSNFKGNASRLEELKMGILTQGASNSKIASNKGDFGVEKFNI"
     misc_feature    8172..9140
                     /locus_tag="CDBI1_18788"
                     /note="Toxic anion resistance protein (TelA); Region:
                     TelA; pfam05816"
                     /db_xref="CDD:253402"
     gene            9368..9868
                     /locus_tag="CDBI1_18793"
                     /db_xref="GeneID:12212902"
     CDS             9368..9868
                     /locus_tag="CDBI1_18793"
                     /note="COG0602 Organic radical activating enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside-triphosphate reductase
                     activating protein"
                     /protein_id="YP_006196904.1"
                     /db_xref="GI:384359049"
                     /db_xref="GeneID:12212902"
                     /translation="MIVLAKNKEECIFESIVDGTGLRLVVFLAGCQHRCKGCHNPETW
                     DINNGIMYTNEEVINFIVDKYKKCNGYYKGITFSGGDPLLQKEELEYIIKDIREKLKE
                     YNFDIWLYTGYNYEEAKSFEVIRLIDVLVDGKFDLDKKSINYKFRGSYNQRIIYLKNG
                     KVEKIL"
     misc_feature    9407..9841
                     /locus_tag="CDBI1_18793"
                     /note="anaerobic ribonucleoside-triphosphate reductase
                     activating protein; Region: NrdG; TIGR02491"
                     /db_xref="CDD:233893"
     misc_feature    9440..>9808
                     /locus_tag="CDBI1_18793"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(9458..9460,9464..9466,9470..9472,9476..9484,
                     9599..9601,9605..9610,9695..9703,9755..9757)
                     /locus_tag="CDBI1_18793"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            9946..10503
                     /locus_tag="CDBI1_18798"
                     /db_xref="GeneID:12212903"
     CDS             9946..10503
                     /locus_tag="CDBI1_18798"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196905.1"
                     /db_xref="GI:384359050"
                     /db_xref="GeneID:12212903"
                     /translation="MNKINDEGSISLEKVMKDFGCLIAQVIESKPKTNDDKNKEDSCK
                     KNKLNVFWSEKIKKGAIGVDEIAELSSMFNIPLNDIYRTIEMLGIAVKQDKKQCVEDP
                     ALEFYLSNRIALMDMYKSNKENLKLAKINLIVETTEIYKTMFSESKDITVVPKIENKK
                     LMLYIYNKNIELFLKENDINKLQLI"
     gene            10770..12308
                     /locus_tag="CDBI1_18803"
                     /db_xref="GeneID:12212904"
     CDS             10770..12308
                     /locus_tag="CDBI1_18803"
                     /codon_start=1
                     /transl_table=11
                     /product="type III restriction protein res subunit"
                     /protein_id="YP_006196906.1"
                     /db_xref="GI:384359051"
                     /db_xref="GeneID:12212904"
                     /translation="MFVPSGYVEYTKNIINDFISENGYVPSFSDLNNSDVKQLFQIYG
                     SWNKVLENLGFIDKTNNAEDILKEVEELRDRLGKIPNREELKENNINIKPLIKKYGKW
                     STVKNKLKTDIVIENPFLEKNKDKNAILLEKVSNIKEIEGIIEKILDLTNNKKCIPTY
                     QQLLENGIKINKLMRVMGSWEKIKKELNLDSIVSKFDEEKIEKIKKEILDIKNEDKYK
                     RVPSELLMKKRGIDVNLLKKTYGSLKEAYKKLKIEEYDIKVFNNEIIKLTKNKIKVPS
                     MARLVFYKIPVKILFSYYGSYENMIDVLNLKAIVEKAKVIKDEKDKKFKDKTMKEIME
                     VYQILDKTPIIRELKEYGIKTATFFRKFGSWREIKAILKLPKRSKYTNTELKESKKII
                     LEMTQSLGKIPTIQNLKDNGVHINSLINIYGSYSKLLLELGLITEPLKNRYTDIELEE
                     SKRAILEMTQSLGKIPTIQNIKDSGVHIKYLVKKYGSYSKLLLELGLITEPLKKDKRE
                     ISMI"
     misc_feature    12033..>12188
                     /locus_tag="CDBI1_18803"
                     /note="Plasmid encoded RepA protein; Region: RepA_C;
                     pfam04796"
                     /db_xref="CDD:252808"
     gene            12363..12698
                     /locus_tag="CDBI1_18808"
                     /db_xref="GeneID:12212905"
     CDS             12363..12698
                     /locus_tag="CDBI1_18808"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196907.1"
                     /db_xref="GI:384359052"
                     /db_xref="GeneID:12212905"
                     /translation="MKNNLLEALKEKKILKKSIGEGLKVEDIFSMPSYKRPLRQVKDD
                     LVIYYISNNNVKKKYVVFGGEKYRVIKQIKDNNAIVYYIPLFVLKNYFNDLDEFDYIY
                     DSLDEIGLF"
     gene            12792..13013
                     /locus_tag="CDBI1_18813"
                     /db_xref="GeneID:12212906"
     CDS             12792..13013
                     /locus_tag="CDBI1_18813"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196908.1"
                     /db_xref="GI:384359053"
                     /db_xref="GeneID:12212906"
                     /translation="MKDFELEIKISIPLKPVAIFMVTASIVLLCFSALRNFDNIKSIP
                     TSALGITTGFIIFQLGLSFFENRKKAKSE"
     gene            13361..13687
                     /locus_tag="CDBI1_18818"
                     /db_xref="GeneID:12212907"
     CDS             13361..13687
                     /locus_tag="CDBI1_18818"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196909.1"
                     /db_xref="GI:384359054"
                     /db_xref="GeneID:12212907"
                     /translation="MDTYNIEKIDKLYNMVTTLKNKNSCESNVNMGEFYKSFNKLKIY
                     IKKELEKESLKDLSGNNYKKLLERIFSFIKDEQIEISYKSIFLKIYFMSECISQEICF
                     LCETDN"
     misc_feature    <13529..>13627
                     /locus_tag="CDBI1_18818"
                     /note="Topoisomerase II-associated protein PAT1; Region:
                     PAT1; pfam09770"
                     /db_xref="CDD:255543"
     gene            14130..15137
                     /locus_tag="CDBI1_18823"
                     /db_xref="GeneID:12212908"
     CDS             14130..15137
                     /locus_tag="CDBI1_18823"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196910.1"
                     /db_xref="GI:384359055"
                     /db_xref="GeneID:12212908"
                     /translation="MSQYQIDLKTSMKNGVCLRCIRDQDYRVCIEALKENGRALEYVR
                     WDSVALLEEEIKQMCLTAVRRNGDSIEYINWNKLNLKTEDIVEICIEAVRSNCWAFKN
                     IHWVQIVDNLSNEQIYLICLEAITSFGEVLKYMNWDLLKLTDKQIYNLCLGAVEQESW
                     NIAYIDDNLSAHNKNKLYLIAIKQNLDVIIFIDKYTEEILLGLSKMYAIKDKDILRRT
                     IEERAKKAIKNDPSLIIYIKNQTYEICLEAIKMDGFCIELIENRDMFKYNILKEAFRN
                     RKVIAIFIDGRWLFTIGCQNNITKEEFLYRIYNENGGFDLEKGINVHRKIYLDFLEQF
                     L"
     gene            15157..15699
                     /locus_tag="CDBI1_18828"
                     /db_xref="GeneID:12212909"
     CDS             15157..15699
                     /locus_tag="CDBI1_18828"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196911.1"
                     /db_xref="GI:384359056"
                     /db_xref="GeneID:12212909"
                     /translation="MSEKLNYKEELIFVITNGNEVYINKAYFIFDPPDEDCYIISYKK
                     RKDCAGFPFFQNRYKELRKDTYNKTCFRKIDLNMIMEKCNKDISIIGETHKNKILELE
                     KDVLLTNNKIDLIKIEMNNIKNKGLTPNRAKSIREKGKGLRRLYKRIENKNNEIERLK
                     IKLSSLRKDTFFKLKNVLKQ"
     gene            complement(15739..16086)
                     /locus_tag="CDBI1_18833"
                     /db_xref="GeneID:12212910"
     CDS             complement(15739..16086)
                     /locus_tag="CDBI1_18833"
                     /note="'COG0202 DNA-directed RNA polymerase, alpha
                     subunit/40 kD subunit'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196912.1"
                     /db_xref="GI:384359057"
                     /db_xref="GeneID:12212910"
                     /translation="MNQLKLSKKIVNHLIKANIDSIESLKTMTSNDLLKINGIGPKSL
                     EEIKQALSLLTKPDNITEGIFTKKRYLKYEGRKNYQQNKSIVNKLNGRVVSLGTYVNG
                     IKIDKRYCIIKNN"
     misc_feature    complement(15931..16083)
                     /locus_tag="CDBI1_18833"
                     /note="Bacterial RNA polymerase, alpha chain C terminal
                     domain; Region: RNA_pol_A_CTD; pfam03118"
                     /db_xref="CDD:251738"
     gene            16247..24235
                     /locus_tag="CDBI1_18838"
                     /db_xref="GeneID:12212911"
     CDS             16247..24235
                     /locus_tag="CDBI1_18838"
                     /codon_start=1
                     /transl_table=11
                     /product="neutral protease A, bacillolysin"
                     /protein_id="YP_006196913.1"
                     /db_xref="GI:384359058"
                     /db_xref="GeneID:12212911"
                     /translation="MNNKKIISIFLSASILSSNLPYNVLADMKNSNNQIIYNENNSIN
                     KETQNEGKEKSSESFSLDMGKYVDTNGILTFPEAKGIVDNPTYLRFDFNRNVYENVTI
                     TYSLNSVENTLIGKNIKIPIRTQNELNEVLKTLRIDTKNNKKLGFDIILGGLPIYKSV
                     EGVPSRLYKAERAVDGNNDSFYGAINKNNSTFTILFEDKTYIENVLIKANKKFIIKGL
                     KNGSWTKIGEGTPEVEKNESKKTVSVTAGEYEGIRIEQAHSGVDSCTISELEFNEESN
                     REKINYNRSEYSLNLGEKSINNDGSISFTEASAKGDNAKLLINFKNSSNKNKISYTQN
                     GKYNEKEGDSEITVSNESELNEIIRSLKIYHDNKVENNVKITLLPDNFSFMEDVPKGV
                     LVQGNSLDDKYTAENVFSGSSGYFISGSDNQLVLKNTKELYINGAYFLNGNSIIIVKG
                     LKNGTWTDIGKHSSNEAEMVNLAPGYYDEIKFVSSSTLDMRNLYLRYSNINEDVKLEI
                     FKDESPELKVGANVDILQNNKFDVMAGVTASDFIDGDLTNKINVEITNPNGEKVSELD
                     TSILGKWTIKYTVKDSGDNTTVYLRTLKVVKDFNVSIDLGKELVTSKYVKFPDAKINS
                     VDDQQKIDGLKMYFPEFFDKDSFKIHYTLNGVEKESTDQRIEINKEFSLNEAEELVKS
                     IKIEHKNNTEFKFTVKLGKNEVDDIVYNYENNHYYKFISAPGITWKDAKVDAEKQELL
                     GVRGYLATITSAYEQEVIHNLTANCIWLGGTDEKEEGKWEWVTKEPFIYTNWYPGRPD
                     NYLGQQHYIISYNDSQRLWDDDFNIASGGKIDGYIVEFGLDEKLPYPNTLDKFKYEDT
                     ATIKPIECKQDIVLNAFFEKNKNKVMLDWNNIKDIDHYKILLKEKEEDFKIIKEQKDT
                     YFEEDKKDINKPTAPTYELFNSGIKQGINFNSEDISSVYEYYIEGISEYGDITHISNK
                     EKVEIKSGFKGFSYEVSNSSVPSISLGDVVNSTDGFISAKELASKLYVHIVSVDKAGN
                     KSEVVTLPIAGIFEDLPPVLNVGGNTSIEQGKVFDIMKGINAIDDYDGDLTKDINVVI
                     KNPDNKIVDEFDTNILGKWSIEYSVKDSKNQESKIIKEIIVKENLDYLNIKLGEPDKK
                     RFIATFPNASITNNSDELINGMKLYISEGFNSSMTIKYLDKGIEKHSKERQIILNENY
                     TTEEAEELIKSIKIEHDNSTSFIFNVRLQNNSVDDIIYNPQNGNYYQFIEDKRITWKN
                     AKERAEKMEYRGLKGHLATIKSKYELDLFNCLTTKTVWLGATDEEEEGKWKWVTGEPV
                     KFTNWCVGEPNNLGGTEDYMSSIKNSGGLWNDTVNSPDPVWTDIEGFVVEFENMDNGS
                     SDGVYRYEDSVKIDNMVSKQDIVLNLENKDDNITLNWNDYKNADYYKVLRKEKDSFEI
                     VKDNLRENILSGYLAEDKVPPKMEYSLILNKERTAKMEFFTEDIGSDYEYKVESYDED
                     DYQTAYSNIVKTTAISGFKGYYYEVDENPNTEINGEVNNTDGKFEFKNVTDNTYLHIY
                     AIDNKGNKSETKHIKLSDDTYNNKPIITVPGRNRVINLGENFDKLEGVSAYDFEDGNL
                     TDKINIEGEIDNTKKGVYEVKYTVVDSKGLESEETVKVHVIGDMKIDITELNNNLEVN
                     WTPVKNAVKYVLYRTNENGFSFEEKGTFNDTQFIDNTATDTSSPAITYLGEINEDSIK
                     TRKVVSLSKEILRKLNKDIDSSDNIKLKVISKDLGTTYRYFVEALDKDNNVVNSSEIR
                     NGKVTSGLAGFSYAIDEKENTEVKNFVNIKNAEDIDIKNNKSKFLHIKAIDKNGNVSK
                     TIHHLITGKYDTNYIPVIKGLTSKRVKEGESFNPLAGVTAYDVEDGDITNKIQIIGSV
                     DTNKNGKYQLIYKVEDSQGNIREVKRNILVHGDMEIKVTPNKEDNNVDISWDKNVLGD
                     DVFYEVRKWNSMEGYYTTIGYTEDLSFTDTDTKDIFGPKINGITEIKEEENNIDEENY
                     EEEENIDEENFLEYNDLENKNNVDENIDKNMDVLEGNNLNSNKFLRKDINDNTYLKLN
                     IDAVDRGVSETYQVRTRLKEDNTVIRDMTDEEGRDWDVGTDFGGEVEYFKWKLSNKRE
                     DNLDTGTIKTSVSKDTIEFNTEDYKYIHFIPYDTYGNAGQLVHYELGEINNEENELIP
                     PTIEGVKNRVIMIDSKFNVLEGIKAYDYAGEDLTGYIKINGFVDANKTGEYTLNYSVM
                     DFKGQLTEETCNIVVADYNENIPNEKPNKIDNSPIVVNYADEVYIKVGNKYDVMSGIK
                     VTDEEDGDLTSKVTYTTNLDTNKVGDYIVNYSIRDSGDNRVRWNRVVHVIPNNIDCPE
                     TGEPSPDWEGNGAFPQIYAYPTYIAVGSEFNPYDSIIVYDEEDGYITNKLKFSGYVNT
                     LKPGIYYLTYKVTDSDGNTSYCGRAVYVYEGNWGNPDGEKPNPDPDWGENDNEDEDND
                     HIPPKPNQPDQDEEGLPPSNLPNIDKDQDGDGQKDIYIDKNGNVVKPDGSIETPGGII
                     VRPSEDGKVPSIDGEGNIVVPPNSIIIKSDGSIEIPKNGAIIRPNGNIEIQQQYKQDD
                     DENNKYIYRDDPDNEERNGTNNNSEGYNNNESNDENNPSTGDKGIFIFLSLIIVSLVG
                     LFFNRKKK"
     misc_feature    18389..18754
                     /locus_tag="CDBI1_18838"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cl02432"
                     /db_xref="CDD:261284"
     misc_feature    order(18653..18655,18662..18664,18692..18694,18698..18709,
                     18725..18733)
                     /locus_tag="CDBI1_18838"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     misc_feature    19988..20359
                     /locus_tag="CDBI1_18838"
                     /note="A bacterial subgroup of the C-type lectin-like
                     (CTLD) domain; a subgroup of bacterial protein domains
                     homologous to the carbohydrate-recognition domains (CRDs)
                     of the C-type lectins; Region: CLECT_VCBS; cd03603"
                     /db_xref="CDD:153073"
     misc_feature    order(20249..20251,20261..20263,20291..20293,20297..20308,
                     20318..20326)
                     /locus_tag="CDBI1_18838"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153073"
     gene            complement(24283..24552)
                     /locus_tag="CDBI1_18843"
                     /db_xref="GeneID:12212912"
     CDS             complement(24283..24552)
                     /locus_tag="CDBI1_18843"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196914.1"
                     /db_xref="GI:384359059"
                     /db_xref="GeneID:12212912"
                     /translation="MEEEDRIKKRKDIKDSIIGFVVKVFIMGIGFMYMNDHMEAGILN
                     FSLPSGKELFSINAFLILKFLFNLTLIIEGFTIIVSMMNYYIENL"
     gene            complement(24886..25887)
                     /locus_tag="CDBI1_18848"
                     /db_xref="GeneID:12212913"
     CDS             complement(24886..25887)
                     /locus_tag="CDBI1_18848"
                     /note="COG1316 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope-like transcriptional attenuator"
                     /protein_id="YP_006196915.1"
                     /db_xref="GI:384359060"
                     /db_xref="GeneID:12212913"
                     /translation="MKSKTKKVIKSIFILLLIVIMFIVSFFTSYTLSNNKIKTKEIKE
                     DAISTESKENKFKKINGITNILLLGTDERSSNVTTRTDTMIILTIDSVNNKIKLTSLF
                     RDALVNIPNHNKGKLNHSYAYGGVDLLEKTIEENYNLTIDKYALVNFNDFVKIIDLLG
                     GVEVEIKEAELKDFNKHLKDIPNSSKEITSPGIKTLTGAQALSYTRIRYNSGGEQGRT
                     ERQRKVISSMANKMKHISIFKYPAILNSVIKYIDTNLSFKDILNILYTANKINFNEIE
                     TLSIPFEELSKCGKYKNYGWVFRTDLELTSEILNNYIFKDIPINLSNINKRNLIFIE"
     misc_feature    complement(24898..25887)
                     /locus_tag="CDBI1_18848"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LytR; COG1316"
                     /db_xref="CDD:224235"
     gene            26031..26675
                     /locus_tag="CDBI1_18853"
                     /db_xref="GeneID:12212914"
     CDS             26031..26675
                     /locus_tag="CDBI1_18853"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196916.1"
                     /db_xref="GI:384359061"
                     /db_xref="GeneID:12212914"
                     /translation="MRKLKKEKYIKNQEEEMLEEKLIPFTQIDANLLLCCGLLIISII
                     TSFIVAKWELFIYSVICIFLTIYIGRRLKFRKKNDEVTNVVIWNLSQSINDFIEYKIK
                     NYDLLGDYKNLLLKTSIVLAICLLFVVNSAICLIPTLFFILLFFISFANKNFCEIRKY
                     IKWLIVTGFLGFVLKMIFAIIVTNNLSIDLFNIININIFTIIQLIIDNIEIKEP"
     gene            complement(26682..27317)
                     /locus_tag="CDBI1_18858"
                     /db_xref="GeneID:12212915"
     CDS             complement(26682..27317)
                     /locus_tag="CDBI1_18858"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196917.1"
                     /db_xref="GI:384359062"
                     /db_xref="GeneID:12212915"
                     /translation="MNFNKDNLEKKILRHQIIRIDGSNVFFEVLSNAFPIGKVQINFR
                     KYDKNANKGEKFTQQVDIFINIENALVLCQDILSGKIEKLAVLSEKEAKQKDSKYPQP
                     IWKNLGGTSVKKLKEQNKERKDGYALSRMLKLSPGKIGFLFTAEEGKGEETDTGLITP
                     RYNQNPDSRILVPLNSEQLKTLALMIKIHIESYLTIKYNPYFSNSYWENKQ"
     gene            27463..28332
                     /locus_tag="CDBI1_18863"
                     /db_xref="GeneID:12212916"
     CDS             27463..28332
                     /locus_tag="CDBI1_18863"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196918.1"
                     /db_xref="GI:384359063"
                     /db_xref="GeneID:12212916"
                     /translation="MIYIFDYLEGIKIGLFNKVSYTKSSGLEVINGSNKNYKIMDRLP
                     LESLYYNYPKSFLVLSIDQNKVNFLKVRDGKYIGKTNKIGEIEIQNFKKVYFQDGREL
                     QIDYLEDIPKFFKSFEEFRSIIKEIELKKNKLIIEIRDSSDELMFINKKPLIDKLEKE
                     LKLSEKEYQEKWFIKKETDIIKFGMYLTCLLKKMEDFQLIQEVGNILEKKGNVPLGKL
                     IKYREIDTENFEKDIISLKDSFSDFISISDNINKRYLDWLNLSSKDVSDHEINAIKEL
                     ILSIQKILESEAF"
     gene            28449..28919
                     /locus_tag="CDBI1_18868"
                     /db_xref="GeneID:12212917"
     CDS             28449..28919
                     /locus_tag="CDBI1_18868"
                     /note="COG3600 Uncharacterized phage-associated protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196919.1"
                     /db_xref="GI:384359064"
                     /db_xref="GeneID:12212917"
                     /translation="MEFINLTGFCPNYDAMDVAEYILWYCENKLKNPINNSKLQRILY
                     FIQKKYICKFNKLLFDNYMVAWSYGIVFPEVYYSYNNYGVEDITGILPCRYFEISTKD
                     DSKFINEMVASLVYRDVEDLIKETQEDEVWKAYCGHKEKEIPLWDLLYWISMEK"
     misc_feature    28563..28877
                     /locus_tag="CDBI1_18868"
                     /note="Protein of unknown function (DUF4065); Region:
                     DUF4065; pfam13274"
                     /db_xref="CDD:257617"
     gene            29149..29658
                     /locus_tag="CDBI1_18873"
                     /db_xref="GeneID:12212918"
     CDS             29149..29658
                     /locus_tag="CDBI1_18873"
                     /note="COG3600 Uncharacterized phage-associated protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage-associated protein"
                     /protein_id="YP_006196920.1"
                     /db_xref="GI:384359065"
                     /db_xref="GeneID:12212918"
                     /translation="MGYVEFNDYDAVDIANYILWYCENKLKNPSTNLRLQKLLYLIQE
                     RYLYLYKESIFNDKFEWFEAWDYGPTMPEIWFTFYEFDSNPITGIIPKNNDLVKDKEK
                     DTIEEVIELTKDISTEDIIEYLRLEEPEHFIGRQTISSFDIEYYIEKRNGILVSKELL
                     DKKLNLSKE"
     misc_feature    29173..>29427
                     /locus_tag="CDBI1_18873"
                     /note="Protein of unknown function (DUF4065); Region:
                     DUF4065; cl01445"
                     /db_xref="CDD:260941"
     gene            29669..29935
                     /locus_tag="CDBI1_18878"
                     /db_xref="GeneID:12212919"
     CDS             29669..29935
                     /locus_tag="CDBI1_18878"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196921.1"
                     /db_xref="GI:384359066"
                     /db_xref="GeneID:12212919"
                     /translation="MVNKSIFMDSRYSAKDVAIYVLWYCENKLNKAIDNLRLNKLLYL
                     IQAKYLYLYNESIFLNLDEGSKLKIMSQLCQSFGLKLVKYLNFV"
     misc_feature    29780..>29842
                     /locus_tag="CDBI1_18878"
                     /note="Protein of unknown function (DUF4065); Region:
                     DUF4065; cl01445"
                     /db_xref="CDD:260941"
     gene            29887..30189
                     /locus_tag="CDBI1_18883"
                     /db_xref="GeneID:12212920"
     CDS             29887..30189
                     /locus_tag="CDBI1_18883"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196922.1"
                     /db_xref="GI:384359067"
                     /db_xref="GeneID:12212920"
                     /translation="MPKLWFEISKIFEFRIIKGFCPIDFNLFTKEEKEVIEEVLNITK
                     NIDTWDLVKYLLYTYPVMWNYKIGDSSIPTQDIKFWVKENNGILIPKFLLEEKEVN"
     gene            30190..30549
                     /locus_tag="CDBI1_18888"
                     /db_xref="GeneID:12212921"
     CDS             30190..30549
                     /locus_tag="CDBI1_18888"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196923.1"
                     /db_xref="GI:384359068"
                     /db_xref="GeneID:12212921"
                     /translation="MKEYKDDLATIYIDVDDTITPDMGNSFFPKAIESIIKLSKKANI
                     IIWSKGGLNYTKEIINKANLVDYIAFCMPKPDLIIDDLSFSDFSYSKMINRGMWDLDI
                     DKLEGNWVNDRINVEKI"
     gene            30636..31181
                     /locus_tag="CDBI1_18893"
                     /db_xref="GeneID:12212922"
     CDS             30636..31181
                     /locus_tag="CDBI1_18893"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196924.1"
                     /db_xref="GI:384359069"
                     /db_xref="GeneID:12212922"
                     /translation="MDKNCFSCSKQFLKNCEILERNKLYIKIHEMDGAVGANEFKENF
                     MCENYRSMNIEYPIEVYKINNKYRNKGHYKESKIGKFVKVRPCKKEYENKTYLGFYLG
                     ELSNSLSISYAPKTKELDINSGMSPAIFVFELNEIIYGNESFWGVIEREEDLKEISNS
                     DIENLWYVKALKSIDKDSDIN"
     gene            31233..31661
                     /locus_tag="CDBI1_18898"
                     /db_xref="GeneID:12212923"
     CDS             31233..31661
                     /locus_tag="CDBI1_18898"
                     /note="'COG0045 Succinyl-CoA synthetase, beta subunit'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196925.1"
                     /db_xref="GI:384359070"
                     /db_xref="GeneID:12212923"
                     /translation="MIKYINSLYVVRRQTEELCIKAVKENGFELQYVIEQTPNICIEA
                     VKESGMALQFVEEQLDEICIEAVKQDGIALKFVEEQTEEICLEAVKQNGLALEYVEKQ
                     NYTICLEALKQDIRSFNHIKWDEFGVAKNELIEMFTKLVS"
     misc_feature    31278..31409
                     /locus_tag="CDBI1_18898"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    31413..31535
                     /locus_tag="CDBI1_18898"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    <31512..>31652
                     /locus_tag="CDBI1_18898"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl09925"
                     /db_xref="CDD:263920"
     misc_feature    31602..31622
                     /locus_tag="CDBI1_18898"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            complement(31695..32300)
                     /locus_tag="CDBI1_18903"
                     /db_xref="GeneID:12212924"
     CDS             complement(31695..32300)
                     /locus_tag="CDBI1_18903"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196926.1"
                     /db_xref="GI:384359071"
                     /db_xref="GeneID:12212924"
                     /translation="MGKYPRYANFSLNTKFAITVTENGKMDFNSVMNINDKNISNKRE
                     LASIIGEQSNGRVSLINYIILEELEEFLFYEFSEMAKLGLIVRKCNLCGKYFILRNKH
                     NTLFCNRIYKNNFTCKQIGNKELYNNKLSKDPVLQKYEKIYKANYAKMQRDEAKEIHG
                     LNNGIARNKFKNWSKKAQHLRKEYLAKKISGDDLVLHIKIK"
     gene            32961..33272
                     /locus_tag="CDBI1_18908"
                     /db_xref="GeneID:12212925"
     CDS             32961..33272
                     /locus_tag="CDBI1_18908"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196927.1"
                     /db_xref="GI:384359072"
                     /db_xref="GeneID:12212925"
                     /translation="MFSYNIYVVINKIEGDVFLKSNCMDQLEFNFFQNFVDFYNQEDL
                     IEIELSSFYSIKKSFDEDYYEQCKVIKGGEGLNNIKKLIEDINSNIAKAKKIIFYGNK
                     L"
     gene            33467..34828
                     /locus_tag="CDBI1_18913"
                     /db_xref="GeneID:12212926"
     CDS             33467..34828
                     /locus_tag="CDBI1_18913"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196928.1"
                     /db_xref="GI:384359073"
                     /db_xref="GeneID:12212926"
                     /translation="MKLEKYNLLKIREDYQNLIYVDQNFNNCMEAIKINEESLKFIKW
                     KRIKNRMTSEELEKLCIEGVKYQGLNLEFIDLKQLIDKLSNKQLYNIYTNAVKENGLA
                     LKYVILEGLTEIQIKNIFLIAVRQNGDVLQYIKNQSYEICIESVKKYSWAIQYVNWDE
                     INLTKEQICNLCIEAVKKHGGSLIYLKWSRLKDKLSKKQLYEIFLEAVREDGLALKHI
                     KEQTPAICKEAVKQTGYALQYVNWDILSKEQIYNLCIESVKRDGYILGYVKEQTPEIC
                     LEAVKQNGYALRYVNNQLDEICLEAVRQNGLAIEFVSEQTDEICLEAVRQNGLSLRYI
                     KVQTEEICIEAVKRNGYALRFVKLDEFSKEQFDEICIEAIHKSPCILQYIENQTEEMC
                     LEAVRRDGKVLKDVENQTEKVCLEAINENPLSFYSIRLKEVKFSKKNLFKIYIKLIKY
                     KLF"
     misc_feature    34070..34198
                     /locus_tag="CDBI1_18913"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    34286..34408
                     /locus_tag="CDBI1_18913"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    34352..34468
                     /locus_tag="CDBI1_18913"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    34418..34534
                     /locus_tag="CDBI1_18913"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    34481..34618
                     /locus_tag="CDBI1_18913"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(34956..36011)
                     /locus_tag="CDBI1_18918"
                     /db_xref="GeneID:12212927"
     CDS             complement(34956..36011)
                     /locus_tag="CDBI1_18918"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196929.1"
                     /db_xref="GI:384359074"
                     /db_xref="GeneID:12212927"
                     /translation="MFNIKVIIDNKNKTHYIHYINSKQIKDKKINYPGEDLIEFLLMD
                     LTEYKNKLNRYFINNKIIIEDIENNYDNLHNIIYHIAELIKNKHDIAYSYLVSKIEFV
                     FLSEKNILNQLHLAFRALEEIIRLQEIFKEGAEICLNAESLTKLTQSERFILFLDKHP
                     QYENFSFKTSHSLTLVKNGESDLYKINDINNNNTNYKTKHPPLAYKQFEEVNPIKYLI
                     LEELEEFLFYEFAEMCKLELKIKKCQLCGEFFILKSKHNAYYCNRIYENNLTCNQIGI
                     KKTYKLKISNNPTLKEYERIYNAKYAKMKRDELKENSIGESKEDFMKWSKIAQKLRKQ
                     YINNEITKEDFLLRLSL"
     gene            36269..36583
                     /locus_tag="CDBI1_18923"
                     /db_xref="GeneID:12212928"
     CDS             36269..36583
                     /locus_tag="CDBI1_18923"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196930.1"
                     /db_xref="GI:384359075"
                     /db_xref="GeneID:12212928"
                     /translation="MFYYNVNVIIEKLEQDVFLRSNELSQSEFDFLKNFIDFFDPHNK
                     NEYIEISASKFLNIKKEFENDYKEHCKFIQNGNGLNNIKKIFEDISYNLSMWESILFD
                     WE"
     gene            37133..37816
                     /locus_tag="CDBI1_18928"
                     /db_xref="GeneID:12212929"
     CDS             37133..37816
                     /locus_tag="CDBI1_18928"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196931.1"
                     /db_xref="GI:384359076"
                     /db_xref="GeneID:12212929"
                     /translation="MNKFNKLGDSLLDCKRELLKDYPEIIINSLIFFAKDMLEKQTID
                     EDVFELLKNKNINFNDFRNTILSNSNCIKTQEELLEEYEIIIQKISEFLDFEKLGIKV
                     SENVEKEIISLRKAFIIPISFIRDYFDIDSEESFREITKQQGFMHKFAVLRMPKIIAP
                     FIKEGEFFDVINSDVFFQKEEESYGIFLSFNIKLAGFENNKILEDTIREISNILESAQ
                     IAFKNGLSC"
     gene            complement(38008..38439)
                     /locus_tag="CDBI1_18933"
                     /db_xref="GeneID:12212930"
     CDS             complement(38008..38439)
                     /locus_tag="CDBI1_18933"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196932.1"
                     /db_xref="GI:384359077"
                     /db_xref="GeneID:12212930"
                     /translation="MLFIFLICFIYISINSVNIIFTDKIILYLLKNTTSKDNIFFKSQ
                     LYKLLLFIINLAPLILVILRSSHIQIKYLLIVFYAIWITLSFCLYFNTKFVLHILDLK
                     YDIDKIPSYYSKDFLFAIINISNNKLTLKYRFFKKRLEIDF"
     gene            complement(38564..39088)
                     /locus_tag="CDBI1_18938"
                     /db_xref="GeneID:12212931"
     CDS             complement(38564..39088)
                     /locus_tag="CDBI1_18938"
                     /note="COG0681 Signal peptidase I"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="YP_006196933.1"
                     /db_xref="GI:384359078"
                     /db_xref="GeneID:12212931"
                     /translation="MSKKQVNEKFTFKDIIVTVILSVIAFLLISSVIRLTTVMGHSMS
                     QTLYDGEKLIISKIAYNKEDPKYKDVVVIKRSDLNVKYIIKRVIAVEGDTLKIINNKL
                     YINDKLIEENYINEKMQTSDLEIKIPKDKIFVMGDNRNNSIDSRSSIIGLIDQKDIEG
                     KVIFNLSQFKKFKS"
     misc_feature    complement(38597..39046)
                     /locus_tag="CDBI1_18938"
                     /note="signal peptidase I, bacterial type; Region:
                     sigpep_I_bact; TIGR02227"
                     /db_xref="CDD:233790"
     misc_feature    complement(38603..38989)
                     /locus_tag="CDBI1_18938"
                     /note="The S26 Type I signal peptidase (SPase; LepB;
                     leader peptidase B; leader peptidase I; EC 3.4.21.89)
                     family members are essential membrane-bound serine
                     proteases that function to cleave the amino-terminal
                     signal peptide extension from proteins that are...;
                     Region: S26_SPase_I; cd06530"
                     /db_xref="CDD:119398"
     misc_feature    complement(order(38834..38836,38963..38965))
                     /locus_tag="CDBI1_18938"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119398"
     misc_feature    complement(38600..>38845)
                     /locus_tag="CDBI1_18938"
                     /note="The S24, S26 LexA/signal peptidase superfamily
                     contains LexA-related and type I signal peptidase
                     families. The S24 LexA protein domains include: the lambda
                     repressor CI/C2 family and related bacterial prophage
                     repressor proteins; LexA (EC 3.4.21.88), the...; Region:
                     Peptidase_S24_S26; cl10465"
                     /db_xref="CDD:263975"
     gene            complement(39292..40041)
                     /locus_tag="CDBI1_18943"
                     /db_xref="GeneID:12212932"
     CDS             complement(39292..40041)
                     /locus_tag="CDBI1_18943"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196934.1"
                     /db_xref="GI:384359079"
                     /db_xref="GeneID:12212932"
                     /translation="MKNINKLNILDKGIDASNYIINKFKHILDIFNNSKENKYKLLTE
                     DLFLDVEDLSYFFNTFENIFDSEELNAFQEFYLKSLIDIINNKINHDNIHFNINTNQK
                     IYFLDVIFTEHNKEYNLLTLDPYLKTIKEKEYQYILNINNCISEKKIELNKLKEYELY
                     LYSISQSPQMLSNDNILKMVDIRLRTKKYLNEIQKEMVANSNNINRLAEEIITYKVLL
                     EEEYKNITNIDVLKTNFLDKLIVFFNFKKLV"
     gene            40566..40640
                     /locus_tag="CDBI1_t20185"
                     /db_xref="GeneID:12212933"
     tRNA            40566..40640
                     /locus_tag="CDBI1_t20185"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:12212933"
     gene            41434..41506
                     /locus_tag="CDBI1_t20187"
                     /db_xref="GeneID:12212934"
     tRNA            41434..41506
                     /locus_tag="CDBI1_t20187"
                     /product="tRNA-Met"
                     /db_xref="GeneID:12212934"
     gene            41807..42160
                     /locus_tag="CDBI1_18948"
                     /db_xref="GeneID:12212935"
     CDS             41807..42160
                     /locus_tag="CDBI1_18948"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196935.1"
                     /db_xref="GI:384359080"
                     /db_xref="GeneID:12212935"
                     /translation="MDRILTIVVRFLMKRLSSYNKNEEDKKVLLEINDSIYLTSVDDI
                     KNHNTEEYFPVKTSSLSVAESILSEIILEEAINVELPIVHRCTICSDVIYGDNVSKGI
                     YGDICEKCNESFNKI"
     gene            42323..42844
                     /locus_tag="CDBI1_18953"
                     /db_xref="GeneID:12212936"
     CDS             42323..42844
                     /locus_tag="CDBI1_18953"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196936.1"
                     /db_xref="GI:384359081"
                     /db_xref="GeneID:12212936"
                     /translation="MKLNLNELRLLISDKENDLYNKRRELLDNSIVIKHSTFIQGKNE
                     LTQMTPEYSFDEELNEYNEMTEDVVKYKNLLQNTNNKTKISDEDTISSALTKLKEYRN
                     YLSVLDKLSSLDKEKKHRKVDTQYASSFYMEIKTLNFDRDNMIERKNELRKKINTLES
                     LISKMNSDTYLEI"
     gene            43260..45683
                     /locus_tag="CDBI1_18958"
                     /db_xref="GeneID:12212937"
     CDS             43260..45683
                     /locus_tag="CDBI1_18958"
                     /note="'COG0507 ATP-dependent exoDNAse (exonuclease V),
                     alpha subunit - helicase superfamily I member'"
                     /codon_start=1
                     /transl_table=11
                     /product="Helicase, RecD/TraA"
                     /protein_id="YP_006196937.1"
                     /db_xref="GI:384359082"
                     /db_xref="GeneID:12212937"
                     /translation="MDLEKYKNGDSIKVTGICGNNIFFMEDTSFGIYNFETNDDIKIT
                     IKGIFNKKLVEGQTYELKGTIVLYKREKQIKVNEFRVCKPNTKKGIIAYLKTLYGLKS
                     RAENIYDIFGDESIQVLLNNPLEVVNKVRGIGKKSVLKWQKELKEIEDNQYIFIELLN
                     YGINYKNARKLHEKYKDEILKLIEENPYMLIKEIRGYGFLKCDKIALDLGIELDNINR
                     LKAGVKFLLQEALLSGHCYLPLELIIEDAINLLNLSLSYKEMCSCNKSSSDEIIKFDK
                     TYKLDKYLLAEKICLYEKNKKTKNNYILFSIKEELILEAIEELINENEIVNEDDCIYL
                     KYLYLSEKLLAERLKLFTNYNQIYIKDEVEKVLNEVCSEKGYILEDKQREACIEFNLY
                     NNGLFVLNGPAGTGKTFTLNLILEVAKRLSKRKLKIEAVAPTGKASKVVRNATYMDCS
                     TIHRSLGYVPYMGFTMNEFNQFNKDIIVCDEGTMIDIELGWNFIKAIKTTSKLIIMGD
                     VHQLPSVGPGTVLKDIIESQIVKVITLDVLKRQDLLSGIAKNANGVVEKKMVCPNEED
                     KDFYVLERDSVRKVRLAVISSIRRLVDKYGLEEIQVLLPQRTGSLGTNVFNYIIQKEF
                     NPYANSEKKVLKTKFEAQIAEVGAPEEVSLFIAKNDKVIHVKNNYNMALYELKDGSFK
                     KINKTDVTNGECGVVYDVVPLEKGGLRVIVQYDEYFAFYDDGVDELELSYAITIHKSQ
                     GSAWRAILLPIVPQHIYMLYNNLIYTGMTRARDFLAMIGSIKTIQQGIKKDIAIKRNT
                     KLKDRMLVA"
     misc_feature    43308..45671
                     /locus_tag="CDBI1_18958"
                     /note="helicase, putative, RecD/TraA family; Region:
                     recD_rel; TIGR01448"
                     /db_xref="CDD:233418"
     misc_feature    43686..43970
                     /locus_tag="CDBI1_18958"
                     /note="Helix-hairpin-helix containing domain; Region:
                     HHH_4; pfam14490"
                     /db_xref="CDD:258630"
     misc_feature    44391..44882
                     /locus_tag="CDBI1_18958"
                     /note="AAA domain; Region: AAA_30; pfam13604"
                     /db_xref="CDD:257919"
     misc_feature    45234..45593
                     /locus_tag="CDBI1_18958"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            45694..46038
                     /locus_tag="CDBI1_18963"
                     /db_xref="GeneID:12212938"
     CDS             45694..46038
                     /locus_tag="CDBI1_18963"
                     /note="COG1396 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_006196938.1"
                     /db_xref="GI:384359083"
                     /db_xref="GeneID:12212938"
                     /translation="MDLFGERFKGLRKEMGLTQEELVEKFNKLNDTHFNKSTISQYEN
                     NKRKPELSILYKWANFYGVSLDFILGRSEIKSLELEDDMKAIKIAYEKMSLKDRAKMM
                     FLLKEIFDINLK"
     misc_feature    45706..45897
                     /locus_tag="CDBI1_18963"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(45718..45720,45730..45732,45823..45825)
                     /locus_tag="CDBI1_18963"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(45727..45729,45820..45822)
                     /locus_tag="CDBI1_18963"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(45748..45753,45802..45804,45811..45813,45823..45828)
                     /locus_tag="CDBI1_18963"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            46140..46742
                     /locus_tag="CDBI1_18968"
                     /db_xref="GeneID:12212939"
     CDS             46140..46742
                     /locus_tag="CDBI1_18968"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196939.1"
                     /db_xref="GI:384359084"
                     /db_xref="GeneID:12212939"
                     /translation="MELLICIYVIQLGLVFLFLQRVFIQEKTRAKNNLLNFLKQNQEE
                     LDFVNQSEFFTLEDYLFIFIPIFGLLIMLIGSDFYKIYQENFECKYHNYLLYSLKAIV
                     KNEKYENEFNLIEEILSNDKSPYYEMVAENIIIFASRINEFNSIKNCIEDEQELINIR
                     NEIKLSLLDFLKVVNCIVNDSKEEIALKEKDMLLENIEIY"
     gene            46774..47409
                     /locus_tag="CDBI1_18973"
                     /db_xref="GeneID:12212940"
     CDS             46774..47409
                     /locus_tag="CDBI1_18973"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196940.1"
                     /db_xref="GI:384359085"
                     /db_xref="GeneID:12212940"
                     /translation="MSILMDLIIPVYKIQVVSGVLLFLIAFVLKKFKYKNKSLNFIEQ
                     SDNPIKDLVFIGGFVAIFIPVLGLVIPIALIMGIFSVLGGDFEKEHSRYLLNAIKLMF
                     NKEYDIKNQYDKEFRLTENILSDRESPHYEIVVKYAIAFESLAHEYNNIKEYIEDLKA
                     IRDMRNEMQLALINLLKTVDSIVNDTKKEVALKEKDILLENMKKYNNILSK"
     gene            47501..47881
                     /locus_tag="CDBI1_18978"
                     /db_xref="GeneID:12212941"
     CDS             47501..47881
                     /locus_tag="CDBI1_18978"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196941.1"
                     /db_xref="GI:384359086"
                     /db_xref="GeneID:12212941"
                     /translation="MEESKFEKAKKINIENYEHDFLYDVKTGRYFEEIDVLKEYYENE
                     EMELPDYVYGCIPIKFNLDMYGIVKDELEDNHYEDAINHVNKDSLKSLQEMVDKWTES
                     QGIVSYVQDDDTIILLNNKKNEVS"
     gene            48043..49776
                     /locus_tag="CDBI1_18983"
                     /db_xref="GeneID:12212942"
     CDS             48043..49776
                     /locus_tag="CDBI1_18983"
                     /note="COG2404 Predicted phosphohydrolase (DHH
                     superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196942.1"
                     /db_xref="GI:384359087"
                     /db_xref="GeneID:12212942"
                     /translation="MESIAKVCLFKHIDMDGESSEIVLGLNNINILKSVGCDYSNVDK
                     FVLDFINKKEYLNFDMTYIVDISVSNEVAKKIDEVVKEGAKFKLIDHHKTALDLNKYF
                     WAKVILFDRKGEPTCGTKLLFEDIFGPSDLYFKELKYFVELVQDWDTFSWTKTNNLEA
                     VRLNDLFEEMGAIDFRKSIVEKITNNKELFSEEENIKINLKTKRRIDYFNEIGEKLIQ
                     RKMNLLKDKKQQEFNVGIVSVDDRREISLLGHFLYTKFDNLDFIAILNNLNNNVSLRT
                     NKDIDLSEIAKLNFNGGGHPSSAGCDLDTFMDKLNISFRKGREDISVTVFVPSDCVNN
                     CEFCTSKREYKKDRPNIKNIKKSISMLNKKGFKSFVFTGGEPFADLDTLKELINLIDN
                     DKVVYINTTLPKNRILDTINYINTEDRIKGVSISRHDNVILDNLAEDSYFTDIKKEVR
                     INSVLTTDSNVSNVIDRFSKFKDISLNFRVDYRYTTKSNLKILDGIGLSLFNNNNYKM
                     IYSGGSDICQDFEFIRLIDGFKIQYHKGLEYSSFEVGNTIIYYDLIIKPNGKVYYDWD
                     DKDLGIKKLLI"
     misc_feature    48058..48975
                     /locus_tag="CDBI1_18983"
                     /note="Predicted phosphohydrolase (DHH superfamily)
                     [General function prediction only]; Region: COG2404"
                     /db_xref="CDD:225268"
     misc_feature    49033..>49320
                     /locus_tag="CDBI1_18983"
                     /note="radical SAM enzyme, TIGR04100 family; Region:
                     rSAM_pair_X"
                     /db_xref="CDD:188615"
     gene            50322..51104
                     /locus_tag="CDBI1_18988"
                     /db_xref="GeneID:12212943"
     CDS             50322..51104
                     /locus_tag="CDBI1_18988"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196943.1"
                     /db_xref="GI:384359088"
                     /db_xref="GeneID:12212943"
                     /translation="MRKRVIIFFILSIIIGVAVGCLVKDYTCNKYNKSTKMIEDNLSK
                     QFQKVLNSEIKKVKDEYEVKLKEEQKKDKSDSSSVVFNKKMIKLRQLVSKYYKNNDKE
                     ALYLAVDGTGNINKLLLTYNKEHYICIKDNTQDIENTYSIEHTQKIDINNENNISDSI
                     TFKILNRGEDTFNINNHQLFIDYIQILMNKNLSNKDKSALNVQVNMNLSELSSVEDLN
                     TYLYNKDSLKINNFIFSVKKIEDKELDLKGIEYSIKSNIEKR"
     gene            51194..51394
                     /locus_tag="CDBI1_18993"
                     /db_xref="GeneID:12212944"
     CDS             51194..51394
                     /locus_tag="CDBI1_18993"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196944.1"
                     /db_xref="GI:384359089"
                     /db_xref="GeneID:12212944"
                     /translation="MKEIYKIGDVVDYNYIKGNSVKAIIKKIEEEGVLIEILICNKKS
                     EKILQEDRIVSYKEITPVKKSI"
     gene            51434..53167
                     /locus_tag="CDBI1_18998"
                     /db_xref="GeneID:12212945"
     CDS             51434..53167
                     /locus_tag="CDBI1_18998"
                     /note="COG0465 ATP-dependent Zn proteases"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cell division protease FtsH-like
                     protein"
                     /protein_id="YP_006196945.1"
                     /db_xref="GI:384359090"
                     /db_xref="GeneID:12212945"
                     /translation="MKKNKKVRLLIAFLVGLIITVIVFFIQKDNIKSLLDIKEISYKK
                     FEQMVEKKEVKEISLDIIDGKYVRVKDKKDNSYITLNPKYNNFKKEMLEKNIYVKERK
                     VIKLKLSTIVLIFFLVLIFKSSSLLKNKFDTVAETPDVKFKDVAGLDGAKEDLKLLVD
                     FMKKPKEFTSKGAVLPKGAILYGPPGTGKTLIAKAVAGEAGVPFFSINGSDFIELYVG
                     LGAKRVRELFEEAKKKAPAILFIDEIDSIGGKRGCSGENSEQRQTINALLAEIDGFDG
                     SEGIFILCATNRLEDLDGALIRPGRFDKHISIPLPETSEDRLNIIKMYLNKKDRKYSN
                     DLDLKSIANETIGFSPADISSLINESILISIQLNKDKIDKECLDKALYKMLLKGHEKK
                     NRSNNLEELKLISHHEAGHALVAKLMGLEVSKVTIIPSTSGAGGATFITPKKINLHSK
                     KEIVEMVKVDYAGRIAEFLLFNDEERVTTGCSSDIKNATQKIYGMITEFGMSDTYGMI
                     NLNCLKIKSDIVLEAVKKEALRIKEETTILLSDNKYLLEKIADVLFEKETISGEELES
                     ILKENSDYIKM"
     misc_feature    51482..51736
                     /locus_tag="CDBI1_18998"
                     /note="FtsH Extracellular; Region: FtsH_ext; pfam06480"
                     /db_xref="CDD:253758"
     misc_feature    51755..53140
                     /locus_tag="CDBI1_18998"
                     /note="ATP-dependent metalloprotease FtsH; Region:
                     FtsH_fam; TIGR01241"
                     /db_xref="CDD:233327"
     misc_feature    51959..52363
                     /locus_tag="CDBI1_18998"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    51980..52003
                     /locus_tag="CDBI1_18998"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(51983..52006,52157..52159,52292..52294)
                     /locus_tag="CDBI1_18998"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    52145..52162
                     /locus_tag="CDBI1_18998"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    52334..52336
                     /locus_tag="CDBI1_18998"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    52628..53134
                     /locus_tag="CDBI1_18998"
                     /note="Peptidase family M41; Region: Peptidase_M41;
                     pfam01434"
                     /db_xref="CDD:250619"
     gene            complement(53201..54037)
                     /locus_tag="CDBI1_19003"
                     /db_xref="GeneID:12212946"
     CDS             complement(53201..54037)
                     /locus_tag="CDBI1_19003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196946.1"
                     /db_xref="GI:384359091"
                     /db_xref="GeneID:12212946"
                     /translation="MFINYRNIIKELLKEYKTGLLKIFFKRVTPILILVYICLFFFMP
                     LSFFSIFILLIQVPLVLIMLLILSIIKVLIIREYKNIKEENFNSIFILKETLEINSSI
                     FKMGKIYNVCLTELKKLDKLSKFLTKKNCIITFTLKEFGLIYLEKDILNIFFNLDTYI
                     LNNRKIILYLMSSNNRLLYKDKNTIEVLKIAYSMNFEDCMNEKIISSLFEEWLLLASI
                     CLLENDYALSNELIEAFYNINQLTLERRTKPLICSKESSFLQLTDSIKKDLKEYPNLY
                     SI"
     misc_feature    complement(<53414..53659)
                     /locus_tag="CDBI1_19003"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     gene            complement(54063..54890)
                     /locus_tag="CDBI1_19008"
                     /db_xref="GeneID:12212947"
     CDS             complement(54063..54890)
                     /locus_tag="CDBI1_19008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196947.1"
                     /db_xref="GI:384359092"
                     /db_xref="GeneID:12212947"
                     /translation="MKTEVVIKLLKEYRFKLDIIGLKELTLCIYIALLSIGFGVFHLL
                     YKMLNFNMIISIIISLSITLPLSQLDIIFSTLKTFKEKKYKEIDDKFFYKILVFNDIM
                     KNDPKLFNINTYLYKIWNDEINEMSKFTQFLEGKYKIITLILYNANIIRVEPSLLDNY
                     FKLEDFLLTLRNLILRCMSDKTSLCENDTRTIFKRACVISYSEGLTGMIPDLLDEWLL
                     IALDYLSKNNFKLSNDLIKAFDNIEKLSVNLNQKDSKTQNEGSCFLKLTESITSDLL"
     gene            complement(54993..55427)
                     /locus_tag="CDBI1_19013"
                     /db_xref="GeneID:12212948"
     CDS             complement(54993..55427)
                     /locus_tag="CDBI1_19013"
                     /note="COG1396 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196948.1"
                     /db_xref="GI:384359093"
                     /db_xref="GeneID:12212948"
                     /translation="MKFRELMIQKRKEKGLSQRELANILGVGHSTINRIENETTENVN
                     IKLYFDLLKFLEIDFTEIDDFNDIIPASKKNLSINKSINKNCIVCGDNLDIQELEISQ
                     NNQMIRLEMCRKHRKELAVLLCESLPKEEKKNLLLEILVNNM"
     misc_feature    complement(55242..55415)
                     /locus_tag="CDBI1_19013"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(55317..55319,55392..55394,55404..55406))
                     /locus_tag="CDBI1_19013"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(55320..55322,55395..55397))
                     /locus_tag="CDBI1_19013"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(55314..55319,55329..55331,55338..55340,
                     55371..55376))
                     /locus_tag="CDBI1_19013"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            55659..57650
                     /locus_tag="CDBI1_19018"
                     /db_xref="GeneID:12212949"
     CDS             55659..57650
                     /locus_tag="CDBI1_19018"
                     /note="COG0272 NAD-dependent DNA ligase (contains BRCT
                     domain type II)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase, NAD-dependent"
                     /protein_id="YP_006196949.1"
                     /db_xref="GI:384359094"
                     /db_xref="GeneID:12212949"
                     /translation="MNKVEEKIRDLREEVIKHDLAYAKGDPIISDTEYDKLYLKLVGL
                     EELYPEYSDENSPTKRIIDIKVEGLKKVEHTIPMLSQKKINTPDELDKFIRQMNDELL
                     VEDKLDGLTVIAKYNNGVLYEGITRGDGKIGDDITHIVLNTPNIPKTIPFNDYLEIRL
                     EGIIPNEDFEMVNSILEEEDKYKSSRNLASGTVRSLNGCVAKERGLKLIAFELVKADN
                     IIFEKDYERLEFLKTLGFDVVNYTLFKKNEEDILKLKDYIFSYNQEVRPFLSYKVDGL
                     VIKANSLELRDSLGNTSKYPKWSSAFKFENEEAITKLKDCIIEVGKSGQLTPVALFEP
                     VQIDGITISKATLSNFKNVKDKDIKIGDMVVVARANDVIPKIEHSIKEDRTGEEKEIE
                     IPKFCPVCNEPIVKENVHYFCVNDDCPAQIEGKIIHFVSKKSLDIDGLGEESIKLFLD
                     NGLISSIIDIFYLKDKKDDLLKLDKYADKKVSNLLENIEASKQASLSKILHGLSIKLI
                     GGRASKELANKFISMKNILNISKNEEEFKQSILSINNFGEEMSNNLVLFFKDERNIEL
                     INKLMEVGFKMEEQIVKVNEEENMLTGKTVVITGKFTDFTREELTEKIENEFGGKCSK
                     SVSKKTDFLIYGDKAGSKYNKALELGVKLITEKELLDII"
     misc_feature    55659..57647
                     /locus_tag="CDBI1_19018"
                     /note="NAD-dependent DNA ligase LigA; Validated; Region:
                     ligA; PRK07956"
                     /db_xref="CDD:236137"
     misc_feature    55674..56570
                     /locus_tag="CDBI1_19018"
                     /note="NAD+ dependent DNA ligase adenylation domain. DNA
                     ligases catalyze the crucial step of joining the breaks in
                     duplex DNA during DNA replication, repair and
                     recombination, utilizing either ATP or NAD(+) as a
                     cofactor, but using the same basic reaction...; Region:
                     LIGANc; cl03295"
                     /db_xref="CDD:261674"
     misc_feature    order(55899..55901,55968..55970,55974..55976,56037..56039,
                     56139..56141,56289..56291,56487..56489,56493..56495)
                     /locus_tag="CDBI1_19018"
                     /note="nucleotide binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238062"
     misc_feature    order(55974..55976,55980..55985)
                     /locus_tag="CDBI1_19018"
                     /note="K-X-D-G motif; other site"
                     /db_xref="CDD:238062"
     misc_feature    55974..55976
                     /locus_tag="CDBI1_19018"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238062"
     misc_feature    56583..56828
                     /locus_tag="CDBI1_19018"
                     /note="NAD-dependent DNA ligase OB-fold domain; Region:
                     DNA_ligase_OB; pfam03120"
                     /db_xref="CDD:145978"
     misc_feature    56844..56918
                     /locus_tag="CDBI1_19018"
                     /note="NAD-dependent DNA ligase C4 zinc finger domain;
                     Region: DNA_ligase_ZBD; pfam03119"
                     /db_xref="CDD:251739"
     misc_feature    57150..57359
                     /locus_tag="CDBI1_19018"
                     /note="Helix-hairpin-helix motif; Region: HHH_2;
                     pfam12826"
                     /db_xref="CDD:257328"
     misc_feature    57435..57647
                     /locus_tag="CDBI1_19018"
                     /note="Breast Cancer Suppressor Protein (BRCA1),
                     carboxy-terminal domain. The BRCT domain is found within
                     many DNA damage repair and cell cycle checkpoint proteins.
                     The unique diversity of this domain superfamily allows
                     BRCT modules to interact forming homo...; Region: BRCT;
                     cd00027"
                     /db_xref="CDD:237994"
     misc_feature    order(57480..57482,57492..57494,57501..57503,57513..57515,
                     57519..57521)
                     /locus_tag="CDBI1_19018"
                     /note="Dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:237994"
     misc_feature    order(57630..57632,57642..57644)
                     /locus_tag="CDBI1_19018"
                     /note="BRCT sequence motif; other site"
                     /db_xref="CDD:237994"
     gene            57716..58987
                     /locus_tag="CDBI1_19023"
                     /db_xref="GeneID:12212950"
     CDS             57716..58987
                     /locus_tag="CDBI1_19023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196950.1"
                     /db_xref="GI:384359095"
                     /db_xref="GeneID:12212950"
                     /translation="MIKSINYYETENKKRIYVKIVDRKTDAYFDVIKNEWTPKKIKEI
                     EEEIFKFAGVESIEGFKKIKSNIYTSKDKDQVLISKFNKIKNYTMTDKYFKEIKAVIK
                     ELNNNKIEKDITNINEKRITYLKERINKNLSYMTKNNRKEKYEDISTDIVKLEKLDYD
                     TKYIKHEIEDKYNKLTIQYYISKFEYNLNCIREYKRISANKIELCKSSIEKLHNLGEN
                     TCNLENKLEKVINDKKEQIEIERLKTIEELRKNTIYLSYLKDGTFRLENKDYNNYDEI
                     KKLIKELEIGEYDGLYSIIVNIKKLDDNGINYEIVNKKVTKIPTFTELEDMPSVFRLR
                     GCTFKENASKGCYIAICDELGTIIYFLTSVEKVNKSGTMITYNFSDFEFENDSYYAVR
                     YGKMYDIRKRIYRFNNEKWYEVSYTYSVEYK"
     misc_feature    <57980..>58240
                     /locus_tag="CDBI1_19023"
                     /note="ATP-dependent Lon protease, bacterial type
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: Lon; COG0466"
                     /db_xref="CDD:223542"
     gene            59002..59520
                     /locus_tag="CDBI1_19028"
                     /db_xref="GeneID:12212951"
     CDS             59002..59520
                     /locus_tag="CDBI1_19028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196951.1"
                     /db_xref="GI:384359096"
                     /db_xref="GeneID:12212951"
                     /translation="MLKIAVGEKFPTKLHDGLSITFGEAGFTVTFKLDNLSEEEILEF
                     CTGNLRIDISFLEKIMFFIFTNPHGIGNADIPFDIHFTDVKEMQDIKENEGYRMDLIL
                     IEGKNNIVKGFRMISFSTKASEYIKKCTEVQLLEKGFNKENYVNKVINLHRRYNLKEI
                     KGMSGEYNIFKR"
     gene            complement(59553..60362)
                     /locus_tag="CDBI1_19033"
                     /db_xref="GeneID:12212952"
     CDS             complement(59553..60362)
                     /locus_tag="CDBI1_19033"
                     /note="COG0582 Integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase XerD"
                     /protein_id="YP_006196952.1"
                     /db_xref="GI:384359097"
                     /db_xref="GeneID:12212952"
                     /translation="MDIENELLEFEKSIQQLSKNTKYNYKLDIKQFLNIYGHQDINKA
                     LLKKYKDEIIENYSIKTVNRKINSLNAYLRFKNINMHVPVAKIQNQTFIDDMLTNEEV
                     RLMLNKSIELNDLRAKAIMLGLFYTGARVSELLQFKVKSIQKDEIMIKGKGSKYRKIL
                     IPSVLNNAFQEYVDNERVDNTQFLFSGQRGVLSRSEVFRILKKYALLANINEDSVYPH
                     AFRHLFTKNLDKKGVSYSAIKQLLGHALSTTDIYMQLSKRELLEEINSIHI"
     misc_feature    complement(59574..60350)
                     /locus_tag="CDBI1_19033"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(59559..60347)
                     /locus_tag="CDBI1_19033"
                     /note="tyrosine recombinase XerD; Region: recomb_XerD;
                     TIGR02225"
                     /db_xref="CDD:233789"
     misc_feature    complement(order(59607..59609,59709..59717,59907..59909,
                     59970..59975))
                     /locus_tag="CDBI1_19033"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(59607..59609,59631..59633,59700..59702,
                     59709..59711,59907..59909,59973..59975))
                     /locus_tag="CDBI1_19033"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(59607..59609,59631..59633,59700..59702,
                     59709..59711,59973..59975))
                     /locus_tag="CDBI1_19033"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(60390..60722)
                     /locus_tag="CDBI1_19038"
                     /db_xref="GeneID:12212953"
     CDS             complement(60390..60722)
                     /locus_tag="CDBI1_19038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196953.1"
                     /db_xref="GI:384359098"
                     /db_xref="GeneID:12212953"
                     /translation="MRQNLKRFLGTKVYATAKFEKYGQVYNDSSKRYSKDKRCFRILL
                     KNIIIEHKGKNYYVGHQWFKVTNSFKNLGILKLGDKLKLYGEVQQYTKRSGKEKDYEI
                     HCLRVERM"
     gene            61221..65552
                     /locus_tag="CDBI1_19043"
                     /db_xref="GeneID:12212954"
     CDS             61221..65552
                     /locus_tag="CDBI1_19043"
                     /note="COG2247 Putative cell wall-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196954.1"
                     /db_xref="GI:384359099"
                     /db_xref="GeneID:12212954"
                     /translation="MNNIKKFLLIILNMILILSNVYIPTNALEKDVKVDVSQNPDIDI
                     VLVAGKTSTSLSTFERDIKNSLKLKGVDINKVNVQAIQSSQVTAESNFTWQKYDHGKG
                     SVSGKDVIFNGYTEEGYSDFWFCNNTKIGEKTFTFTLNESQVKYHSFMGGGFLFGMKD
                     YGDGTFEGYTLLIDSGTMSIKKIPRVSKTTFSNTNGNFAYENPSGSGTSSVAKMSTQT
                     HDIKMVLVDNSVKVYENNTLKLDYTLSTSTPGEGFGIIADHNSHNCNETSTFRLSNLV
                     MRTETSKEFNEVLRGPEWRDNSVKFIVNVEDKERTDFNSPTALGEIVSRMLNEEIYLV
                     NLGTSNSKAQIDKLIASNNNNGIFITNTNYNSSIEQTAQYILEKLNVITKPSPYVLIN
                     TPFKYSISPEELKTDTISTEFPDGAWKIEHDYTYFDNSMGKSSLSGLYMDDFNLKLDK
                     PGKLDISFEDRSVIPASLFVHRKPVANFGFSLSSNGSGYNINYTEASYDEDGITKSDR
                     GIAEKEWKYKATTSSSWINGRPSTINQNTDYIVQLRVKDHQGVWSSPDTKYITTSNNS
                     VNPISSFTCPKTVTKYEQLEITDNSYDPYARTITQYEWEIFNSSGTSIYKSSSPNKNI
                     GNYGTGTYIYALRVKNSQNLWSPVFKRTINVVNDTQAPDIFADVVNHKGTPDEINVNL
                     SFTDLGGSGFNSFRYKISNNISAGTWSDWKSETTSSVKIDKYGDNYLYVEAKDNNGNI
                     AKRTFGRYTKTDITAPNIEADIESHSGTPDEIKVNLNFTDLGGSGFNSYRYQVSQSTE
                     VENTKWSNWINKNSAEVKINTYGVNYIHIESKDNDGNISKKTFGTYRITDETAPEIEA
                     DIKNHGGTSEVIKVNLSFSDLGGSRFNNYRYQVSQSMDADDTKWSDWVSGDNGVIEIS
                     KYGENYIHVEAKDNDSNTSKKTFGPYNITDITPPEIETNLENDPGSPTSININLKFSD
                     DEGSGFNSYRYKIVTNVKEDKVWSEWISKDNDVIKIESYGVNYLYIEAKDNDNNITQK
                     MFGPYNRTDNIAPEIKADIENKDWTRSEIDVNLSFSDLGGSGFNSYRYQISRDEKETE
                     TKWSEWIAKPNGLIKISNYGKNYIHVEAKDNDGNTSKKTFGPYNREAPKPNSHETKFD
                     DLVGENRFDTAIKISQTGWDSSYYLVLVNANSIVDAMTSSPLASSKKSPILLTEKNSL
                     ANNTKNEIKRLGVEKVYIIGGENMIDKNVENQLIEMNISIERVAGNDRFETSLKIAKQ
                     VKSQTGSKDVFVVNGENGLADVVSVGAIASQSKSPIILSDGNNIPKGLDIIEQSSKAY
                     LIGGTNTISNSLEDKIPNSSRIFGENRNGTNSEVIKTFYKDDVLNNIYVVKNGSEKEE
                     HLVDALAVSVLGAKTKSPVLIVGNTLDEKQVELFAEKRFEKVTKVGGNGNESCFNEIE
                     NIIVSKR"
     misc_feature    64668..64928
                     /locus_tag="CDBI1_19043"
                     /note="Putative cell wall binding repeat 2; Region:
                     CW_binding_2; pfam04122"
                     /db_xref="CDD:252392"
     misc_feature    64953..65225
                     /locus_tag="CDBI1_19043"
                     /note="Putative cell wall binding repeat 2; Region:
                     CW_binding_2; pfam04122"
                     /db_xref="CDD:252392"
     misc_feature    65241..65531
                     /locus_tag="CDBI1_19043"
                     /note="Putative cell wall binding repeat 2; Region:
                     CW_binding_2; pfam04122"
                     /db_xref="CDD:252392"
     gene            65913..67346
                     /locus_tag="CDBI1_19048"
                     /db_xref="GeneID:12212955"
     CDS             65913..67346
                     /locus_tag="CDBI1_19048"
                     /note="COG2247 Putative cell wall-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="cell surface protein"
                     /protein_id="YP_006196955.1"
                     /db_xref="GI:384359100"
                     /db_xref="GeneID:12212955"
                     /translation="MCKLRLFILIFSVVFLFNVLEVEALSRIEVFNYKDSYDMSYLIS
                     KQKHSTTFILFNKEKLSDGSSASALAGSTGASILFTNKDFLPKETKDSLKNAKKVYLL
                     GGYSSVSLETEEVVKKQNIEVIRLSGKDRLDTSYKVANEISKYKDIDKVFLANGLKGE
                     ADVISISPVAYRDGAPIILTNGMDTKYNLSGKKVYVIGGYALMDKSFDKDEAIRISGE
                     DRFSTSNKIIKSFYNVTPDKIYLCDGDKYLNALLGATIPGGNPVKLINNESPELLYGD
                     STKPILLGELSNINSSKIKLISDLIDVRLSNKKEIDQNELNNMVKEILSIDIKLLTSL
                     KVNNKKIIITDMDVTDIDEFKFLKDKKVPTYKDSTYEELAGLSSNKIAVAVLGKSHMS
                     SSKSVILHEIAHLIDSTLGGISKSDKFKKVCSDEAKNMYMNDYVTGNSVEYFAESLMN
                     YYLEPIEMKNNTPGTYYFIEKEVVRNK"
     misc_feature    66012..66254
                     /locus_tag="CDBI1_19048"
                     /note="Putative cell wall binding repeat 2; Region:
                     CW_binding_2; pfam04122"
                     /db_xref="CDD:252392"
     misc_feature    66282..66509
                     /locus_tag="CDBI1_19048"
                     /note="Putative cell wall binding repeat 2; Region:
                     CW_binding_2; pfam04122"
                     /db_xref="CDD:252392"
     misc_feature    66549..66788
                     /locus_tag="CDBI1_19048"
                     /note="Putative cell wall binding repeat 2; Region:
                     CW_binding_2; pfam04122"
                     /db_xref="CDD:252392"
     gene            67596..67745
                     /locus_tag="CDBI1_19053"
                     /db_xref="GeneID:12212956"
     CDS             67596..67745
                     /locus_tag="CDBI1_19053"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006196956.1"
                     /db_xref="GI:384359101"
                     /db_xref="GeneID:12212956"
                     /translation="MIKIHRVKLKLSQSQFKLVREKQMECANCWNEIIRVSKEYYLEN
                     KKMDK"
     gene            67798..68760
                     /locus_tag="CDBI1_19058"
                     /db_xref="GeneID:12212957"
     CDS             67798..68760
                     /locus_tag="CDBI1_19058"
                     /note="COG0675 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006196957.1"
                     /db_xref="GI:384359102"
                     /db_xref="GeneID:12212957"
                     /translation="MQAISDKFSANRKTIAELRKKGNTKAKYPYKEKKFYVIPFKNSA
                     INTNSMGNLKFSMSKGRHLELDFNIENIKTAEIVWRNGYYLYYTFDNGLDEVVAEGTN
                     IIGVDLGEIHSIASVTNEGNGLIISNRTGRSVKQFRNKMYAYISKRLSRCKKGSRQSK
                     KLWKLKNAIRTKTDNQLRNLYHQATKKFIDFCVEQQVCEIVLGDIKGIEKNTKKKKRL
                     NRINRQKISQMEYGRIKDYIKYKAKEQGIEVKLVKENYTSQTCPKCSKKHKPIGRIYS
                     CTCGYKTHRDIVGAWNILNKKHKYNLVDFSINHKQPINLKVSTI"
     misc_feature    67801..68685
                     /locus_tag="CDBI1_19058"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    67855..68421
                     /locus_tag="CDBI1_19058"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     misc_feature    68488..68685
                     /locus_tag="CDBI1_19058"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            69389..69760
                     /locus_tag="CDBI1_19063"
                     /db_xref="GeneID:12212958"
     CDS             69389..69760
                     /locus_tag="CDBI1_19063"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="YP_006196958.1"
                     /db_xref="GI:384359103"
                     /db_xref="GeneID:12212958"
                     /translation="MGLRKLSKSELKLMKFIWDLDVKVRSDEVSNYMKEKYDWTEKRS
                     LKILLKLSNKKFLYAQEISNYTYYTIAVKQEKYFKFVSMKINYFLSCNSIRNLLVSLF
                     EEELTEEKLNSLEEWVKDWEQ"
     misc_feature    69401..69736
                     /locus_tag="CDBI1_19063"
                     /note="Penicillinase repressor; Region: Penicillinase_R;
                     cl17580"
                     /db_xref="CDD:266753"
     gene            69929..70279
                     /locus_tag="CDBI1_19068"
                     /db_xref="GeneID:12212959"
     CDS             69929..70279
                     /locus_tag="CDBI1_19068"
                     /note="COG1396 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="YP_006196959.1"
                     /db_xref="GI:384359104"
                     /db_xref="GeneID:12212959"
                     /translation="MLEEQIYAIIGKRIRNYRKRAGYSQEALAKKAGLFHAYLGQIER
                     GESKASLRSIFKIANALEMPLEILFENIIQNEKDPETLSSEAYELIDSLTSKEQKAII
                     KLLKEIIEYRKLEE"
     misc_feature    69956..70267
                     /locus_tag="CDBI1_19068"
                     /note="transcriptional repressor DicA; Reviewed; Region:
                     PRK09706"
                     /db_xref="CDD:182039"
     misc_feature    69959..70132
                     /locus_tag="CDBI1_19068"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(69971..69973,69983..69985,70058..70060)
                     /locus_tag="CDBI1_19068"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(69980..69982,70055..70057)
                     /locus_tag="CDBI1_19068"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(70001..70006,70037..70039,70046..70048,70058..70063)
                     /locus_tag="CDBI1_19068"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            70393..70734
                     /locus_tag="CDBI1_19073"
                     /db_xref="GeneID:12212960"
     CDS             70393..70734
                     /locus_tag="CDBI1_19073"
                     /note="COG3682 Predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="YP_006196960.1"
                     /db_xref="GI:384359105"
                     /db_xref="GeneID:12212960"
                     /translation="MLIRKIPQAELDIMKFIWEKNDTVTSKSIIEAMERKHGWKQTTT
                     LTILSRLVKKQFLKSERINRLTYYEIIVTKKVYQVFATKEFIRDIHSNSIESLINSLM
                     EILKNSDINYF"
     misc_feature    70408..70701
                     /locus_tag="CDBI1_19073"
                     /note="Penicillinase repressor; Region: Penicillinase_R;
                     cl17580"
                     /db_xref="CDD:266753"
     gene            complement(71059..71721)
                     /locus_tag="CDBI1_19078"
                     /db_xref="GeneID:12212961"
     CDS             complement(71059..71721)
                     /locus_tag="CDBI1_19078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196961.1"
                     /db_xref="GI:384359106"
                     /db_xref="GeneID:12212961"
                     /translation="MKIKDYMKLDDEYKEKKNELNRTYELLRNMEEQLDLKDLNSYGY
                     KEIKTIYNSIKNKNVLNKVKEIMQIKKSIEYPQINDVHYFSEIKDIDFLSQEEKVELD
                     KFIAKHAFFRESSFSFNEKAIDFLISNKIVERVYCLNCYCGECQEVQLTQDGLDSYKE
                     YWINEDTTEEEDEKMDYGILTIGCWEYPDIEICSLEKFNEHISSIYYKRIKKPDKTLD
                     NI"
     gene            complement(71798..72529)
                     /locus_tag="CDBI1_19083"
                     /db_xref="GeneID:12212962"
     CDS             complement(71798..72529)
                     /locus_tag="CDBI1_19083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196962.1"
                     /db_xref="GI:384359107"
                     /db_xref="GeneID:12212962"
                     /translation="MELELNEDGRYNICEEKKFILKDLIGKVEILNKQIEMIENLKIE
                     PVTEENWHELCKTLFRGKNISLKIAEATFPHGENFKLDLNKISFEMQGFNIYVPTSEL
                     KGIEIGMSWYKQYLLQDFKPKNRYKRMRKYFKLLDEGNSKWYELAESTCPTKLNKAQL
                     LKYWFLKGKWHKNDRNLWEEKFKLEDKQNNDEYLKYKKNQEDLKEKIKKFYEVVDILK
                     EWSEVKGHILQNGIYSTVNIENFLR"
     gene            complement(72559..72807)
                     /locus_tag="CDBI1_19088"
                     /db_xref="GeneID:12212963"
     CDS             complement(72559..72807)
                     /locus_tag="CDBI1_19088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196963.1"
                     /db_xref="GI:384359108"
                     /db_xref="GeneID:12212963"
                     /translation="MNNFIKYHEVYKEKEIELEKIKSKLVYICTNLDYNEVVKIVSRL
                     NYNDALTIFVLLREYGANPNLLKKVFEIIYLKKSTMRI"
     gene            complement(72840..73031)
                     /locus_tag="CDBI1_19093"
                     /db_xref="GeneID:12212964"
     CDS             complement(72840..73031)
                     /locus_tag="CDBI1_19093"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196964.1"
                     /db_xref="GI:384359109"
                     /db_xref="GeneID:12212964"
                     /translation="MNENKFNFFIENAKEDMFYSLKEKCNDRKEYKDMFGKRKEACTI
                     YNGKFKKKCNINNCKLFEK"
     gene            complement(73051..73266)
                     /locus_tag="CDBI1_19098"
                     /db_xref="GeneID:12212965"
     CDS             complement(73051..73266)
                     /locus_tag="CDBI1_19098"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196965.1"
                     /db_xref="GI:384359110"
                     /db_xref="GeneID:12212965"
                     /translation="MNKIQKDKVDKYKNILKRLDNAEAYYNQLDDSKFKDIEKSSAYI
                     TLCNLIKEAGELYIELKEENIMVSRWN"
     gene            complement(73263..73523)
                     /locus_tag="CDBI1_19103"
                     /db_xref="GeneID:12212966"
     CDS             complement(73263..73523)
                     /locus_tag="CDBI1_19103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196966.1"
                     /db_xref="GI:384359111"
                     /db_xref="GeneID:12212966"
                     /translation="MYMKYKRNSNVVIQNIIVMGIYIIIFTFIIVSFFTLCLYLLLQL
                     SNHLKFMDIVIYFIDFASILFTIIINIFIIHSFFKNEGGGRK"
     gene            complement(73636..74775)
                     /gene="clpX"
                     /locus_tag="CDBI1_19108"
                     /db_xref="GeneID:12212967"
     CDS             complement(73636..74775)
                     /gene="clpX"
                     /locus_tag="CDBI1_19108"
                     /note="'COG1219 ATP-dependent protease Clp, ATPase
                     subunit'"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATP-binding subunit ClpX"
                     /protein_id="YP_006196967.1"
                     /db_xref="GI:384359112"
                     /db_xref="GeneID:12212967"
                     /translation="MKKMCNWCGNRKDENEMEETKSGDYICLNCKGKIEKKEDVIENL
                     RKNIKKPIDIIKYMDKFIIGQDKAKKMIATTIYNHYLSIINKVDVEKNNILLTGASGT
                     GKTLIAKTLANFLDVPFVVADANTLTEAGYIGKDVESIIASLYNKANKNLNKTKYGIV
                     FLDEIDKLAKNNTTYKNQVGKEGVQQALLKLIEGTICKIQDDITKDYVEIDTTNILFI
                     CGGAFVGIEDIIKERLHKKTIGFKSSLSLEETSLTKDEIRKNINIDDLYNFGMIPEFL
                     GRFPVICNLETLDIEKVKLILKSEEGLIGDYNKLFELQDKELEFTEEALSLIANLAIE
                     ENVLMLGARGLKTFLSPFMTELMFCASNDNEQKYLITEERVKNFF"
     misc_feature    complement(73645..74763)
                     /gene="clpX"
                     /locus_tag="CDBI1_19108"
                     /note="ATP-dependent protease ATP-binding subunit ClpX;
                     Provisional; Region: clpX; PRK05342"
                     /db_xref="CDD:235422"
     misc_feature    complement(74053..74589)
                     /gene="clpX"
                     /locus_tag="CDBI1_19108"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(74461..74484)
                     /gene="clpX"
                     /locus_tag="CDBI1_19108"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(74116..74118,74287..74289,74458..74481))
                     /gene="clpX"
                     /locus_tag="CDBI1_19108"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(74284..74301)
                     /gene="clpX"
                     /locus_tag="CDBI1_19108"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(74074..74076)
                     /gene="clpX"
                     /locus_tag="CDBI1_19108"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(73657..73866)
                     /gene="clpX"
                     /locus_tag="CDBI1_19108"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            complement(74927..75523)
                     /locus_tag="CDBI1_19113"
                     /db_xref="GeneID:12212968"
     CDS             complement(74927..75523)
                     /locus_tag="CDBI1_19113"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196968.1"
                     /db_xref="GI:384359113"
                     /db_xref="GeneID:12212968"
                     /translation="MEFILLNLIPLQSLFIIRAISSFGIGVLNVLYGFSISILSRDFS
                     VIFVMLLLYLLVSFSIFQLSKKADLKYAWLSFIPILQSVNFYKLGGISIPYIVVVSCL
                     SIIPSIGIFINLYMTTYILIKISKNIIKRDGEALLKHNDAVVIEICVSVLLIIFTLLS
                     LFLTGKAIILLEYTLQFLSFYFLVYISVIAFSKNLKIE"
     gene            complement(75659..75904)
                     /locus_tag="CDBI1_19118"
                     /db_xref="GeneID:12212969"
     CDS             complement(75659..75904)
                     /locus_tag="CDBI1_19118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196969.1"
                     /db_xref="GI:384359114"
                     /db_xref="GeneID:12212969"
                     /translation="MKITNKTKKEINCGNYYNTKEALELLEIGYNSFNKLMEENLVDV
                     YAITLNNKDRYAYYFHEEDLYTVKFMLIMNGFYKKVD"
     gene            complement(75935..78460)
                     /locus_tag="CDBI1_19123"
                     /db_xref="GeneID:12212970"
     CDS             complement(75935..78460)
                     /locus_tag="CDBI1_19123"
                     /note="COG1203 Predicted helicases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196970.1"
                     /db_xref="GI:384359115"
                     /db_xref="GeneID:12212970"
                     /translation="MNLEKIIKSNKYIYSHKSEDEEENILLHLDRTKCVFFQIDSKYK
                     ILNKLRKTYGNLKFKLNELDFYLSEEAINLIENMFLYSVYLHDIGKINPKYQSEKMKN
                     NFEFLSEEEKSTLCLNKIVSTNHSYLSSIVYIDLMQEKIDESKNISTKEKIVLYYLML
                     VNANIISRHHSNQSNLEYYFAKLEREINNAKMANYLYFYNKKLNINYEKISKAFINIK
                     KIKFDETSVYIWNKILNSLLISCDFIATHSFYSKKSISEFKINCIEGKENIKDIFYKN
                     PIYKGIESYKLNNRYFEENNLPKINELRSDILIESNNNLDKNNNERIFNIESPTGSGK
                     TINSLSCALKLIKDGSKLFYVFPVNTLAEQTEDVLNGIFKGKLNTQIINSISPLPIKS
                     TDKKIDYNKVLLDRQILNYESILTSNITLFNLFFGCGREQSMGLFSLFDSVIILDEIQ
                     NYKNLIWKEIVEFLYKFSEIMDFKLIIMSATLPNLEELMDFEDKKFINLIENPKIYYN
                     NKLFKDRVSIENKLLNETVDFKKLLDLIKEEVNIWNKEKKEYAKFLIEFITKKTAQEF
                     YMYVSKKLNNYTVFELDGDDNKIKKQSIINHLKKDSKELKSNILLITTQVIEAGVDID
                     MDLGAKDTSFPDLDEQFIGRINRSCLKEGCKAFLFNLDMANIVYKNDYRLVMNIDKNK
                     DNYLKCLSNKDFSCLYDKVFNKINLTKGNWLCSEIDVFYKDLKMIRNKDISKHMKLID
                     INSFEIFIPTIIDGVDGEEVWSEYVELVSNIDMEYAERKVKMINLKEKLEMFTFSIKS
                     NKSNKLNAFGGFYYIKNGNKFIANDKFDSSRFKKEYMCLLNAQ"
     misc_feature    complement(77705..78256)
                     /locus_tag="CDBI1_19123"
                     /note="CRISPR/Cas system-associated protein Cas3'';
                     Region: Cas3''_I; cd09641"
                     /db_xref="CDD:193608"
     misc_feature    complement(76448..77494)
                     /locus_tag="CDBI1_19123"
                     /note="CRISPR/Cas system-associated protein Cas3; Region:
                     Cas3_I; cd09639"
                     /db_xref="CDD:187770"
     misc_feature    complement(76502..77494)
                     /locus_tag="CDBI1_19123"
                     /note="CRISPR-associated helicase Cas3; Region: cas3_core;
                     TIGR01587"
                     /db_xref="CDD:233483"
     gene            78891..79298
                     /locus_tag="CDBI1_19128"
                     /db_xref="GeneID:12212971"
     CDS             78891..79298
                     /locus_tag="CDBI1_19128"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196971.1"
                     /db_xref="GI:384359116"
                     /db_xref="GeneID:12212971"
                     /translation="MYLDEFYEVKNVLLKEHLEDVGQEDIEPLSQVFKVCLTHHANKR
                     MIERYIDWNEVENLLKSKSNKILDTSIGEEFIVLNDNKELAIVCVLEKIEKKYSIVIK
                     TVIKKMIYIFNSKTKEIKTEHLEVKFSKENSTY"
     gene            complement(79348..80100)
                     /locus_tag="CDBI1_19133"
                     /db_xref="GeneID:12212972"
     CDS             complement(79348..80100)
                     /locus_tag="CDBI1_19133"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas5, hmari subtype"
                     /protein_id="YP_006196972.1"
                     /db_xref="GI:384359117"
                     /db_xref="GeneID:12212972"
                     /translation="MDEVLKFNLKGKGASFSKPTYNSSSIIQTYPHIHKVALLGILGA
                     IIGIDNTGYKRKKELPKFYKLLKDLKIAIAPKKLNFNKCVDVVTDTSGFSNKISPNVG
                     STYLINYEILINPSWDIYILGDGEYYNKIKKYILNRSAVFHPFLGRNHLFADLSEVEI
                     LNGEFSKELSKIDSFFISDNVVLDEDEILLNEKLYLFKDSMPISIDNRKIDGTDFMLN
                     QYSIKSLTFSNIDVLKSEEDLFYCGDKVLYFI"
     misc_feature    complement(79351..80094)
                     /locus_tag="CDBI1_19133"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas5; Region: Cas5_I-B; cl18994"
                     /db_xref="CDD:267347"
     gene            complement(80103..81059)
                     /locus_tag="CDBI1_19138"
                     /db_xref="GeneID:12212973"
     CDS             complement(80103..81059)
                     /locus_tag="CDBI1_19138"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196973.1"
                     /db_xref="GI:384359118"
                     /db_xref="GeneID:12212973"
                     /translation="MIGIGLNNANINADMTGNPVRHGDEFTASPFSIKYLFRNYWDTK
                     GIDVFYMRSYVVDKKNKGLVPRSLEKRLEQKVENFNKLSEIEIQRELFKYIDVSCFGG
                     VFAVKGFNRNYYGTIQFGTGINKYEDSEVVRERMLSPFQNPKGKINKETNEEIENRQT
                     TLGSRAYLTEGHYFYDFIINPLVNKSIMELDTELECFNENNYNLFKEASLNCANSLNS
                     VSKKGCYNEFAIFIKLKEDSVAYLGNISNKVSFYKDEKRNVIDISLLAQDLLSIDEDI
                     EDIEIYYNPTDTILKFPIDSLKNRTSINNILSTIKIDFMEKN"
     misc_feature    complement(80202..81038)
                     /locus_tag="CDBI1_19138"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas7; Region: Cas7_I-C; cl01465"
                     /db_xref="CDD:260950"
     gene            complement(81239..82918)
                     /locus_tag="CDBI1_19143"
                     /db_xref="GeneID:12212974"
     CDS             complement(81239..82918)
                     /locus_tag="CDBI1_19143"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196974.1"
                     /db_xref="GI:384359119"
                     /db_xref="GeneID:12212974"
                     /translation="MQEIINRLKKLKEAYGDDILIKHSIVPKGCYYKIKKDGSIASFI
                     NDNEKNFQLNEEYIFFKQRIFYERMINANKCLNQEKGLGKKIHSVTPYALIFKIETFN
                     NVLFRDFLYSHFKKMKEVYNNSLNIEETIKHFEECFNIIEKDCRYFNSKTPDKIFIFL
                     DEDLELYKDAYNSYASKKCFISEDTKVVIDGQIYGIPCFSINLNKGKPTLSNNPYNDF
                     LFRLTLEDSMLLLSLLKLKNSSINELLNNNKIFNELELELDIGNNANDKSNEIVSVEM
                     KADYSNKCLDFEESIILQSMFSNENIINLNIDRKNLLKKIDEVLKIKNGVNNMTLEKA
                     LSLKKDNYNDFINRLGNLNLAQSIISNKDLLMYYFIEDKDISINKEIEKIVFYMYLEG
                     IKNEKDLNKSSLIRIRQKIDFMISILMTFYKEGGYKEMPSNLNKIWNKLISAKKGKEY
                     EYEIESDEEFFFVSAQLLYWINTTGSFSSKTNDYIQNILSLRDSNQLKEKMIDGYETY
                     LYNIPLGNNFANRLYSKLLLYKESQNIKIKGIYKYYFHSGLFGENINYTKC"
     gene            complement(82992..83678)
                     /locus_tag="CDBI1_19148"
                     /db_xref="GeneID:12212975"
     CDS             complement(82992..83678)
                     /locus_tag="CDBI1_19148"
                     /note="COG1583 Uncharacterized protein predicted to be
                     involved in DNA repair (RAMP superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas6"
                     /protein_id="YP_006196975.1"
                     /db_xref="GI:384359120"
                     /db_xref="GeneID:12212975"
                     /translation="MRYLEIELFLKLEKEVLYVDLPEYLSKGINYQFLSSEESKQYHH
                     KNRIKLYNYSFLTPIEEDKVYKKDKAYTLKIRFMDLNIANIFFNSLGTIMSPYFTILG
                     KRYDFKENNKEIRYLTTITPAIIKIRNNITLDMNSMDLNLVKERILRNTCKKYNMLNY
                     DNIKPHDFIDNIELLNNSSIGFNYKDALVIGNKYKIKIKPDKLSQEMAFVILGAGLLE
                     KNSLAFGFCV"
     misc_feature    complement(82998..83537)
                     /locus_tag="CDBI1_19148"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas6; Region: Cas6-I-III; cl11443"
                     /db_xref="CDD:264371"
     gene            complement(83781..84242)
                     /locus_tag="CDBI1_19153"
                     /db_xref="GeneID:12212976"
     CDS             complement(83781..84242)
                     /locus_tag="CDBI1_19153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196976.1"
                     /db_xref="GI:384359121"
                     /db_xref="GeneID:12212976"
                     /translation="MAKNKMINLFHPDEVFGDIAIEANSIYDNPFKIVSKNVYMLKRK
                     LADDKVLCVNIGKQKKECKNLIDMIFLTQNNKKVKIYDNKFNTGEFDILFKKDGYSIG
                     DIYIIKTQENNRENYKVILVTDLYVLFFNSNNKLILYSFDELNNINIIKIN"
     gene            complement(84333..84593)
                     /locus_tag="CDBI1_19158"
                     /db_xref="GeneID:12212977"
     CDS             complement(84333..84593)
                     /locus_tag="CDBI1_19158"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196977.1"
                     /db_xref="GI:384359122"
                     /db_xref="GeneID:12212977"
                     /translation="MPKNYFEDRSNFTKYPGFVNAGDRVLIIKKEDQGAKTKDVLVEG
                     IVLRVLSKGKYYSNGVKVEVTPVDNAESGETVIGRIQYFVQN"
     misc_feature    complement(84351..84539)
                     /locus_tag="CDBI1_19158"
                     /note="Uncharacterized conserved protein (DUF2196);
                     Region: DUF2196; cl02044"
                     /db_xref="CDD:261160"
     gene            complement(84702..85037)
                     /locus_tag="CDBI1_19163"
                     /db_xref="GeneID:12212978"
     CDS             complement(84702..85037)
                     /locus_tag="CDBI1_19163"
                     /note="'COG0045 Succinyl-CoA synthetase, beta subunit'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196978.1"
                     /db_xref="GI:384359123"
                     /db_xref="GeneID:12212978"
                     /translation="MKCLIVKEKWADLILSGEKTLELRSRNTNVRGTIGIIKSGTGLI
                     CGTVDILSSYEITDEEYIELKNKHKVPYSREQIKYKKIFAWELHNPVKYKDCIKYKHK
                     KGCVVWINI"
     misc_feature    complement(84759..85037)
                     /locus_tag="CDBI1_19163"
                     /note="ASC-1 homology domain, ASC-1-like subfamily. The
                     ASCH domain, a small beta-barrel domain found in all three
                     kingdoms of life, resembles the RNA-binding PUA domain and
                     may also interact with RNA. ASCH has been proposed to
                     function as an RNA-binding domain...; Region:
                     ASCH_ASC-1_like; cd06554"
                     /db_xref="CDD:119346"
     gene            complement(85275..85865)
                     /locus_tag="CDBI1_19168"
                     /db_xref="GeneID:12212979"
     CDS             complement(85275..85865)
                     /locus_tag="CDBI1_19168"
                     /note="'COG1989 Type II secretory pathway, prepilin signal
                     peptidase PulO and related peptidases'"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase A24A domain-containing protein"
                     /protein_id="YP_006196979.1"
                     /db_xref="GI:384359124"
                     /db_xref="GeneID:12212979"
                     /translation="MLFFIGVVFLLFFKVSFDELKKYNYSFKVVFILSILLVYSFIRV
                     ADFKIDAILYSCIIPVLVSISYIDLKVKEIPDKLIFIIYIYGLFLIVVNKNYINHNIF
                     ILNNLCSSFSLFSIYLVIAIITNGVGGGDIKLMGALGLFFNTSSIFKLLVYPVFLGVI
                     MSVFLIVLKKAKLKDNFPLGPAISISACLIFLINYI"
     misc_feature    complement(85278..>85787)
                     /locus_tag="CDBI1_19168"
                     /note="Type II secretory pathway, prepilin signal
                     peptidase PulO and related peptidases [Cell motility and
                     secretion / Posttranslational modification, protein
                     turnover, chaperones / Intracellular trafficking and
                     secretion]; Region: PulO; COG1989"
                     /db_xref="CDD:224900"
     misc_feature    complement(85377..85697)
                     /locus_tag="CDBI1_19168"
                     /note="Type IV leader peptidase family; Region:
                     Peptidase_A24; pfam01478"
                     /db_xref="CDD:250649"
     gene            86097..86606
                     /locus_tag="CDBI1_19173"
                     /db_xref="GeneID:12212980"
     CDS             86097..86606
                     /locus_tag="CDBI1_19173"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196980.1"
                     /db_xref="GI:384359125"
                     /db_xref="GeneID:12212980"
                     /translation="MSKNIYEIMNEIKSLRTDFINRKSSLSKELGVLSKRINQIEKMI
                     EFNKDKLNNERKAELIDELYILFVKKRKVKREFNVAIRVDEDNKFSYNMLGFTLKGYD
                     DLLEKLKMVEKNRLMDISQYGVYEIDVANYTHEDIENKIKYLKPKYDMVFYSEDELVI
                     YYYNRCVPI"
     misc_feature    86391..>86552
                     /locus_tag="CDBI1_19173"
                     /note="ribonucleotide-diphosphate reductase subunit alpha;
                     Validated; Region: PRK07088"
                     /db_xref="CDD:180831"
     gene            86966..87790
                     /locus_tag="CDBI1_19178"
                     /db_xref="GeneID:12212981"
     CDS             86966..87790
                     /locus_tag="CDBI1_19178"
                     /note="COG0675 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="IS605 family transposase OrfB"
                     /protein_id="YP_006196981.1"
                     /db_xref="GI:384359126"
                     /db_xref="GeneID:12212981"
                     /translation="MKRAYKIEINPTTEQISKIHQTIGVSRFIYNFYIAHNKEIYERE
                     GKFISGIDFSKWLNNEYIPNNQDMKWIKDVSSKATKQAIMNGDKAFKDFFKKTKGFPK
                     FKKKKNQDVKAYFPKNNKTDWTIERHRVKIPTLGLVKLKELGYIPINSIVKSGTVSQK
                     SNRYYVSILVEEDDIQVSKCTNKGIGIDLGIKDFAICSNGSKFKNINKTSTIKKVEKK
                     LKREQRKLSRKYEGLKLRNKNIKEGVATRQNIQKQIAKVQKIHQRLVNVDYLLIEI"
     misc_feature    86966..>87760
                     /locus_tag="CDBI1_19178"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    86966..87103
                     /locus_tag="CDBI1_19178"
                     /note="Helix-turn-helix domain; Region: HTH_OrfB_IS605;
                     pfam12323"
                     /db_xref="CDD:256981"
     misc_feature    87173..87763
                     /locus_tag="CDBI1_19178"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     gene            87983..89044
                     /locus_tag="CDBI1_19183"
                     /db_xref="GeneID:12212982"
     CDS             87983..89044
                     /locus_tag="CDBI1_19183"
                     /note="COG4193 Beta- N-acetylglucosaminidase"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein"
                     /protein_id="YP_006196982.1"
                     /db_xref="GI:384359127"
                     /db_xref="GeneID:12212982"
                     /translation="MDIFDHILSSRLISILKYKIVLFILTFSVLFSCIERNAFAVTPN
                     LDYEQQRIKLNKDITSSENKLSEIDNTIKNIKNSIKTNTGNLNIVKSKYKVKKDINTY
                     KFKNLSKDNLDILELVLKSNSLSELMNNLDIMTKLFVVNNKSLNDLNEKEKQLIELQE
                     LNLTKLEKANKDKKNEEEKLKSLKTELLKLKEIIERKPNEKISFNPENLLEKSNVSIE
                     DLYKALEGTALYELAPIYVEAENTYGVNAIFLASLTAQESAWGTSQRAINDNNLTGFG
                     VYSPSSNGINSNTKRDNILRTAKTLREKYLTVGGVYYNGLSIHGVNTMYCMLPFGGPD
                     YNWSSSITKIGNLLIDKMQ"
     misc_feature    88028..>88564
                     /locus_tag="CDBI1_19183"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3883"
                     /db_xref="CDD:226400"
     misc_feature    88676..>88813
                     /locus_tag="CDBI1_19183"
                     /note="Mannosyl-glycoprotein
                     endo-beta-N-acetylglucosaminidase; Region:
                     Glucosaminidase; cl17361"
                     /db_xref="CDD:266650"
     gene            89400..89690
                     /locus_tag="CDBI1_19188"
                     /db_xref="GeneID:12212983"
     CDS             89400..89690
                     /locus_tag="CDBI1_19188"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196983.1"
                     /db_xref="GI:384359128"
                     /db_xref="GeneID:12212983"
                     /translation="MFLKEIINNVNFLKGNAEATISSNVLEFIISALFIIVVISLLLR
                     LISFIISILKIAFYFINKNVKILIKKVKANNFNNIGLNQESSNVIYFNNYKK"
     gene            complement(89734..91854)
                     /locus_tag="CDBI1_19193"
                     /db_xref="GeneID:12212984"
     CDS             complement(89734..91854)
                     /locus_tag="CDBI1_19193"
                     /note="'COG0209 Ribonucleotide reductase, alpha subunit'"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-triphosphate reductase,
                     adenosylcobalamin-dependent"
                     /protein_id="YP_006196984.1"
                     /db_xref="GI:384359129"
                     /db_xref="GeneID:12212984"
                     /translation="MNNFISDSFLSLYKGKEDLMGVLGKFVYLRTYSRYLNDLKRREL
                     WYETCKRVVEYNVGLEERFLLKHNKTISFNELKEEAEFFYDNLFNLKTFPSGRTLYMG
                     GTEIVDKYPLSNYNCGFMSLNSFESFEDLFYLLMVGCGIGLRITKEEVNKLPNIKEVE
                     VEHIHNPNFRKKELKERYLNFLNGKNEKNPYDEIENTVIDIIDIDTIELKVGDSKEGW
                     VDALRYYFKIISEDTYKDIRKIIINYSYVRDAGEPLKRFGGRASGHESLLVMFKKINN
                     ITLGIKKLSTINCLDIATIISENVVCGGVRRSSLIILCDPDDIDLINAKKDIYSIDKN
                     GNFLIDESVGHRRMSNNSILFQSKPSINKIKEVMESIKNNGEPGFLNGENALKRKSDF
                     EGCNPCGEILLKSKSCCNLTTTNLVNFISNDKLDIDALKSVLRLSVRIALRMTLIDAE
                     LKEWDKVMKSDRVIGVSLTGIMDMFNLTNMTYRELGEILNTLRAVVHDEGERYSKVLG
                     IEAPNLMTTIKPEGSISTLPEVSSGIHFSHAPFFIRRVRISSSDPLYKAIEKDNSFPI
                     FDEIGSPNIKVIEIPVKSYAGKTKYNVSALEQLELYKLTMENWTDHNTSITVHVREEE
                     WDSVSKWVYENFNSIVGITFLPLTEETYPLMPFEKISEEEYYRRLKDIKPINKDYLRL
                     LESDSFEEQEIYENTCTSGACPIR"
     misc_feature    complement(89737..91794)
                     /locus_tag="CDBI1_19193"
                     /note="ribonucleoside-triphosphate reductase,
                     adenosylcobalamin-dependent; Region: RTPR; TIGR02505"
                     /db_xref="CDD:233901"
     misc_feature    complement(89740..91785)
                     /locus_tag="CDBI1_19193"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:245211"
     gene            complement(91993..92577)
                     /locus_tag="CDBI1_19198"
                     /db_xref="GeneID:12212985"
     CDS             complement(91993..92577)
                     /locus_tag="CDBI1_19198"
                     /note="COG1012 NAD-dependent aldehyde dehydrogenases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196985.1"
                     /db_xref="GI:384359130"
                     /db_xref="GeneID:12212985"
                     /translation="MIFEESKEFLVSRITDIMGKLQDDKLEKEDLEGYDSCEDIITNI
                     SLLGRYRDLIERGYQDHYKLNNERILKYPCVYKHFKGNFYATIGLSKPIDEKSLIELL
                     LGDPATEGRSYLLYNCSFISKHTESGKNIYMHKDEMGNLYHAKEQVDCELVIYKSLEY
                     DKNEVYARPLEMFLSHVDRLKYPECQEWRFEEIK"
     misc_feature    complement(91999..92361)
                     /locus_tag="CDBI1_19198"
                     /note="Protein of unknown function (DUF1653); Region:
                     DUF1653; cl01949"
                     /db_xref="CDD:261125"
     gene            complement(92606..92806)
                     /locus_tag="CDBI1_19203"
                     /db_xref="GeneID:12212986"
     CDS             complement(92606..92806)
                     /locus_tag="CDBI1_19203"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196986.1"
                     /db_xref="GI:384359131"
                     /db_xref="GeneID:12212986"
                     /translation="MASSYPDLINECKYLGCYLNEKMYIEGRSKKGKQRLSEKELWET
                     LEEIRKELFELYNEGAQELGWR"
     misc_feature    complement(<92645..92716)
                     /locus_tag="CDBI1_19203"
                     /note="signal recognition particle protein; Provisional;
                     Region: PRK10867"
                     /db_xref="CDD:236780"
     gene            93004..93447
                     /locus_tag="CDBI1_19208"
                     /db_xref="GeneID:12212987"
     CDS             93004..93447
                     /locus_tag="CDBI1_19208"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196987.1"
                     /db_xref="GI:384359132"
                     /db_xref="GeneID:12212987"
                     /translation="MLDFFYRNINTLNIILSTALYLLNGYGLYMLSLRANIKRPWLAF
                     VPILNILPLIKLARVPNCVFFICILLMAINIFFISVPLLLISTIISLSLSLYVMYKFL
                     LNYNCSNIELVLLMLFASLTFDSGFTYLYILIREYPYSPKLKEDN"
     gene            complement(93511..93813)
                     /locus_tag="CDBI1_19213"
                     /db_xref="GeneID:12212988"
     CDS             complement(93511..93813)
                     /locus_tag="CDBI1_19213"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196988.1"
                     /db_xref="GI:384359133"
                     /db_xref="GeneID:12212988"
                     /translation="MKVLDEFQMKENISLIAKVWDLFKNDLLGLVKSTDEDISTKTMT
                     EMIKSIKERLELTTEEIKVIDKWTICFIEGCKKYDAKIIKIMDMTIKKIEEDFHNN"
     gene            complement(93835..94377)
                     /locus_tag="CDBI1_19218"
                     /db_xref="GeneID:12212989"
     CDS             complement(93835..94377)
                     /locus_tag="CDBI1_19218"
                     /note="'COG0188 Type IIA topoisomerase (DNA gyrase/topo
                     II, topoisomerase IV), A subunit'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196989.1"
                     /db_xref="GI:384359134"
                     /db_xref="GeneID:12212989"
                     /translation="MGLNIFNIWESIGKKTPFAVKRTNWSNKNIYVIVDKIEPDGNGY
                     GKAYGTPTENGEFCSYWQTDKKWKESRLIPNSGVYSWEYIKDVPLEINRENVIKKTVE
                     ANKIKKPVSGVYDIDTNIDFGKYRGLEISILINLNPNYLIWAIKNVSKFKLSYNAINV
                     LCKKIEVKDEVVQINNKKGE"
     gene            complement(94547..95110)
                     /locus_tag="CDBI1_19223"
                     /db_xref="GeneID:12212990"
     CDS             complement(94547..95110)
                     /locus_tag="CDBI1_19223"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196990.1"
                     /db_xref="GI:384359135"
                     /db_xref="GeneID:12212990"
                     /translation="MTQYEFDLAMVKEDGVYIMNVQKQSYEMCIEAVRNNKEAILYIR
                     WDELNLTKEQKNNIYLEVIEDKRQASEYINELTGELYFNAVKQDGGVLLLVYIMNVQK
                     QNYEMCLEAVKNSKEAILYIRWDELNLTKEQKNNIYLEAVRNDGLSLEYIEEQTEEIC
                     IEAIRQANQAILFVKNMTKNIYLESIA"
     misc_feature    complement(94649..94801)
                     /locus_tag="CDBI1_19223"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(95339..95698)
                     /locus_tag="CDBI1_19228"
                     /db_xref="GeneID:12212991"
     CDS             complement(95339..95698)
                     /locus_tag="CDBI1_19228"
                     /note="COG1396 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_006196991.1"
                     /db_xref="GI:384359136"
                     /db_xref="GeneID:12212991"
                     /translation="MNLTEFGKFSRKLRIEKNEILRDMSEKLNVTVSYLSAVETGKRS
                     IPKSWENIMIEKYNLKDEEQIKLKKAISDSATKIKINMKDFTTEEKKLLFCLLKNYKK
                     LNIEDKIKIKEILLKEK"
     misc_feature    complement(<95564..95668)
                     /locus_tag="CDBI1_19228"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(95579..95581,95654..95656,95666..95668))
                     /locus_tag="CDBI1_19228"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(95582..95584,95657..95659))
                     /locus_tag="CDBI1_19228"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(95576..95581,95591..95593,95600..95602,
                     95633..95638))
                     /locus_tag="CDBI1_19228"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(96359..96619)
                     /locus_tag="CDBI1_19233"
                     /db_xref="GeneID:12212992"
     CDS             complement(96359..96619)
                     /locus_tag="CDBI1_19233"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196992.1"
                     /db_xref="GI:384359137"
                     /db_xref="GeneID:12212992"
                     /translation="MNKVNEIIASIKKGEIELKNLNFKELGLTQDKVDEICMVAVKEN
                     GLNLKCVENKTPEICFEAIKQNKDADMYRRENKIPNNPWINI"
     gene            complement(96713..97126)
                     /locus_tag="CDBI1_19238"
                     /db_xref="GeneID:12212993"
     CDS             complement(96713..97126)
                     /locus_tag="CDBI1_19238"
                     /note="COG0480 Translation elongation factors (GTPases)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196993.1"
                     /db_xref="GI:384359138"
                     /db_xref="GeneID:12212993"
                     /translation="MQHEINLKRVSENGLYLKEMKEQTEDICLESVRQNGVYLYFVKN
                     QTDDICREALKSNASAIYFIDSKKIDEYIEKFNIRELKATDTNKGVIAVKENGEWLFS
                     LDCQKNISKDEFIDMIYNMDNVNKQIYTDFIENLG"
     gene            97292..97543
                     /locus_tag="CDBI1_19243"
                     /db_xref="GeneID:12212994"
     CDS             97292..97543
                     /locus_tag="CDBI1_19243"
                     /note="COG0675 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196994.1"
                     /db_xref="GI:384359139"
                     /db_xref="GeneID:12212994"
                     /translation="MGCPVCNKKMIESDLFLNHVRCSSCNYEEDKEKVEMMNKIKKFI
                     AERNLSHVKLEFWNKDGYNECFLDTDIDIISEMLLKMLK"
     misc_feature    <97292..97405
                     /locus_tag="CDBI1_19243"
                     /note="putative transposase; Provisional; Region:
                     PHA02942"
                     /db_xref="CDD:165252"
     gene            complement(97749..98573)
                     /locus_tag="CDBI1_19248"
                     /db_xref="GeneID:12212995"
     CDS             complement(97749..98573)
                     /locus_tag="CDBI1_19248"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196995.1"
                     /db_xref="GI:384359140"
                     /db_xref="GeneID:12212995"
                     /translation="MKQLKLDLERVKKEPCYLKNIKQNYELCLEIIRQCGEALSFVKW
                     DELNLTKKQKHNIFVEAVKQNGLAIRYIEEQTPELCLIALKQNNKALKYIENQTEEMC
                     LREVRKDARALEYIKKHNYKLCLEAVTQWGVSLKYINWNDMSITDKQKYNLYVKAVKQ
                     EGLALLWIEEQTEELCIEAVKQRGLLLSRVKEQTEKVCLEAVKENGLALEYVKEQTPE
                     ICLEAVKENGLALRFVKNQTEIMCKEAVMENGLALLWVNNPTEELSLIALKQRVGK"
     misc_feature    complement(98352..98504)
                     /locus_tag="CDBI1_19248"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(98292..98396)
                     /locus_tag="CDBI1_19248"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(97932..98057)
                     /locus_tag="CDBI1_19248"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(97866..97991)
                     /locus_tag="CDBI1_19248"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(97800..97922)
                     /locus_tag="CDBI1_19248"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            98768..99076
                     /locus_tag="CDBI1_19253"
                     /db_xref="GeneID:12212996"
     CDS             98768..99076
                     /locus_tag="CDBI1_19253"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196996.1"
                     /db_xref="GI:384359141"
                     /db_xref="GeneID:12212996"
                     /translation="MNFNYLIFAKIGDKVIKSNKLGQMEFNFLQNFVDFFSDDNLGKE
                     EIKIRNNEFKKIEKDFFDDCKEILKCIGTLEEVRNLYDFFSKIRKTHLKENEIAFSFE
                     "
     gene            complement(99157..99837)
                     /locus_tag="CDBI1_19258"
                     /db_xref="GeneID:12212997"
     CDS             complement(99157..99837)
                     /locus_tag="CDBI1_19258"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196997.1"
                     /db_xref="GI:384359142"
                     /db_xref="GeneID:12212997"
                     /translation="MKNKNIILNKLNNKLSKEEFNELCLELVLQDEKTLNEIKLNLTK
                     EQINEIYINAVKFDRLALQFIKEKTPKICLEAVRENGLAIRCIKWDELKGKFSKEQIE
                     EICVEAVKQNGDSLMYIEDQTEEMCLMAVRQNGMSLKHVKNQSDNICLEAVRENGYAL
                     YYVEKQTPKICIEAIKNDEHALVFVEDYQIDKICLEAIRENPCVYSLVKGCKLNRNLI
                     KNYLNRDL"
     misc_feature    complement(99409..99534)
                     /locus_tag="CDBI1_19258"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(99343..99468)
                     /locus_tag="CDBI1_19258"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(100130..100612)
                     /locus_tag="CDBI1_19263"
                     /db_xref="GeneID:12212998"
     CDS             complement(100130..100612)
                     /locus_tag="CDBI1_19263"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196998.1"
                     /db_xref="GI:384359143"
                     /db_xref="GeneID:12212998"
                     /translation="MSQKESDLLRVKVDGLYLRNIVKQDHDICMEAVRENGIALFWVK
                     EQTSEICIEAIKQNGEALEYVEEQTEEMCLIAVKQNGNALRYVKEQTEEMCLIAVKQN
                     GNALKYVNKQTREICLEAIIQDFNAFNFIKWSDLEVPSNDLIGMFIKLTFKSREKEIL
                     "
     misc_feature    complement(100412..100540)
                     /locus_tag="CDBI1_19263"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(100271..100405)
                     /locus_tag="CDBI1_19263"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(100796..101341)
                     /locus_tag="CDBI1_19268"
                     /db_xref="GeneID:12212999"
     CDS             complement(100796..101341)
                     /locus_tag="CDBI1_19268"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006196999.1"
                     /db_xref="GI:384359144"
                     /db_xref="GeneID:12212999"
                     /translation="MAVMRDGVALKHVKEQTSRICIEAVRQTGSALRYVKNQTKEICL
                     IAVKENPYSIVYMKNQTPELCLIAVKQNGLALKFIIEQTDEICREALKQNKYAIRYVK
                     DKDKYEKIFDIRYLKKQKDVNEVIAIKGNGKWLFTIGCQRNITKDEFIRRIYNKGGGF
                     DLKKGINVHRKIYLDFLNRFN"
     misc_feature    complement(101105..101224)
                     /locus_tag="CDBI1_19268"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(101030..101155)
                     /locus_tag="CDBI1_19268"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(102148..104466)
                     /locus_tag="CDBI1_19273"
                     /db_xref="GeneID:12213000"
     CDS             complement(102148..104466)
                     /locus_tag="CDBI1_19273"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197000.1"
                     /db_xref="GI:384359145"
                     /db_xref="GeneID:12213000"
                     /translation="MNNKDEILRKIKKTPFFIKNVLDQTEEMCIEAVRRDSNVLEYVH
                     NQTEQICLEAIKKDGNALKYVNKKTEAICKEAVKQDGEALKFVEEQTEEICLIAVKQN
                     GLALQYVKEQTEEICLEAVKQNGRSLFWVKEQTEEICLTAIKQNKTCKHNRSVLKYIK
                     AQTEEICLEAIKDNESAFEYVKEQTEKICIEAVKQNGLLLKDVKDQTEKICIEAVKQN
                     GKALKLVKKQTEKICIEAVRQDGMVLKDVKEQTEEICVEAVKNYGWALMYVKEQTPRI
                     CIEAVRSRGLALQYVKIQTEEICLEAVKQNGLALEYVKKQTEKICLESVKQKGLMLRL
                     VEKQTPEICLEAVKENGLALIYIKEQTEEMCLIAVREKGLLLEDVKEQTEKICLEAVR
                     KNEMALKYVKEQTEEICLEAVKQNGLLLEDVKDQTEKICLEAVKQNCLSLEYVKEQTE
                     EICIEAVKQKGLMLRLVEKQTPRICLKAVKQYGLALKYVNWSELEGISLKEQLDEICL
                     EAVKNYGNAIKYVIEQTPEICFEAVKQKGLTLKYVKWDELNLTKEEIYDLYLLAVKEN
                     GFALEHVKDQTKELCSIAISNNAYALQDVIEQTEELCLIAVRKQPLSLRFVEKQTEEI
                     CLEAVRRNGMALKFVDKHTEEICIEALKQDKHSILYIDNKEKYLKMFYDDIKFLNSLE
                     QLKRDNKYKFAFSNLEFKEAKEEIQNIIAIKEDGKWLFTLCNLFYLDDGWKDMSKGGF
                     IYKIHNEDNGYDVHYRVNLYRQVYLDFLEQFE"
     misc_feature    complement(104263..104391)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(104200..104325)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(104068..104193)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(103852..103977)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(103654..103779)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(103522..103641)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(103390..103581)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(103192..103317)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(103126..103251)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(103060..103185)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(102904..103047)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(102838..102954)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(102541..102669)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(102475..102603)
                     /locus_tag="CDBI1_19273"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(104714..105730)
                     /locus_tag="CDBI1_19278"
                     /db_xref="GeneID:12213001"
     CDS             complement(104714..105730)
                     /locus_tag="CDBI1_19278"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197001.1"
                     /db_xref="GI:384359146"
                     /db_xref="GeneID:12213001"
                     /translation="MKKIDLDCIKKCPLELKYAEKQTYNMCIEAVSQNGLLLEDIRWD
                     ELNLTKEQIYNLYIIAIKQHGEALKFIEKQTEDLCLIAVKRNGRALKFVREQTEEICI
                     EAIKENELAINYVKWDEFSKEQREKISLIVVRYNGRDIRYIKEQTEKICIEAVRQNGL
                     ALEYVREQTPNICIEAVRQNEWALEYVREQTEKLCLMTVRKKRIVLFYVKKQTEEICI
                     EAVRQDGFALEHVKWDNFSKEQISKICREALKQNKHAIEYIEDKEKYLEEFDIRCLKA
                     QGKVREVLAIKEDGKWLFTIGCQEDITKEKFIHRIYSTDGGFDLEKGINIHRQIYLNF
                     LKEF"
     misc_feature    complement(105386..105505)
                     /locus_tag="CDBI1_19278"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(105164..105289)
                     /locus_tag="CDBI1_19278"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(104945..105091)
                     /locus_tag="CDBI1_19278"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            105942..106808
                     /locus_tag="CDBI1_19283"
                     /db_xref="GeneID:12213002"
     CDS             105942..106808
                     /locus_tag="CDBI1_19283"
                     /note="COG0863 DNA modification methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA modification methylase"
                     /protein_id="YP_006197002.1"
                     /db_xref="GI:384359147"
                     /db_xref="GeneID:12213002"
                     /translation="MDSIVNYKDRGSFGKNDYRGNTSGKIILDLNKIYKFSKISDYMA
                     GSFTTKDVADYLNISSNCYDLNNGFDLVEDEIKERNEFIFWHPPYWDIVKYSGNVYGT
                     QILKNDLSHIKDYYEFMRKLNFCLTKQFNTLDNGGRIAILMADVKKNKKLYSMLLDIN
                     KIGTTEQIIIKQQNNCTSDNKIYSNNNFIKISHEYVLLLRKDNPLIVPFSITKTDVFD
                     IRDSLKITWKDLVANVLESLNKKAYLNEIYSKIQGHKKCNSNKNWKEKIRQTLQENKI
                     FYRIDKGVWGLI"
     gene            complement(107018..107494)
                     /locus_tag="CDBI1_19288"
                     /db_xref="GeneID:12213003"
     CDS             complement(107018..107494)
                     /locus_tag="CDBI1_19288"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197003.1"
                     /db_xref="GI:384359148"
                     /db_xref="GeneID:12213003"
                     /translation="MKYKDGDTRVKFLFGILMLSILFVLVVYFGIKQQEVREKYRLDY
                     ILEDKVVKEIETNKIVDLEKLAKIKFSKITVYPSYSSIKDFKSFINDYNKVIPKDYFN
                     YIVFLDEKEELVKVMVLDKTYDILGDKSCKEYLNKETTFKFNKVNKNNDIAYTLYQ"
     gene            107676..108113
                     /locus_tag="CDBI1_19293"
                     /db_xref="GeneID:12213004"
     CDS             107676..108113
                     /locus_tag="CDBI1_19293"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197004.1"
                     /db_xref="GI:384359149"
                     /db_xref="GeneID:12213004"
                     /translation="MRHNQVEKEHMGQYTEFVFAVKLKRDTPKNVIEILKFLKEDTDE
                     EEYDIPELPKHDFFNCDRWSMLFLSDSAYFDGITNSILEFDNITESYFLTVRSNLKNY
                     DNEIVKFLNWIKPYIDNIGHSFLGYFKYEECDNPRLIYYDEIK"
     gene            complement(108345..109367)
                     /locus_tag="CDBI1_19298"
                     /db_xref="GeneID:12213005"
     CDS             complement(108345..109367)
                     /locus_tag="CDBI1_19298"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197005.1"
                     /db_xref="GI:384359150"
                     /db_xref="GeneID:12213005"
                     /translation="MREVNLDMIRKFPWNLRYAKEQSYEMCIEAVKQDGFLLKDVRFN
                     ELSLTKEQVYNLYLIAVRRSGEALQFIKWDEINLTKEQIYNLCIEAVKRNGYALKYVR
                     EQTEEICIEAVKQNGFALKYVEEQTEKICIEAIKQNSSALCHVENQTEEMCLIAIKKC
                     PWEFSSVKEQTEAICLEVVRKRGLSLEFVKKQTEKLCKEAVKENGLALQYVKKQTTEI
                     CIEAVMENGLALKFVDWDRFSKEQIDKICREALKQDKLAIIYIKDKEKYLKEFGIKYL
                     EAQGDARDVIAIKENGEWLFTLGCQYKITKEEFIYRIYNTGGGFNLEKGINIHRQVYL
                     DFLKGF"
     misc_feature    complement(108993..109112)
                     /locus_tag="CDBI1_19298"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(108666..108788)
                     /locus_tag="CDBI1_19298"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(109764..110246)
                     /locus_tag="CDBI1_19303"
                     /db_xref="GeneID:12213006"
     CDS             complement(109764..110246)
                     /locus_tag="CDBI1_19303"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197006.1"
                     /db_xref="GI:384359151"
                     /db_xref="GeneID:12213006"
                     /translation="MYSKNIPIHVLINIVLFGLSIYMFKIIIDDNLIESEENERRYKL
                     DYSLEDNVIKTIKSNNVVDFRKLAKVNFSKISVHSSYDTLGDFKGDIRALNSEAPKNN
                     FSYILFLDENEKVVKTMVLNEKYDISRSRSHREYLSKNATFKFNKVDKENEVTYRLEE
                     "
     gene            complement(110295..110477)
                     /locus_tag="CDBI1_19308"
                     /db_xref="GeneID:12213007"
     CDS             complement(110295..110477)
                     /locus_tag="CDBI1_19308"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197007.1"
                     /db_xref="GI:384359152"
                     /db_xref="GeneID:12213007"
                     /translation="MKKIDMDQVKDYQLCLLLAEKQSNNKRFNSMNGGFDPEKGINVH
                     RQVYLDFLRFIKIYII"
     gene            110643..110876
                     /locus_tag="CDBI1_19313"
                     /db_xref="GeneID:12213008"
     CDS             110643..110876
                     /locus_tag="CDBI1_19313"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197008.1"
                     /db_xref="GI:384359153"
                     /db_xref="GeneID:12213008"
                     /translation="MDIQTLKHRTKFKLPIYLGEEIITVIEVYEVFNLIEVKLNGEDE
                     TFVVDIITLKEESYNDKGIPLNLIKKEKNYYVK"
     gene            111118..111288
                     /locus_tag="CDBI1_19318"
                     /db_xref="GeneID:12213009"
     CDS             111118..111288
                     /locus_tag="CDBI1_19318"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197009.1"
                     /db_xref="GI:384359154"
                     /db_xref="GeneID:12213009"
                     /translation="MANIYCENYDCKNYFEDMCMLQRIEINNLKVCESYVEGENELYQ
                     LEMSLEKTTEQE"
     gene            complement(111492..112439)
                     /locus_tag="CDBI1_19323"
                     /db_xref="GeneID:12213010"
     CDS             complement(111492..112439)
                     /locus_tag="CDBI1_19323"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197010.1"
                     /db_xref="GI:384359155"
                     /db_xref="GeneID:12213010"
                     /translation="MKEVSLDEIKRFPWRIKNAKKQTYEMCIEAVERYGCLFEYVKLE
                     ELNLTKEKIYNLCLIAVREDGTALEYVKWNELEGELSNDQIYKICKEAVKKNGLALQY
                     VKKQTPELCLIAVRQNGHALEFVEEQYDEICREALKQNELAIKYVKKQTEEICIEAVK
                     ENGLALQYVEKQTSKICIEAVKENGYALKYVEKQTSKICLEAVRKNGLVLKYVEDQTE
                     EICIEALKQNKLAIIYIKDKNKYLEELNIKYLEAQGEAREVIAVKEYGEWLFTVGCQE
                     DITKEEFIHRIYNTNGGFDLENGINVHRQIYLDFLEQFK"
     misc_feature    complement(112059..112178)
                     /locus_tag="CDBI1_19323"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(111927..112049)
                     /locus_tag="CDBI1_19323"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(111861..111986)
                     /locus_tag="CDBI1_19323"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(111726..111848)
                     /locus_tag="CDBI1_19323"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(112814..113497)
                     /locus_tag="CDBI1_19328"
                     /db_xref="GeneID:12213011"
     CDS             complement(112814..113497)
                     /locus_tag="CDBI1_19328"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197011.1"
                     /db_xref="GI:384359156"
                     /db_xref="GeneID:12213011"
                     /translation="MYRHDKTKPKKFKEISLTKEQVENICAEYVRKTRGDLEYIEKYP
                     ESIYLEMVKLNCHLLRDIEYQTEKICLEAVKQNRYALDYVKKQTPKICMEAVRQEGLF
                     LCCVKEQTPELCIEAVKQTGLALMYVRWNQLEGEFLRYWTEEICIEAVKQDREALKYV
                     KNQTEHICLEAVRKDGLAIQFVENQTKEICTEALKQNKKAIKYIKDKEKYLNKSRVKN
                     LFDWIKDKK"
     misc_feature    complement(113012..113164)
                     /locus_tag="CDBI1_19328"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(112877..112999)
                     /locus_tag="CDBI1_19328"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            114946..115314
                     /locus_tag="CDBI1_19333"
                     /db_xref="GeneID:12213012"
     CDS             114946..115314
                     /locus_tag="CDBI1_19333"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197012.1"
                     /db_xref="GI:384359157"
                     /db_xref="GeneID:12213012"
                     /translation="MINVQYSIFCYYPSVESKDSIALGILFYDKTNNICEFKTIKKLH
                     KLKSFNDELDIDIVKLQLEAIKEEIQESVLRGNFDIKDYTKFYINELKFTEVVSIEIK
                     EEFQNFIDSCTKQYMPVIFD"
     misc_feature    114961..>115155
                     /locus_tag="CDBI1_19333"
                     /note="Protein of unknown function (DUF3037); Region:
                     DUF3037; pfam11236"
                     /db_xref="CDD:151678"
     gene            complement(117186..120287)
                     /locus_tag="CDBI1_19338"
                     /db_xref="GeneID:12213013"
     CDS             complement(117186..120287)
                     /locus_tag="CDBI1_19338"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197013.1"
                     /db_xref="GI:384359158"
                     /db_xref="GeneID:12213013"
                     /translation="MNRKKLTLPVLALLGLLTAFNINSLKSSAWGGDDGGGGDTVIKN
                     SRITWDMKTVDATGRPQSGTFHKNQIMSKNPLFGDVDGAYVGGGGRTYVKDGGKVRSA
                     IKSGYGFDLLYYEQYADKDGKVYKSPDADGAKENFYTKMDSTLTSGYRNRYWNLNWKG
                     SQTNFSKVNVEPNYQGRKKYQMSTNDNVTNNYDARFDKDGEWRYLGYNLRGEPLTNPF
                     FSCDGSGTETHMSDFGILWQGEGCKKFGDWLEYNSVSYRERKRDAIERLLKKDPQFKN
                     GTLIQVANNNKQSKKVSGGNISADVWMDSLSLLTDPQKETPIFRVYRVKTKNWNDKTF
                     KGKSSLNAYTIVAPINVKQSQDVTISDIKLIDKSGAVLKQFKRDDSGNTSTVGKGTVT
                     PGEKYKVEYTIKNNGDVATKTMPNTIDVGTATDNNATKNDYTQKYPNNNTKGTLSGGG
                     FIEAGKTVTLTKEVTVPADTKTAFRVTGYIGDVYNKTDNKDQTNDWGHVVASVEGKEE
                     EQPGDLKVNNIKMIDKNGKEALYMKPGEEYKIRYIVDYHGPSKEFWQTRTDSEGNTTR
                     YRVKKAFKFNWTAKRYLPQGGSELYKNNKTLNLYGVDKGESWTFETPYFVWEVPRAEA
                     TIAVNAPVSVDLNKGNNTAQKKWFYNYDVKVSNVKVFNDKERPIQDSFITLGVKYDVD
                     VIAPSQTPIFETDIKTHITLPNGQILQFIDHVKKGSNKDIAREIKVPITAITSGSKKL
                     NVNVYANADKHFWENDLNTQANNKGSNYSTQLPPVNPVASGGCSIFNTENNWNVAHKT
                     LNYNGKYIKYKKFDSSREYDFYRYTNGTSKTENESYYEEYNIKSVKFKSKYTTDKGFG
                     WVDLTKVADRKKAKIKAGYGYELDITVEYNTNALTAQPKAWDTRNTSTSKGLSVTNQN
                     MPPNIYKDIYVKTADGKTLSATGIYGSQKVFDVTVVSTNADKTVLRYKMQKKSKNGVE
                     EPIKIYTGTNTKDGFYSLDVWTPELTGVGSTKSKDKLCDEKNLEFEVKGSMWDDTNDH
                     IVQ"
     gene            complement(120684..121265)
                     /locus_tag="CDBI1_19343"
                     /db_xref="GeneID:12213014"
     CDS             complement(120684..121265)
                     /locus_tag="CDBI1_19343"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197014.1"
                     /db_xref="GI:384359159"
                     /db_xref="GeneID:12213014"
                     /translation="MNKTDLEWIKKYPWGLAHMQKQSYKMCIEAVRRQGGLLKDVRWY
                     ELNLTKKKIYNLCLIAVSQDGLALRFVKWNELKGKFSKEQLDKICIEAIKQNKYAIRY
                     IKDKEKYENIFNFKYLKKQGKAKEVMAIKEDGRWRFTIGWQDNITKETFIYKFYKETF
                     IDMIYTKGGGFDPKKGINVHRQIYLNFLKEFEQ"
     misc_feature    complement(120948..121100)
                     /locus_tag="CDBI1_19343"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(121784..122584)
                     /locus_tag="CDBI1_19348"
                     /db_xref="GeneID:12213015"
     CDS             complement(121784..122584)
                     /locus_tag="CDBI1_19348"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197015.1"
                     /db_xref="GI:384359160"
                     /db_xref="GeneID:12213015"
                     /translation="MGKIELGWAIKDVWDLKFEKTQTYKMCIDAVSQYGCLLKHVRWS
                     ELNLNKEQMYNLCLIAVKQDGKALKYVKLDGLSKEQIDKLCLEAVKQNSSAIQFVENQ
                     TEEMCLIAVKNWGWNLYYVKNQLDKICLEAVRQNGSSLQYMNKQTPKICLEAVKQNGY
                     ALQYVKDQTPEICIEALKQDKHLIEYVIDKEEYEELFNVKYLEAKGKAREVIAIREDG
                     RWLFTVGCQRDIDKETFIDRIYNTDGGFDPEKGVNAHRQVYLDFLKEF"
     misc_feature    complement(122288..122419)
                     /locus_tag="CDBI1_19348"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(122150..122275)
                     /locus_tag="CDBI1_19348"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(122084..122203)
                     /locus_tag="CDBI1_19348"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(122024..122137)
                     /locus_tag="CDBI1_19348"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(123205..123693)
                     /locus_tag="CDBI1_19353"
                     /db_xref="GeneID:12213016"
     CDS             complement(123205..123693)
                     /locus_tag="CDBI1_19353"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197016.1"
                     /db_xref="GI:384359161"
                     /db_xref="GeneID:12213016"
                     /translation="MRKIDLDKIKIYPWDLKNVKTQTYEMCIEVLRRDGLSLKNIRWN
                     ELSLSEKQIFNLYIIAVRQNGLALEFIENQIDEICMEALKQNELAIKYVKDKKKYEKI
                     LRFEYVKDLIAIILCIIILVIIFISIFIYIYFLCGLVRTILLLFSCLFVFHCMRLSTS
                     LK"
     misc_feature    complement(123406..123528)
                     /locus_tag="CDBI1_19353"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(124092..124439)
                     /locus_tag="CDBI1_19358"
                     /db_xref="GeneID:12213017"
     CDS             complement(124092..124439)
                     /locus_tag="CDBI1_19358"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197017.1"
                     /db_xref="GI:384359162"
                     /db_xref="GeneID:12213017"
                     /translation="MDVKWGELEGKFSKEQLDEICVYALKQDKHLIKYIRNKEKYEDM
                     FNIKYLKEQGNASEVFAVKENGIWLFTVGCQENITKETFIYRIYNTDGGFDLEKGINV
                     HRQIYLDFLKEFK"
     gene            complement(124467..124907)
                     /locus_tag="CDBI1_19363"
                     /db_xref="GeneID:12213018"
     CDS             complement(124467..124907)
                     /locus_tag="CDBI1_19363"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197018.1"
                     /db_xref="GI:384359163"
                     /db_xref="GeneID:12213018"
                     /translation="MRGIDLDCIKRWPWDLRFAKTQTYEMCIEALKRDGMLLGHVKFD
                     ELNLTKEQLYNLSLIAVKQNGLALQFVKEQTPEICIEAVRDDGRALQFVKEKTEEICI
                     EAVKQNGRALKYVNNQTDEICIEAVKKNGSNLYCVKNQTPEICI"
     misc_feature    complement(124689..124835)
                     /locus_tag="CDBI1_19363"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(124557..124679)
                     /locus_tag="CDBI1_19363"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(124491..124616)
                     /locus_tag="CDBI1_19363"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(125373..126749)
                     /locus_tag="CDBI1_19368"
                     /db_xref="GeneID:12213019"
     CDS             complement(125373..126749)
                     /locus_tag="CDBI1_19368"
                     /note="COG2247 Putative cell wall-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin/adhesin"
                     /protein_id="YP_006197019.1"
                     /db_xref="GI:384359164"
                     /db_xref="GeneID:12213019"
                     /translation="MFNINRGDMEGNKMKKIKQLGIVALAGSSALGATMMGSSAMAPQ
                     ELVLAGEDRIDTSLKISSYKWQNAENAVLINSNTIADALCSAPLATSKNAPVLLTEKD
                     NLNAKTKEEIKRLGVKNIYVIGSTNTISANVEKELNNLNINVKRIGGTDRIDTSLKIA
                     KELENVDSVAVVNGYKGLADAVSIASPAKSNTAILFAEKDSLNKNIEDYAKTFNTTYV
                     VGGESSISKNIVNKLKNVIKFAGTDRTDTNAKVMDYFYTDKALNNVFVAKNGMANEGD
                     LIDALSVGPVGAKEDSPVLLAGKNLSTSQKNFIKKHEFSKVTQVGNGGNENVFREILN
                     ILKGEETPGTITNAEFREKLPELGWTKDGSTTYVYKQKSNQGNGFNEMGIVNAEDNVV
                     GFGLFSNSPEFDSSVKECFKLLLPTKGEQLFNIVKGKFEDQTLEMDGKKVEIKNGSMG
                     VYVDIYNK"
     misc_feature    complement(126342..126608)
                     /locus_tag="CDBI1_19368"
                     /note="Putative cell wall binding repeat 2; Region:
                     CW_binding_2; pfam04122"
                     /db_xref="CDD:252392"
     misc_feature    complement(126054..126317)
                     /locus_tag="CDBI1_19368"
                     /note="Putative cell wall binding repeat 2; Region:
                     CW_binding_2; pfam04122"
                     /db_xref="CDD:252392"
     misc_feature    complement(125757..126032)
                     /locus_tag="CDBI1_19368"
                     /note="Putative cell wall binding repeat 2; Region:
                     CW_binding_2; pfam04122"
                     /db_xref="CDD:252392"
     gene            complement(127529..128365)
                     /locus_tag="CDBI1_19373"
                     /db_xref="GeneID:12213020"
     CDS             complement(127529..128365)
                     /locus_tag="CDBI1_19373"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer protein, putative"
                     /protein_id="YP_006197020.1"
                     /db_xref="GI:384359165"
                     /db_xref="GeneID:12213020"
                     /translation="MNKNIKKITIAGLIMGCVLGQCLTINAEEITLKTTADKEIKIFD
                     LADKLGQKGTKVESEKYGSGYSLNLNDNLFTFYENSPYVYVNGYMLPIKTKKIKDSVS
                     KEEFNFPDDSQKLKKDGDDFLIPKEILVNYLGFKEDNNGIKINAINVKDQDKKEDKND
                     ADLSVSNEVFRNKLEDLGWTKDGSTTYVYKQKSNQGNGFNEMGIVNAEDNVVGFGLFS
                     NSTEFDSSVKECFKLLLPTKGEELFNIVKDKFEDQTLEMDGKKVEIKNGSIGVYVDIY
                     NK"
     gene            complement(128977..129903)
                     /locus_tag="CDBI1_19378"
                     /db_xref="GeneID:12213021"
     CDS             complement(128977..129903)
                     /locus_tag="CDBI1_19378"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197021.1"
                     /db_xref="GI:384359166"
                     /db_xref="GeneID:12213021"
                     /translation="MKKVGLREIKKYSWYLRFAKKQSYDMCIEAVRRDGRLLKDIRWD
                     ELNLSKEQVYNLYLIAVKQDGFALKYIKWDKFSKEEINKICLEAVRRNSFALEYVKWS
                     ELECKFLKEQIEAICLEAVRQNGLALEYAKKQTEKICIEAVKEFGLALEYVKRQTEKT
                     CLEAVKENGLALEYVKKQTKKICLEAVKEDGLALEYVKWSELEGKFLKNQTDEICRKA
                     LKQNVYAIRYIKDKEKYLEEFGVKYLEKQGKAREVLAIKEDGEWLFTIGCQENITKEK
                     FINRIYNENGGFDLEKGVNVHRGRYLNFLKEF"
     misc_feature    complement(129505..129654)
                     /locus_tag="CDBI1_19378"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(129445..129558)
                     /locus_tag="CDBI1_19378"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(129313..129423)
                     /locus_tag="CDBI1_19378"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(129208..129366)
                     /locus_tag="CDBI1_19378"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(130865..131620)
                     /locus_tag="CDBI1_19383"
                     /db_xref="GeneID:12213022"
     CDS             complement(130865..131620)
                     /locus_tag="CDBI1_19383"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197022.1"
                     /db_xref="GI:384359167"
                     /db_xref="GeneID:12213022"
                     /translation="MTKQENNLIKHQEMDLGIINRNKNHLKYAKVQTYEMCLKAIEKN
                     GLLLKDIRWDEINLTKEQVHKLCIKAVRNNGIALQYVKEQTPEMCKEAVKNREFALMY
                     VKEQTEELCILAVKQDYSALQYVKKQTPEICIKALKKNEFALQYVKWDILSEEQIDEI
                     CREALKHDRCLIRYIKDKDIFNIKYLEAQGKASEVIAIKEDGEWLFTVGCQRNITKEE
                     FIYRIYNTDGGFNLEKEINVHRQVYLDFLEQFK"
     misc_feature    complement(131240..131362)
                     /locus_tag="CDBI1_19383"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(131180..131299)
                     /locus_tag="CDBI1_19383"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(131087..131230)
                     /locus_tag="CDBI1_19383"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(131806..132969)
                     /locus_tag="CDBI1_19388"
                     /db_xref="GeneID:12213023"
     CDS             complement(131806..132969)
                     /locus_tag="CDBI1_19388"
                     /note="COG0675 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="IS605 family transposase OrfB"
                     /protein_id="YP_006197023.1"
                     /db_xref="GI:384359168"
                     /db_xref="GeneID:12213023"
                     /translation="MKRAYKIEINPTTEQISKIHQTIGVSRFIYNFYIAHNKEIYERE
                     GKFISGIDFSKWLNNEYIPNNQDMKWIKDVSSKATKQAIMNGDKAFKDFFKKTKGFPK
                     FKKKKNQDVKAYFPKNNKTDWTLERHRVKIPTLGWVRLKEFGYIPTNSIVKSGTVSQK
                     SNRYYVSILVEEDDIQVSKCTNEGIGIDLGIKDFAICSNGSKFKNINNTSTIKKVEKK
                     LKREQRKLSRKYESLKVRNKNIKEGVATRQNIQKQITKVQKIHQRLTNIRTDYINKTV
                     FQVIEQKPSYITIEDLNVTGMMKNKHLSKAISSQRFFEFRTKLTAKCKQNNIELRVVD
                     RWYPSSKTCSQCGEIKKDLKLKDRVYKCECGLSIDRDLNASLNLKNAKKYKIA"
     misc_feature    complement(131830..132969)
                     /locus_tag="CDBI1_19388"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    complement(132832..132969)
                     /locus_tag="CDBI1_19388"
                     /note="Helix-turn-helix domain; Region: HTH_OrfB_IS605;
                     pfam12323"
                     /db_xref="CDD:256981"
     misc_feature    complement(132076..132762)
                     /locus_tag="CDBI1_19388"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     misc_feature    complement(131836..132036)
                     /locus_tag="CDBI1_19388"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            complement(133067..133567)
                     /locus_tag="CDBI1_19393"
                     /db_xref="GeneID:12213024"
     CDS             complement(133067..133567)
                     /locus_tag="CDBI1_19393"
                     /note="COG2452 Predicted site-specific
                     integrase-resolvase"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase domain-containing protein"
                     /protein_id="YP_006197024.1"
                     /db_xref="GI:384359169"
                     /db_xref="GeneID:12213024"
                     /translation="MSKHYKPKEFAELLNVSVITLQRWDNDGKLKAFRTPTDRRYYTY
                     EQYLEYKGIHKEQVNRKIVIYTRVSTSNQKDDLKNQVEFLRQYANAKGIIVDEVIEDY
                     GSGLNYNRKKWNKLIDSCMANEVNTIIITHKDRFIRFGYEWFEGFLAKFNVNIIVVNN
                     ESISPQ"
     misc_feature    complement(133070..133558)
                     /locus_tag="CDBI1_19393"
                     /note="Predicted site-specific integrase-resolvase [DNA
                     replication, recombination, and repair]; Region: COG2452"
                     /db_xref="CDD:225296"
     misc_feature    complement(133409..133555)
                     /locus_tag="CDBI1_19393"
                     /note="Helix-Turn-Helix DNA binding domain of truncated
                     MerR-like proteins; Region: HTH_MerR-trunc; cd04762"
                     /db_xref="CDD:133390"
     misc_feature    complement(order(133448..133456,133502..133504,
                     133544..133552))
                     /locus_tag="CDBI1_19393"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133390"
     misc_feature    complement(<133085..133384)
                     /locus_tag="CDBI1_19393"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cl02788"
                     /db_xref="CDD:261450"
     misc_feature    complement(order(133154..133156,133163..133168,
                     133361..133363,133367..133369))
                     /locus_tag="CDBI1_19393"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238206"
     misc_feature    complement(133361..133363)
                     /locus_tag="CDBI1_19393"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:238206"
     gene            complement(134532..135809)
                     /locus_tag="CDBI1_19398"
                     /db_xref="GeneID:12213025"
     CDS             complement(134532..135809)
                     /locus_tag="CDBI1_19398"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197025.1"
                     /db_xref="GI:384359170"
                     /db_xref="GeneID:12213025"
                     /translation="MVKQESNLINRQKMDLDVIKRFPNHLKYAKVQTYEMCLEAILRK
                     GIVLGDVRWSDLNLSKVQVYNLCIKAVKRNGLALKYVKEQTKDMCLKAVKENGLALKY
                     VERQTPEICIEALKQNGMALEFIKEQTEELCLIAVKQDGLALKYVKEQSLRICIEAVK
                     QDGYSLKYVKAQTEKICIEAVKQNGNALKNVNEQTIEICKESVKQDGLALKYVKTQTP
                     DICLIAVKQNGNALKNVNEQTIEICIEAVNKNASALAFVKNQTKEICLKAVRRDGLSL
                     KHVKEQTEEICLTAVREDGFALRYVKKQVPEICIEALKQDKYAIMYVKEQTDEMCRKV
                     LKQDKRLIDYIKDKGKYVEEFDIKYLEEQKGAQEVIAIKEDGEWLFTVGCQEYINLEE
                     FMDRIYTENGGFDPEEDINVHREIYLEFLKDFY"
     misc_feature    complement(135501..135614)
                     /locus_tag="CDBI1_19398"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(135429..135554)
                     /locus_tag="CDBI1_19398"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(135363..135485)
                     /locus_tag="CDBI1_19398"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(135171..135290)
                     /locus_tag="CDBI1_19398"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(135099..135221)
                     /locus_tag="CDBI1_19398"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(135024..135155)
                     /locus_tag="CDBI1_19398"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(134901..135026)
                     /locus_tag="CDBI1_19398"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(134835..134960)
                     /locus_tag="CDBI1_19398"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            136082..137383
                     /locus_tag="CDBI1_19403"
                     /db_xref="GeneID:12213026"
     CDS             136082..137383
                     /locus_tag="CDBI1_19403"
                     /codon_start=1
                     /transl_table=11
                     /product="NERD domain-containing protein"
                     /protein_id="YP_006197026.1"
                     /db_xref="GI:384359171"
                     /db_xref="GeneID:12213026"
                     /translation="MLQDLIDLYSLPVLPIAWFLELITMHTFSRRIYLWISLFIWIIL
                     SILLICKFFLHSKYGYNLRLKKRELKKLKLRRKLQDNVIKEEILSTLRNYNLEKGPIS
                     GLIDIPESKNIKLDLIEKQTLLKNELEYITRYKEEKTALNFDEYLNLDTLNYSKLNFP
                     KSLAWYEEDVEYLKEFLPIDVKSHYDTYSSLNKMIKEYNFEINDIQKSLAIINKGVKG
                     EEAVKNELKWFTDRYKVLENINILIDKEKHETSESDFIIISKNGVFVVEVKNYGSTGD
                     TLIASSDGNWYIKDKYENIEPINNIASQNNRHCGINQYLINRELKNRGYNLETKIDCT
                     SIIVIANKEIVIENNTPNTVIRPSEILNVINNHKPNFELDEKLQDEIVDILKEYSIDA
                     SKFPAVSRKEKIEALLYNINILEPGIKASAKIANDYYMNYL"
     misc_feature    136721..137056
                     /locus_tag="CDBI1_19403"
                     /note="Nuclease-related domain; Region: NERD; pfam08378"
                     /db_xref="CDD:254764"
     gene            complement(138056..138880)
                     /locus_tag="CDBI1_19408"
                     /db_xref="GeneID:12213027"
     CDS             complement(138056..138880)
                     /locus_tag="CDBI1_19408"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197027.1"
                     /db_xref="GI:384359172"
                     /db_xref="GeneID:12213027"
                     /translation="MREVNLDRIRKFPWELMRVKNQTYEMCIEAVKREGLLLKIIKWG
                     ELSLSDEQINNLYITAVKQNGYALQYVKRQTPEICLLAVKERGGALEYVKWNELEGEL
                     SKDQIDKICKEAVKKNGLALQYVKKQTPELCLIAVKQNGLALKYIKKQSPEICIEAVK
                     ENGYALKYVEKQTSKICLEAVRKNGLALKYVEDQLDKICVEALKKNKLAIRYVKDKEK
                     YLKEFGIKYLEAQGEAREVIAIRENNKWLFTLGCQYKITKEEFIYRIYNTGEGFNL"
     misc_feature    complement(138602..138715)
                     /locus_tag="CDBI1_19408"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(138500..138652)
                     /locus_tag="CDBI1_19408"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(138434..138553)
                     /locus_tag="CDBI1_19408"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(138368..138490)
                     /locus_tag="CDBI1_19408"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(138296..138424)
                     /locus_tag="CDBI1_19408"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(138233..138355)
                     /locus_tag="CDBI1_19408"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(139285..140004)
                     /locus_tag="CDBI1_19413"
                     /db_xref="GeneID:12213028"
     CDS             complement(139285..140004)
                     /locus_tag="CDBI1_19413"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197028.1"
                     /db_xref="GI:384359173"
                     /db_xref="GeneID:12213028"
                     /translation="MKGIDLDCIKRYPWELEFADKQTYEMCVEALRRDGMLLEHVKFD
                     ELNLTKEQLYNLYLIAVKQDGFALKFIKEQTEEICIEAVKEYYLALEFVKEQTERICL
                     EAVKECHTALFYIKQQTPEICIEAIKNNKNALCYVKNPTEDIYIEALKQDKLIIKYIK
                     DKEKYLDMFNIKYLEKQGKAREVIAIKENGKWLFTLDCQYKITKDEFIERIYNENGGF
                     NPEKGVNIHRQVYLNFLKEFK"
     misc_feature    complement(139720..139839)
                     /locus_tag="CDBI1_19413"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(139519..139644)
                     /locus_tag="CDBI1_19413"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(140392..140997)
                     /locus_tag="CDBI1_19418"
                     /db_xref="GeneID:12213029"
     CDS             complement(140392..140997)
                     /locus_tag="CDBI1_19418"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197029.1"
                     /db_xref="GI:384359174"
                     /db_xref="GeneID:12213029"
                     /translation="MKEVSLDEIKKFPWKIKEYALYYVEEQSDEICMEEVRRNGLVLF
                     YVKKQTEEICIEAVKENGYALKYVEKQTPKICIEAVKENGCALKYVKWNELEGKLLKD
                     QTEEICIEALKQNKLAIIYIKDKNKYLEELNIKYLEAQGEAREVISIEKNGEWLFTVG
                     CQRNITKEEFIYRIYNTNGGFDLENGINVHRQIYLDFLEKF"
     misc_feature    complement(140788..140910)
                     /locus_tag="CDBI1_19418"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(140728..140847)
                     /locus_tag="CDBI1_19418"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(140623..140775)
                     /locus_tag="CDBI1_19418"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(141635..142618)
                     /locus_tag="CDBI1_19423"
                     /db_xref="GeneID:12213030"
     CDS             complement(141635..142618)
                     /locus_tag="CDBI1_19423"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197030.1"
                     /db_xref="GI:384359175"
                     /db_xref="GeneID:12213030"
                     /translation="MNIYMVKTNKECFISDCKVFSGSDYEYHRTQLTNLYFDGEKPKE
                     TYCKNWYVIDKYPEKIETESIEYTNERYEINNKNLICEKFPETIKKEDRGKFNFDITE
                     FYTFKRDKLPLRLVEAENVNVEIIIELDSFKMPNKIEYDIVCDKEHYKNNSAYKITNA
                     NVKHQFLDKMIFPEIMLSSRPCKLTSKQMYDITRKYIKDNIDLSKAKITSDYKFCFAV
                     KKIIPLLTPEKISYTNIFARTKKERNKIHHEIKEYKEVEIFSMTHKQENYGGYTAIDE
                     LCANNENELKEKVDTWLKGVVDIINKPLTQCEHCNGTGYIDEIKKIELNQN"
     misc_feature    complement(141713..>141943)
                     /locus_tag="CDBI1_19423"
                     /note="alanyl-tRNA synthetase; Region: A-tRNA_syn_arch;
                     TIGR03683"
                     /db_xref="CDD:234309"
     gene            complement(143244..143444)
                     /locus_tag="CDBI1_19428"
                     /db_xref="GeneID:12213031"
     CDS             complement(143244..143444)
                     /locus_tag="CDBI1_19428"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197031.1"
                     /db_xref="GI:384359176"
                     /db_xref="GeneID:12213031"
                     /translation="MIKYVEQLGIRYLNEAGNTREVIAIKEDGEWLFTVGCQEDIDIE
                     EFIYRIYDTNGGFDSEEGVNVH"
     gene            complement(145674..147749)
                     /locus_tag="CDBI1_19433"
                     /db_xref="GeneID:12213032"
     CDS             complement(145674..147749)
                     /locus_tag="CDBI1_19433"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197032.1"
                     /db_xref="GI:384359177"
                     /db_xref="GeneID:12213032"
                     /translation="MDDIDLTKKQLKSLYIEAVRKNGLALEYIKYEKLKQKFSRGEIY
                     HIYSIAVRQNGLALEYVKWDTVDLTKNQINNLCKIAIKQDSLALMYVKEQTPELCLLA
                     VKQSGLILEYVNRDKLSKEQFNQICFEAVKETGQALGLIKEQTEELCLLAVKQNGLYL
                     KFVNEQTEKICMEAVKQDGEALKYVNNQLDEICLEAVKKDGYAFRYVVKQLNKICVEG
                     LKRYGWALEYIEKQTEELCLIAVRENGLALSYVKEQTEEICLEAVKEYGLSLKYVERQ
                     TQEICIEALKQNGLALEYVKWSELEGKFLKNQIPGLCLIAVKQNGEAIKHINWDELEG
                     EFSKEQIEEICLEAVKKDGLLLKYIEEQLYEICIEAVKQNGNALQYINWDKLKNKLSN
                     KQIERICLIAVKQNGGALEYVYKQNYEICLEAVSRRGYSLEDVRWDELNLTKEQTYNL
                     YMSAVKENGYALRYIKEETEELCIEAVMQNGLALEYVDKQTQEICLIAVREDGQALEY
                     VREQTEEICLEAIRQEASMLGNVEKQTLEICLEAVKQGGYALIFVDEGEFSKEQNEEI
                     CLEAVKQNGDVLYQVKNQTEEICIEAVKQYGYALEYVIDQTEKICLEAVRENGLALEF
                     VKEQTPEICLEAVKENGKALEYVKWEELKGELLKDQLDEICREALRQNRQAIEFIENK
                     DKYLEELNI"
     misc_feature    complement(147117..147248)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(146931..147050)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(146865..146984)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(146769..146915)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(146607..146726)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(146505..146657)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(146445..146558)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(146283..146402)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(146217..146342)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(145941..146063)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(145791..145928)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(145704..145859)
                     /locus_tag="CDBI1_19433"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(148792..148977)
                     /locus_tag="CDBI1_19438"
                     /db_xref="GeneID:12213033"
     CDS             complement(148792..148977)
                     /locus_tag="CDBI1_19438"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197033.1"
                     /db_xref="GI:384359178"
                     /db_xref="GeneID:12213033"
                     /translation="MKINICVKTNKVGSECEYELEIDDDDLKDMSEEEREEYINKIAL
                     DYALESLIDWNWYEIEG"
     gene            complement(149004..149327)
                     /locus_tag="CDBI1_19443"
                     /db_xref="GeneID:12213034"
     CDS             complement(149004..149327)
                     /locus_tag="CDBI1_19443"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197034.1"
                     /db_xref="GI:384359179"
                     /db_xref="GeneID:12213034"
                     /translation="MIIIKSLRCRFGHKFLRVIDCDLITTRSQQYTCKIWMCKYCGQI
                     IGGSTPIYHPKMDKNEYCIKCDRLTCAKNDEGYCNSKDKEIEFKSICLDDGKQFLKCE
                     SFDLE"
     gene            complement(149375..149647)
                     /locus_tag="CDBI1_19448"
                     /db_xref="GeneID:12213035"
     CDS             complement(149375..149647)
                     /locus_tag="CDBI1_19448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197035.1"
                     /db_xref="GI:384359180"
                     /db_xref="GeneID:12213035"
                     /translation="MYEYTCVCRNLNNDIKEYFRCEYVQDKIKSYDHDLKELEKDRDS
                     IIIKEDDEKELLLKIIQFYKHNSNMSDLTPFELKSLSAILEKFFVS"
     gene            complement(150254..150505)
                     /locus_tag="CDBI1_19453"
                     /db_xref="GeneID:12213036"
     CDS             complement(150254..150505)
                     /locus_tag="CDBI1_19453"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197036.1"
                     /db_xref="GI:384359181"
                     /db_xref="GeneID:12213036"
                     /translation="MSPFAFFMEDYYLFEVIEEFTDERVHFDEENAHFYKGDKFIGYI
                     SESGIDREVVIKAYCSIEIIQIPLDKVKKVYRVEFKEVK"
     misc_feature    complement(150544..151864)
                     /note="potential frameshift: common BLAST hit:
                     gi|302391857|ref|YP_003827677.1| HNH endonuclease"
     gene            complement(152286..152945)
                     /locus_tag="CDBI1_19468"
                     /db_xref="GeneID:12213037"
     CDS             complement(152286..152945)
                     /locus_tag="CDBI1_19468"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197037.1"
                     /db_xref="GI:384359182"
                     /db_xref="GeneID:12213037"
                     /translation="MSQLKIALEEIKETTNYFEDINQNYEICLKVIEECGEALPYVKW
                     DELNLTKEQINNLYLLAVKQKGLSLKHVGEQTHEICIEAVRKNGLALMYVKKQTHEIC
                     IESVRVCGLALRFVEEQTETICIEAVKQNGVVLGFVEEQTETICIEAVKQNGLALQYV
                     REQTETICIEAVKQNGLALQYVREQTPNICIEAIKQDGIALKYVEEQTKRCLFGSFKA
                     I"
     misc_feature    complement(152658..152777)
                     /locus_tag="CDBI1_19468"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(152592..152714)
                     /locus_tag="CDBI1_19468"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(152460..152579)
                     /locus_tag="CDBI1_19468"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(152394..152513)
                     /locus_tag="CDBI1_19468"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(152319..152447)
                     /locus_tag="CDBI1_19468"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(153524..153790)
                     /locus_tag="CDBI1_19473"
                     /db_xref="GeneID:12213038"
     CDS             complement(153524..153790)
                     /locus_tag="CDBI1_19473"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197038.1"
                     /db_xref="GI:384359183"
                     /db_xref="GeneID:12213038"
                     /translation="MNGEINVEDYRYFKQLQEEKNNVYTNYLNGEYISKSQLIEFLKN
                     KSHVLNEINDKYKFYYESAILTLDELNKQLTDGKFDLVKKNNSK"
     gene            complement(154240..154479)
                     /locus_tag="CDBI1_19478"
                     /db_xref="GeneID:12213039"
     CDS             complement(154240..154479)
                     /locus_tag="CDBI1_19478"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197039.1"
                     /db_xref="GI:384359184"
                     /db_xref="GeneID:12213039"
                     /translation="MDGEIENKEIIDITIEGNVKDINCSGSVEVRGNVSGSIDCGGSA
                     TIEGSVKGDIDCGGNCHVQGDCKGDIDAGGSVNIR"
     misc_feature    complement(<154243..>154446)
                     /locus_tag="CDBI1_19478"
                     /note="Protein of unknown function (DUF342); Region:
                     DUF342; cl19219"
                     /db_xref="CDD:267572"
     gene            complement(156256..157392)
                     /locus_tag="CDBI1_19493"
                     /db_xref="GeneID:12213040"
     CDS             complement(156256..157392)
                     /locus_tag="CDBI1_19493"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197040.1"
                     /db_xref="GI:384359185"
                     /db_xref="GeneID:12213040"
                     /translation="MTQLEMDLKEIKKNPRSLKDIKEQAIEVCIEAVRRNGLVLEYVD
                     RDKFSKEQINEIYLIAVRQNGNSLKFVREQSYDICMEAVKQRPPSLQYVNEQTPEICI
                     EAVRQKGLVLKYVRWDELKGKFSKEQIEKICLEAVKEDGYALEYVREQTKEICIEAVS
                     NRGRAFKFVREQSYDICLIAVKNDSYSLRYVKNQTPELCLIAVRENGYAIRDVKEQTE
                     ELCMEALTQNPRALQFIRKQTKEMCLNAVRQRASDLYYIKKQTEEMCLIAINQDPQTF
                     RYVKNQTLNICFEAIRRDGLVLEYVEKQTEEMCLIAVRQNGLALQHAKIQTEEICLEA
                     VRENGLALEFVYKQTLKICKEAVKQNKDAIDFVEIRFLEIDINS"
     misc_feature    complement(157174..157314)
                     /locus_tag="CDBI1_19493"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(157108..157230)
                     /locus_tag="CDBI1_19493"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(156880..157005)
                     /locus_tag="CDBI1_19493"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(156814..156939)
                     /locus_tag="CDBI1_19493"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(156673..156804)
                     /locus_tag="CDBI1_19493"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(156424..156537)
                     /locus_tag="CDBI1_19493"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(156352..156477)
                     /locus_tag="CDBI1_19493"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(157429..157707)
                     /locus_tag="CDBI1_19498"
                     /db_xref="GeneID:12213041"
     CDS             complement(157429..157707)
                     /locus_tag="CDBI1_19498"
                     /codon_start=1
                     /transl_table=11
                     /product="ISCpe4, transposase"
                     /protein_id="YP_006197041.1"
                     /db_xref="GI:384359186"
                     /db_xref="GeneID:12213041"
                     /translation="MKMGKYQSRKESKKKTFKEIWKFKNKIEEGGATRQNIQKQVVKV
                     QKLHHKLDNVRFDYINKTVSQAIEQKPSHITVKDSNVSAMMKKDFSQY"
     misc_feature    complement(157444..>157614)
                     /locus_tag="CDBI1_19498"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     gene            complement(157682..158518)
                     /locus_tag="CDBI1_19503"
                     /db_xref="GeneID:12213042"
     CDS             complement(157682..158518)
                     /locus_tag="CDBI1_19503"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197042.1"
                     /db_xref="GI:384359187"
                     /db_xref="GeneID:12213042"
                     /translation="MLREDIDIDWIKEHPWDLKDAKVQTYEMCIESIKKDGLFLKDIR
                     WDELDFNKEQINNLCLIAVKENGLALEYVKKQTEEICIVAIKDSSYSFKYVKEQTPKI
                     CSIAVKEDIGALKYVENQTPELCLEAVRHDGWALKHVKNQTEKICIEAIKQNPSALCH
                     VENQTEEMCLIAIKKCPWEFSSVKEQTEAICLEVVRERGLSLEFVKKQTEKLCKEAVK
                     ENGLALEYVREQTPELCLIAVRENGLALEYVKKQTDEICREALRQNKQAIIYIEDGKI
                     SK"
     misc_feature    complement(158294..158440)
                     /locus_tag="CDBI1_19503"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(158228..158347)
                     /locus_tag="CDBI1_19503"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(158036..158152)
                     /locus_tag="CDBI1_19503"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(157766..157891)
                     /locus_tag="CDBI1_19503"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(157700..157822)
                     /locus_tag="CDBI1_19503"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(159166..160560)
                     /locus_tag="CDBI1_19508"
                     /db_xref="GeneID:12213043"
     CDS             complement(159166..160560)
                     /locus_tag="CDBI1_19508"
                     /note="COG1171 Threonine dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197043.1"
                     /db_xref="GI:384359188"
                     /db_xref="GeneID:12213043"
                     /translation="MNQYKGDRGMFKKNLKNIKKKLSCLMNTKRLNYEACVEIVKKNG
                     LMIQFFKWNKLNLTQEQIEEICLVAVKEDGRALEYINNPTKDMCIEAIKENALSLKYV
                     DNQTIDLCTMAVKRNGLALKYIKWNELKDNLSKEQIFSICLIAIRQVPNALKFINKKE
                     LNLSDEQMRDIYIEAVKQNGYVLQDIEEQTEEMCLIAVRQNGLALQYVKEQTPEICLE
                     AVRNNGWSLQNVREQTVEICFEAVRQCPESLIFVHNQTPEICLEAIRRNGLVLEFIFN
                     QYEKICVEAVKQNGMALYYVKKQTPEICIEAVKQNGLALQYVRAQTPNICIEAIKQDG
                     IALKYVREQTEEMCMEAVKFYWRTLQYVKEQTEAICLEALKQSKYAIEYVKDKEKYET
                     TFGVRFLQGKYKAKDIIAVKRYNTWLFTIGNHYEITKKEFIEHIYNDNGGFDLEKGTN
                     VHRQVYLDFLEQFN"
     misc_feature    complement(160249..160374)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(160171..160308)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(160084..160239)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(159931..160056)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(159865..159990)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(159733..159855)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(159667..159789)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(159607..159726)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(159535..159657)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(159400..159528)
                     /locus_tag="CDBI1_19508"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(160767..161543)
                     /locus_tag="CDBI1_19513"
                     /db_xref="GeneID:12213044"
     CDS             complement(160767..161543)
                     /locus_tag="CDBI1_19513"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197044.1"
                     /db_xref="GI:384359189"
                     /db_xref="GeneID:12213044"
                     /translation="MKKRDIYLEIVKHCGYNLKYIENQDYEMCLRSVENYGTALRYVK
                     WKDLNLNKGQIYNLYLKAVKQNGNALKYIDKQNEELCLIAVKQDGNALKHVKLDEFSK
                     RQIYNICLEAVKQNGRSLIYVEEQLDEICREAVKQNGLALEYVKNKTYEVCLLAVKQT
                     GWALAFIKEQTYELCIEAVRQDSRALMFVKWQKLSNKLSKKQTEEICIEALKQDIDAL
                     EYINLDELKEIYSKEELNEIYVEVSKRFKHVIKFLRNKKK"
     misc_feature    complement(161415..161534)
                     /locus_tag="CDBI1_19513"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(161259..161372)
                     /locus_tag="CDBI1_19513"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(161100..161222)
                     /locus_tag="CDBI1_19513"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(161037..161159)
                     /locus_tag="CDBI1_19513"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(160863..161027)
                     /locus_tag="CDBI1_19513"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(161758..162447)
                     /locus_tag="CDBI1_19518"
                     /db_xref="GeneID:12213045"
     CDS             complement(161758..162447)
                     /locus_tag="CDBI1_19518"
                     /note="COG0480 Translation elongation factors (GTPases)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197045.1"
                     /db_xref="GI:384359190"
                     /db_xref="GeneID:12213045"
                     /translation="MEQYEIDLGRVKNYPYCLKKIKKQTYEMCMVAVEKWGLAIQFVA
                     WDDLNLPKEKLNKLCLKAVKKDGYALKYLKWDELNNKLSKNQIEKICIEAVKQNPWIL
                     RYVNEQTEEICIEAVRKAGYALEYVKEQTDKICREALKQDEFAIKFIDKKEKYLKEFN
                     IKYLEPQGDISEVIAINKNGQWLFAIDCEIDMIRKDFIDYIHDVAKELNLEENIDTYN
                     QVYFDFLEQLN"
     misc_feature    complement(162127..162276)
                     /locus_tag="CDBI1_19518"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(162061..162186)
                     /locus_tag="CDBI1_19518"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(161992..162120)
                     /locus_tag="CDBI1_19518"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(162649..163113)
                     /locus_tag="CDBI1_19523"
                     /db_xref="GeneID:12213046"
     CDS             complement(162649..163113)
                     /locus_tag="CDBI1_19523"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197046.1"
                     /db_xref="GI:384359191"
                     /db_xref="GeneID:12213046"
                     /translation="MSERLREEMLKGDNFTIKKYILVLYNADSIVSILSFDNIEEVKH
                     EDLNKSKNIDKIRIFKSNNKKEDIELIKEYKLKEIVSDDSLFMDEGTKLLGYDLKLNV
                     ANSIVFRIKFEMTKELQLEHELWYKKRSISLRLVQSNQDESVVDVESEALTI"
     gene            complement(163348..164361)
                     /locus_tag="CDBI1_19528"
                     /db_xref="GeneID:12213047"
     CDS             complement(163348..164361)
                     /locus_tag="CDBI1_19528"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197047.1"
                     /db_xref="GI:384359192"
                     /db_xref="GeneID:12213047"
                     /translation="MLRKEIDLDWIRKYPGDLKNAKKQTYGMCIEAVRRNGLYFMDIR
                     LGEVNLSYEELNNICVEAVKENCLMLSVIDKVVKFYRHCKNTSEICIEVIKEAPEIFK
                     EMPFDEINLTQKEMKAIYLEYLKKTECDLSIVENQAIMYLEIVKLNGRFLKYIKNQTE
                     GICLEAVKNYGPALKYVRWNKLSNNRNEKLYECSSNRVKYFHAKLNKIKNKFSSKENE
                     GICLEAVRQNALAIKYVNKQTEPICVEALKQNKHAIMFIKDKKKCLKEFNIRYLEKQG
                     DAREVIAIKENDKWLFTIACQRNITKEEFIYRIYNTNGGFDLKLRINVHRQIYLDFLK
                     QFE"
     gene            complement(164593..166248)
                     /locus_tag="CDBI1_19533"
                     /db_xref="GeneID:12213048"
     CDS             complement(164593..166248)
                     /locus_tag="CDBI1_19533"
                     /note="COG0050 GTPases - translation elongation factors"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197048.1"
                     /db_xref="GI:384359193"
                     /db_xref="GeneID:12213048"
                     /translation="MKFFEIGTSDFKEYMNSGAYFIDKSLFIKEVWEDNKYILITRPR
                     RFGKTLNMSMLKYFFSNNEADRNKELFRKLEISKYEDIMKEQGQYPVIFISFNGCDIN
                     DLESLKELVVKKIKNELDRFDYLIDELPGRKAKKFENILDSNKDSDLIESIAYLSEIL
                     HFATGKKPILLIDEYDTPINKAYTEGIYEEIINFMKAFYSNSIKDNIHVKKVIMTGVL
                     RVAKESIFSGLNNLSVYTIRDKGYESCFGFTKQEVEKILKYFSIDRNVKLLEDYYDGY
                     KFGDMEIYNPWSIMKYVENATKYGNYIEKPYWINTSSNDIVVELVNIKHKDGIEKLIS
                     GEEVIDIIDENIAFRYIADESTSPWSLLYFSGYLKISNEYDYGQVGLIIPNREVLHFF
                     KNEIIKWFNIDMKIEEYIPIVLSLIKGDTESFKKGFKEILTGVFSYFDLKGDESEQYY
                     HVFTIGIMALLSDNYIIKSNREAGDGRADLLIIPKNPSELGIIMEFKKSDKEELLLKD
                     AEIALKQINDKKYDNELLVLGVNNILKVGISFYNKECEMIFEQ"
     misc_feature    complement(165364..166233)
                     /locus_tag="CDBI1_19533"
                     /note="Predicted AAA-ATPase; Region: AAA-ATPase_like;
                     pfam09820"
                     /db_xref="CDD:255584"
     misc_feature    complement(164599..164910)
                     /locus_tag="CDBI1_19533"
                     /note="Protein of unknown function (DUF1703); Region:
                     DUF1703; pfam08011"
                     /db_xref="CDD:254580"
     gene            complement(166884..167936)
                     /locus_tag="CDBI1_19538"
                     /db_xref="GeneID:12213049"
     CDS             complement(166884..167936)
                     /locus_tag="CDBI1_19538"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197049.1"
                     /db_xref="GI:384359194"
                     /db_xref="GeneID:12213049"
                     /translation="MNNQKSDLIERYKIDLEIIRKFPNHLKFAKFQNYDMCLKALKQD
                     GYALEFVRWAELGLTKEERYSLCLLAIKNNGKAIKYVNWDKLSKEQIYNLCLLAVRDN
                     GIALEFVYNQTEEICLEAVKRNPYALKFVKNQTEEMCLIAVRNRGLTLEYVKEQTEEI
                     CLEAVTQDGNALEYVKEQTFELCIEAVRQDGNALKYVKNQLNEICIEAVKQDGRALKD
                     VKEQTEEICIEAVKQDYSALQFVKEQTPEICILAVKQNGLALYWVKKQTEEICIKSVM
                     QNGMALQYVVEKTKEICMRALKQNKHAIKYVKEKGDYLKEFGIRYLEAPEDGSEVIAI
                     KEDDQWLFSIGCQKKY"
     misc_feature    complement(167784..167891)
                     /locus_tag="CDBI1_19538"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(167472..167597)
                     /locus_tag="CDBI1_19538"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(167334..167465)
                     /locus_tag="CDBI1_19538"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(167142..167267)
                     /locus_tag="CDBI1_19538"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(167007..167135)
                     /locus_tag="CDBI1_19538"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(168046..168786)
                     /locus_tag="CDBI1_19543"
                     /db_xref="GeneID:12213050"
     CDS             complement(168046..168786)
                     /locus_tag="CDBI1_19543"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197050.1"
                     /db_xref="GI:384359195"
                     /db_xref="GeneID:12213050"
                     /translation="MFKSKGVLTLLRENEIDLKYAKVQSYEKWLNAINKDPLYIKHIG
                     VAEINLSQEQINSLCLIAVRQRPWTISYVKDQTPRLCIEAVKDWGSSLQYIREQTNKI
                     CLRAVKDYGLALQYVKKQTTEICIEAVMENGLALKFVDWDRFSKEQIDKICREALKQD
                     KLAIRYIKDKEYYLKEFDIKYLEEQGKASEVIAVKEHGEWLFTVGCQEDITKEEFIHR
                     IYNTGGGFDLEKGINVHRQVYINFLEQF"
     misc_feature    complement(168367..168483)
                     /locus_tag="CDBI1_19543"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(168277..168420)
                     /locus_tag="CDBI1_19543"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            169061..169408
                     /locus_tag="CDBI1_19548"
                     /db_xref="GeneID:12213051"
     CDS             169061..169408
                     /locus_tag="CDBI1_19548"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197051.1"
                     /db_xref="GI:384359196"
                     /db_xref="GeneID:12213051"
                     /translation="MKIAFSILTYRPMLTSLKKINIAILYKDIKNKIVYFETITNWDI
                     IEIFDNEIDVDLFKMIIMGIKSHAERNLKNCSLEDYIKRYNNELKFEEVLYREADSLK
                     ELTLKIKQLYLEI"
     gene            complement(169475..169981)
                     /locus_tag="CDBI1_19553"
                     /db_xref="GeneID:12213052"
     CDS             complement(169475..169981)
                     /locus_tag="CDBI1_19553"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197052.1"
                     /db_xref="GI:384359197"
                     /db_xref="GeneID:12213052"
                     /translation="MEEYETDLKRIILYNFGLEAIRNQNYIICLEAVRENGLELKDVK
                     WDELDLTKEEIENLNMEAVKQNPYAISYVKEQTDKVCIKALEQSGYAIYEIKNKDKYI
                     KMFDIRFLEKIEKIITVVAIRINREWLFTVKNEENLSKEEFIYWANSEKISDKYKQIY
                     LEFANNCK"
     gene            170137..170820
                     /locus_tag="CDBI1_19558"
                     /db_xref="GeneID:12213053"
     CDS             170137..170820
                     /locus_tag="CDBI1_19558"
                     /note="COG1396 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197053.1"
                     /db_xref="GI:384359198"
                     /db_xref="GeneID:12213053"
                     /translation="MNKNLLRNYEIIDKNSLSTLLDSFDYQERMLVNAIHVEKDFIQN
                     LVNFRKKQNITQKEIAEKTGLTQQAISGIETGGRKPTLINLIRYLQGIGININDLFIE
                     NRTNLKLEQIGYIDELYYLFLEKFNYVTEVLKDNNIKDSEWDIDFIKKDALKSVKTIK
                     DKIIINKSINLQSIRDLLEKSKNNFKIVDNMYDNPIKRSEQYYDLLIGLFDNAKEIIN
                     FSKKSYPNQ"
     misc_feature    170263..170433
                     /locus_tag="CDBI1_19558"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(170272..170274,170284..170286,170359..170361)
                     /locus_tag="CDBI1_19558"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(170281..170283,170356..170358)
                     /locus_tag="CDBI1_19558"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(170302..170307,170338..170340,170347..170349,
                     170359..170364)
                     /locus_tag="CDBI1_19558"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(170900..171787)
                     /locus_tag="CDBI1_19563"
                     /db_xref="GeneID:12213054"
     CDS             complement(170900..171787)
                     /locus_tag="CDBI1_19563"
                     /note="COG1209 dTDP-glucose pyrophosphorylase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197054.1"
                     /db_xref="GI:384359199"
                     /db_xref="GeneID:12213054"
                     /translation="MNKYEADLKMVKEDGYYLRTVKKQNYELCLQAIDNWGPAIQFIR
                     WKTINLSKLQRNNLYKKAVSKDGELLKYVKKQTEEICLLAVRENPWALIHVKRQTERI
                     CIEAVKQWGTILQFVKKQTPKICLEAVKQNSFALYYVKKQFEEVCIEAVKQDGDALKY
                     IKKQTKELCLRAIENDVCSLQYVKWAELNLTEFEVDEIYKFALTQTSRALTYIKNKDK
                     YIKMFNIKFSKNNRKVTAINIDGEWLFTIGCQENITKDEFMKRIYNEGGGFDLKAGKN
                     VHRQEYLVFLDQFPDKEAV"
     misc_feature    complement(171503..171616)
                     /locus_tag="CDBI1_19563"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(171431..171556)
                     /locus_tag="CDBI1_19563"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(171359..171484)
                     /locus_tag="CDBI1_19563"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(171290..171418)
                     /locus_tag="CDBI1_19563"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(171969..172298)
                     /locus_tag="CDBI1_19568"
                     /db_xref="GeneID:12213055"
     CDS             complement(171969..172298)
                     /locus_tag="CDBI1_19568"
                     /note="COG2217 Cation transport ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197055.1"
                     /db_xref="GI:384359200"
                     /db_xref="GeneID:12213055"
                     /translation="MVEDIKIKKQLELCKFDELKTILKGLTKGTIIYPGIIKDKLNLA
                     MEDVYIMLEQMVKEKAIKRVYELCCQSCINPKEKILNSIEGRFYCDACSKELDPLKDS
                     IVVYIVI"
     misc_feature    complement(<172176..>172298)
                     /locus_tag="CDBI1_19568"
                     /note="aminoacyl-tRNA ligase; Region: PLN02959"
                     /db_xref="CDD:215518"
     gene            172456..172764
                     /locus_tag="CDBI1_19573"
                     /db_xref="GeneID:12213056"
     CDS             172456..172764
                     /locus_tag="CDBI1_19573"
                     /note="COG2051 Ribosomal protein S27E"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197056.1"
                     /db_xref="GI:384359201"
                     /db_xref="GeneID:12213056"
                     /translation="MSNIVKLFKESNQEYLSTAYLLSNSDDSVEDIYEEIHSMLELKT
                     IQKFEFVICPLCASETKVESSLSEYIKCLNCNEFIIPDFVIERFKITDKEDKLRLKQD
                     "
     gene            173384..173800
                     /locus_tag="CDBI1_19578"
                     /db_xref="GeneID:12213057"
     CDS             173384..173800
                     /locus_tag="CDBI1_19578"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197057.1"
                     /db_xref="GI:384359202"
                     /db_xref="GeneID:12213057"
                     /translation="MDNIKKGQTVYLKYERTENSALENLKDLYREGTISSIGRKYLTV
                     DVNGYPYKFYKDTLDQVTNYAQDYYLYLSEKELLDELETNFILSELRSQIGIYSYSNC
                     KLNINQLRRIKKIMDENNIVETENKDIDNSNLITQK"
     gene            complement(174095..174457)
                     /locus_tag="CDBI1_19583"
                     /db_xref="GeneID:12213058"
     CDS             complement(174095..174457)
                     /locus_tag="CDBI1_19583"
                     /note="COG1396 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="YP_006197058.1"
                     /db_xref="GI:384359203"
                     /db_xref="GeneID:12213058"
                     /translation="MEMDYKALGKRIKIARIKKGITQESIANEIDITPSHLSNVETGK
                     TKVSLPTLIDIANALSINIDSLLCDNILNSKVVFEGEAKEVFDDCDEYEIRMLVDILK
                     YMKETIRKDRKTRDQFSR"
     misc_feature    complement(174110..174436)
                     /locus_tag="CDBI1_19583"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(174260..174433)
                     /locus_tag="CDBI1_19583"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(174332..174334,174407..174409,
                     174419..174421))
                     /locus_tag="CDBI1_19583"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(174335..174337,174410..174412))
                     /locus_tag="CDBI1_19583"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(174329..174334,174344..174346,
                     174353..174355,174386..174391))
                     /locus_tag="CDBI1_19583"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(175049..175585)
                     /locus_tag="CDBI1_19588"
                     /db_xref="GeneID:12213059"
     CDS             complement(175049..175585)
                     /locus_tag="CDBI1_19588"
                     /codon_start=1
                     /transl_table=11
                     /product="TraG/TraD"
                     /protein_id="YP_006197059.1"
                     /db_xref="GI:384359204"
                     /db_xref="GeneID:12213059"
                     /translation="MIDKELDSTISSAKVCKCEYCNKIKLCFEKEKYKNVYLQNLVKD
                     RNLLYGDEDEAIENTIMALNILNSDSPQFFKDIAELLVRKSVKLLKRLYGDDATLIDL
                     NNLVWNSNGIGKKIVNEFSKLPTINPIEQKENDEIVIWFIKDYYSGMTGAQGGTKTYE
                     HCSGARAQIYKLISINES"
     gene            complement(175873..176235)
                     /locus_tag="CDBI1_19593"
                     /db_xref="GeneID:12213060"
     CDS             complement(175873..176235)
                     /locus_tag="CDBI1_19593"
                     /note="COG0115 Branched-chain amino acid
                     aminotransferase/4-amino-4-deoxychorismate lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197060.1"
                     /db_xref="GI:384359205"
                     /db_xref="GeneID:12213060"
                     /translation="MKWDEVNFTKEQINNLYLEAVKQNGLALRYVKKQTEEICLESVR
                     NNGLALEYIKEQTPKLCLEAVRQNGLALNYSQYKTEEICLEAVKQNGLALRYVKKQTD
                     EICLEAVKQNPQALEFVY"
     misc_feature    complement(176071..176190)
                     /locus_tag="CDBI1_19593"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(175879..175998)
                     /locus_tag="CDBI1_19593"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(176240..176494)
                     /locus_tag="CDBI1_19598"
                     /db_xref="GeneID:12213061"
     CDS             complement(176240..176494)
                     /locus_tag="CDBI1_19598"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197061.1"
                     /db_xref="GI:384359206"
                     /db_xref="GeneID:12213061"
                     /translation="MNNYEIDLEMVKENGMDIIFVEHQTDEICLIAVGQNGMALQYVE
                     NQTDEICLIAVGQNPMSLRDVIKQTYVMCLIAVRQKRISS"
     misc_feature    complement(176366..176488)
                     /locus_tag="CDBI1_19598"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(176300..176416)
                     /locus_tag="CDBI1_19598"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(176694..176888)
                     /locus_tag="CDBI1_19603"
                     /db_xref="GeneID:12213062"
     CDS             complement(176694..176888)
                     /locus_tag="CDBI1_19603"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197062.1"
                     /db_xref="GI:384359207"
                     /db_xref="GeneID:12213062"
                     /translation="MNKFQKVVSKMVIQDEKEKFWEGYEYCMVGRSIPSSIRRYVKGF
                     KENNYTIEDVYNELKLLKNN"
     gene            complement(176992..177474)
                     /locus_tag="CDBI1_19608"
                     /db_xref="GeneID:12213063"
     CDS             complement(176992..177474)
                     /locus_tag="CDBI1_19608"
                     /codon_start=1
                     /transl_table=11
                     /product="TraG/TraD"
                     /protein_id="YP_006197063.1"
                     /db_xref="GI:384359208"
                     /db_xref="GeneID:12213063"
                     /translation="MEYINRICVESEKIIVDFNEEFCKTLLEGNESQSIERIVTVFEI
                     LNYDSPQFFKDMSDSLIRKSVKLLKRLYGDDATLIDLNDLVCNSNGIGQKMINEFSKL
                     PAKNPSEQKENEEIAIWFLTDYYSGVTGKRKGIIGKRKGTSTYEHCLGVRSQMSKLIF
                     "
     gene            complement(177542..178420)
                     /locus_tag="CDBI1_19613"
                     /db_xref="GeneID:12213064"
     CDS             complement(177542..178420)
                     /locus_tag="CDBI1_19613"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197064.1"
                     /db_xref="GI:384359209"
                     /db_xref="GeneID:12213064"
                     /translation="MKICIEDLEIVKRDPFWLKNIDNQTEEICVEAVRRNGLVLEFVE
                     KQTDAICLEAVKQCGKALKYVKNQLDEICLEAVRQDGLALAYVHNQTKEVCLTAVKEE
                     GLALLWVEQQTEEICLEAVKQNGYVLEYVIDQTEKICLEAVKENGLVLWYVKEQTYNI
                     CIEAIRNDVGSLMYVKDLTEEICLEAVKQDGLALRYIKWFKLLNKRTTELYLLDKRRL
                     SKLYMILNKIKNRILNKQIKEICLEAVKQNGKALQYVKDQTEEMCLIAVRQDNRNVKY
                     VKNLTNKVLKESNLDT"
     misc_feature    complement(178214..178345)
                     /locus_tag="CDBI1_19613"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(178145..178273)
                     /locus_tag="CDBI1_19613"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(177956..178081)
                     /locus_tag="CDBI1_19613"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(177830..178015)
                     /locus_tag="CDBI1_19613"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(177650..177883)
                     /locus_tag="CDBI1_19613"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(177584..177709)
                     /locus_tag="CDBI1_19613"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(178581..178799)
                     /locus_tag="CDBI1_19618"
                     /db_xref="GeneID:12213065"
     CDS             complement(178581..178799)
                     /locus_tag="CDBI1_19618"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197065.1"
                     /db_xref="GI:384359210"
                     /db_xref="GeneID:12213065"
                     /translation="MDNSKEEAVKQNGLALEFVKEQTEEICLIAVRQNGLALEFVKEQ
                     TQEVFAELAKQIEIELCIKNILKYNNLA"
     misc_feature    complement(178671..178781)
                     /locus_tag="CDBI1_19618"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(178802..179362)
                     /locus_tag="CDBI1_19623"
                     /db_xref="GeneID:12213066"
     CDS             complement(178802..179362)
                     /locus_tag="CDBI1_19623"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197066.1"
                     /db_xref="GI:384359211"
                     /db_xref="GeneID:12213066"
                     /translation="MGNDKTFMLNDLELLGIKSNERSLEAVKESGYNIAYVENPNYEI
                     CIASVRQDGNTLEHIMIDEINLTKEEKRNIYMEAIKESGRAIDYIKEDDREKYKDLFK
                     YKDLKDKDIMEHIVAIKINGEWKFSVSFKHNISKDEFIEWIYNDRIKILEEEVAFDRD
                     SSLFNQLETMNRKKYLDFLDIIDLIK"
     gene            complement(179545..180591)
                     /locus_tag="CDBI1_19628"
                     /db_xref="GeneID:12213067"
     CDS             complement(179545..180591)
                     /locus_tag="CDBI1_19628"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197067.1"
                     /db_xref="GI:384359212"
                     /db_xref="GeneID:12213067"
                     /translation="MIKHNIWLLECAEKQSYEMCMEAVSQNGLLLEDVRWSELNLTKE
                     EIYNLCLIAVKQNGEAIKYAKVQTKEICLLAVKRYGLSIRDIKWEELDFSNEEIYEIY
                     LIAVSNTGLALEYLSYNLLNLTQVQIENICIKAIEETGLALKYVPWNSLSLPENRYNY
                     LCKKALENRGFALKYIENQTEELCLIAVREDPIALQFVKSQTEDICIEAVRRNGYVLK
                     DVNNQTYRMCLEAVKNNGRALKYIKWDIGFTEEQKKIIHLEAIKQSAEVLDIIEDKEK
                     YMKLINMKILEETDEYMQLIAFKMDGKWLFNIGNQKNITEEEFKKYIESLYRKTEKIA
                     YTKFLEQLEVSNSK"
     misc_feature    complement(180151..180294)
                     /locus_tag="CDBI1_19628"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(180704..181534)
                     /locus_tag="CDBI1_19633"
                     /db_xref="GeneID:12213068"
     CDS             complement(180704..181534)
                     /locus_tag="CDBI1_19633"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197068.1"
                     /db_xref="GI:384359213"
                     /db_xref="GeneID:12213068"
                     /translation="MDMYFKGIDIEKYRLQLVEVYGSTLKYIDNQTDELCLKAVKGNG
                     VALRYVKKQTEEICIEAVRRDCRALAFVKWDIPNSVAYKICMEAIRQDVDSIRFIDWK
                     IIKNILLEEQIFNLCIEVMKINGEYIEYINWDEINLSDKCKEKICIEALKQTGYALQF
                     IEDYKKYEDIFNIKILEEYGDSSEVIAMKINEEWLFTIGCQDNITKEEFIYRIYNENG
                     GFDLEKGINPHRKRYIEFLEQFFEEKTDKRFNIDDIRLEFITKTRDISFNLILGDDVK
                     "
     gene            complement(181706..183289)
                     /locus_tag="CDBI1_19638"
                     /db_xref="GeneID:12213069"
     CDS             complement(181706..183289)
                     /locus_tag="CDBI1_19638"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197069.1"
                     /db_xref="GI:384359214"
                     /db_xref="GeneID:12213069"
                     /translation="MAKHGNYERLLNWLKRAGLEEEQTEEMCIEAVSKNGMALEFVKE
                     QTDKICLEAVKQNGKALRFVKNKTEKICLEAVKQNGLALFHAKNKTEGMCLIAVKQNG
                     LALKYVKKQTPKICIESVKQNGKALKYVREQTEEICIEAVKQDGNALKFVGEQTEDIC
                     LLAVRQDGSLLKYVETQTEEICITAIREKHFALCYVGKQTYELCLNAVKHNGNSLCYI
                     RWEELNASKNNIYELCLEAVRQDGRSIVYINERNTKLSKEKIRKLSLEAVRKGAPLLY
                     IKMSMLGFSKEEMNTLYLEAVKQNGLEVRHVRTQTSELCLTAVKQNGLALEYVNKQTK
                     AVCIEAVKQNGLALRHIKEQTLEICIMAVKQNPLALEYVNKQTPEICIMAVRKNGLVL
                     SYVNEQSYNVCLEAVKQNGEAVVFIKFNELNLSNDEIEILHITAIKSNPIVIECIENK
                     KKYIELFDNIILSEAKGKAKEVIAIKVNGEWLFTVGCQNNITKDEFIERIYNEGGGFD
                     LEKGINSHRKVYLDFLKQF"
     misc_feature    complement(183089..183217)
                     /locus_tag="CDBI1_19638"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(183023..183145)
                     /locus_tag="CDBI1_19638"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(182894..183013)
                     /locus_tag="CDBI1_19638"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(182768..182887)
                     /locus_tag="CDBI1_19638"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(182537..182686)
                     /locus_tag="CDBI1_19638"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(182231..182353)
                     /locus_tag="CDBI1_19638"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(182099..182221)
                     /locus_tag="CDBI1_19638"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(182039..182155)
                     /locus_tag="CDBI1_19638"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            complement(183584..184042)
                     /locus_tag="CDBI1_19643"
                     /db_xref="GeneID:12213070"
     CDS             complement(183584..184042)
                     /locus_tag="CDBI1_19643"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197070.1"
                     /db_xref="GI:384359215"
                     /db_xref="GeneID:12213070"
                     /translation="MCLESVKFYWRALEYVKEQTEEMCLEAINQNPVALLYVHKKTFN
                     ICIEALKRDGLLLKHIKLNELNLTKEQIYNLYIIALKQNGLALKFIENQTPELCLLAV
                     KQNGFALSYVKEQTPEICIEAVKESKNAIKYIKFNSVNLTEEEVKNIWVL"
     misc_feature    complement(183863..183982)
                     /locus_tag="CDBI1_19643"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(183701..183820)
                     /locus_tag="CDBI1_19643"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(183641..183757)
                     /locus_tag="CDBI1_19643"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(184218..185538)
                     /note="potential frameshift: common BLAST hit:
                     gi|302391857|ref|YP_003827677.1| HNH endonuclease"
     gene            complement(186021..186404)
                     /locus_tag="CDBI1_19658"
                     /db_xref="GeneID:12213071"
     CDS             complement(186021..186404)
                     /locus_tag="CDBI1_19658"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197071.1"
                     /db_xref="GI:384359216"
                     /db_xref="GeneID:12213071"
                     /translation="MIKGYLCKECKENNNGWCKKRKMQGLKSITECDFFIKHHDEENL
                     KETNIEGAKLYGKRELSYFLCKQIISLENKGKSNLSIDELKEMMVNINQVLDVEEEMT
                     GINIEYEVDKDVVNSNKRIIDSWDK"
     gene            complement(186671..187675)
                     /locus_tag="CDBI1_19663"
                     /db_xref="GeneID:12213072"
     CDS             complement(186671..187675)
                     /locus_tag="CDBI1_19663"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197072.1"
                     /db_xref="GI:384359217"
                     /db_xref="GeneID:12213072"
                     /translation="MGQILEMLKMNGLDLESIENQTPEMCIIAVRQNGLALKYVNNQL
                     DEICLEAVIENPDSLYYVNNQTEKICMEAIKRNAWSLVYVKNKTYKLCLMAVKQDGYA
                     LKFVNKEELNLSDEQMRDIYIEAVRQSGFSLQFIEEQLDEICKEAVKQNGLALQYVKN
                     QTEDICIEAVRNNGWALQDVKWDELNLSKEKEELVCIEAVKQTGHALQYVKEQTEAIC
                     LEAINQDVKSFFYVKNQTEKICINSLKQTGSIFKYIKDAKRYIKKFDIRFLVERGNVR
                     GVVAMKIDGVWRFTLGCQDNITKEAFIYKIYNTKGGFNLKEGINVHRKFYLNFLDQFK
                     "
     misc_feature    complement(187484..187606)
                     /locus_tag="CDBI1_19663"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(187349..187477)
                     /locus_tag="CDBI1_19663"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(187196..187321)
                     /locus_tag="CDBI1_19663"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(187136..187252)
                     /locus_tag="CDBI1_19663"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    complement(187040..187189)
                     /locus_tag="CDBI1_19663"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            188026..188706
                     /locus_tag="CDBI1_19668"
                     /db_xref="GeneID:12213073"
     CDS             188026..188706
                     /locus_tag="CDBI1_19668"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197073.1"
                     /db_xref="GI:384359218"
                     /db_xref="GeneID:12213073"
                     /translation="MILGKTIVLLFTTFFLLIIVQLIFYLILRSIRFFKRKNIFKKIQ
                     VGPNYKEMHYYTDEYFDIQPEFLIPIHGIQLIIKKFHNSFSILSSNKILIDLSKVYVR
                     KLEIDSFIKDNLSEEAKKNLIDKCKFDFSIFKELDYNNVYYPLIIRLFLELKNTIKTY
                     KDYVANGKSKIVKEVDESIIEFLNFYEKVYLNKNKNLSKEEEFMLDNLNKYKLLVKDI
                     EENISIHK"
     gene            188912..189484
                     /locus_tag="CDBI1_19673"
                     /db_xref="GeneID:12213074"
     CDS             188912..189484
                     /locus_tag="CDBI1_19673"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197074.1"
                     /db_xref="GI:384359219"
                     /db_xref="GeneID:12213074"
                     /translation="MNSWLKEECVLPDELIFPIYGLFSTIKELKKFYSKILTYDFKIK
                     LSKHYIYLLHIGAFIELNLSENIFEQLKKQNIFNWSFFEKLDCTNIYYNLIVQLFLSL
                     KDTIENLDQTTDKNKKKYIRKNIKRAKNKAIISFLFIFKKMYINGRSNELSEKEKKEK
                     DSLNNLDNYCSLIKNIEKDIFNNNKEKAIY"
     gene            complement(189519..189854)
                     /locus_tag="CDBI1_19678"
                     /db_xref="GeneID:12213075"
     CDS             complement(189519..189854)
                     /locus_tag="CDBI1_19678"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197075.1"
                     /db_xref="GI:384359220"
                     /db_xref="GeneID:12213075"
                     /translation="MGDFFIEEWYFVIFPDQRIVDFEETTISINELQVKFKMSENYWY
                     KEMDVEYSIYIPYSNSIFTKEYIEEFDINNPFENDEFCDELDNLRGEIEIGIEKYLKD
                     KKKLIDAEY"
     gene            complement(189959..190990)
                     /locus_tag="CDBI1_19683"
                     /db_xref="GeneID:12213076"
     CDS             complement(189959..190990)
                     /locus_tag="CDBI1_19683"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197076.1"
                     /db_xref="GI:384359221"
                     /db_xref="GeneID:12213076"
                     /translation="MIKRERNEEKTNELLQGLKDKNVTIENIDKYLNEQGVSVDVHVG
                     RHRNKVKINPALFGVDVEQNEELKSFFTDYMKPGALCFIPQIYEKKLATIESSLRTKK
                     LEMAIGYYGKYMPIEVYYEYEEFVEMKKKEYFQLRDEVVSIWNNLMSSFEAKLDNSLE
                     ALSAISKEEIKETIMKKMPTKDKYYNSFYVETSLKAFPIMENIGLFDDRLEEKVREEV
                     KKDSINAIYEIISQIMGEAFSCINKAYNYYNKNGHITNKYLISLQKLMHKMASKNILK
                     NKLIDDIIYAIKELVKDENLEDIAQGLEVILAQIYSFAKDIEIESLIDLSECELDEEQ
                     LLSLYDLVR"
     misc_feature    complement(190292..>190555)
                     /locus_tag="CDBI1_19683"
                     /note="Spore germination protein GerPC; Region: GerPC;
                     pfam10737"
                     /db_xref="CDD:256147"
     misc_feature    complement(189962..190114)
                     /locus_tag="CDBI1_19683"
                     /note="Cdc14 phosphatase binding protein N-terminus;
                     Region: Cytokin_check_N; pfam10407"
                     /db_xref="CDD:150988"
     gene            complement(191049..192008)
                     /locus_tag="CDBI1_19688"
                     /db_xref="GeneID:12213077"
     CDS             complement(191049..192008)
                     /locus_tag="CDBI1_19688"
                     /note="COG3481 Predicted HD-superfamily hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="YP_006197077.1"
                     /db_xref="GI:384359222"
                     /db_xref="GeneID:12213077"
                     /translation="MKIEELKFNSGVQKILCNVDVVENMTKKKDKYYLKMDFSDSTGK
                     VSIMIWDNDPNYEYYKGLNYALAEASLEFVKVNSGGYEEYALHDLVVKERPSITDCVD
                     KERLKDELRNIIRGVKDESLRNICFGVCKEKEILNGLFEAPGSEQSAYSFSGGILAHI
                     VRLCKLSIAIGNVFNSWTFNKEGFNEKVNVDLLITISILHDLGNVEAFEIKEGIVKKT
                     IKGKIFENSYLTSKILNNILDKYGSGLDESHRLLLEHAVTSSKGKQSYGAINTPRTKE
                     ANLFHNIEKIDILMGNFEFMDRCSLDGDFEKLFDKLYCLWDFE"
     misc_feature    complement(191118..191918)
                     /locus_tag="CDBI1_19688"
                     /note="Predicted HD-superfamily hydrolase [General
                     function prediction only]; Region: COG3481"
                     /db_xref="CDD:226012"
     gene            192257..192925
                     /locus_tag="CDBI1_19693"
                     /db_xref="GeneID:12213078"
     CDS             192257..192925
                     /locus_tag="CDBI1_19693"
                     /note="COG0419 ATPase involved in DNA repair"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197078.1"
                     /db_xref="GI:384359223"
                     /db_xref="GeneID:12213078"
                     /translation="MNDCNKLKRIEEYISTTKNSIALKMGKIEILNESISNKKSELVT
                     LSEKYQDYLTIKMLIEESCSEARTNASELYSQLSTSSIQDIFGDRYKVKLVLDSKDGT
                     PISEVKIIKKANGKEKEINPAEEDSGGLTDIIALSLLMAIGKTLDDNFAPNVFDEPTK
                     FVSKGIFSEKVAEFVSNLIDYTGKQAIISTHDNNLINIAKTNYKLIQDKETSITTIYK
                     MKGL"
     misc_feature    <192635..192886
                     /locus_tag="CDBI1_19693"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    192635..192661
                     /locus_tag="CDBI1_19693"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    192710..192727
                     /locus_tag="CDBI1_19693"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    192734..192745
                     /locus_tag="CDBI1_19693"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    192815..192835
                     /locus_tag="CDBI1_19693"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            192933..194753
                     /locus_tag="CDBI1_19698"
                     /db_xref="GeneID:12213079"
     CDS             192933..194753
                     /locus_tag="CDBI1_19698"
                     /note="COG0433 Predicted ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197079.1"
                     /db_xref="GI:384359224"
                     /db_xref="GeneID:12213079"
                     /translation="MANNLKKGIVLGATGVKYLNIVNQNKAFIQNEYLIIKDRVQGNV
                     PCEVIETSIIPIIDEPLLPKGCSLNVAEHAGFNLNEVTYIAKVKLLEEISCPILPNSD
                     VFHATYDEIKHIVNNVNEADCMTIGIIKGTEHSQNELPNNIRNVSPLWENGSISNQKG
                     IPIFLNHHSFRENPHIGLFGSSGSGKSSAIRVLIEELMRLNIPGLAFDPHNEFDFNKR
                     SDNLDSALNYNFEKKYKVLKIGEDIGIKFEELGIFELFSLFEYVGELTEPQKNILEVL
                     YQKGDTLKHLQHKISSIKNAFEKVEQNKWSKKKTNEDNLNSKEADLYYKYKDKISGVA
                     SLQALIWKCISLENTNIFTKDISDVKQTLLTGKWAIIRGDIQRLKMIASYLLRKLYFF
                     RKNYLNNSEAFFPPFFCMLDEAHGFAPNKSQKILPVKKILTELAQESRKSGIYLILAT
                     QKPNNLDSTLVSQLNTKIFLRLTNQEDMKIAQSEGNLTIDETKKLPDLQSGHGYISSA
                     TLNKTYSIRFRASFSKAPNTLDPFDELKRIKDDDKLASILISMLPINSFEIGLKIKEI
                     SSSYGERLSIKDITSKLEELSNQNKIKIENSSIGTKYECL"
     misc_feature    192948..194489
                     /locus_tag="CDBI1_19698"
                     /note="HerA helicase [Replication, recombination, and
                     repair]; Region: COG0433"
                     /db_xref="CDD:223510"
     misc_feature    193455..194099
                     /locus_tag="CDBI1_19698"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     gene            complement(194771..195619)
                     /locus_tag="CDBI1_19703"
                     /db_xref="GeneID:12213080"
     CDS             complement(194771..195619)
                     /locus_tag="CDBI1_19703"
                     /note="COG0827 Adenine-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="YP_006197080.1"
                     /db_xref="GI:384359225"
                     /db_xref="GeneID:12213080"
                     /translation="MRRKDSKRIEDNRKVSNLLEESRRRVLNEEEIEIIKNMHTGYGG
                     ISNNTQFFTPEVVINYMLDSLEATGFKGGKILEPSCGNGKFVNALISKFENVEITSVE
                     LNNELHYLNKICYPNVNTINGDCLEYLKEFEGKFDLVIGNPPFGKSCKRDGFEFGKSS
                     LESYFFELSLRALKEGGSLIMVLPDSILSSKKYFNLRKFTVDNFRIIQSISLPTTTFY
                     FYGTSVKTSILHLKKKDCNNKDYSIFMGIVDKIGWDSKGNKNENELISAYHEFKEFCK
                     IEKDIS"
     misc_feature    complement(195071..195400)
                     /locus_tag="CDBI1_19703"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(195194..195196,195245..195253,
                     195311..195316,195368..195388))
                     /locus_tag="CDBI1_19703"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     misc_feature    complement(194921..195217)
                     /locus_tag="CDBI1_19703"
                     /note="Eco57I restriction-modification methylase; Region:
                     Eco57I; pfam07669"
                     /db_xref="CDD:254345"
     gene            195844..196719
                     /locus_tag="CDBI1_19708"
                     /db_xref="GeneID:12213081"
     CDS             195844..196719
                     /locus_tag="CDBI1_19708"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197081.1"
                     /db_xref="GI:384359226"
                     /db_xref="GeneID:12213081"
                     /translation="MKESKIKDILEKFLIESSNRHEIRKKNHIWMYLVLLPPYGLYKA
                     YRNKAFSKHTLLFMLIAFIMIFILTLDTIAYPNRVLDSKVTQSINNFKDIGTVRRVNK
                     EGILYKKFFIYNTITTKGEYDVYLSNNNNTLKIDGINQTLPNRKMIYKNGIEDNLNGV
                     FAEIIRHISNDNKNIYGKIKSISKTYKNGQIINTEKGTFNFEVKFDNVINVFKLNKNN
                     IYTKIYSEPPQIKIPNDISKIIKRNRKKIGNIKQVISYNLTPKAEEYIYLSDNGFYYK
                     IVKDLNKEIKIFKQK"
     gene            complement(196779..198140)
                     /locus_tag="CDBI1_19713"
                     /db_xref="GeneID:12213082"
     CDS             complement(196779..198140)
                     /locus_tag="CDBI1_19713"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleotidyltransferase"
                     /protein_id="YP_006197082.1"
                     /db_xref="GI:384359227"
                     /db_xref="GeneID:12213082"
                     /translation="MFDLSIELKKFYYNEVVLSSEETKNLREKKKLNIKRLREGLSDY
                     NADYNTNYAIAETLEQGSVAMSTVTQNEKNDYDIDVAIIFDKSNLNGLGPIAVKNVVA
                     DALKRKCTNFKTQPESKTNCVRIIYSDNYHIDFAIYRRIRNDDGSYNYEHAGSEWRPR
                     DPRAINKWFRDEIKEHTEDLRKVVRLLKMFSKSRELWKMPGGLIQSVLSEEKIQNYKR
                     MDELFFYTIREISVRLKKSIEVYNPTDDTQSLLLKQSDYKKMSNLCNRLENKLSALDI
                     LFDNECTKKDAVQAWYEIFNHDYWTYKEDENNMKFESFNKSFDTFEYDDTEEYIRNIV
                     PVSNKYKITLDCRVIDKNGTIKKLSTIYNNGKSIPLNRKLLFYLDENRVPKPYDIYWK
                     VKNEGVEAIERNCIRGQIFKNADPCFETIEERSDFVGNHYVECYIIKNGVCVAKDRID
                     VNI"
     misc_feature    complement(197628..198044)
                     /locus_tag="CDBI1_19713"
                     /note="Nucleotidyltransferase (NT) domain of
                     2'5'-oligoadenylate (2-5A)synthetase (2-5OAS) and class I
                     CCA-adding enzyme; Region: NT_2-5OAS_ClassI-CCAase;
                     cd05400"
                     /db_xref="CDD:143390"
     misc_feature    complement(order(197649..197651,197658..197660,
                     197670..197672,197739..197741,197775..197777,
                     197784..197789,197904..197906,197910..197912,
                     197934..197942,197946..197948,197955..197963))
                     /locus_tag="CDBI1_19713"
                     /note="active site"
                     /db_xref="CDD:143390"
     misc_feature    complement(order(197649..197651,197658..197660,
                     197670..197672,197784..197786,197904..197906,
                     197910..197912,197955..197960))
                     /locus_tag="CDBI1_19713"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143390"
     misc_feature    complement(order(197739..197741,197904..197906,
                     197910..197912))
                     /locus_tag="CDBI1_19713"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143390"
     gene            complement(198168..199271)
                     /locus_tag="CDBI1_19718"
                     /db_xref="GeneID:12213083"
     CDS             complement(198168..199271)
                     /locus_tag="CDBI1_19718"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197083.1"
                     /db_xref="GI:384359228"
                     /db_xref="GeneID:12213083"
                     /translation="MIIVLCFLIIVIIIGIIFTVLKFKKSKKEEGVASLLFTTGITLI
                     TSSTPATIDKCLDLLCNMTKLNNTVSSTDGFNYPYFVVGVILVGISIFQYIHIKKKIY
                     ILNINGYMHKKIEDFFGNLKMDNFEFKEREIDFVKIYKKLFCYKLNEEAFMCIKEDIE
                     DKVKAFKEETKNNIKRGYTGIAPIPFIMYAGTFLQRENIDEYYELDKISSETYYKLTT
                     HKGVDFQEIKLKTDINSLNKSNTELVVAISLTQKITDSDLSQFSNIDKIHIGIDDLKD
                     NAIRSKEILNEYKNFIFDNIEKLLKEFPYLKTIHLVYAGQSCLALEMGKRSFDSTRLP
                     EIIIYQYEGQSNKKYPWGIIINGQKKGDLVKAE"
     gene            complement(199537..199986)
                     /locus_tag="CDBI1_19723"
                     /db_xref="GeneID:12213084"
     CDS             complement(199537..199986)
                     /locus_tag="CDBI1_19723"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197084.1"
                     /db_xref="GI:384359229"
                     /db_xref="GeneID:12213084"
                     /translation="MYIALEKKMLISLVIIVMLLSVFSVQSYAINEQKVEPIKNEDIY
                     NNTKGDKNGGYMTGDDVMEKVTMDEFSDRVEKKGFEIIKFMKVFANPFFTICFIVALI
                     FTAIGAFCKRGGFLWIGISAMIIVAFSYTAVIYSSDILRWVQTWIVS"
     gene            complement(200244..203444)
                     /locus_tag="CDBI1_19728"
                     /db_xref="GeneID:12213085"
     CDS             complement(200244..203444)
                     /locus_tag="CDBI1_19728"
                     /note="COG0741 Soluble lytic murein transglycosylase and
                     related regulatory proteins (some contain LysM/invasin
                     domains)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197085.1"
                     /db_xref="GI:384359230"
                     /db_xref="GeneID:12213085"
                     /translation="MNNDERNPQEEQQRLNREILNSINKKRKKSFMKKIYNVGKKISK
                     LVSRLFLTFFKTIILPILPLLIGFIIIIFLVFFSWDLIFNSRGKTMDYQAEDVTQYNQ
                     VALDDKGDITSTDFSTGNKIVQAFYTFFAEKSIWVVVKEDGINEPVQFNSEEYVKKYG
                     ENGMRDKYQREKKFYLNPNALWSLDEFLNKNQFRFPEQFVQPVQHDKDTLELKQLTDK
                     NRKLTAKSKEYDLNTKKPKVNGKKTEGVWDYGFGSILNYKKFKEESKKEGLFSEIEIW
                     DTENETKVKVPIDEAEDMVKSDRYTSFNSSYKNKLYSKKMPERDETVYMIDQVTSPLG
                     LIKNNIVQEWVNTNETFTASESFTKTVTVGGKPKKIEFNAYVTGNIQKFEARYEGEPD
                     ASQLVGGQYFEDYIGNYTTYVPKEVLTSFNFKDRTGKTDKELLKLLDRGAFGEGSAEG
                     GTSSGTVDLGSFKLGSGASSDNYKKAMQYYDIFKKYGEMYGVDPKLLIAIACQESGGS
                     HESYLGASRCASAGCGIMQIEQPGKTITKATAFNHNTGQMETMSINMGTVTSIDGNIK
                     AGAMLQAERMKAQNYNIILALQTYNYGTGVANIMLKTYAQATGKTPEEVRNNPTDLGW
                     LAYRADISDNPGKYINGWSHSRYGDKQYVEHVLRYYVADGGSGIWVKKEDGSTVTISP
                     DGTFEIGSGSGGSSGSSSNSKDGWLKGIWEKLKEGWNKLFPEFEKPLSERRLEFSNKY
                     PENQIQNVIKMMFVMEERKYITEYEDFTDEQWKKKYILLFTNPLGDSWGSGNGSNQNI
                     DVASIFPKGFEAPIDVSPVTIGKVYDQVHQGIDLVAIKGTEVKAISDGKIIEVSSSSI
                     KIQHDGTTQTYYSNLQEVLVKQGDSVSKGQVIGKTGGGKEGNVLHLELSVNGAKQDPS
                     WIVTGDFIAGDYNINASDAEIIKKVIDLGRTKIGCPYVWGAKGPNSFDCSGYTKWLYK
                     QVTGVSIGDGTIGQVSTMKNFKVDINNIQPGDLLYRIGGSGNHVVMYIGNGKCMEAMG
                     TKWGVVYSDFSKCKSRGLNKVYRPIAYINSKKGIKN"
     misc_feature    complement(201627..>202028)
                     /locus_tag="CDBI1_19728"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    complement(201465..202016)
                     /locus_tag="CDBI1_19728"
                     /note="lysozyme_like domain.  This contains several
                     members including Soluble Lytic Transglycosylases (SLT),
                     Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes
                     (HEWL), chitinases, bacteriophage lambda lysozymes,
                     endolysins, autolysins, and chitosanases; Region:
                     lysozyme_like; cl00222"
                     /db_xref="CDD:260275"
     misc_feature    complement(201933..201935)
                     /locus_tag="CDBI1_19728"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238249"
     misc_feature    complement(200706..>201080)
                     /locus_tag="CDBI1_19728"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    complement(200706..200966)
                     /locus_tag="CDBI1_19728"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     misc_feature    complement(200280..200756)
                     /locus_tag="CDBI1_19728"
                     /note="Cell wall-associated hydrolases
                     (invasion-associated proteins) [Cell envelope biogenesis,
                     outer membrane]; Region: Spr; COG0791"
                     /db_xref="CDD:223862"
     misc_feature    complement(200328..200603)
                     /locus_tag="CDBI1_19728"
                     /note="NlpC/P60 family; Region: NLPC_P60; pfam00877"
                     /db_xref="CDD:189752"
     gene            complement(203555..206203)
                     /locus_tag="CDBI1_19733"
                     /db_xref="GeneID:12213086"
     CDS             complement(203555..206203)
                     /locus_tag="CDBI1_19733"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197086.1"
                     /db_xref="GI:384359231"
                     /db_xref="GeneID:12213086"
                     /translation="MIKRKLRKFLALGLLGILTSSTLIGVNNIDSYAHNTYFISVTLD
                     ESSYNYVPNVIFEQNSWSANKHAEADLGNFTTVSEQSNSDIKSKNLKVPILKYEGIKD
                     EQVKESYDSAMKVKENDEGTKEDDATRGSGDGSKSLIFTFPALHGKGLLVDSVNANAE
                     DEKRADLVADVLIGGLNNALNFCLSSTEGNFTIEQIKAFSANLANKAINKSGSVSLGE
                     VSFTISSASEKDLKKLMDGTTIKDYIKITSPNNGSIIVPMQIFKGYVASGSREPERKL
                     NSDYYKQLKEGGDVKYLNWKHVVLQGNYNADVKKITFSNENEISKPNQLTIMVGDFLN
                     GMLSGLRRLLGLYPMEDLMLNTGVRDNNYYYGIMPNGWMSSATLLNIVCQIVAWNLIG
                     FSIVRMLLKRQLATINISEKLSLMEGFKNLIITAFLLCTFTLIFQGFLKVNYELVDMF
                     GKSSSFSSYIGTTHTMNSGLIATILINIAFFVINIYFNFFYVLRAVTIALLYAVAPLC
                     IFSLSLGGKYVQIFSNFMKELVSQIFIQTFHAILVAFFTSVTSTQKMKTFELFVVFCS
                     FIPLTNFLRSNILGLPSGITDQAERISGMGRAIVGGAVAGVVGESVGGKGKAGGVVDN
                     EMIGMGINSRPSSFSSALKDKYINGSSSYNGIDNKDLLSGIEDSNKSNYATQVYGEKN
                     SFDKAVDTAKTVGSIGKSVGKAVGTAGLSMGYGVIGDNRGMERIGAGMASATSSIRNS
                     LGGNSPDLSGFGISSIYDNGESNTAVYDAQIGEHGVKFNNSSIDDSTYGRNLNEMYNV
                     FNSNGEYSDDKEKGYLRDSAKQYYQSQGIIGVGTVSGDNGEKQMAVNFDKSMVSKNRN
                     FSLRDIGEIKPYEPMAKSANLKKDIK"
     misc_feature    complement(204500..>204949)
                     /locus_tag="CDBI1_19733"
                     /note="7TM diverse intracellular signalling; Region:
                     7TMR-DISM_7TM; cl09440"
                     /db_xref="CDD:263781"
     gene            complement(206223..208145)
                     /locus_tag="CDBI1_19738"
                     /db_xref="GeneID:12213087"
     CDS             complement(206223..208145)
                     /locus_tag="CDBI1_19738"
                     /note="'COG3451 Type IV secretory pathway, VirB4
                     components'"
                     /codon_start=1
                     /transl_table=11
                     /product="Type IV secretory pathway VirB4 component-like
                     protein"
                     /protein_id="YP_006197087.1"
                     /db_xref="GI:384359232"
                     /db_xref="GeneID:12213087"
                     /translation="MFFKKKKEKSTAKIIDFNKDDILNETNLLDKGIPSLKELISPSS
                     FEVDADYIKIGKKYVRSFIMQGFPAQVYVGWLDSIFNYEGETDTTIHIDPTDDKIALE
                     EYTRKITQFEAQLMSEQEKGNIRNITRLRDKIQELYMERSKLERNTDKLFQVQIACNL
                     YSDSLDELNKETQKIDNKLRGRKMYMMPTYLRQDDTYKTVSPYGKSYVEDMFRNFNSG
                     ALTSCFPFYNSDIRHEKGVFCGINLSTCSPILIDFYDRSKLKNSNITVIGQPGTGKTF
                     FVSLLTMRSALRGIRTVIIDPESEYGRLTEALGGSRIYLATDSKECINPFDIEEEDEL
                     DENFLPTGIKLVDVKGKIADLLNLIAVMAGGLSGAQTSTVAQLLQELYESFGITKNPK
                     SLYVTEPYFDKNTKEFIHEGRKKTMPIFSDFYNSLSEYAEKNSDIEVMDLVRVLKMFK
                     KGGVYDLFDCYTSSNISNFKNSPIVTFDVSKLEENILRPIGMYVALSWTWEKFGKKDP
                     YINKRIVCDEAWMLVSKNMAGSEYSAKFLETASRRIRKRMGGLLVASQKFTEFVESTQ
                     GQAVLTSAETKIFLGQDTTDIDSIQNMFKLSEGEKLFLLRADKGEMLVRIQGESTVVK
                     VLAFDFEKKLIEKRTA"
     misc_feature    complement(207762..>207962)
                     /locus_tag="CDBI1_19738"
                     /note="Catalytic NodB homology domain of the carbohydrate
                     esterase 4 superfamily; Region: CE4_SF; cl15692"
                     /db_xref="CDD:265761"
     misc_feature    complement(206352..207365)
                     /locus_tag="CDBI1_19738"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     misc_feature    complement(<207258..207356)
                     /locus_tag="CDBI1_19738"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cd01983"
                     /db_xref="CDD:238941"
     misc_feature    complement(206682..207350)
                     /locus_tag="CDBI1_19738"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     gene            complement(208162..209130)
                     /locus_tag="CDBI1_19743"
                     /db_xref="GeneID:12213088"
     CDS             complement(208162..209130)
                     /locus_tag="CDBI1_19743"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197088.1"
                     /db_xref="GI:384359233"
                     /db_xref="GeneID:12213088"
                     /translation="MIIVMLFFILFVIGLIGFAFYKIKETDPNRGNGASKNNYYADNA
                     QDALMFEDIRDNVIHLGGHQYRAIIKCNSINYNLKTDKEQAVIEIAFQRFINSLSHPI
                     SLYVQTKEIDNSRVMDLFQKDIEKTIEEFPLLRDYAILNIDDMNNMFFEIGNNKEKNK
                     YIIVQFNDSTTLTDSDDDEKYEYSLKEIYGRCQRIIDGLTSVGLKAEILNTYDLIDLL
                     YSTYHKDNASQVNNILNGEFLSRIVTGEDRLNKISNNPEATLDWILYEAQIRLKTEIL
                     ENKIIEDTDKEKATDSMIKIDKIRNSIAGFYKSNENEINKKHENAN"
     gene            complement(209127..209435)
                     /locus_tag="CDBI1_19748"
                     /db_xref="GeneID:12213089"
     CDS             complement(209127..209435)
                     /locus_tag="CDBI1_19748"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197089.1"
                     /db_xref="GI:384359234"
                     /db_xref="GeneID:12213089"
                     /translation="MPRVNLMPPDTNEEEKAIGGLITFNQFFWLLGGFVLGIITYLII
                     IYSIKLQFIAIPMAVIVFLSSAPFAFFKKHDMPLFKYLNIKRKYNKKNKKLINRRKLN
                     "
     misc_feature    complement(209190..209405)
                     /locus_tag="CDBI1_19748"
                     /note="PrgI family protein; Region: PrgI; pfam12666"
                     /db_xref="CDD:257204"
     gene            complement(209587..210018)
                     /locus_tag="CDBI1_19753"
                     /db_xref="GeneID:12213090"
     CDS             complement(209587..210018)
                     /locus_tag="CDBI1_19753"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197090.1"
                     /db_xref="GI:384359235"
                     /db_xref="GeneID:12213090"
                     /translation="MNAVLVNSKKIVLMFMLSLIMCMTFLQTDKIESYAGNDIGDVKV
                     EVNGSGGLSVSGGGMDYKDGASSWNGFLGKIKFFVVGLSGVGALIGLGSLIFHFSKLA
                     STATNPQERSKVLTGIMWSVIAMAGLGSISIIGGFFYGILK"
     gene            complement(210132..210779)
                     /locus_tag="CDBI1_19758"
                     /db_xref="GeneID:12213091"
     CDS             complement(210132..210779)
                     /locus_tag="CDBI1_19758"
                     /note="COG1191 DNA-directed RNA polymerase specialized
                     sigma subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Sporulation sigma factor SigK"
                     /protein_id="YP_006197091.1"
                     /db_xref="GI:384359236"
                     /db_xref="GeneID:12213091"
                     /translation="MPFETKKTLNYSDGAKIEKEFYTKEEKEKVAYANNKLIHHVIKQ
                     LNTNVASHDELYSVGLVGYAKALESFDKKRNVKFSTYAINCIRNEILYFLRKENNHNK
                     NTVSFNKILSSDKDGHNLELEDIISEDEISKKRFEDNLVDKEDRETILKALEFLKEEE
                     RIVIIYRFGLNNGIMMTQSEIGKMINMSQANISKIQKSSIDKLRLILDKNIYYKQ"
     misc_feature    complement(210168..210710)
                     /locus_tag="CDBI1_19758"
                     /note="RNA polymerase sigma-70 factor, sigma-B/F/G
                     subfamily; Region: SigBFG; TIGR02980"
                     /db_xref="CDD:234078"
     misc_feature    complement(210489..210671)
                     /locus_tag="CDBI1_19758"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(210168..210344)
                     /locus_tag="CDBI1_19758"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(210180..210182,210186..210191,
                     210195..210203,210207..210212,210216..210218,
                     210246..210251,210279..210281,210309..210311))
                     /locus_tag="CDBI1_19758"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(210930..211382)
                     /locus_tag="CDBI1_19763"
                     /db_xref="GeneID:12213092"
     CDS             complement(210930..211382)
                     /locus_tag="CDBI1_19763"
                     /note="COG0541 Signal recognition particle GTPase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197092.1"
                     /db_xref="GI:384359237"
                     /db_xref="GeneID:12213092"
                     /translation="MIVKRRMKLQELDGEDVIAMKAVGDFEKFLHSYYNPHGFSYVNS
                     KNEFVTDKEYYKLLLKSGNCIKMGDFMIFKEGYHESYEEYANKYLSEINSKCSFDLAE
                     LNSVSNFGVVNSTIDMVKRNLYPKERAFKIIEKYFRNPRYAQNILNLI"
     gene            211525..212190
                     /locus_tag="CDBI1_19768"
                     /db_xref="GeneID:12213093"
     CDS             211525..212190
                     /locus_tag="CDBI1_19768"
                     /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiol-disulfide isomerase-like thioredoxin"
                     /protein_id="YP_006197093.1"
                     /db_xref="GI:384359238"
                     /db_xref="GeneID:12213093"
                     /translation="MNIKRIIGLILFLSTIILAGCSNVTNDNDTIKHKSEVKQTIKSS
                     EDKLLEYTEEGMNILKANYPTFEKMDLALKNIGNSVSNLTLNNTDGEPFKFNKLNGKK
                     VILSVNKTDCSFCKKTSMLIDKVIKDTDIIYIPLFIKSTNDEINDYYENLNLNKPNTI
                     LVDENLSFIKEASIKNVPTLFFIDENNRISLIKEFDYDKITLTDDLKLAFESPKIYKM
                     KVK"
     misc_feature    211768..212091
                     /locus_tag="CDBI1_19768"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(212251..212982)
                     /locus_tag="CDBI1_19773"
                     /db_xref="GeneID:12213094"
     CDS             complement(212251..212982)
                     /locus_tag="CDBI1_19773"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197094.1"
                     /db_xref="GI:384359239"
                     /db_xref="GeneID:12213094"
                     /translation="MNDVYIKKSIKKISLNGIIFLRITNFDAYGNIINIKLYQKINNR
                     YKPVDMLDIPFSMINSINTSSLYKSVSKKEESKIINKLNILKKNILKKNSFNLDYIKI
                     GIICDIYYILGKDKNSDFYGLNSIKVNEIGEIIKIGVLDYNEIVYVLIDLLKDENIEE
                     RLFLIDINKFSFIKKVKEYYVVSFYSLLSEEENEQYVNKDNYLILMVKNNSFQIILSE
                     EANIMGILDKKDFNVVDESFLKMIF"
     gene            complement(212983..213753)
                     /locus_tag="CDBI1_19778"
                     /db_xref="GeneID:12213095"
     CDS             complement(212983..213753)
                     /locus_tag="CDBI1_19778"
                     /note="COG0541 Signal recognition particle GTPase"
                     /codon_start=1
                     /transl_table=11
                     /product="Stress protein"
                     /protein_id="YP_006197095.1"
                     /db_xref="GI:384359240"
                     /db_xref="GeneID:12213095"
                     /translation="MKNIFNFGRKKNTGDESKENINNEKNSIELKKEKVNLRKDTVSK
                     ICLTKSNFNDIKNMKFDVVLVLDCSLSTSDLFENGTIQDIFERLLPISLSFDNDGMLD
                     VWLFNEEAYQLTSIDMNNLFNYVKNEKLFKKYVRGGTKYAPVIKEIVKEKTELNEAKE
                     PVYIIFITDGDNSDKKEAELVIREASNKPIFFQFIGIGKQKFKFLEQLDVMEGRVVDN
                     ANLFALNDINNISDEELYERVMKELPEWVREAKKKGIF"
     misc_feature    complement(213112..213573)
                     /locus_tag="CDBI1_19778"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(213247..213249,213337..213339,
                     213553..213555))
                     /locus_tag="CDBI1_19778"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(213813..215174)
                     /locus_tag="CDBI1_19783"
                     /db_xref="GeneID:12213096"
     CDS             complement(213813..215174)
                     /locus_tag="CDBI1_19783"
                     /note="'COG0577 ABC-type antimicrobial peptide transport
                     system, permease component'"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="YP_006197096.1"
                     /db_xref="GI:384359241"
                     /db_xref="GeneID:12213096"
                     /translation="MKIIDYFKLSYSNLKKRKIRTLINIFSIAIGVTLIVTLVSLGSG
                     LKSYVMSQIKELNNLQHVSVYNTKVQSSEELEKKLAKTDANGDIDVENLYEKKKINDK
                     VINSLSKDKRISQLLVKYETELTEIQYGDKKIKEIKAVSYDGDFYLKSEKASLKQKEE
                     ADNSSLSYILEGRELNNKDKNAVMLPESFVKNTLEIDNLKDIIGKEINLKLVLPDFNK
                     DKVFDRKATIVGVINKKYYQPSFVMSKDLMTDIKNFEEGGNKSLKERGADVLELSITN
                     LENVEKVVSYIEQNLGYTTESVQSVAKIIEKILLGINIILSVVGIITILVASLGVINT
                     MIMSINERTKMIGLMKATGASKVDILCLFLVESSVIGLLGGCLGSFLSYFNLLGIKGI
                     ITYILECLEINQVSFLDKIVNMNLSITILTICFAVVLTMLAGLYPSIKASKLNPIDAL
                     KFD"
     misc_feature    complement(213819..215174)
                     /locus_tag="CDBI1_19783"
                     /note="ABC-type transport system, involved in lipoprotein
                     release, permease component [Cell envelope biogenesis,
                     outer membrane]; Region: LolE; COG4591"
                     /db_xref="CDD:226957"
     misc_feature    complement(214308..215138)
                     /locus_tag="CDBI1_19783"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    complement(213837..214226)
                     /locus_tag="CDBI1_19783"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            complement(215171..215833)
                     /locus_tag="CDBI1_19788"
                     /db_xref="GeneID:12213097"
     CDS             complement(215171..215833)
                     /locus_tag="CDBI1_19788"
                     /note="'COG1136 ABC-type antimicrobial peptide transport
                     system, ATPase component'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197097.1"
                     /db_xref="GI:384359242"
                     /db_xref="GeneID:12213097"
                     /translation="MIEIRNLEKEYILGNNCVKVINNINLTINDGEFVAIVGSSGSGK
                     TSLLNLLGGLDKPSSGNIFVQNKDITKLKDREMSEYRRDLVGFIFQEFMLEGNKTVQE
                     NLMMPLIFSKVEKKERLNRVNEVLDKVGIKDKLMCKANELSGGQRQKVAIARALINEP
                     KILLADEPTGNLDSKNGELIINLLKELNKNNNYTILLVTHNIEQASQAKRIVKIKDGE
                     IL"
     misc_feature    complement(215177..215833)
                     /locus_tag="CDBI1_19788"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    complement(215177..215830)
                     /locus_tag="CDBI1_19788"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    complement(215699..215722)
                     /locus_tag="CDBI1_19788"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(order(215234..215236,215333..215338,
                     215564..215566,215696..215704,215708..215713))
                     /locus_tag="CDBI1_19788"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(215564..215575)
                     /locus_tag="CDBI1_19788"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(215381..215410)
                     /locus_tag="CDBI1_19788"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(215333..215350)
                     /locus_tag="CDBI1_19788"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(215315..215326)
                     /locus_tag="CDBI1_19788"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(215228..215248)
                     /locus_tag="CDBI1_19788"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            complement(215943..216428)
                     /locus_tag="CDBI1_19793"
                     /db_xref="GeneID:12213098"
     CDS             complement(215943..216428)
                     /locus_tag="CDBI1_19793"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197098.1"
                     /db_xref="GI:384359243"
                     /db_xref="GeneID:12213098"
                     /translation="MYSSFDYLKEVEAVFLNPIVVITLTLFLLFASYSDFKYLKIYHK
                     FNFIFFLLRIVFVFLPISSLPLTLSNINGVIFGFCLMYIPAMFCGVSKGGDIRFISIL
                     GLYLGFPLLLNMLLITYCSIIIYLIVRKFIFKKNVTNLGIPLAPFVLIGYIINCVIFY
                     I"
     misc_feature    complement(<216075..216359)
                     /locus_tag="CDBI1_19793"
                     /note="Flp pilus assembly protein, protease CpaA
                     [Posttranslational modification, protein turnover,
                     chaperones / Intracellular trafficking and secretion];
                     Region: CpaA; COG4960"
                     /db_xref="CDD:227295"
     gene            complement(216433..217080)
                     /locus_tag="CDBI1_19798"
                     /db_xref="GeneID:12213099"
     CDS             complement(216433..217080)
                     /locus_tag="CDBI1_19798"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197099.1"
                     /db_xref="GI:384359244"
                     /db_xref="GeneID:12213099"
                     /translation="MGLELILSKIKNRLNNNDGSIAILGCALILVFVTVATGFLSLSN
                     SSWVLNEVQSIMDLSTTNALQQSINNEYLRQEVINVSNSDSSISNDGVLNVNNKLLSD
                     VINTSFRKELNRQVGLTPFIQKIDINYLKPELVYENWGLNYAGDLNKERPQLILDSIV
                     QITLKNYREFDNLGSYIINEYNARDNGNMKISVEGKTGDGNLILTIRTLSRLVYR"
     gene            complement(217082..217636)
                     /locus_tag="CDBI1_19803"
                     /db_xref="GeneID:12213100"
     CDS             complement(217082..217636)
                     /locus_tag="CDBI1_19803"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197100.1"
                     /db_xref="GI:384359245"
                     /db_xref="GeneID:12213100"
                     /translation="MLKVIKDKIKNKNGMVFIEFLVGFLVFIFIFSFFFDLFQIGSKK
                     FVMTQQASQIVRQLAKQSGIQSQVPLNYPGGGGSYLTSSQLIKVTEDKFKKIGVKPED
                     WSIEIILRDKAQANGERVISLSDTSNIKADYRDSIGIRFTYSYNWGLWSQLVPGDFNK
                     TTNVDKYAFCEYKHDYSNWKGEED"
     gene            complement(217805..218125)
                     /locus_tag="CDBI1_19808"
                     /db_xref="GeneID:12213101"
     CDS             complement(217805..218125)
                     /locus_tag="CDBI1_19808"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197101.1"
                     /db_xref="GI:384359246"
                     /db_xref="GeneID:12213101"
                     /translation="MNNQLLIKTESYNTNKCSAFFEGLSQKKNNFLTKSTYKIKNFLT
                     KEDGLVDRSKRAMAGEDGMELLQMVIIISVVLVIATAVFLLRDKIVAYFSRATGEVDK
                     LQVK"
     gene            complement(218220..218717)
                     /locus_tag="CDBI1_19813"
                     /db_xref="GeneID:12213102"
     CDS             complement(218220..218717)
                     /locus_tag="CDBI1_19813"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197102.1"
                     /db_xref="GI:384359247"
                     /db_xref="GeneID:12213102"
                     /translation="MGVYYIFYIKFLLKNAVKEKKLKILSGFPDFINVVQGFLVSDMT
                     LVKAIESSIPYVGTEWSKLAQEFVIDSKTNSQEKCIEIIYEKIDIFEVRELWSLIKLN
                     SEQGINIKECFSNQAKKITDLNMELIHKKINTRQIMATLVQAPLLLLLLIAISLPMVS
                     QMLIL"
     misc_feature    complement(<218352..>218705)
                     /locus_tag="CDBI1_19813"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; cl19503"
                     /db_xref="CDD:267856"
     gene            complement(218678..219115)
                     /locus_tag="CDBI1_19818"
                     /db_xref="GeneID:12213103"
     CDS             complement(218678..219115)
                     /locus_tag="CDBI1_19818"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197103.1"
                     /db_xref="GI:384359248"
                     /db_xref="GeneID:12213103"
                     /translation="MDVNMLKWISALCAFLIFIPLVRNMLRILFHQEDESLHKKRLKQ
                     LQKTEKRKSEQEKNKEFIEKITTPVSTYILPKIDKKKDLTQLEKDLKMCNWDKYFTPA
                     TFISLDITMKILAVIIGLIVYSIANLILALLWGSIIFFILNFY"
     misc_feature    complement(218837..>219025)
                     /locus_tag="CDBI1_19818"
                     /note="HOOK protein; Region: HOOK; pfam05622"
                     /db_xref="CDD:253283"
     gene            complement(219145..220098)
                     /locus_tag="CDBI1_19823"
                     /db_xref="GeneID:12213104"
     CDS             complement(219145..220098)
                     /locus_tag="CDBI1_19823"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197104.1"
                     /db_xref="GI:384359249"
                     /db_xref="GeneID:12213104"
                     /translation="MNKYVLFTIITLLLYIAIALVLSKVANKNKEIKIKSRFGNKYFR
                     SSDVSVKKQIEEKMSQRASIKKKYKVETTCLQAGYNINYGEYSVICLAMAISLPLIMM
                     ILLKNIILAIVFIFIGYSVPWQFFKTLSNKRVTKMESQIGSFIRIIIERYKINKNISK
                     SLVETLPDFQGSEPLYSELKKSVVDIDLGIPIEEVLSSLARRTGSKYLKLFSNYYEVS
                     SMLSSQESKIKILTTSFNQYEDNRIIKRDLRKEIMGPVRESYIMVFAIPVLMLYQSFV
                     SDGYLDFMINEKIGQMGLTGIFVSILLCVWFINAKIGAPLD"
     misc_feature    complement(219175..220089)
                     /locus_tag="CDBI1_19823"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; cl19503"
                     /db_xref="CDD:267856"
     gene            complement(220166..221569)
                     /locus_tag="CDBI1_19828"
                     /db_xref="GeneID:12213105"
     CDS             complement(220166..221569)
                     /locus_tag="CDBI1_19828"
                     /note="'COG4962 Flp pilus assembly protein, ATPase CpaF'"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein E"
                     /protein_id="YP_006197105.1"
                     /db_xref="GI:384359250"
                     /db_xref="GeneID:12213105"
                     /translation="MAINKEFHSFNKDITKNIGSNKKGSSYLYDYDEAYELLKVNENF
                     KSAMSEDVDLKLENKNKIIKKDKKYFREKKKNYMDMIVSTINASGIEVRGYENDLQKL
                     ALEMVEDLFGYSTIKELMYDDKVTDVYCLSKNKIYYERDGSESPIKFNKSFKSDEHYK
                     NFIERLLKEADKSMLDNGEFKSIDFDLYEDRYNALSTAISPNGYVLTIRKHSENHIKL
                     PQIIEKECMTQYVADFVGTLIRGGCNLIIAGITGSGKTTTMRALLDYFVAQMNRRMLV
                     CEDTRELFPENDHTLELVTSEGADEKDKSNIDLRDLVKIALRQKPRYIVIGEVRGVEA
                     ESAVEAMETGHATIFSMHAGTAIDAINRLVTKYLMQMPTLGVDVVERIIGSALDYILI
                     QDDIPGIGRRVTSITEISFDNETRRIITTPIIKFNFRSKTFDFKNNLSEEKADKMLRK
                     GIKIDELSEYMHKEWTA"
     misc_feature    complement(220277..221284)
                     /locus_tag="CDBI1_19828"
                     /note="Flp pilus assembly protein, ATPase CpaF
                     [Intracellular trafficking and secretion]; Region: CpaF;
                     COG4962"
                     /db_xref="CDD:227297"
     misc_feature    complement(order(220802..220810,220820..220825))
                     /locus_tag="CDBI1_19828"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(220586..220591,220733..220738,
                     220742..220744,220802..220810,220820..220822))
                     /locus_tag="CDBI1_19828"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(220589..220603)
                     /locus_tag="CDBI1_19828"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(221687..223144)
                     /locus_tag="CDBI1_19833"
                     /db_xref="GeneID:12213106"
     CDS             complement(221687..223144)
                     /locus_tag="CDBI1_19833"
                     /note="COG4753 Response regulator containing CheY-like
                     receiver domain and AraC-type DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning ATPase-like protein"
                     /protein_id="YP_006197106.1"
                     /db_xref="GI:384359251"
                     /db_xref="GeneID:12213106"
                     /translation="MKKILLSIGQPKLDNKIKTDVIPKVHMELVGEVENKEYLIEKIE
                     ETNPDLLIISKMLKGAGLSILELLLTIKREYPKLRIIFLAGEVDEKNKEKYKELAVLV
                     KAGIYDILHRKSIKPREIVHLVENPNTRKQVEYLLKYEKDNIIYEDEIVEIEEEKEVK
                     DLEKEGYKNVYVISSIKPGTGKSFLSTNIATNIAKYGRNKDGSRPKVALVESDLQNLS
                     VGTLLQIEDNNKNLKNVMEKIDTIIVNGGESLVDDPLKIKSVNEYIRSCFKQYKNCKN
                     LWALTGSQFTMEEIENIKNYHYTYLIENILDDFDVIIIDTNSALEHVSTYPLLRLCNT
                     AYYILNLDFNNIRNNSKYKETLDNINVLNKIKYVLNEDIDKDYKILTGETMLEELTFK
                     SDMLEENGFNVIAKIPEIPKEIFLNRLYQGIPIVLDNTNYTLKARLELAKVAKEICEI
                     ENFDWLCKEYQNYSMSINEKLKKTKKKKFSLFNKK"
     misc_feature    complement(<222770..223066)
                     /locus_tag="CDBI1_19833"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(222770..>223057)
                     /locus_tag="CDBI1_19833"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cl19078"
                     /db_xref="CDD:267431"
     misc_feature    complement(order(222803..222808,222818..222820,
                     222893..222895,222953..222955,222983..222985))
                     /locus_tag="CDBI1_19833"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(222983..222985)
                     /locus_tag="CDBI1_19833"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(222953..222961,222971..222976))
                     /locus_tag="CDBI1_19833"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(222800..222808)
                     /locus_tag="CDBI1_19833"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(221789..222640)
                     /locus_tag="CDBI1_19833"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(222119..222640)
                     /locus_tag="CDBI1_19833"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            complement(223352..224131)
                     /locus_tag="CDBI1_19838"
                     /db_xref="GeneID:12213107"
     CDS             complement(223352..224131)
                     /locus_tag="CDBI1_19838"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197107.1"
                     /db_xref="GI:384359252"
                     /db_xref="GeneID:12213107"
                     /translation="MKNIKNKANILLQFSLFILFAGGVFLFTQSQVKPVAVYQYSRNI
                     PENTVIQKGDYIKTFKPKDILTKSMITNEKDINGKILTTNVYRSEYAIKNNLEDPAKL
                     DEFAKIDLSNLRKVSIPVEMKDAVGGNLKKGDRVDLTFVKQGDSKNNDTSDSFTYAKT
                     FMQDVLVYNVVDDGGKKYVDQTEGTQSLANEKGEVVESGSLSIVTVAVTAQQAEEIYA
                     RHKDGDIGIIGRFKESQDTGTSGYTIGEYKNIKTQESSPEN"
     misc_feature    complement(<223484..224080)
                     /locus_tag="CDBI1_19838"
                     /note="Domains similar to fish antifreeze type III
                     protein; Region: SAF; cl00555"
                     /db_xref="CDD:260496"
     gene            complement(224149..226065)
                     /locus_tag="CDBI1_19843"
                     /db_xref="GeneID:12213108"
     CDS             complement(224149..226065)
                     /locus_tag="CDBI1_19843"
                     /note="COG0455 ATPases involved in chromosome
                     partitioning"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197108.1"
                     /db_xref="GI:384359253"
                     /db_xref="GeneID:12213108"
                     /translation="MVKICLAVASNDLEEYLIENTEYIQKEIGDDVEFVGEVVYREGV
                     MQAIVNNTPDILIIREGLPGKVDILRLVQELTLFFPFPKLRIIFIAKDRRIGDALLAS
                     LVQFRVYDIVIGNNIDAFSIIEKIITPNILNDVAQFLPKIRETEKNTKLFEAQDLELI
                     KKASEINQTVKKEIKPLKPIKNIEHHDKKVPRDYSEEKIILEREIENEIKEEDIVIED
                     ELINIEKEEEIIIEDEGLNIEDDLIEEEIIIEEEIENKEELNIEEDIVIEDEGLNIED
                     DLIEEELITIEENLIIDEDINKNEEELNIEKQIENKEELKIEKEIKDYLKEDISVKED
                     KKQEKKIKIIKKNKPLRNKLPLTKSSEEKFTYVKKVNQQIISFLGAKQGVGNSQISFN
                     VAVDLANKGLKVLYIDLNERSSINDIFYLGFDEVGIDTALEGIDKNDYILINKSIVTI
                     NNLLNEYELLYKSYLKFPKTLEFLFFSQKYVEEKHEIPINKIKDLNLYLIMQKGYDFI
                     IINATNDIHNELSELLLIYSAKIFFTIAQDASVIKNNLLQTKIMDEKGINFREKFYYL
                     LNKYDNSNFNKDQIYEWMSDSLDLEGFPIITIPNLNREFINSNFNGLPLILDNKKNKE
                     MKKSFLDIYNIIIK"
     misc_feature    complement(224155..224949)
                     /locus_tag="CDBI1_19843"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(<224839..224946)
                     /locus_tag="CDBI1_19843"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            226272..226745
                     /locus_tag="CDBI1_19848"
                     /db_xref="GeneID:12213109"
     CDS             226272..226745
                     /locus_tag="CDBI1_19848"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197109.1"
                     /db_xref="GI:384359254"
                     /db_xref="GeneID:12213109"
                     /translation="MKKVICLNTDNEMKLIILLTCIKVKGINSCTLEEGMNTVLKVNG
                     LLKDKNGRLIGSFNCNNNKYKKLLPNTKTGLALNNIWDFLNNLSFGTKEQMNLLKDYN
                     FNMLEDIIGKHFKDALFLLEKNNLIKDREFLFGSKLLINPLPKDILDKVDFIFNS"
     gene            complement(226785..228050)
                     /locus_tag="CDBI1_19853"
                     /db_xref="GeneID:12213110"
     CDS             complement(226785..228050)
                     /locus_tag="CDBI1_19853"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197110.1"
                     /db_xref="GI:384359255"
                     /db_xref="GeneID:12213110"
                     /translation="MKKDNIYDIKNTLSDIDLNVLYHIYTYRCLTIRQIYRTFYINEF
                     SFNQFIDIKINFFIIKDLLEEVFFNKNNSALFLTKIGVEIVREKFCLDVNTINKDKII
                     KGYNSSSDLKLLSRLIPHQIFLNQFVLDFNVALKYKQLDLKTEYFDEKYVSQYQNIRP
                     DGLLRLKDMDLDLFLELDMGTESNKQLSLKWKNYRMFLNSGEWDLVSNKVIVLFIVEN
                     VKNVENRKNVIKKTVIDEMLDLLGEKFELLVGTKEDLLKIVFNDIIPKLSKKEELFES
                     IIKSKHGYSILKGKNLKDKLGGDIYPYYIKKTDKGIEHEFLVDFYSGNELNVVRRMEL
                     LKRNSSIFNYYNKRDIKLIIVCKDIVSNIKKDVNLSSSDVLKNENIYYTTLKRLTEFD
                     LKTALCQIDAFSRIYHFSDDNLSIRCLEE"
     misc_feature    complement(227442..227990)
                     /locus_tag="CDBI1_19853"
                     /note="Replication-relaxation; Region: Replic_Relax;
                     pfam13814"
                     /db_xref="CDD:258094"
     gene            complement(228265..228537)
                     /locus_tag="CDBI1_19858"
                     /db_xref="GeneID:12213111"
     CDS             complement(228265..228537)
                     /locus_tag="CDBI1_19858"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197111.1"
                     /db_xref="GI:384359256"
                     /db_xref="GeneID:12213111"
                     /translation="MQEKNVIVVEEEKAPNSRVKIVLIKEAIRRCPTDKILNVNIICK
                     ELGEILEERYQTEDCLEYHAKRMGLFYTRDMVKQIKSYICKSYNGD"
     gene            228937..230139
                     /locus_tag="CDBI1_19863"
                     /db_xref="GeneID:12213112"
     CDS             228937..230139
                     /locus_tag="CDBI1_19863"
                     /note="COG1396 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcriptional regulator, XRE family protein"
                     /protein_id="YP_006197112.1"
                     /db_xref="GI:384359257"
                     /db_xref="GeneID:12213112"
                     /translation="MNLNDLLTLTEEYAKKIKNDDIIDDNLIENAIQQLHKIKKIDKD
                     VKDILLKKYINLRQENESLKEKKELLKKINEAMQRGKDGQFIQLEEIEELSEFLKESS
                     IDADSKNILNSKILKLRRKYAPIKATRWDLFVEDMAKLEDIEEINNLINKINTTLSNK
                     NISEDTFNRIDSLYKEAFPIINEKLDEVDRRRAISLFNNKIKVLYNRLNRITDTAFGD
                     WIKKLRTEKQLTYKELGSLSEVSSSYIYRIESGEKKTPSMAVACALSDALGQDRSELY
                     KILNVYNPENIKYDFPTGNIDELEDILKNRDFLIHGKRATKKQKDSLIKLIKQNHLSE
                     NTDELEDLLRNSDFLIYGEHATKKQKDSLIKLIEQIIEAKWENETKLDELFKIKEYID
                     TFINDLSN"
     misc_feature    229582..>229797
                     /locus_tag="CDBI1_19863"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    229585..229761
                     /locus_tag="CDBI1_19863"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(229597..229599,229609..229611,229684..229686)
                     /locus_tag="CDBI1_19863"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(229606..229608,229681..229683)
                     /locus_tag="CDBI1_19863"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(229627..229632,229663..229665,229672..229674,
                     229684..229689)
                     /locus_tag="CDBI1_19863"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(231005..231310)
                     /locus_tag="CDBI1_19868"
                     /db_xref="GeneID:12213113"
     CDS             complement(231005..231310)
                     /locus_tag="CDBI1_19868"
                     /note="'COG0145 N-methylhydantoinase A/acetone
                     carboxylase, beta subunit'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197113.1"
                     /db_xref="GI:384359258"
                     /db_xref="GeneID:12213113"
                     /translation="MKKLKGCIIIGVFIAILAIIINNLDILKDTDCISTKSAFDLVEE
                     KVPKEAIYQGYKKNQVKGETVLYYSYKDASHIVTLSHPENRITREIDWDEVYNMKFD"
     gene            231576..232253
                     /locus_tag="CDBI1_19873"
                     /db_xref="GeneID:12213114"
     CDS             231576..232253
                     /locus_tag="CDBI1_19873"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197114.1"
                     /db_xref="GI:384359259"
                     /db_xref="GeneID:12213114"
                     /translation="MREKNKEKYLFLKMKNGKVIKYKSPFESTKKDDNTNETFLYNRS
                     ATSRNTLKIIFILFTFFSFSLLLKIVPDSLSKFDYLPKYITMEKKEPLINKKKSNKDI
                     YLIEKAINLENILLKKNYDSLKHNALLYYSGNFSFLDMQNYLSEKKQVVEDNLSSFHK
                     KDTLFEQNKDIYLLLEKRHLNFKKLILNLISDLERSSIIETINTNISEDNFLLEKEMK
                     LFDKLNS"
     gene            232487..233656
                     /locus_tag="CDBI1_19878"
                     /db_xref="GeneID:12213115"
     CDS             232487..233656
                     /locus_tag="CDBI1_19878"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197115.1"
                     /db_xref="GI:384359260"
                     /db_xref="GeneID:12213115"
                     /translation="MNEKIANKIIVVDPGKNAVKVVVFSNTYELLTHYMFPSKTQIKR
                     TFSDIDGSSDFQFRAEFEGSKYLIGEGVQSSYNFETTKNNIHHQLCVYTAIAKEVHSK
                     NENVHVVVGYPSSDFSNEIQREKYVDLIKSNEKIDIILNGSDKSFNISEFNVFPEGMA
                     LVPRMKFPKRKVRVIDIGGQNLNHRLYDEKGNTLESFSLDEAGINHLEEYLRTTLRKN
                     INADMVDIDSINILEAIEKQKIDAISDDMINGYDSVASFIENTVLDFIDNKILNQLSS
                     KNVFLYKRSHLIIFTGGGSITLKKYLEELLPNNIGNLYFSETATWDNCASYLIKDLTL
                     KFKDSKISKIELANYTKKIVKAFNDLIIGITPSTEENLTEDEELINRKRKTVKQK"
     misc_feature    232511..233473
                     /locus_tag="CDBI1_19878"
                     /note="Plasmid segregation protein ParM and similar
                     proteins; Region: ParM_like; cd10227"
                     /db_xref="CDD:212669"
     misc_feature    order(232523..232525,233012..233014)
                     /locus_tag="CDBI1_19878"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212669"
     misc_feature    order(232529..232540,232544..232546,233015..233023,
                     233360..233365,233375..233377)
                     /locus_tag="CDBI1_19878"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212669"
     misc_feature    order(232607..232609,232613..232615,232685..232687,
                     232694..232702,232751..232753,232949..232951,
                     232997..232999,233048..233050)
                     /locus_tag="CDBI1_19878"
                     /note="putative protofilament interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212669"
     gene            233666..234223
                     /locus_tag="CDBI1_19883"
                     /db_xref="GeneID:12213116"
     CDS             233666..234223
                     /locus_tag="CDBI1_19883"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197116.1"
                     /db_xref="GI:384359261"
                     /db_xref="GeneID:12213116"
                     /translation="MQMKNKKIRNSCSFTFISNKTELNRILDELEGNEELNKSQELGK
                     MIIRGNKISNSLSLTTVMNAYELGESLLKIRFPNISDSKIQLYLEESLRKSISVDLKN
                     LTEEINSIIYNEDSHLEEVLIKEEIQDNEVEETKQEEKEEVHKEVKVNKKQESIQVKE
                     VYEEIQDNEESQDNFDIDINILCND"
     gene            complement(234274..234474)
                     /locus_tag="CDBI1_19888"
                     /db_xref="GeneID:12213117"
     CDS             complement(234274..234474)
                     /locus_tag="CDBI1_19888"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197117.1"
                     /db_xref="GI:384359262"
                     /db_xref="GeneID:12213117"
                     /translation="MLFNIITESGCMYRNVKVISSRGFARDKKDVKGALKYEKGITLY
                     SPVYMNKYIENKNVYSIEEVEE"
     gene            complement(234581..236905)
                     /gene="dnaE"
                     /locus_tag="CDBI1_19893"
                     /db_xref="GeneID:12213118"
     CDS             complement(234581..236905)
                     /gene="dnaE"
                     /locus_tag="CDBI1_19893"
                     /EC_number="2.7.7.7"
                     /note="'COG0587 DNA polymerase III, alpha subunit'"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III DnaE"
                     /protein_id="YP_006197118.1"
                     /db_xref="GI:384359263"
                     /db_xref="GeneID:12213118"
                     /translation="MGAKGAINDTARIWNKDTRFSSEISKLIPSRPNITIDEALKEST
                     GLKQLYDGNLEVRDIIDKAKKIEGLLKSSGVHACGIIIGREAITNFCPQSLVTNRETG
                     KKEWVTQYTMEECESIGLLKMDFLALKTMTILNESIEDINESYGQKLAVNNLPVNDVE
                     VYEHIFKGNTRGVFQIESPGMTGFMKNLFQDVPDFLNSISNSSLTKEQIEKKKEEFGD
                     ILFERLIAGISLYRPGPMEEIPNYINNMINPEQIHYDTPELESILKNTYGIIIYQEQV
                     INIVIKLAGFSKGQGDWIRKAMGKKKDEILKEYEPYFIYGSGDAKDKVTKKPLNIVGC
                     INNEISEDVAKSTWNKMKDFSKYAFNKSHGGGYSLLSYQTAWISHYYPVIFMKSNLNV
                     YITNTNKCKAFLAYCSRKNITVLPPSINKSNKKFSVENNCIRFGFQGIKNLGCSSELI
                     IKERESERGLFKNFQDFIERMVKYQKTDKRVIENLIFAGALDCFKDSTRKEKLEIIPS
                     ILESSKLDKKKNINGQISLFDIEDFSGIKEIVIPKLGEFNKDYLLEKEKEVANIYISA
                     HPLDNFMDLLEKEDIVEIVDLISEDDEYNKKDNENYLTDFVGNTIYVAGIVKDVQIKY
                     SKRNKPFYIFNLEDKTGEIKCVCFNKLKNEDNIVEKKKLIIKAELTYNDFGYQLNVLS
                     SENLELKIKKNNSILITGSQNRDEAVKQWKYLKEFVNKNKGNSKVYFEFEEVEYSLKN
                     KLNLSWENLYNLQTVFGENNCKLNISMKNKVHVN"
     misc_feature    complement(235958..>236731)
                     /gene="dnaE"
                     /locus_tag="CDBI1_19893"
                     /note="Bacterial DNA polymerase III alpha subunit; Region:
                     DNA_pol3_alpha; cl19160"
                     /db_xref="CDD:267513"
     misc_feature    complement(235403..235675)
                     /gene="dnaE"
                     /locus_tag="CDBI1_19893"
                     /note="Helix-hairpin-helix motif; Region: HHH_6;
                     pfam14579"
                     /db_xref="CDD:258717"
     misc_feature    complement(234845..235069)
                     /gene="dnaE"
                     /locus_tag="CDBI1_19893"
                     /note="DnaE_OBF: A subfamily of OB folds corresponding to
                     the C-terminal OB-fold nucleic acid binding domain of
                     Thermus aquaticus and Escherichia coli type C replicative
                     DNA polymerase III alpha subunit (DnaE). The DNA
                     polymerase holoenzyme of E. coli contains...; Region:
                     DnaE_OBF; cd04485"
                     /db_xref="CDD:239931"
     misc_feature    complement(order(234869..234877,234896..234904,
                     234923..234925,234962..234964,234968..234976,
                     234992..234994,234998..235009,235049..235057))
                     /gene="dnaE"
                     /locus_tag="CDBI1_19893"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239931"
     misc_feature    complement(order(234854..234856,234908..234910,
                     234914..234916,234920..234922))
                     /gene="dnaE"
                     /locus_tag="CDBI1_19893"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239931"
     gene            complement(237799..239247)
                     /locus_tag="CDBI1_19898"
                     /db_xref="GeneID:12213119"
     CDS             complement(237799..239247)
                     /locus_tag="CDBI1_19898"
                     /note="'COG0587 DNA polymerase III, alpha subunit'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197119.1"
                     /db_xref="GI:384359264"
                     /db_xref="GeneID:12213119"
                     /translation="MYVNLSKKQCEKIQSELKEGKNNSSSNYLSLIENDGKIEVSLLN
                     GKEVLFVLKKEKFVKDTFIKNNIFDYRNNFIGEFVDEKLKVITCIRLHGHTEYSLLDS
                     IVRIGDLAKETEYSCSITDHGVMYGAINFYKQMVSKNKKPIIGFEAYSESIDGSMNKN
                     HLVLLAKDEVGYKNISKLCSMAYNNFYKSPQIKYSWLEKYNKGVIVLSGCIAGEIPRA
                     IADGNNKLAKQIALKLKGIFKDDFYIEIQRHNIKDEDKINKQLMLLAKKLDIKVVATD
                     DAHYLKKEDSLVHETHLCNQTKTTMDNPKRFKFSGDGYYVHTCGDMEEKYKDIPEVLF
                     NTLEIMDKCDLHFDFGHNILPVFPREDEKNLNNEEYFKKLCEEGFKERFYGSSKYESV
                     EYKERLEFEVKTICKMGYPDYFLIVWDFINFAKKNNIPIGPGRGSCVGSLVAYVLKIT
                     EMDPIRYDLLFERFLNPDRISMPDIDVGVTRW"
     misc_feature    complement(<239083..>239247)
                     /locus_tag="CDBI1_19898"
                     /note="Mitochondrial ATP synthase B chain precursor
                     (ATP-synt_B); Region: Mt_ATP-synt_B; pfam05405"
                     /db_xref="CDD:253182"
     misc_feature    complement(238183..238977)
                     /locus_tag="CDBI1_19898"
                     /note="Polymerase and Histidinol Phosphatase domain;
                     Region: PHP; cl17102"
                     /db_xref="CDD:266516"
     misc_feature    complement(238471..238977)
                     /locus_tag="CDBI1_19898"
                     /note="PHP domain; Region: PHP; pfam02811"
                     /db_xref="CDD:251545"
     misc_feature    complement(order(238411..238413,238417..238419,
                     238807..238809,238882..238884,238966..238968,
                     238972..238974))
                     /locus_tag="CDBI1_19898"
                     /note="active site"
                     /db_xref="CDD:213985"
     misc_feature    complement(<237817..238143)
                     /locus_tag="CDBI1_19898"
                     /note="Bacterial DNA polymerase III alpha subunit; Region:
                     DNA_pol3_alpha; cl19160"
                     /db_xref="CDD:267513"
     gene            complement(239376..241325)
                     /locus_tag="CDBI1_19903"
                     /db_xref="GeneID:12213120"
     CDS             complement(239376..241325)
                     /locus_tag="CDBI1_19903"
                     /note="COG4548 Nitric oxide reductase activation protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197120.1"
                     /db_xref="GI:384359265"
                     /db_xref="GeneID:12213120"
                     /translation="MNSLEVMGRKDIIKFCDSYSINKKLKFFANLIDEKMQQFSLFLK
                     VGGSTYTDFKDVFIGIPEYMEGETKEVLFSICKALIGHEVSHKNYTPKEKYGGFIEEF
                     SLHFKDKYKLGKNKTKEVGAFIINSIEDGRIERLLSLNYPGIISDLILMRGFWWREQP
                     IKDNNNELFDTLFCITTIATMGILPEDYTKHYNYTNENIINNIKLYCSKAVNCNSFSD
                     CLKYAWELVYSIEDWLVAELLKLPEQEDLIDLNKGFSKIGENIDGSMNKYEECEEENI
                     ENNIHGAFKSDDKKQELGESTDKLESSTNDENRANDFDLKELVDKIIEESKDFLYKES
                     NSAIIQAEKEDILKKEKDKKDELDAKDSLSQEKMKDIENYYNELFKDKHFRFKDNLNV
                     INYNYEKVSVTGDILTESKKLKKELSKIIIDQVKINPKNKKRGLLDTNAIWKIQNKQY
                     DIFKKRYYDNKKNHAFYVLVDGSGSMTGEKFKEAYKATAILEDALSEFVALKIAQFNV
                     TYNINHHIIKNFNEKKGNKSLAFLKNNKAEGCNMDGYSIRVALEELKERNEDKKILII
                     LSDGLPYVNGLYGDKLALDDVKCAIRDGRRDGILIFNIMFGSKKERESLANKFLYMYE
                     KSIVSCEPYKIPTELLRIAKRELLK"
     misc_feature    complement(239511..239933)
                     /locus_tag="CDBI1_19903"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:260163"
     misc_feature    complement(order(239619..239621,239703..239705,
                     239913..239915))
                     /locus_tag="CDBI1_19903"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(241383..243026)
                     /locus_tag="CDBI1_19908"
                     /db_xref="GeneID:12213121"
     CDS             complement(241383..243026)
                     /locus_tag="CDBI1_19908"
                     /note="COG0714 MoxR-like ATPases"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase associated with various cellular
                     activities"
                     /protein_id="YP_006197121.1"
                     /db_xref="GI:384359266"
                     /db_xref="GeneID:12213121"
                     /translation="MEKVSVVHSYKDLDYIEIGTKITFKKDPKNKMDEDAIIAFFKEE
                     KIGFISAQPKTMGEGTVSNHAIVNKMKDEFYGIVVGYDEIKTNKTKTILIVEIQSDSE
                     NDDKKNEFRRNLILKVKGSIKEYKKKMEAINQFKNGEKIFLKVGLENEKIILFKNGEK
                     AGVIEEKDFPKCSSVNEIKALKTILKSNIDIGLAEIYKTEKTDFYVVLDFDLEKYKSV
                     TNEALKEENIKIKEKLIKKGFNKTILDEIEDYLLNNNFKIALIQKIFSTYKKYGKNVS
                     HRIPKENPNYQDNSNNLKIGCSAIRNKCHILCSGEKGTGKNIFVETMAWIFQRPLYSI
                     SISKETDKFDLLGSKSVDTKVDENGISKSTIVFEPEVLLEAMEQGGIINVDEINFADP
                     GVTALLHSITDHRQSIEVPGYKQVRAEENFIVIGTMNVGYEGTSDLNEALSDRFVDIL
                     FESNNSIYSILKDSCPCVKQSDLLIADKVYSKLIDLIKSIYVDLDESCMSIRGFIHAV
                     KMSEDLESIKEALIVGVANKVRDTEYRENVKEVIEQICV"
     misc_feature    complement(241674..242114)
                     /locus_tag="CDBI1_19908"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(241677..242114)
                     /locus_tag="CDBI1_19908"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    complement(242076..242099)
                     /locus_tag="CDBI1_19908"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(241740..241742,241872..241874,
                     242073..242096))
                     /locus_tag="CDBI1_19908"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(241869..241886)
                     /locus_tag="CDBI1_19908"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(241692..241694)
                     /locus_tag="CDBI1_19908"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(243134..244507)
                     /locus_tag="CDBI1_19913"
                     /db_xref="GeneID:12213122"
     CDS             complement(243134..244507)
                     /locus_tag="CDBI1_19913"
                     /note="COG0358 DNA primase (bacterial type)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="YP_006197122.1"
                     /db_xref="GI:384359267"
                     /db_xref="GeneID:12213122"
                     /translation="MKRKDFIKEIIELVREVVGIDEIESRMDLKNGKGLCPFHNDKRI
                     GSFSVSKNKKIFKCFSCGTGGDIIKFVSLFENITYVESAFKIALEKRLISEEKYKQIL
                     SKKLSESENLKIEKTYIKQNLIEHQSKKADNETLNKIYSLFIKGFDYLGKNRLNEEDI
                     KHLKNKRGLTDKEIEDTGYFSFPNRYILKPFLTDLEKNNIKLSTLNNIPGFFYNKKNN
                     RYDFTTIKRGGIAIPIRNEFKQIIGIQIRKNVVNSHESRYIWFSSAFAQENEGYKFGT
                     SAGVSVDVIYPEELKVKTIFITEGHFKAKKIAKEYNSIAISIQGVCAWGNIIEVIKNI
                     QKLYSEVELPYIYVAFDADMGYNLAVYKQALKLGEALQKIENKKIFYVLWDSDFGKGI
                     DDLIDNGKKDMVDKISFDEMNTYYNKYIEILISLFGPDEKKYPKEAKKELYEQIILRQ
                     LKKYKNI"
     misc_feature    complement(243137..244486)
                     /locus_tag="CDBI1_19913"
                     /note="DNA primase, catalytic core; Region: dnaG;
                     TIGR01391"
                     /db_xref="CDD:233392"
     misc_feature    complement(244247..244486)
                     /locus_tag="CDBI1_19913"
                     /note="CHC2 zinc finger; Region: zf-CHC2; cl17510"
                     /db_xref="CDD:248064"
     misc_feature    complement(243320..243625)
                     /locus_tag="CDBI1_19913"
                     /note="Domain of unknown function (DUF3854); Region:
                     DUF3854; pfam12965"
                     /db_xref="CDD:257434"
     gene            complement(244658..245182)
                     /locus_tag="CDBI1_19918"
                     /db_xref="GeneID:12213123"
     CDS             complement(244658..245182)
                     /locus_tag="CDBI1_19918"
                     /note="COG0629 Single-stranded DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197123.1"
                     /db_xref="GI:384359268"
                     /db_xref="GeneID:12213123"
                     /translation="MSEKKYNFNFCGFEKVGETLVAYIEGWTCKYKDKENFVEFRKVS
                     TKNGDKLVANMELSTKIPQSVAKFYFGEDFDKEQHFIKVTAWDVVAERLQKFNPSENM
                     LLGVMGKLKVEESTKKDGTPFKKLVITISNFKSVVKKKNAEESNRHVEENFNKKNEVI
                     EANFEEIDDDDIPF"
     misc_feature    complement(order(244796..244804,244850..244858,
                     244877..244879,244925..244927,244931..244939,
                     244979..244984))
                     /locus_tag="CDBI1_19918"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239601"
     misc_feature    complement(244661..>244966)
                     /locus_tag="CDBI1_19918"
                     /note="Replication protein A, class 2b aminoacyl-tRNA
                     synthetases, and related proteins with
                     oligonucleotide/oligosaccharide (OB) fold; Region:
                     RPA_2b-aaRSs_OBF_like; cl09930"
                     /db_xref="CDD:263924"
     misc_feature    complement(order(244781..244783,244862..244864,
                     244868..244870,244874..244876))
                     /locus_tag="CDBI1_19918"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239601"
     gene            245388..246452
                     /locus_tag="CDBI1_19923"
                     /db_xref="GeneID:12213124"
     CDS             245388..246452
                     /locus_tag="CDBI1_19923"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197124.1"
                     /db_xref="GI:384359269"
                     /db_xref="GeneID:12213124"
                     /translation="MDNFKYLFEKNKQKILLTISLLFLFIICITIFLFIKKNNFNENM
                     TDVQYEDVGIKKAEYILTGTCNGKIDLIKTSNQKVVDSLQLNNLGNTMYSRDPNLKKL
                     MVYNNSNFYSIEEKKGKIIKNNVYKLKDNIQILNFNFSDNYIVFNSNGAYKSISLKEN
                     KENYINEREFDNYVVSKDNLIYSKDNLITSLNLKTNKVNKTINLGDKTKAISLTKNGL
                     TIFNNFGYDNNRSIILGVNPETLYINSVYKLDSNKVLPVTQYSRDLEVYFMDKVEKDS
                     ALIESHYAVKVDNKTTKTTLSNTNKDSDKTPNTYNTVSAKGYLYSNEDLKELKIFELR
                     SNTLVATINTDKIFFMPILK"
     gene            complement(246478..247335)
                     /gene="polC"
                     /locus_tag="CDBI1_19928"
                     /db_xref="GeneID:12213125"
     CDS             complement(246478..247335)
                     /gene="polC"
                     /locus_tag="CDBI1_19928"
                     /EC_number="2.7.7.7"
                     /note="'COG2176 DNA polymerase III, alpha subunit
                     (gram-positive type)'"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III PolC"
                     /protein_id="YP_006197125.1"
                     /db_xref="GI:384359270"
                     /db_xref="GeneID:12213125"
                     /translation="MSKKGKLEIEMLNYNEFVVVDIETTAFSIQKGGRILEIGAVKIK
                     NGEIVDNFSTLVNPELKIPKKITELTKITNDMVKDAPYIGNVLQKFNEFISDSVIVAH
                     NASFDWDRFLKPALATIGIKSSHKVMDTVSLSKFTFPDKKKHTLIDLCSYLEVPLEKN
                     HRAIDDAIATAKCFLKLKALNAEKLNDNIQVEFFNEINCDENIEVCKSIVIKRVKYWE
                     KSKMKRLYVNFSSGVNRGEAYFNILTKTWYIKKFDLQIDINLINKEVLKFLDLETVDD
                     LCKYRNNLK"
     misc_feature    complement(246811..247284)
                     /gene="polC"
                     /locus_tag="CDBI1_19928"
                     /note="DEDDh 3'-5' exonuclease domain family; Region:
                     DEDDh; cd06127"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(246838..246840,246853..246855,
                     247015..247023,247027..247032,247258..247260,
                     247264..247275))
                     /gene="polC"
                     /locus_tag="CDBI1_19928"
                     /note="active site"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(246838..246840,246853..246855,
                     247018..247023,247027..247032,247258..247260,
                     247264..247275))
                     /gene="polC"
                     /locus_tag="CDBI1_19928"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(246838..246840,246853..246855,
                     247015..247017,247267..247269,247273..247275))
                     /gene="polC"
                     /locus_tag="CDBI1_19928"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176648"
     gene            complement(247584..248225)
                     /locus_tag="CDBI1_19933"
                     /db_xref="GeneID:12213126"
     CDS             complement(247584..248225)
                     /locus_tag="CDBI1_19933"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197126.1"
                     /db_xref="GI:384359271"
                     /db_xref="GeneID:12213126"
                     /translation="MMKLLFNSIPKEHATIKGFLQEVKSKGFSLEAGNKNSNYTITVN
                     LEKVNEKYGKYISESLKRYLEFNNYEINSNIQVIDDNKKTVNLDEVIKRIKKIEAGMD
                     IDKKQSYEFADKWTSSLEYYYNILFGISHNYFIETEYFNSNILKQYKDIIESNKNTDM
                     SKKLSKVVNVLEKNNRKFDSNTKVQIENIINEIYTKDIKDAINKKYPEQISND"
     gene            complement(248206..248559)
                     /locus_tag="CDBI1_19938"
                     /db_xref="GeneID:12213127"
     CDS             complement(248206..248559)
                     /locus_tag="CDBI1_19938"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197127.1"
                     /db_xref="GI:384359272"
                     /db_xref="GeneID:12213127"
                     /translation="MNKRKIFKIMTSAFLISMLVSGCTNVKKLSSSEKTKVMNKIYNY
                     SSTEKEGLDGLDNLIKSNIDQFNIKERDEMVNIYISNMFNFMDNLNNKLYCLGFELED
                     VVEQYKINVNDEASF"
     gene            complement(248585..248830)
                     /locus_tag="CDBI1_19943"
                     /db_xref="GeneID:12213128"
     CDS             complement(248585..248830)
                     /locus_tag="CDBI1_19943"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197128.1"
                     /db_xref="GI:384359273"
                     /db_xref="GeneID:12213128"
                     /translation="MEKEKIDKQEVINKKLKKVIEEIIIQEEDYFADKFDGRDFKEIK
                     KHKNQVSQIVLTNELLVEYLRAFIVDGIDMYYYLKKK"
     gene            complement(248921..249748)
                     /locus_tag="CDBI1_19948"
                     /db_xref="GeneID:12213129"
     CDS             complement(248921..249748)
                     /locus_tag="CDBI1_19948"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197129.1"
                     /db_xref="GI:384359274"
                     /db_xref="GeneID:12213129"
                     /translation="MYIQGINIQKSNTTEQDLIQISNVINNVFNKLADKDFYYSYFYD
                     PYKYYEPVNSYFEEKYINKIISENKSPIKEVIDAIYSNENEYFKEAKIVAIGEDVKNK
                     FAEIEIISLGDSELFNIENMRIDFNDNFQIINSKKISNKKQVPYTTKALDKESLLSNT
                     NDIFLKEFNKFIGPLKNKKLFKEFNLKLNTEVNIKVDAMLSNLQYEDINKDILLKFFT
                     LGRGSFNNYKIVKYYFDDKDAMANSRYVIKIVNKNKTNSFEILFSRISNKIIKITEL"
     gene            complement(249972..250526)
                     /locus_tag="CDBI1_19953"
                     /db_xref="GeneID:12213130"
     CDS             complement(249972..250526)
                     /locus_tag="CDBI1_19953"
                     /note="COG4474 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197130.1"
                     /db_xref="GI:384359275"
                     /db_xref="GeneID:12213130"
                     /translation="MLYLKSKEKTCAFTGHRTDKLYGSDLSNTKYQMLAKLLRKQIIT
                     LIEVNNVDTFISGGATGFDTISFFTVESLKNKYSYINNILAIPFEEQSSTWNNYDKLR
                     YERMLGKANEVIYVDKLDLYNKSKNKKYTYAYKYQKRNEFMVDVSSYIIACFDGSKSG
                     TLNCLNYAKEKKNKIYLINPKSIQ"
     misc_feature    complement(249975..250502)
                     /locus_tag="CDBI1_19953"
                     /note="Protein of unknown function (DUF1273); Region:
                     DUF1273; cl01859"
                     /db_xref="CDD:242750"
     gene            250646..251659
                     /locus_tag="CDBI1_19958"
                     /db_xref="GeneID:12213131"
     CDS             250646..251659
                     /locus_tag="CDBI1_19958"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197131.1"
                     /db_xref="GI:384359276"
                     /db_xref="GeneID:12213131"
                     /translation="MLNILILLFILKYLNEIRKVHLIENKLDYIFLGFSIITFLETTF
                     VALTHLYSLVEFFLHYEFFKSFSISIYKIIQNDPNFIIPKLLSVFSFIIIQFVVFFVG
                     YLYLLYKERLRNISKRKKEYLKIFKQIFPFVFFAIIVTEFVYNPFIGYLSVNYIFLYL
                     VLLFTSFYFSLKEFKKEIKNNPNEKPNYYIIFFGLLIVCLLILSTCTFLFILLNPTFN
                     TVPEKSPTYTSLINSLYYLSLLAILISMYLISYLFVYNINLGISKFNKVRCIFYLILF
                     VLYILSRLANFSTDSSVFTIKVLEYELNFKSAITEYSTEAFLTVVIFDSFFQSLLEFK
                     KSK"
     gene            251717..252280
                     /locus_tag="CDBI1_19963"
                     /db_xref="GeneID:12213132"
     CDS             251717..252280
                     /locus_tag="CDBI1_19963"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_006197132.1"
                     /db_xref="GI:384359277"
                     /db_xref="GeneID:12213132"
                     /translation="MKKISEISKENIGELDIFLGIIFNILIVIGYILFNDFEFLINNI
                     NLKSLFYFIAIVVSTVIVHELIHILFFNFFSKGKAKIKIKYDKHIGSIVIYQSNKVIL
                     YNKIQTIIILLAPLLSIAIISFFCIFYFKTISEILKINLILNSMGSTGDFIISSKLFH
                     NYISKNILINYSYSSHKGTIMNIYTKK"
     misc_feature    251879..252193
                     /locus_tag="CDBI1_19963"
                     /note="Protein of unknown function (DUF3267); Region:
                     DUF3267; pfam11667"
                     /db_xref="CDD:256544"
     misc_feature    252501..254635
                     /note="potential frameshift: common BLAST hit:
                     gi|18310965|ref|NP_562899.1| DNA topoisomerase"
     gene            254803..255420
                     /locus_tag="CDBI1_19978"
                     /db_xref="GeneID:12213133"
     CDS             254803..255420
                     /locus_tag="CDBI1_19978"
                     /note="COG2206 HD-GYP domain"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver modulated metal
                     dependent phosphohydrolase"
                     /protein_id="YP_006197133.1"
                     /db_xref="GI:384359278"
                     /db_xref="GeneID:12213133"
                     /translation="MIAENQNISTVNEAILLLKEINYIKNYNIYNKISNLEIFSIHRE
                     TFYHLFRCQELAFYFSQMLMLSGDKKITLIEGCLLHDIGKLTLDPKLLYKKDKLSKDE
                     YLYIKKHTEFKSPILSLDINTLIRLHHKKLCLLRYNNLYEILKIILIIDAYDAMNNKR
                     SYKDKLSYEKIKIEIFNNLNIQFDEEYSTKFLLFLDLFNKEKTLL"
     misc_feature    254935..255330
                     /locus_tag="CDBI1_19978"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(254944..254946,255040..255045,255253..255255)
                     /locus_tag="CDBI1_19978"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    255043..255045
                     /locus_tag="CDBI1_19978"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            complement(255433..257361)
                     /locus_tag="CDBI1_19983"
                     /db_xref="GeneID:12213134"
     CDS             complement(255433..257361)
                     /locus_tag="CDBI1_19983"
                     /note="'COG0507 ATP-dependent exoDNAse (exonuclease V),
                     alpha subunit - helicase superfamily I member'"
                     /codon_start=1
                     /transl_table=11
                     /product="Helicase RecD/TraA"
                     /protein_id="YP_006197134.1"
                     /db_xref="GI:384359279"
                     /db_xref="GeneID:12213134"
                     /translation="MGVLKLIKNDYRILLTVPKITEKKAKLIYQQLIEFENFQELAFF
                     IQGMGIATRVAIKVYETYGELSLPKILNNPYSICTNGNIKFIYADKIANNLGLSADNQ
                     KRVVCAILEYLNYRTDNNGDMCIYRDMVFSNLNRFLNRFSSYSNNNISEDQIKFALEE
                     LEALKLVIIEKDEKGNTYIYKSFYNYVENNIVNNIKNLLNKPKSEFLQKKDINNFISY
                     YESTFFTLDLKRKEALNTVLNSKLSIITGGPGTGKTFLTNIIVNCLKYINPKVKIRLL
                     APTGKASNRMKELIKMESSTIHRGLKINPYKNTELEEITEDVVIIDEASMIDASLFDK
                     LISKINENTMVIIVGDVDQLPSVGAGLILKDLIDSNIIPVVKLNKIFRQSKDSSIILN
                     SHKVNSGLLTTSRDGIDILNKTGSDFIFWKESNIFKIKSNILRSIKCLMEKYNFKFED
                     IYILTPLKLNEIGVKEINRVLQQEFNPKSSNPEYVIDNYNCFRIGDRVMQNSNNYNLG
                     VFNGDIGFIRKIYTKVSQKGILEYEIEVEYKIHDKNVIYTEDLIDELELSYAMTIHKS
                     QGSEFPAVIMPIHHSQRTSLNRNLIYTGMTRAKEKLIMIGEEEALNYSIEQTKSLNRI
                     SRLREKLERLKLENKIAS"
     misc_feature    complement(256990..257271)
                     /locus_tag="CDBI1_19983"
                     /note="Helix-hairpin-helix containing domain; Region:
                     HHH_4; pfam14490"
                     /db_xref="CDD:258630"
     misc_feature    complement(<256588..>256908)
                     /locus_tag="CDBI1_19983"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(256291..256686)
                     /locus_tag="CDBI1_19983"
                     /note="AAA domain; Region: AAA_11; pfam13086"
                     /db_xref="CDD:257489"
     misc_feature    complement(<256309..256632)
                     /locus_tag="CDBI1_19983"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(256600..256623)
                     /locus_tag="CDBI1_19983"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(256396..256398,256597..256620))
                     /locus_tag="CDBI1_19983"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(256393..256410)
                     /locus_tag="CDBI1_19983"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(255547..255888)
                     /locus_tag="CDBI1_19983"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            complement(257433..257696)
                     /locus_tag="CDBI1_19988"
                     /db_xref="GeneID:12213135"
     CDS             complement(257433..257696)
                     /locus_tag="CDBI1_19988"
                     /note="'COG0507 ATP-dependent exoDNAse (exonuclease V),
                     alpha subunit - helicase superfamily I member'"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197135.1"
                     /db_xref="GI:384359280"
                     /db_xref="GeneID:12213135"
                     /translation="MEYYIKFVIKKINYRDNEKRYSICKAILKNKIDNNSTQEITVKG
                     FFPILYEGDEYEGKVTKKFDDIYGDFFYLEEIPKLLYLKVRRP"
     gene            257822..258721
                     /locus_tag="CDBI1_19993"
                     /db_xref="GeneID:12213136"
     CDS             257822..258721
                     /locus_tag="CDBI1_19993"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197136.1"
                     /db_xref="GI:384359281"
                     /db_xref="GeneID:12213136"
                     /translation="MDNLYKILIINSTFFIRNIVKTAISNKPKKNKCSFSVINEECVI
                     GKEVEEIEKNKIKIVIVDINTLDEIRLIKEISESFKTMNIIVLTSLSDQLIKDEILKY
                     TSYYIKKPLAEIELWNKLDLIVKSNLKRKETKETKETINISKKSTSSCKETKETIDLT
                     VSKNYLLDSIKFDIHNLVNEMKILQKYDIDETKLIDEIESISNKENQAVEKEKEQTNT
                     SSINLSFLNNFEGSAQKMELNNAHKYYNKKNTSKCIEITPPKEDKRKNIEIKHTLKRN
                     NYEKKEKKKNAFRELLKNLKKKS"
     misc_feature    <257954..258169
                     /locus_tag="CDBI1_19993"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(258005..258007,258023..258025,258083..258085,
                     258137..258139,258146..258151)
                     /locus_tag="CDBI1_19993"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    258005..258007
                     /locus_tag="CDBI1_19993"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    258017..258025
                     /locus_tag="CDBI1_19993"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    258146..258154
                     /locus_tag="CDBI1_19993"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            258743..259567
                     /locus_tag="CDBI1_19998"
                     /db_xref="GeneID:12213137"
     CDS             258743..259567
                     /locus_tag="CDBI1_19998"
                     /note="COG0539 Ribosomal protein S1"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="YP_006197137.1"
                     /db_xref="GI:384359282"
                     /db_xref="GeneID:12213137"
                     /translation="MKNINKESLERYKNYMEEKKVLSGTVRLVKFNEELNSDILIIIL
                     EDGGEVIIKREDIDIRQTKRSLTPYLFKKIEFIIIDIIESGENEVKILASRKEIKEKH
                     KDQLIKKLEEGEEFEAKVVHLEKYGAYLEINEIGVTIRNTEFSDDYTNVSDIYKVNDV
                     IKVKLFKVNSNKRIYVEAVEKYKSNAIIDMDSFTTGSVVIGSVRTIRTDDCFVCIAPN
                     LDVLSPIPTFSDYELVEGDKVSLLIKKVETKQDPNSEKLIYRIKGKIIRILTEDIK"
     misc_feature    259067..259261
                     /locus_tag="CDBI1_19998"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(259103..259105,259127..259129,259148..259150,
                     259154..259156)
                     /locus_tag="CDBI1_19998"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     gene            259660..260613
                     /locus_tag="CDBI1_20003"
                     /db_xref="GeneID:12213138"
     CDS             259660..260613
                     /locus_tag="CDBI1_20003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197138.1"
                     /db_xref="GI:384359283"
                     /db_xref="GeneID:12213138"
                     /translation="MYIKDSNIYKSIPEGYKQIFQNKFRNNISKHQVLNLVTDKKLSN
                     RDITIAEFLFNFKFATANNIYDFLKINNILTLKKYKEGEEEKETSFISIKSRLDKLVQ
                     YGILNKFTLSKIDELKNEADALNIYCLDLGGKFLLTNYSNQDTVNWQTSINLNSSENV
                     GKELFITNFYLKLLDVCNVVYFETHPLRKADKINLSPSFEFAIESNGVKNYFIGEVTR
                     QFDIPILFSKRIDKLDRLLSTNSWKKYYLDSQVVPTLFIFTETDELAVDASKLVFNTT
                     NLEKVRFGTDERIFNNLSTGFLKYMPEHKKLKIIKLKYFEK"
     gene            complement(260640..261029)
                     /locus_tag="CDBI1_20008"
                     /db_xref="GeneID:12213139"
     CDS             complement(260640..261029)
                     /locus_tag="CDBI1_20008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197139.1"
                     /db_xref="GI:384359284"
                     /db_xref="GeneID:12213139"
                     /translation="MKKIKNLQKKIIFKINSLIFLPILLLNIIRIDAFSVDEENIKIK
                     ASTDAGFLESLKKVQSTYSFYFNVFIGVCIFLSLAILLIHLIKLGMVGGNPQERKIVL
                     SNMFISLICFSMISGGAVIYYLLFFLF"
     gene            261969..263153
                     /locus_tag="CDBI1_20013"
                     /db_xref="GeneID:12213140"
     CDS             261969..263153
                     /locus_tag="CDBI1_20013"
                     /codon_start=1
                     /transl_table=11
                     /product="TraG/TraD"
                     /protein_id="YP_006197140.1"
                     /db_xref="GI:384359285"
                     /db_xref="GeneID:12213140"
                     /translation="MENLQNDNKNTNLIIGTNNNNDIFISQKNRYLNMIVLGKKGTGK
                     TSKVLPTLASQDLQNKNIGMTLIVTKKEMAYTLNALAKEFDREVVFLKVSTNIEILNH
                     FLFMEKYDYDYVNENIINYKEAIKKKKIVIIDMEVAKYKYNAINAVKMLLLQLTLDIQ
                     ETDITKRNPHFIYIDDSFYYLDSLEYLLNYSDDYNISLILFFQSRNQFLLNDKDYTAL
                     LDNNIRTTILLNALNVEDVEYYQKRIYEKKNPSDFWQQHLNFFLYESLNATGKRIVGS
                     GQFKFLDKEFIENLEKKSKRLRNKLIKNTKDEYKNKNMIKDFSYLEGEPTPVDPRLIF
                     EENITDNNNELDILIKSENSHKQNSLGEMEKEKKRKISSILFNKESENISYVNNNFDY
                     KF"
     gene            complement(263190..264080)
                     /locus_tag="CDBI1_20018"
                     /db_xref="GeneID:12213141"
     CDS             complement(263190..264080)
                     /locus_tag="CDBI1_20018"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197141.1"
                     /db_xref="GI:384359286"
                     /db_xref="GeneID:12213141"
                     /translation="MYESEYFLTFDLDILYCPNKELKLSCKKLNLQNLVFENYSGNID
                     NIDSNYKIKAKDVNAIVNKVFKNEIGTELAHEDMSWIKEFETTFVINNKLTSSEEKII
                     FNYFILKLMLLGFSQDMAKDIVVSYKLSIEKNCTSIDFLSFINALDMKLKNKKFWVNF
                     NMSYEKDLECEFINMMFTYKEKLENRFDFTVFKDNYLNVCKKSIVKKMYDFNSKSSYL
                     VKNPLSIEKQEKYLLYEYKSTIAGVIKYLVTNEYPKLAVESRFLDYIIEEMVSVVKLY
                     LKILKNDEVNRNINNLLNKR"
     gene            complement(264106..264423)
                     /locus_tag="CDBI1_20023"
                     /db_xref="GeneID:12213142"
     CDS             complement(264106..264423)
                     /locus_tag="CDBI1_20023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197142.1"
                     /db_xref="GI:384359287"
                     /db_xref="GeneID:12213142"
                     /translation="MKEKKLNYEAMVKELPTLEKIISDGGKALIKCEAELNSLRNSYE
                     KCKKEIENLGVNPQKVKEEIVTLKEDFSKKYNELEKLLPTEIINEINNVNDYNENKED
                     LIF"
     gene            264558..265418
                     /locus_tag="CDBI1_20028"
                     /db_xref="GeneID:12213143"
     CDS             264558..265418
                     /locus_tag="CDBI1_20028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197143.1"
                     /db_xref="GI:384359288"
                     /db_xref="GeneID:12213143"
                     /translation="MLNKKYKLKIILFSTAFVLFGLISSISVYNQINNNHNNNKGETQ
                     KKIDTDIQKELNKNNLSPEEKSKMNEREKLLKTYGENANKIINSVKLGEDNNREFPKE
                     DTNKLYNNLIKLAQNANYDKVLDRVDKELETYKFKEEYNWKIGNVYSDANIMLSTLTA
                     PIQGKGYMVKNLKDPNMLLIGTLMIPEESRRDVILEKTSLSPIFDGPVTILSSETLDT
                     KDSVYAEISTKIEHFKDIYKINFKIENFLLYAYIIDSGEENPLFYKIVNDECNETPYK
                     DINYWISLNN"
     gene            265556..267625
                     /locus_tag="CDBI1_20033"
                     /db_xref="GeneID:12213144"
     CDS             265556..267625
                     /locus_tag="CDBI1_20033"
                     /note="COG0433 Predicted ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="TraG/TraD"
                     /protein_id="YP_006197144.1"
                     /db_xref="GI:384359289"
                     /db_xref="GeneID:12213144"
                     /translation="MKKDDILEILKDKFSIIIAGLSFAEIFLLLIQLCFRKSSIILCL
                     FVSFSSIAYYLAFKDVKVFKLKNIVFSFFIFLGMLLIINHSLISFLNSTNVEFQKLIM
                     VFIYLLNFIYLCIIIGLSSQESFRETISQINNINFTSKLFKPEEEKIRPGDVILGKKI
                     ESINGEAGETLDTPVFIPLKDRFLHMLILGPTGCGKTSQTIIPMINQDLQNKEIGVTV
                     LEPKSDLAEKVYQMAKIHNREVIYFNPLLADCPYFNPLFGHESEVIENMATTFNMLNP
                     DSPQFFKDMSDGLIRKSVKLLKRLYGDDATLIDLNDLVWNSNGIGKKIVNEFSKLPVK
                     NPLQQKENEEIAIWFLTDYYSGMTGDRKGTKTYEHCSGVRTQISKLVSNEYLRKALNP
                     PRGHGTDIDFDKALEEGLVITMTTTQGSLRDLGKFLGYFIILQLQSSVFRRPGDEDSR
                     RENMLYIDEFQVYANQGFGEMLTQGRSYRVASHLATQARDQMSVGREGDSFLELVSAN
                     ARNKIIYPGISITDAKYYSEEFGEELRTTIGKSYSKDRYFSSFSDEKMTTKVDERYEP
                     RFSPSNLIYRDFGQITHCLVKNNTVQIPALAQIEYIPNDLNEKIKKMVKEYNEEQIKR
                     NKEYATEYSKSVACNHFPNKDILYVVKKDDIIEDKEESFELEENINDNRNSISIDIDV
                     EDEYDDI"
     misc_feature    <266060..267277
                     /locus_tag="CDBI1_20033"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     misc_feature    266108..267148
                     /locus_tag="CDBI1_20033"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     gene            complement(267994..269049)
                     /locus_tag="CDBI1_20038"
                     /db_xref="GeneID:12213145"
     CDS             complement(267994..269049)
                     /locus_tag="CDBI1_20038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197145.1"
                     /db_xref="GI:384359290"
                     /db_xref="GeneID:12213145"
                     /translation="MYNKYMFDELKANARISKSKLKEIISVFKKKIDVIKINDNGLSK
                     LEKELGLTKNNYTKIISSNKSLIKQYLLYHFLPFANDCFVRKNISYQDIAKLCNISIV
                     TARNNQKTLSYLGLAYFTPSSNYGRFDIVIADEYKNHYKKEKGGSGYITLTLNHLVHL
                     INLKNVNELKLELKKLLWIDACKAKGKKIRFSKDKLVDVLPLYIKKSDKFIFDILSSK
                     NTKFKMVGDSLETKNYESKSEFNKKFVFKVSEKIRNLFEQNNYSYSYNHSKLLLQNNP
                     SNEDLRKLEGEKALIINDLACLSLEFGVRKVYLGLDHMFKNTIYNEDININKIKNPAG
                     FLRNFIEKKLITFGSFY"
     gene            270693..272255
                     /locus_tag="CDBI1_20043"
                     /db_xref="GeneID:12213146"
     CDS             270693..272255
                     /locus_tag="CDBI1_20043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197146.1"
                     /db_xref="GI:384359291"
                     /db_xref="GeneID:12213146"
                     /translation="MNKENAREDFILIMHAIYEQEKFKFITQKYFEVHMIKSYESIDE
                     IATVFEDFLSTTISSKLDLLTTPAKAKKLRAWEISSTWRLKQNWVKMALDSLESNKAE
                     AKLLKKEYLTIKEEFLKNKGKIKSIDLESPEQLVEMRKKTLKEWATDSSYNISDFPYL
                     SEMSDAKINSAFTHDLLLCITEILKEQYKFNINNIVLTTPTNVVPGIFLPTLRPKRNK
                     NIEIIKNDDNSFESGTYGAKNHTGSQLNISYKFKIDEENSQIESFKMELYNLETEEKA
                     LPKLSLDKRDLEIIIYIERLFNLDTASFYLSDLLKHLGLKSRTKANYDNVKNRLLKLP
                     YYSIYSKSTDAFGQVKEMSFNFFSSVEISRNEGEGDIVKGRDIVKVKRSVSPDMERMS
                     TDIMYENELKKIKLQQSINLAYFLEGRRNYLIRSGEDLQNKKYRFTIDHLKYEVHLSG
                     KNSLKKNMNYLELGFNEIMENQFIIKDYIRGEDFFDVVFYENNEKQKCLLNTILGSLP
                     DYIINNIRVAQS"
     gene            complement(272280..272801)
                     /locus_tag="CDBI1_20048"
                     /db_xref="GeneID:12213147"
     CDS             complement(272280..272801)
                     /locus_tag="CDBI1_20048"
                     /note="COG1544 Ribosome-associated protein Y (PSrp-1)"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribosome-associated factor Y"
                     /protein_id="YP_006197147.1"
                     /db_xref="GI:384359292"
                     /db_xref="GeneID:12213147"
                     /translation="MDIKIIKKHNKEISKDIELAIHQKLNFLEVFLKENDYIKITVEQ
                     NKLSYKIELLLEYNKKIIKMNEVSGDFFSSLEKITNRLKRKLYKIYHMNLNVDSNNIP
                     FKKVIKTTNKQKKEDIKRKQIKLKPMSEEEAFLQMELLGYSYFLFYNQNFIMSLIHLN
                     KNGQYELIEGFLK"
     misc_feature    complement(272538..272786)
                     /locus_tag="CDBI1_20048"
                     /note="RaiA ('ribosome-associated inhibitor A', also known
                     as Protein Y (PY), YfiA, and SpotY,  is a stress-response
                     protein that binds the ribosomal subunit interface and
                     arrests translation by interfering with aminoacyl-tRNA
                     binding to the ribosomal...; Region: RaiA; cl00250"
                     /db_xref="CDD:260300"
     gene            complement(272935..273282)
                     /locus_tag="CDBI1_20053"
                     /db_xref="GeneID:12213148"
     CDS             complement(272935..273282)
                     /locus_tag="CDBI1_20053"
                     /note="COG4570 Holliday junction resolvase"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="YP_006197148.1"
                     /db_xref="GI:384359293"
                     /db_xref="GeneID:12213148"
                     /translation="MPAKGKYSKFREYEELVSWSSVKAISTSKYKNNKFNENLTTVIK
                     LYFPDKRNRDIHNYPKSICDGIEKSGIIKNDKLLKPVVIMDFIDKENPRVEIELYPAS
                     EYTFKYSLDKIKE"
     misc_feature    complement(272983..>273258)
                     /locus_tag="CDBI1_20053"
                     /note="Endodeoxyribonuclease RusA; Region: RusA;
                     pfam05866"
                     /db_xref="CDD:253429"
     gene            complement(273364..274035)
                     /locus_tag="CDBI1_20058"
                     /db_xref="GeneID:12213149"
     CDS             complement(273364..274035)
                     /locus_tag="CDBI1_20058"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197149.1"
                     /db_xref="GI:384359294"
                     /db_xref="GeneID:12213149"
                     /translation="MKLNIELILEKNEEFSYLSKLVDSKYLEVKKLNENIDLEELGCL
                     PHTEVKKLYDCIKHRVSSQKLNQIKKILIKKTKEFYPELNKIHNYPEINNITFLNEDI
                     KIKLDELLTKYENKIIIPNFAFLELQTPNKINTKIINFLYDSGMLEKIFNLKCLCGES
                     KLSISEKKFNKMKDIFSLGEDDFAYVDCDYCNGREIFDLETLNESVEIKYRFIRKSKN
                     NILQI"
     misc_feature    complement(273388..273570)
                     /locus_tag="CDBI1_20058"
                     /note="Ribosomally synthesized peptide in Bacteroidetes;
                     Region: Bacteroid_pep; cl15739"
                     /db_xref="CDD:265770"
     gene            274318..276912
                     /locus_tag="CDBI1_20063"
                     /db_xref="GeneID:12213150"
     CDS             274318..276912
                     /locus_tag="CDBI1_20063"
                     /note="COG0420 DNA repair exonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="Metallophosphoesterase"
                     /protein_id="YP_006197150.1"
                     /db_xref="GI:384359295"
                     /db_xref="GeneID:12213150"
                     /translation="MLRFLVLGDWHYSSKTPWSRIDDFKDTRQKKTKEIMEIANKYKI
                     DAFLEMGDFLNSDRLSEQELASLAKDFKFSQLNNKILQMKTGETTFREIEQDLKSSIP
                     VIGTIGNHELIGNEISSLEETSLNVLISCGAITIATKENPVIFKDKEGFSLAITGAPY
                     THNIDGEDKSAYIVNKKLGDFHIHLVHGYLMPKSYGKKFKHTVVSQIAHTKADLTING
                     HDHTGYDEIDINGKKFINPGSPFRLSAELKEINRMPKVILIEVDKNGINLKPIFLSCA
                     KKGSEVLSREKIAKKEKKLEKIEDVKSLMNKAELAKGIDIVDIVKNIAKNKNIDDSIR
                     DQAVNNIVENIKLMKVPFSSKGKYTITELEIINFACFKHAVFEFSEGLNVVSGVSGQG
                     KSAVLRAIREVYDCYIKNPRNHILSGEDFFKITLYLSNGFVISRIVENNEDKNGNKRK
                     GKNGYEIFDPNKGCIEYFNTKAITTVQEILGFNKVKLSEKSSVDVNFINQGDPWFFVG
                     KNMSSTDKAKLVGSLYGTQYGDVVVKEMTSNIKKINMKKNVIEKEVSELEERKESYNY
                     VFKLEENIYKVESILNEIKLKKELIEKLSKFSLELIEKERSISELEKKVLKLTENKEK
                     ITDMFELLTNKFFKIKILEEKSAELTKVLKLGTELRGKVEELKEIDKAPLLMSNLKDS
                     YEKIGLEEKKLYEYKKIESEKTNIYKKYKYLKKQYNVLLDIEKQINKIEDLKSINETI
                     KEKSKKLKDIYILEEEFKNIKNRIDKFNSIRYKLNDIEDIELKLSNLKEQKEKIKIIE
                     KQKEELNIIFNQGKEMKHNIEQKKEYLINKIEIYKKLLLEVETCPICHAKIDKIVVNS
                     IINNLINF"
     misc_feature    274324..275049
                     /locus_tag="CDBI1_20063"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     misc_feature    order(274342..274344,274348..274350,274471..274473,
                     274642..274647,274876..274878,274972..274974)
                     /locus_tag="CDBI1_20063"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    order(274342..274344,274348..274350,274471..274473,
                     274642..274644,274876..274878,274972..274974)
                     /locus_tag="CDBI1_20063"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     misc_feature    275395..>276870
                     /locus_tag="CDBI1_20063"
                     /note="ATPase involved in DNA repair [DNA replication,
                     recombination, and repair]; Region: SbcC; COG0419"
                     /db_xref="CDD:223496"
     misc_feature    275395..>275607
                     /locus_tag="CDBI1_20063"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    275476..275499
                     /locus_tag="CDBI1_20063"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(275485..275490,275494..275502)
                     /locus_tag="CDBI1_20063"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     gene            277330..277842
                     /locus_tag="CDBI1_20068"
                     /db_xref="GeneID:12213151"
     CDS             277330..277842
                     /locus_tag="CDBI1_20068"
                     /note="COG0744 Membrane carboxypeptidase
                     (penicillin-binding protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycosyltransferase Family 51 candidate
                     bifunctional family GT51 b-glycosyltransferase/PBP
                     transpeptidase (candidate murein polymerase)"
                     /protein_id="YP_006197151.1"
                     /db_xref="GI:384359296"
                     /db_xref="GeneID:12213151"
                     /translation="MSKKNKKIKIIIISIFIFLIISLIASIFIYLYLKNDISNYIERA
                     YSKTESMDRNSFNNRETTKIYDNNGKLLKEFKVREYDYQKYKDINPYVFKAFIAVEDK
                     RFYEHNGIDFKALIRAGVVILKGGSLQGGSTITQQLAKNIFLSMDRNIWRKLEEAVIA
                     QEIEKKFYKK"
     misc_feature    277531..>277839
                     /locus_tag="CDBI1_20068"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:250219"
     gene            277910..279934
                     /locus_tag="CDBI1_20073"
                     /db_xref="GeneID:12213152"
     CDS             277910..279934
                     /locus_tag="CDBI1_20073"
                     /note="COG0744 Membrane carboxypeptidase
                     (penicillin-binding protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="multimodular transpeptidase-transglycosylase"
                     /protein_id="YP_006197152.1"
                     /db_xref="GI:384359297"
                     /db_xref="GeneID:12213152"
                     /translation="MYYFGKNTKDLNVSQIALLAGIPNNPSLYDPMLNKENAIKRRNN
                     IIDKMYESKFITEKEQLNAKKEILELNVKKKYYDNNINDYAVEYAIQKSTEEIMKNNG
                     FQFRYMFDNEEQRKKYSNLYSSEYKKCREELLNGGYKINTCINFDLQNKLQSIINKEM
                     IKYKKINKSNSLYMKQSASTVIDNNTGEVIAIVGGRTQEGKSNTFNRASIGARQPGST
                     MKPLISYLPAFEKGYSPDDEFEDRPINKGPSNWYNGYKGRITLRYATEISTNTIPFRL
                     TKLNGVEKSLKYLAKMNFKYLTSTDRTPTIALGGLTRGATTTEMASAYSTIARNGEFI
                     EPTNVKEIKKISTGEIIYKNNKNKKRVYDSGASYLMTDVLKGSIEKEHGTSHKAKLNN
                     YKYQAGKTGTTNDNKDAWFCGYTPYYTMSVWIGDDIPSYQSSLESNSVKYIWNKFMSG
                     LHEGKEDVDFKKPDQVYSKNGKLKTLGPQEFAIKKERLDLEKNRKNNEAEVQKERLKE
                     LEYRIIFGLSEEEETIREIKAKNDIESLREYKLIDLKQVKEIDKILLKVKNSINNVKR
                     KSIYDELIEEYRFLNDNFNEIKEQLNREKREEEYLKEKKEREYQEKIKNQIKNNVQEN
                     VEKDTSIKNEDLNNELNNESDNESNNTEDSQENNNNKNDDTETNNNENKV"
     misc_feature    <277913..278059
                     /locus_tag="CDBI1_20073"
                     /note="Transglycosylase; Region: Transgly; cl19357"
                     /db_xref="CDD:267710"
     misc_feature    278447..279253
                     /locus_tag="CDBI1_20073"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl17760"
                     /db_xref="CDD:266819"
     gene            279955..280635
                     /locus_tag="CDBI1_20078"
                     /db_xref="GeneID:12213153"
     CDS             279955..280635
                     /locus_tag="CDBI1_20078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197153.1"
                     /db_xref="GI:384359298"
                     /db_xref="GeneID:12213153"
                     /translation="MKFFKNKIIIAIALLAIILGFVLGGKVSKELEISSDNLQGLINQ
                     DYKIEDLETKNNYIEFTVRGNLQINDIKDFSNELFNKSKHWKQNKLKVFFVSKEADTK
                     NLKKEFFVDGLTNKVIIDKKESVIKVGTFVSVPSIEKSRELSKFKETNIKYKDNNAEI
                     NVSIPEINSLEKIVSQSKTYSIMFRDINKNKDIDNIQLNIDNISNNYTFSTENENVIE
                     VIEKIKES"
     gene            complement(280820..281329)
                     /locus_tag="CDBI1_20083"
                     /db_xref="GeneID:12213154"
     CDS             complement(280820..281329)
                     /locus_tag="CDBI1_20083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197154.1"
                     /db_xref="GI:384359299"
                     /db_xref="GeneID:12213154"
                     /translation="MNLNTLKNNKGFTSLEVAIFSIILLICIAGIMDFQNMQKKFNSI
                     SSTSTYITRVVGHQGGIRTSAPSNYLDSYVTSQKLYQDVKYILGKAGIAEEKWKVYIN
                     GYELSPDLYMPIVERGTNITTQLKFSYDWNFLSQIIPVKKEQTKASVRNTISTFKLRE
                     STDIDTEIK"
     gene            281668..282162
                     /locus_tag="CDBI1_20088"
                     /db_xref="GeneID:12213155"
     CDS             281668..282162
                     /locus_tag="CDBI1_20088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197155.1"
                     /db_xref="GI:384359300"
                     /db_xref="GeneID:12213155"
                     /translation="MARPPELPIRGEEDYFQKLVKEINPYLQSLNIELNFKGYKNTVK
                     EYGEVDSKDYNKLWELSRDFNMWGEYFTNMQAVIEKLYLDAEVTEKEVFAIASETADV
                     KSVNRGDRFANREASVVETRKNKNSLKAFLKVIESKIDFSYKCHHHCKSTCNCLKLPN
                     SNFS"
     gene            282175..282624
                     /locus_tag="CDBI1_20093"
                     /db_xref="GeneID:12213156"
     CDS             282175..282624
                     /locus_tag="CDBI1_20093"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197156.1"
                     /db_xref="GI:384359301"
                     /db_xref="GeneID:12213156"
                     /translation="MKKSKKILRRQLEFIEISKKVGKLFKDRNISLSFEGYKTTLEEY
                     LSCNEYDLENLYHLIIDSNLWSHYFGDLIGLTDNIYSEKISKSFFLEMEHITKKEEIE
                     DLKIEINLFKVFLKRLKIQKKMFDRIHYHCSKMYMDANNNLNFRSFE"
     gene            complement(282715..283029)
                     /locus_tag="CDBI1_20098"
                     /db_xref="GeneID:12213157"
     CDS             complement(282715..283029)
                     /locus_tag="CDBI1_20098"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197157.1"
                     /db_xref="GI:384359302"
                     /db_xref="GeneID:12213157"
                     /translation="MLNYSIVAEISNNNRVVVLKSEMLQPEFNILLNYINFSFSTEKE
                     DCVESDFNSFNDIYNDFIKSDYTEHCNCIKSEEGIHHIKNLFDNIKLNMLKEDTIYFL
                     WE"
     gene            complement(283357..285099)
                     /locus_tag="CDBI1_20103"
                     /db_xref="GeneID:12213158"
     CDS             complement(283357..285099)
                     /locus_tag="CDBI1_20103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197158.1"
                     /db_xref="GI:384359303"
                     /db_xref="GeneID:12213158"
                     /translation="MHKKLISAISIGLILVQFIPTTSFAVNKADYKNNLIRKESINNN
                     LINPNKKDIIPVLFNSDTMREIDRILESLDKLSSDFSKSLLIDIFKMAVNLHTKLDDT
                     DIQKHKDYDQFDYIFFQIIYLAFVNTNGSERNEIFIDFMDEMYLSSAKRLNSNDKYSF
                     FLDKYGLYIGYQLSDYFKDERTNKILKGGASMFIDLQSFTPTEESGKIPEDELPSNID
                     PTKPDGDNNSNKDEPPIYIPDEIPDNEFNNGGNNNSDGTSDNYNPNLDNGLTPGNSSD
                     LTSDEYVKENNSCTKITTTYDLNGNIVNKKKTKAQNGFCNIFNSNVVTGEVWNRNHNG
                     DLALNVWQSLNENELNKESNLTLKFTLNKNAEDIYYYDSGINVNLNKTVTYNQVRDVL
                     NQIALKIKNGYLIEDRNKLLFIAEGKPLVIEDKKNSYSDTEIKRLLNTFNNLSLKIEE
                     KSKTNEPKFKDEKQNSTLDKIFINNKEVKLKHPAMLKNGIIQFPIEEIAEELKIKLKI
                     NKNLAILSDDNNVIEYYIGTKKIKINGAEKLTTTSSKLENNIVYAEMNATLREFGFSI
                     NFNVSTDKISILKK"
     misc_feature    complement(283369..283641)
                     /locus_tag="CDBI1_20103"
                     /note="Copper amine oxidase N-terminal domain; Region:
                     Cu_amine_oxidN1; pfam07833"
                     /db_xref="CDD:254459"
     gene            complement(285341..286546)
                     /locus_tag="CDBI1_20108"
                     /db_xref="GeneID:12213159"
     CDS             complement(285341..286546)
                     /locus_tag="CDBI1_20108"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197159.1"
                     /db_xref="GI:384359304"
                     /db_xref="GeneID:12213159"
                     /translation="MRIKNFFNIFRKKSSKEKHIKVIESLDIIQRIISVKFLDEYILI
                     NIILNLDDEIILIHKICNSICRTNYKFLVDNSYICFKCHSIYLTNKLNKNLLLYFDYK
                     YELLEAVTDYNKPVMLMHKSCKKVSYVKPSDVTRDYYCKFCKPINTLPRFKEKVLELT
                     GNEYEVTGRFISASENILMKHTKCNKEFLVTPHEFITGKRCQHCLIKKKTERLQKRIF
                     ENFSDEYILTSNYNGFYGEVEILHSKCGFKFKTAPYFLEFKEKCKVCSQEDYLKQLNK
                     NNNLSQEDIFKKDIYDFSNKELIVLDMEEKQFSVFEKSSKEVFILEKEAFLNLEDKNN
                     IKYTFINYLLLKNNLNRYVLVSDYVNLLTYTKFLCKECDNLFLAKPIDIINRNKKCPI
                     CNEKIHVNA"
     gene            286726..287046
                     /locus_tag="CDBI1_20113"
                     /db_xref="GeneID:12213160"
     CDS             286726..287046
                     /locus_tag="CDBI1_20113"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197160.1"
                     /db_xref="GI:384359305"
                     /db_xref="GeneID:12213160"
                     /translation="MRKFIPSIIIVLSILFLEININNTSAYSINQISIILNIFMLPIL
                     FFIQGLMIQKENLNESFLIFPFVTYISLLIISLECKNLIFLLIYFSFMKLGCFLGVWI
                     YNNK"
     gene            287150..288655
                     /locus_tag="CDBI1_20118"
                     /db_xref="GeneID:12213161"
     CDS             287150..288655
                     /locus_tag="CDBI1_20118"
                     /note="COG2268 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197161.1"
                     /db_xref="GI:384359306"
                     /db_xref="GeneID:12213161"
                     /translation="MIDIMVIVFTLVICIFLGIILIGPRIIGSGEIGIVEKKFSKNFL
                     KEGELIALNGEAGFQADILRTGLHFKNRLFYKVHKKPLVTIKQGQIGYVFARSGESLK
                     NGQILGRAVSCNDFQDTKTFLKNGGQKGPQRVVLREGTYAFNLAEFIILTKNETYFLN
                     IGDKKEIEDIKKMKDELIKKNGFDPIVIDDKEDNLGIVVTKEGKALKQGDLIAPIVGD
                     DENNPDLYHNSFQDIEAFLKAGGYKGRQYEVLTEGVYVINRLFASIEIVPKQEIEISS
                     VGVVCSYIGQKGEDVSGKSYTHGELVEDGCRGILKNPLMPGKYAFNIYSGSIEKIPTD
                     NFALKWRGDECGQYEYDRHLKELSVITKDGFKPLLPLSVVVHIDYKKAPLVIQRFGSV
                     QKLVDQTLDPIISAYFKQVAETKTFLELLQNKTEISQESYKIMKEEFQKFNLELEEVL
                     IDTPKANGDERILALIEQLADRQLAKEQVETYEAKKQHLQRKENIENYNLK"
     misc_feature    287150..>288637
                     /locus_tag="CDBI1_20118"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2268"
                     /db_xref="CDD:225177"
     misc_feature    288053..288610
                     /locus_tag="CDBI1_20118"
                     /note="SPFH domain / Band 7 family; Region: Band_7;
                     pfam01145"
                     /db_xref="CDD:250396"
     gene            288730..289200
                     /locus_tag="CDBI1_20123"
                     /db_xref="GeneID:12213162"
     CDS             288730..289200
                     /locus_tag="CDBI1_20123"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197162.1"
                     /db_xref="GI:384359307"
                     /db_xref="GeneID:12213162"
                     /translation="MAKIKAEQNKIEADSKLYIKEKEVEAEIYRISEKAKAEAESIKA
                     LAEAEAQKEEKVGKAIASANREKAKAYGSAELLITKEIAIAVAEAIKEGNVDIVPKNV
                     ISNGNMDSCNSLGNLVQLVTLNKLESNEYLKKEKIGNPIDLKEEIINVTEESLQ"
     misc_feature    <288784..288945
                     /locus_tag="CDBI1_20123"
                     /note="core domain of the SPFH (stomatin, prohibitin,
                     flotillin, and HflK/C) superfamily; Region: SPFH_like;
                     cl19107"
                     /db_xref="CDD:267460"
     gene            289219..289641
                     /locus_tag="CDBI1_20128"
                     /db_xref="GeneID:12213163"
     CDS             289219..289641
                     /locus_tag="CDBI1_20128"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197163.1"
                     /db_xref="GI:384359308"
                     /db_xref="GeneID:12213163"
                     /translation="MILSRYKKIVNFKFHKSDKIKNELMNNIKKAVDINKSILICNKN
                     QIEFEYEGYIYTINKFLQEHHKDEYYKKNSDFYESLFNEIMCFDDKDIGVRIIKKEKI
                     ALSLFSKLYRDESVKFLEVYSKEFIKNKKRLLMKKSNI"
     gene            290174..290608
                     /locus_tag="CDBI1_20133"
                     /db_xref="GeneID:12213164"
     CDS             290174..290608
                     /locus_tag="CDBI1_20133"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197164.1"
                     /db_xref="GI:384359309"
                     /db_xref="GeneID:12213164"
                     /translation="MNDFEKVSRFSSYLKHVDHQTYEICLVAVKQNGFTLQDIKWNDI
                     NLSKEQIYMLYLEGVRQSGLVLKFIDFKNLTKKQVYELCLEAVKQNSHSIFYIEWEQF
                     NFSDEEKLNLCFEAVKQDKEVLKNFNWEKVGCDINADSKRII"
     gene            290762..291376
                     /locus_tag="CDBI1_20138"
                     /db_xref="GeneID:12213165"
     CDS             290762..291376
                     /locus_tag="CDBI1_20138"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197165.1"
                     /db_xref="GI:384359310"
                     /db_xref="GeneID:12213165"
                     /translation="MLNKIKFIITVFLLFISCSSEVNAYRDKEISDLEIEHIRSEAFD
                     YSSFIELDGVDYNTQFKVYKYLDVIPENIIEKFIENKMKIEITNKSLQERFLSNYILS
                     GVYFDKTIHLSSNKDWAEQSLLHEFGHFVDEISYMDKNEFIKIYEREKDNLILNKDKD
                     KSYYLRNVSEYFAQSFEEYLINPERLLLNNPKTYEYIKLCIDQI"
     gene            291513..291755
                     /locus_tag="CDBI1_20143"
                     /db_xref="GeneID:12213166"
     CDS             291513..291755
                     /locus_tag="CDBI1_20143"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197166.1"
                     /db_xref="GI:384359311"
                     /db_xref="GeneID:12213166"
                     /translation="MSKNNAWVIRLLASSEDQTEEMCLDAVSIYGKALQFVDKQTYLV
                     CLKAIEQDKDAIDCIKWEEVDFTEEEIKKLNILSGK"
     misc_feature    291570..291698
                     /locus_tag="CDBI1_20143"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            291777..293438
                     /locus_tag="CDBI1_20148"
                     /db_xref="GeneID:12213167"
     CDS             291777..293438
                     /locus_tag="CDBI1_20148"
                     /note="COG1357 Uncharacterized low-complexity proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197167.1"
                     /db_xref="GI:384359312"
                     /db_xref="GeneID:12213167"
                     /translation="MNSKKFENYLVRITEQKESLNIVDVNKLDLTKEQVFNLYLSAVK
                     NNGLELKYVDFKKYALSDIDIKQICIEAVKKHGYALEYIKFNELNLSAKEIEEICLEA
                     VRQNAFSLKAVDFNKLNLSDEQIYNIFTEAVKQNGYILEDIKKQDYNLCLIAVRQNGL
                     ALQYAKFDSFFITEKQKNKIYIEAIKQDISALLFIKNKTEEIYKETVKNDGLALIYIK
                     EQTEELCLLAVKQNGLALEYVKEQTEEICLEAVKQNGLALEYVKKQTEEICIEAVKQN
                     GLALEYVKEQTEEICIEAVKQNGLALEYVKEQTEEICIEAVKQNGLALKYVKEQTHNI
                     CLIAVRQDGKALKYVNKQTEDICKEAVKKNGMILQYVENQTEEICLIAVRQDGFAIRD
                     VKKQTPEICLEAVKQKGWYLMYVKEQTEEICLEATKNDKRAFQYVKEQTVEVCIEAIK
                     GDLVNLSFIKDDMLNELNKKENLKKLKLKNKIEKKIFKNSNGHEEINAFKLDHIWYLV
                     FECDEIIKVEDFYKMLVNDENIFKYYILSSRKDEYLNFLKYLENK"
     misc_feature    292374..292499
                     /locus_tag="CDBI1_20148"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    292440..292565
                     /locus_tag="CDBI1_20148"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    292506..292631
                     /locus_tag="CDBI1_20148"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    292572..292697
                     /locus_tag="CDBI1_20148"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    292704..292829
                     /locus_tag="CDBI1_20148"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    292776..292889
                     /locus_tag="CDBI1_20148"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    292836..292961
                     /locus_tag="CDBI1_20148"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    292971..293093
                     /locus_tag="CDBI1_20148"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     gene            293576..294094
                     /locus_tag="CDBI1_20153"
                     /db_xref="GeneID:12213168"
     CDS             293576..294094
                     /locus_tag="CDBI1_20153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197168.1"
                     /db_xref="GI:384359313"
                     /db_xref="GeneID:12213168"
                     /translation="MNKKNINLINELTKDIIDIYMIEIPIKDMNNVVDKMGGIIKKDN
                     SLSKFSDSYIRKLKNYHYEFEIVIPYGQSNHISNMHIAKALGHLFLHMRYNIDDDIWN
                     SQKINEFYKSKNLQEEEQVKEFALALLMPKSEFELIEENGVINIDKVSKYFNVNQRDA
                     SNRAYSLGYIKK"
     misc_feature    <293816..294040
                     /locus_tag="CDBI1_20153"
                     /note="Domain of unknown function (DUF955); Region:
                     DUF955; cl01076"
                     /db_xref="CDD:260778"
     gene            294210..294470
                     /locus_tag="CDBI1_20158"
                     /db_xref="GeneID:12213169"
     CDS             294210..294470
                     /locus_tag="CDBI1_20158"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197169.1"
                     /db_xref="GI:384359314"
                     /db_xref="GeneID:12213169"
                     /translation="MDNLDWSKIGAIGTIVIGIVTVVLTFIGVRQNKINRNKKSNKQI
                     IKGKDILNNEITQSSESKKNEDNKQIIKGKKISKNKIKQDNK"
     gene            294484..297693
                     /locus_tag="CDBI1_20163"
                     /db_xref="GeneID:12213170"
     CDS             294484..297693
                     /locus_tag="CDBI1_20163"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197170.1"
                     /db_xref="GI:384359315"
                     /db_xref="GeneID:12213170"
                     /translation="MGIKKILSRFLFKNNISEQKVNGVILSGNTIIQESNTYKNEKIV
                     DEYMKDKLDEIESLFDRQEYEEIEDKINWIYRKKQDRFSEAVERKLLQYNCFLALLTN
                     KQERLSEYFKELEAYGDKTAEFLNVKFNIATFSQSDSIFKELKSTWESLDMDSSKIDS
                     NEIKYLYFSKQYDVLIERFNNEKDLDAPEIKLYVAKSFIKIEKFDEAEKLLFEIKEKG
                     DTYKAEYILCKALSVFSIDRELGELTEGERVVFSDCIEEIKNINLEKLEFNQFREISY
                     YKLQMILFSDKSLALEEISNLSDKFEKDTEFYVLKINIFNLNGKYEEADKICKYLLEN
                     NGNINIYISSVINNCLCMENWSKVKELFIKYRDYLENIDFAFYAYGFSLLNLYGEEYT
                     INVIEKECKAEGNLIDFLRAKANSKNKEKSEFYLDKIVNNTKNKDLILLDVADEYMNM
                     DNTEKSLAIVKENSIYDIRFLKRYISITISKNMEAYFDDILDIYIRCYIDTCNEYVER
                     GIYSIYIKKKLYRGAYFIAKKAFNNTKKLYWLNELTRMKLINKELIDLKEFADILNNE
                     KDLQYLMTASETYLKLGEVTKARELSYKIAFNMNNMDIDSAIRIWQILLSNEIQNVSD
                     FEEHKDLIKQVELDDVIILKSGKEELKVCLNKEVFYRINDIRFGCLHINMNEGLWIEL
                     LGSKVNDEINFKQKEYKIIEIINKYDFLTRSCFNIRVKEKDDNIKMLSINEKDLIENT
                     DNDLIRELQKDIDNFNKRLDGYLGKDKSMGGFELPINYLLPQIENVNGNIDYLLKDKN
                     LFFKSGMSNIIEEGSKVVLTIVSTLLLSKVNLLDEFMSYYDVYVPRRLIESIEDTISE
                     LTINFSNKSVKIYSIEKKLVFFEKDQKEKKIELKNFNKIIESLKKGKIISKDIYIKHY
                     VSIPEQVMYSADMEAFEISKAEDTSIFIDDKFTCLLYSTIHSQRRSNMAGFINSILFN
                     DFNKYWKIAEQLIKSKYEYFFNYIDLETLVFNLDVGTRNNIKKFKHVFKIILKNDING
                     FYSLLLRFICTDITFIHKSYFKYKIKIDIIMDIISNLEK"
     gene            298148..298771
                     /locus_tag="CDBI1_20168"
                     /db_xref="GeneID:12213171"
     CDS             298148..298771
                     /locus_tag="CDBI1_20168"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006197171.1"
                     /db_xref="GI:384359316"
                     /db_xref="GeneID:12213171"
                     /translation="METGSYLKEIEEQSYEVCREAIINDSSSIKYVNWKDLKDKLSEW
                     EIEELCLEAVMDKGLNLRHIPFGLLKDKLSKEQVENITLKAIQEFEDSFQFAPIQTDR
                     ICLEAVRRDGNLIVYVKKKVTNICIEAVKQNGLALKHTGGQIKRTCIEAVRQNGLALE
                     FVHTQTEEICLEAVKQNGLALRYVKKQTKEICIEALKQNKYASEFIS"
     misc_feature    298454..298564
                     /locus_tag="CDBI1_20168"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
     misc_feature    298646..298768
                     /locus_tag="CDBI1_20168"
                     /note="Domain of unknown function (DUF4116); Region:
                     DUF4116; pfam13475"
                     /db_xref="CDD:257799"
CONTIG      join(FN668943.1:1..300869)
//
DBGET integrated database retrieval system